Sequence alignment for CL0003

PF13543

Q7PXM5_ANOGA/57-187LDVIQSMIDISADRLEGLRTQCATSAELTQQEIRTLETKLVKLFSDLLITKSKLPERLP...AQGLPAT....GNELKQW
B4JHV4_DROGR/35-171LIIIQDMIDLSANHLDDLRTQCATSATLTQQQIRGLESKLVRYFSELLLTKSRLNERIP...ANGLLPHHQATGNELRQW
B3S691_TRIAD/17-148LGDLQILIDTTVTQLIRTRAQCDVTFDFIQQQLRALEGKVIKYISQQLLEIANGIPPNSPSIADKFYQY.....PKLNQW
B4NB95_DROWI/21-157LDIIQDMIDLSANHLEGLRTQCATSSMLTQQEIRCLESKLVRFFSELLITKSRLNERIP...ANGLLPHHDATGNELRQW
B7P9M2_IXOSC/21-149CVTAQAMIDINSEHLDGLRTQCATSVELTQNEIRALETKLIKLFSRQVVAKKKYAGTEN...ANELQHY.....PKLVLW
C3ZV30_BRAFL/17-145CKTLQSMIDISASNLNGLRTMCETSHDLTQTEIRTLEGKLVKLFSKQLQAKNKVPEDQR...TSELQRY.....PSVKQW
B4QWW4_DROSI/33-166LVIIQDMIDLSANHLEGLRTQCAISSTLTQQEIRCLESKLVRYFSELLLAKMRLNERIP...ANGLVPHA..TGNELRQW
X1WHK8_DANRE/44-171CELIQRLIEISISSLKGLRTKCAASNDLTQHEIRALEEKLVKYISKQLDWKRSVAERDR...PLALDSY.....PNLTDW

PF02198

ELF3_HUMAN/48-132--------------QMSLEGTE-----------KASWLGE.....QPQFWSK----------------------TQVLDW
ELG_DROME/186-269--------------DSKFKREQ-----------IRLKIPE.....AANEWTH----------------------AHVTYW
ETS1_RAT/53-136--------------FSGFTKEQ-----------QRLGIPK.....DPRQWTE----------------------THVRDW
ETV6_HUMAN/38-124--------------PRALRMEE-----------DSIRLPAHL.RLQPIYWSR----------------------DDVAQW
PNT2_DROME/166-250--------------FASWEKEV-----------QKCNITK.....DPREWTE----------------------EHVIYW
SPDEF_HUMAN/131-213--------------LKDIETAC-----------KLLNITA.....DPMDWSP----------------------SNVQKW
EHF_MOUSE/31-115--------------CNVSSGFF-----------GSQWHEI.....HPQYWTK----------------------YQVWEW
ETS2_CHICK/90-173--------------FSGFTKEQ-----------CRLGIPN.....NPWLWTE----------------------QHVCQW
ELF5_HUMAN/45-129--------------AFEHQTAC-----------DSYWTSV.....HPEYWTK----------------------RHVWEW
FLI1_HUMAN/114-198--------------PPNMTTNE-----------RRVIVPA.....DPTLWTQ----------------------EHVRQW
GABPA_HUMAN/170-251--------------LEGYRKEQ-----------ERLGIPY.....DPIQWST----------------------DQVLHW
B4LTU0_DROVI/33-116--------------..SSQLAE-----------LKTQLPPSL.PSDPRLWSR----------------------DDVLDF
F7E1T3_XENTR/87-169--------------FNGFTKER-----------CRLGIPG.....NPWLWDE----------------------NHVFQW
Q9VB52_DROME/1279-1366--------------.PNYRLWQ-----------LNSAFKLDDVRTNPLHWTS----------------------WDVCEY
W4XHK4_STRPU/122-205--------------FSSFKKEQ-----------ERLGIPK.....DPSRWSE----------------------CQVVAW

PF07647

EPHB4_MOUSE/904-969----------------------------------------------PHYSAF----------------------GSVGEW
EPHA4_MOUSE/908-973----------------------------------------------PEFSAV----------------------VSVGDW
EPHA5_MOUSE/801-866----------------------------------------------LGSGAY----------------------RSVGEW
LCP2_MOUSE/12-76----------------------------------------------VLAWNS----------------------DNLADY
ASZ1_MOUSE/271-334----------------------------------------------SPYTAF----------------------GDLEIF
RHG07_HUMAN/451-513----------------------------------------------IEAKEA----------------------...CDW
EPHB6_MOUSE/938-1003----------------------------------------------LDFPCL----------------------DSPQAW
TNKS1_HUMAN/1024-1087----------------------------------------------VAGLDM----------------------.NISQF
SPLA_DICDI/1731-1796----------------------------------------------FKNWAP----------------------NDVAIW
STE11_YEAST/17-82----------------------------------------------EKTNDL----------------------PFVQLF
LIPB2_MOUSE/721-791----------------------------------------------VVQWSN----------------------HRVMEW
EPHA7_HUMAN/920-985----------------------------------------------PDFTTF----------------------CSVGEW
Q9W263_DROME/754-824----------------------------------------------PIVWTN----------------------QRFIRW
SARM1_DROME/757-824----------------------------------------------YSSKDT----------------------AKMHQF
LIPB_CAEEL/774-844----------------------------------------------VVRWTH----------------------SATCEW
DGKD_HUMAN/1142-1206----------------------------------------------VHLWGT----------------------EEVAAW
SARM1_HUMAN/479-546----------------------------------------------YSTCDR----------------------SNLADW
EPHA3_DANRE/907-972----------------------------------------------TPEAAV----------------------NTVEDW
NEB1_RAT/986-1050----------------------------------------------VHEWSV----------------------QQVSHW
POB1_SCHPO/247-311----------------------------------------------VPNWST----------------------EEVVEW
BYR2_SCHPO/1-65----------------------------------------------MEYYTS----------------------KEVAEW
EPHA3_MOUSE/908-973----------------------------------------------VDIATF----------------------HTTGDW
STE4_SCHPO/8-71----------------------------------------------YWNWNN----------------------EAVCNW
BOB1_YEAST/225-290----------------------------------------------AKSWSP----------------------EEVTDY
PHP_DROME/1510-1575----------------------------------------------ISSWSV----------------------DDVSNF
BOI2_YEAST/263-328----------------------------------------------AEFWSP----------------------EEITAY
STIM_DROME/210-279----------------------------------------------VHNWTI----------------------EQTTDW
EPHB5_CHICK/926-991----------------------------------------------PDFPSL----------------------SNAHEW
VTS1_YEAST/448-510----------------------------------------------TDPKLL----------------------KNIPMW
SAMH1_MOUSE/43-109----------------------------------------------LRTWEP----------------------EDVCSF
SAM10_HUMAN/115-182----------------------------------------------VVLWSQ----------------------QDVCKW
Q9DG07_CHICK/12-76----------------------------------------------VITWNP----------------------DDLAEY
TNKS2_HUMAN/871-934----------------------------------------------VPGVDF----------------------.SITQF
SAMN1_HUMAN/238-303----------------------------------------------SNSKKS----------------------KTLQEF
STIM2_HUMAN/133-202----------------------------------------------VHNWTL----------------------EDTLQW
Q9SF10_ARATH/452-517----------------------------------------------KKVEKA----------------------GGLNEW
P63_HUMAN/541-605----------------------------------------------PPYPTD----------------------CSIVSF
Q9VM93_DROME/1115-1185----------------------------------------------VLVWSN----------------------ERVIRW
Q9VU88_DROME/530-600----------------------------------------------VELWTA----------------------HRIMGW
Q9VUI0_DROME/173-237----------------------------------------------EHPTLS----------------------PRVKSL
F1NHC7_CHICK/928-993----------------------------------------------PDYTSF----------------------NTVDEW
F6QKP3_XENTR/910-974----------------------------------------------.EWSQV----------------------ASVLDW
F6ZV43_XENTR/909-973----------------------------------------------.DITAF----------------------TSVDDW
F7CRM0_XENTR/898-963----------------------------------------------PDYTTF----------------------PTVSDW
G4UGT7_NEUT9/219-286----------------------------------------------VESWSA----------------------DQVAEY
H2N9D2_PONAB/371-435----------------------------------------------PPYHAD----------------------PSLVSF
H2ZQZ0_CIOSA/63-126----------------------------------------------.EMLDL----------------------SSLGQW

PF00536

EPHA8_MOUSE/927-991-----------------------------------------------SGNGD----------------------LTVGDW
LIPA2_HUMAN/1018-1082-----------------------------------------------DMNHE----------------------WIGNEW
EPHA6_MOUSE/958-1022-----------------------------------------------EYPLF----------------------VTVGDW
ANS1B_HUMAN/808-874-----------------------------------------------PRCPV----------------------QTVGQW
ANS1B_HUMAN/882-947-----------------------------------------------DGYHP----------------------TSVAEW
EPHA1_HUMAN/911-975-----------------------------------------------DGIPY----------------------RTVSEW
CSKI2_HUMAN/487-550-----------------------------------------------EGKDA----------------------QAIHNW
CSKI2_HUMAN/557-620-----------------------------------------------SY.IP----------------------TDLLEW
EPHA2_HUMAN/902-966-----------------------------------------------EGVPF----------------------RTVSEW
SPKA_DICDI/238-301-----------------------------------------------RIKKY----------------------KDLFDW
Q9U2L2_CAEEL/244-306-----------------------------------------------GNRGP----------------------RRLSEL
SCML1_HUMAN/256-322-----------------------------------------------STWSV----------------------EAVVLF
Q9VD37_DROME/3-64-----------------------------------------------HH...----------------------NIVCEW
LIPB2_MOUSE/562-626-----------------------------------------------AQWST----------------------ERVCTW
LIPB2_MOUSE/637-697-----------------------------------------------DH...----------------------IWVTRW
Q9W263_DROME/667-731-----------------------------------------------QLGHT----------------------WVATEW
ANS1A_HUMAN/697-760-----------------------------------------------LE...----------------------QSVGEW
ANS1A_HUMAN/768-832-----------------------------------------------DGNSP----------------------PSVPSW
PHC2_MOUSE/784-848-----------------------------------------------TKWNV----------------------EDVYEF
LIPB_CAEEL/612-676-----------------------------------------------VDWRS----------------------EQLADW
SARM1_CAEEL/612-676-----------------------------------------------PGWTC----------------------ADVQYW
SCMH1_HUMAN/591-656-----------------------------------------------SSWTV----------------------EDVMQF
CNKR2_HUMAN/9-73-----------------------------------------------SKWSP----------------------SQVVDW
EPHA7_CHICK/916-980-----------------------------------------------DFTTF----------------------CSVGEW
O62258_CAEEL/2-65-----------------------------------------------EAWTQ----------------------FFVRAG
O64649_ARATH/237-300-----------------------------------------------LVTDL----------------------SPVLKW
EPHB2_CHICK/929-993-----------------------------------------------DYTSF----------------------NTVDEW
EPHA3_CHICK/909-973-----------------------------------------------DISAF----------------------RTAGDW
EPHB3_HUMAN/923-987-----------------------------------------------DYTTF----------------------TTVGDW
EPHA5_CHICK/939-1003-----------------------------------------------GSGAY----------------------RSVGEW
EPHB4_HUMAN/905-969-----------------------------------------------HYSAF----------------------GSVGEW
Q09493_CAEEL/1046-1109-----------------------------------------------DVWSV----------------------DDVIGW
Q18662_CAEEL/331-394-----------------------------------------------GVPHA----------------------EVLANW
Q18662_CAEEL/401-465-----------------------------------------------SVVPN----------------------NSLREW
SMSR1_CAEEL/12-78-----------------------------------------------NEWRC----------------------EDVGNW
SMG_DROME/594-654-----------------------------------------------RNVGM----------------------SGIGLW
BICC_DROME/803-866-----------------------------------------------QLAKH----------------------KDIQTL
LIPB1_HUMAN/645-709-----------------------------------------------AKWTK----------------------EQVCNW
LIPB1_HUMAN/720-780-----------------------------------------------DF...----------------------NWVTRW
Q93203_CAEEL/904-967-----------------------------------------------SAGRF----------------------FYVSEW
SHAN2_RAT/1409-1472-----------------------------------------------HLWTK----------------------PDVADW
Q9SFU7_ARATH/141-202-----------------------------------------------SQQAD----------------------SSVDSF
SCML2_HUMAN/629-695-----------------------------------------------STWSV----------------------DEVIQF
SMBT_DROME/1138-1201-----------------------------------------------DTWNV----------------------YDVSQF
Q9VMJ4_DROME/41-102-----------------------------------------------VHNSR----------------------MSISEW
Q9VR43_DROME/77-140-----------------------------------------------FEWDD----------------------MDIRRW
SHAN1_RAT/2102-2165-----------------------------------------------GFWTK----------------------FDVADW
S23IP_HUMAN/642-703-----------------------------------------------ENKEV----------------------LTLQET
C3XPM2_BRAFL/468-528-----------------------------------------------....Y----------------------SSVPEW
F1QSD6_DANRE/911-972-----------------------------------------------..APF----------------------RSVDEW
F1QX96_DANRE/887-948-----------------------------------------------..SSC----------------------GTVGDW
F1R5F3_DANRE/763-825-----------------------------------------------..SHC----------------------SSVADW
F7C2S3_XENTR/693-755-----------------------------------------------..MPF----------------------RTIAEW
F7G443_MACMU/679-740-----------------------------------------------.LWSK----------------------FDVGDW
Q8IMC2_DROME/984-1043-----------------------------------------------....F----------------------ISTDLW
X1WB99_DANRE/651-714-----------------------------------------------.SWSI----------------------DEVIQF

PF09235

Q6CUY2_KLULA/2-76--------------------------------------------SGTNEWST----------------------EEVCKK
Q6FX88_CANGA/16-90--------------------------------------------DNFDKWTT----------------------DEVVQW
STE50_YEAST/30-104--------------------------------------------EDFSQWSV----------------------DDVITW

PF13543

Q7PXM5_ANOGA/57-187LR---V---V-G----LSCASLNAVIQQVSTLEGL--LEKDEKE--L---RTIMGN..NVYVR.EEEMKRLTRACGNLR-
B4JHV4_DROGR/35-171LR---V---V-G----LSQESLNVCLGRLKTLEQT--LQLSDDE--L---KQLLAHNTSSS.QLDEELRRLTKAMHNLR-
B3S691_TRIAD/17-148LE---V---V-G----MESSTAKAICGLQLPLSTM--LNMQEED--M---RQMLND...VQCN.EGDSCRFIAAMKNLR-
B4NB95_DROWI/21-157LR---V---V-G----LGQETLNIILSKVKSLEET--LKMSDEE--L---KDILIEHSENQHR.EEEMRRLTRAMQNLR-
B7P9M2_IXOSC/21-149LK---V---V-G----LSAKSIEGLSNKLTTFDDM--LEKPEQE--V---KGFLSA...VNAR.EEEKRRFLIAMRNLK-
C3ZV30_BRAFL/17-145LE---V---V-D----IQPVAIRGIENKKISLEDL--LKMTKVE--I---VSLMSY...YGAE.EGETIRLLSAVNHLR-
B4QWW4_DROSI/33-166LR---V---V-G----LSQGTLTACLARLTTLEQS--LRLSDEE--I---RQLLADS.PSQRE.EEELRRLTRAMQNLR-
X1WHK8_DANRE/44-171LY---T---I-N----LRPEIIEAV.PVKLSLDAL--LQMSSGQ--V---EENMKR...LGSS.SEECSRITAALSCLK-

PF02198

ELF3_HUMAN/48-132IS---Y---Q-VEKNKYDASAIDFSRC.DMDGATL--CNCALEE--L---RLVFG.---..PL-GDQLHAQLRDLTSSS-
ELG_DROME/186-269LE---W---A-VKQ..FELVGINMSDW.QMNGQEL--CAMTHEE--F---NQKLPR---..DP-GNIFWTHLQLLKECN-
ETS1_RAT/53-136VM---W---A-VNE..FSLKGVDFQKF.CMNGAAL--CALGKEC--F---LELAPD---..FV-GDILWEHLEILQKED-
ETV6_HUMAN/38-124LK---W---A-ENE..FSLRPIDSNTF.EMNGKAL--LLLTKED--F---RYRSP.---..HS-GDVLYELLQHILKQR-
PNT2_DROME/166-250LN---W---A-KNE..FSLVSMNLDPFYKMKGRAM--VDLGKEK--F---LAITPP---..FT-GDILWEHLDILQKDC-
SPDEF_HUMAN/131-213LL---W---T-EHQ..YRLPPMGKAFQ.ELAGKEL--CAMSEEQ--F---RQRSP.---..LG-GDVLHAHLDIWKSAA-
EHF_MOUSE/31-115LQ---H---L-LDTNQLDASCIPFQEF.DISGEHL--CSMSLQE--F---TRAAG.---..SA-GQLLYSNLQHLKWNG-
ETS2_CHICK/90-173LA---W---A-TNE..FSLANVNIHQF.LMSGQDL--CNLGKER--F---LELAPD---..YV-GDILWEHLEQMIKDS-
ELF5_HUMAN/45-129LQ---F---C-CDQYKLDTNCISFCNF.NISGLQL--CSMTQEE--F---VEAAG.---..LC-GEYLYFILQNIRTQG-
FLI1_HUMAN/114-198LE---W---A-IKE..YSLMEIDTSFFQNMDGKEL--CKMNKED--F---LRATTL---..YN-TEVLLSHLSYLRESS-
GABPA_HUMAN/170-251VV---W---V-MKE..FSMTDIDLTTL.NISGREL--CSLNQED--F---FQRVP.---...R-GEILWSHLELLRKYV-
B4LTU0_DROVI/33-116LR---F---C-VRE..FDLPKLDFDLF.QMNGKAL--CLLTRAD--F---GHRCP.---..GA-GDVLHNVLQMLIIE.-
F7E1T3_XENTR/87-169LL---W---A-AKE..FSLENVNFQKF.LMNGHEL--CSLGKER--F---LALAPD---..FV-GDILWEHLEEMMKE.-
Q9VB52_DROME/1279-1366IE---R---A-LDS..TDIAKVIFEQ..DIDGRAL--LMLGRKE--L---DTYLKL---KVGP-AVKLYSLILNLRIA.-
W4XHK4_STRPU/122-205VH---W---S-IKE..FSLEGVSINNF.RISGRDL--CTLPKTD--F---LSRAPP---..FM-GDILWEHIDMLRKEC-

PF07647

EPHB4_MOUSE/904-969LR...A---I-..KM..GRYEESFAAAGFGSFEVV..SQISAED--L...L.RIGV-----TL-AGHQKKILASVQHMK-
EPHA4_MOUSE/908-973LQ...A---I-..KM..DRYKDNFTAAGYTTLEAV..VHMSQDD--L...A.RIGI-----TA-ITHQNKILSSVQAMR-
EPHA5_MOUSE/801-866LE...A---I-..KM..GRYTEIFMENGYSSMDAV..AQVTLED--L...R.RLGV-----TL-VGHQKKIMSSLQEMK-
LCP2_MOUSE/12-76FR...K---L-..NY..RDCEKAVKKYHIDG.ARF..LNLTEND--I...Q.KFPK-----LR-MPLLSKLSQDINKNE-
ASZ1_MOUSE/271-334LH...G---L-..GL..EHMTDSLKEKDITL.RHL..LTMKKDE--L...T.KNGI-----AS-KDQ.QKILAALKELE-
RHG07_HUMAN/451-513LR...A---T-..GF..PQYAQLYEDFLFPIDISL..VKREHDF--L...D.RDAI-----EA-LCRRLNTLNKCAVMK-
EPHB6_MOUSE/938-1003LS...A---I-..GL..ECYQDNFSKFGLSTFSDV..AQLSLED--L...P.GLGI-----TL-AGHQKKLLHNIQLLQ-
TNKS1_HUMAN/1024-1087LK...S---L-..GL..EHLRDIFETEQITL.DVL..ADMGHEE--L...K.EIGI-----NA-YGHRHKLIKGVERLL-
SPLA_DICDI/1731-1796LE...S---F-..NY..GQYRKNFRDNNISG.RHL..EGITHAM--L...KNDLGI-----EP-YGHREDIINRLNRMI-
STE11_YEAST/17-82LE...E---I-..GC..TQYLDSFIQCNLVTEEEI..KYLDKDI--L...I.ALGV-----NK-IGDRLKILRKSKSFQ-
LIPB2_MOUSE/721-791LR...S---V-..DL..AEYAPNLRGSGVHGGLIILEPRFTGDT--LAML.LNIPP-----QK-TLLRRHLTTKFNALI-
EPHA7_HUMAN/920-985LQ...A---I-..KM..ERYKDNFTAAGYNSLESV..ARMTIED--V..M..SLGI-----TL-VGHQKKIMSSIQTMR-
Q9W263_DROME/754-824VR...S---I-..DL..GEYADNLKDSGVHGGLVVLEPSFSGDT--MATA.LGIPP-----SK-NIIRRHLNTEFDALI-
SARM1_DROME/757-824LS...E---I-GTDY..CTYTYAMLNAGIDK.CAL..PHVNEDM--L...MTECGI-----HN-SIHRLRILNAVKNLE-
LIPB_CAEEL/774-844LR...K---I-..DL..AEFTQNLLFAGVPGALMIYEPSFTAES--LA.EILQMPP-----HK-TLLRRHLTSHFNQLL-
DGKD_HUMAN/1142-1206LE...H---L-..SL..CEYKDIFTRHDIRG.SEL..LHLERRD--L...K.DLGV-----TK-VGHMKRILCGIKELS-
SARM1_HUMAN/479-546LG...S---L-DPRF..RQYTYGLVSCGLDR.SLL..HRVSEQQ--L...LEDCGI-----HL-GVHRARILTAAREML-
EPHA3_DANRE/907-972LD...L---I-..KM..GQYKEHFSSAGYVTLDSV..LYVSSSE--L...D.KMGV-----EL-AGHQKKILSSIQCLQ-
NEB1_RAT/986-1050LV...G---L-..SL..DQYVSEFSAQNISG.EQL..LQLDGNK--L...K.ALGM-----TS-SQDRALVKKKLKEMK-
POB1_SCHPO/247-311LM...N---A-..GL..GSVAPNFAENEITG.EIL..LGLDSNV--L...K.ELNI-----TS-FGKRFEVLRKIQQLK-
BYR2_SCHPO/1-65LK...S---I-..GL..EKYIEQFSQNNIEG.RHL..NHLTLPL--L...K.DLGI-----EN-TAKGKQFLKQRDYLR-
EPHA3_MOUSE/908-973LN...G---M-..RT..AHCKEIFTGVEYSSCDTI..AKISTDD--M...K.KVGV-----TV-VGPQKKIISTIKALE-
STE4_SCHPO/8-71IE...Q---L-..GF...PHKEAFEDYHILG.KDI..DLLSSND--L...R.DMGI-----ES-VGHRIDILSAIQSMK-
BOB1_YEAST/225-290FS...L---V-..GF.DQSTCNKFKEHQVSG.KIL..LELELEH--L...K.ELEI-----NS-FGIRFQIFKEIRNIK-
PHP_DROME/1510-1575IR...E---L-..PG.CQDYVDDFIQQEIDG.QAL..LLLKEKH--L...VNAMGM-----.K-LGPALKIVAKVESIK-
BOI2_YEAST/263-328FI...M---E-..GY.DVQSASRFQKHKISG.KIL..LELELVH--L...K.ELDI-----NS-FGTRFEIFKEIEKIK-
STIM_DROME/210-279LA..QS---V-..QL..PQYVDLFKLHKVTGAALPRLAVNNLQY--V...GNVLGI-----KD-PIHKQKISLKAMDVV-
EPHB5_CHICK/926-991LD...A---I-..KM..GRYKENFDQAGLITFDVI..SRMTLED--L...Q.RIGI-----TL-VGHQKKILNSIQLMK-
VTS1_YEAST/448-510LK...S---L-..RL..HKYSDALSGTPWIE...L..IYLDDET--L...E.KKGV-----LA-LGARRKLLKAFGIVI-
SAMH1_MOUSE/43-109LE...N---R-..GFREKKVLDIFRDNKIAG.SFL..PFLDEDR--L...E.DLGV-----SS-LEERKKMIECIQQLS-
SAM10_HUMAN/115-182LKKHCP---H-..NY..LVYVEAFSQHAITG.RAL..LRLNAEK--L...Q.RMGL-----AQ-EAQRQEVLQQVLRLQ-
Q9DG07_CHICK/12-76FK...T---L-..KY..KDC.EKVVRKHSINGQRF..LNMSEND--I...Q.KFPK-----LR-VPIVSKLSQEINRNE-
TNKS2_HUMAN/871-934VR...N---L-..GL..EHLMDIFEREQITLDVLV...EMGHKE--L...K.EIGI-----NA-YGHRHKLIKGVERLI-
SAMN1_HUMAN/238-303LE...R---I-..HL..QEYTSTLLLNGYETLEDL..KDIKESH--L...I.ELNI-----EN-PDDRRRLLSAAENFL-
STIM2_HUMAN/133-202LI..EF---V-..EL..PQYEKNFRDNNVKGTTLPRIAVHEPSF--M...ISQLKI-----SD-RSHRQKLQLKALDVV-
Q9SF10_ARATH/452-517VG...S---I-..GL.GREFERMLRGQRMSK.FQM..ANLTMEK--L...K.QMGA-----LA-VGPRRKLIHAIGCVY-
P63_HUMAN/541-605LA...R---L-..GC..SSCLDYFTTQGLTTIYQI..EHYSMDD--L...A.SLKI-----PE-QFR.HAIWKGILDHR-
Q9VM93_DROME/1115-1185VG...S---I-..GL..KEYANNLLESGVHGGLMALDEGFDANA--MG.LALQIPT-----QN-AQARQILDTEFNNLL-
Q9VU88_DROME/530-600LQ...T---I-..DL..SEYTPNLRGAGVHGALMLYEPRFNADL--LA.DLLSIPP-----SK-SLLRRHLAMHFKELV-
Q9VUI0_DROME/173-237LD...R---T-..GN..AHLTELFTRQEIDIEVLI...QMTLED--L...A.ALGV-----RG-AREIRLAMNIIQLAK-
F1NHC7_CHICK/928-993LD...A---I-..KM..SQYKESFASAGFTTFDIV..SQMTVED--I...L.RVGV-----TL-AGHQKKILNSIQVMR-
F6QKP3_XENTR/910-974LQ...A---I-..KM..ERYKDNFTAAGYTSLEAV..VHVNQDD--L...T.RIGI-----SS-PSHQNKILSSVQGMR-
F6ZV43_XENTR/909-973LS...A---I-..KM..GQYRDIFLSSGFTSLQLV..AQMTSED--L...L.RIGI-----TL-AGHQKKILNSIQSMR-
F7CRM0_XENTR/898-963LE...A---I-..KM..GQYQENFLSAGFTSFHLV..AQMTAED--L...L.RIGV-----TL-AGHQKKLLNSVQDMR-
G4UGT7_NEUT9/219-286LF...T---V-..GV.EKHHCEVFRDQEITG.EVI..LGMDQTS--LF.IK.AFDL-----GS-VGRRLKTWQKIKNLQ-
H2N9D2_PONAB/371-435LT...G---L-..GC..PNCIEYFTSQGLQSIYHL..QNLTIED--L...G.ALKI-----PE-QYR.MTIWRGLQDLK-
H2ZQZ0_CIOSA/63-126LD...Q---M-..NM..LKYKPMMMRHGCVTAEQI..MRLNPSE--L...T.HMGF-----ID-TNDVNTVLRQADLL.-

PF00536

EPHA8_MOUSE/927-991LD---S...I.RM....GRYRDHFAAGGYSSLGMV--LRMNAQD..V---RA.LGI-----TL-MGHQKKILGSIQTMR-
LIPA2_HUMAN/1018-1082LP---S...L.GL....PQYRSYF.MECLVDARML--DHLTKKD..L---RVHLKM-----VD-SFHRTSLQYGIMCLK-
EPHA6_MOUSE/958-1022LD---S...I.KM....GQYKSNFMAAGFTTFDLI--SRMSIDD..I---RR.IGV-----IL-IGHQRRIVSSIQTLR-
ANS1B_HUMAN/808-874LE---S...I.GL....PQYENHLMANGFDNVQFM--GSNVMEDQDL---LE.IGI-----LN-SGHRQRILQAIQLLP-
ANS1B_HUMAN/882-947LD---S...I.EL....GDYTKAFLINGYTSMDLL--KKIWEVE..L---INVLKI-----NL-IGHRKRILASLGDRL-
EPHA1_HUMAN/911-975LE---S...I.RM....KRYILHFHSAGLDTMECV--LELTAED..L---TQ.MGI-----TL-PGHQKRILCSIQGFK-
CSKI2_HUMAN/487-550LS---E...F.QL....EGYTAHFLQAGY.DVPTI--SRMTPED..L---TA.IGV-----TK-PGHRKKIASEIAQLS-
CSKI2_HUMAN/557-620LC---A...L.GL....PQYHKQLVSSGYDSMGLV--ADLTWEE..L---QE.IGV-----NK-LGHQKKLMLGVKRLA-
EPHA2_HUMAN/902-966LE---S...I.KM....QQYTEHFMAAGYTAIEKV--VQMTNDD..I---KR.IGV-----RL-PGHQKRIAYSLLGLK-
SPKA_DICDI/238-301LQ---K...H.GF....EQYKDAF.LKEEMFLDEL--GEMSEDI..L---NK.MGI-----TS-TGTRLRILKETSNLA-
Q9U2L2_CAEEL/244-306LE---E...M.DL....SRYIDQF.KHENVDLEVF--FELKEQD..F---VD.MNI-----AY-.GPKKRMLDVIERYK-
SCML1_HUMAN/256-322LK---QTDPL.AL....CPLVDLF.RSHEIDGKAL--LLLTSDV..L---LKHLGV-----KL-.GTAVKLCYYIDRLK-
Q9VD37_DROME/3-64LR---T...I.GL....AHYGESFLENGYDELEIC--KQIGEID..L---DA.IGV-----DN-PSHRGKLLKSVRMLR-
LIPB2_MOUSE/562-626ME---D...F.GL....GQYVIFA.RQWVTSGHTL--LTATPQD..M---EKELGI-----KH-PLHRKKLVLAVKAIN-
LIPB2_MOUSE/637-697LD---D...I.GL....PQYKDQF.HESRVDGRML--QYLTVND..L---LF.LKV-----TS-QLHHLSIKCAIHVLH-
Q9W263_DROME/667-731LP---D...I.GL....PQYAEPF.VQSLVDARML--DTLSKKE..L---EKFLGV-----TR-KFHQASIVHGIHVLR-
ANS1A_HUMAN/697-760LE---S...I.GL....QQYESKLLLNGFDDVHFL--GSNVMEEQDL---RD.IGI-----SD-PQHRRKLLQAARSLP-
ANS1A_HUMAN/768-832LD---S...L.GL....QDYVHSFLSSGYSSIDTV--KNLWELE..L---VNVLKV-----QL-LGHRKRIIASLAD.R-
PHC2_MOUSE/784-848IR---S...LPGC....QEIAEEF.RAQEIDGQAL--LLLKEDH..L---MSAMNI-----KL-.GPALKIYARISMLK-
LIPB_CAEEL/612-676IA---E...I.GY....PQYMNEV.SRHVRSGRHF--LNMSMNE..Y---EGVLNI-----KN-PVHRKRVAILLRRIE-
SARM1_CAEEL/612-676VK---K...I.GF....EEYVEKF.AKQMVDGDLL--LQLTEND..L---KHDVGM-----IS-GLHRKRFLRELQTLK-
SCMH1_HUMAN/591-656VR---E...A.DPQ..LGPHADLF.RKHEIDGKAL--LLLRSDM..M---MK.YMG-----LK-LGPALKLSYHIDRLK-
CNKR2_HUMAN/9-73MK---......GLDDCLQQYIKNF.EREKISGDQL--LRITHQE..L---ED.LGV-----SR-IGHQELILEAV.DLL-
EPHA7_CHICK/916-980LQ---A...I.KM....ERYKDNFTAAGYNSLESV--ARMTIED..V---MS.LGI-----TL-VGHQKKIMSSIQTMR-
O62258_CAEEL/2-65IP---S...E.IA....KKYAKSF.ATNRITKEML--PELDKST..L---SE.LGV-----SA-IGDQLCILRRIKAAK-
O64649_ARATH/237-300LR---S...L.GL....AKYEDVF.IREEIDWDTL--QSLTEED..L---LS.IGI-----TS-LGPRKKIVNALSGVR-
EPHB2_CHICK/929-993LD---A...I.KM....SQYKESFASAGFTTFDIV--SQMTVED..I---LR.VGV-----TL-AGHQKKILNSIQVMR-
EPHA3_CHICK/909-973LN---G...F.RT....GQCKGIFTGVEYSSCDTI--AKISTDD..M---KK.VGV-----TV-VGPQKKIVSSIKTLE-
EPHB3_HUMAN/923-987LD---A...I.KM....GRYKESFVSAGFASFDLV--AQMTAED..L---LR.IGV-----TL-AGHQKKILSSIQDMR-
EPHA5_CHICK/939-1003LE---A...I.KM....GRYTEIFMENGYSSMDSV--AQVTLED..L---RR.LGV-----TL-VGHQKKIMNSLQEMK-
EPHB4_HUMAN/905-969LR---A...I.KM....GRYEESFAAAGFGSFELV--SQISAED..L---LR.IGV-----TL-AGHQKKILASVQHMK-
Q09493_CAEEL/1046-1109LS---S...L.HL....SEYTPAF.RSQRINGRCL--RQCDRSR..F---TQ.LGV-----TR-IAHRQIIESALRGLL-
Q18662_CAEEL/331-394LD---S...I.NM....SNYLAVFLKQGY.DLQTI--ARCTPAD..L---LS.LGI-----KN-PDHRKKLMSDIHSWK-
Q18662_CAEEL/401-465LH---A...I.AL....AEYIPMFESQRYTSVSDV--LDLQWED..F---ED.IGV-----KR-LGHLKRFGLTIKKLK-
SMSR1_CAEEL/12-78LK---K...I.GM....AKYADLIAMKHKVDGKCL--LALTDTDLKD---PP.VSI-----NC-LGDIKKILFAIEFLS-
SMG_DROME/594-654LK---S...L.RL....HKYIELF..KNM.TYEEM--LLITEDF..L---QS.VGV-----TK-.GASHKLALCIDKLK-
BICC_DROME/803-866LT---S...L.GL....EHYIKIF.VLNEIDLEVF--TTLTEEN..L---ME.LGI-----AA-FGARKKLLTAIHTLL-
LIPB1_HUMAN/645-709LM---E...Q.GL....GSYLNSG.KHWIASGQTL--LQASQQD..L---EKELGI-----KH-SLHRKKLQLALQALG-
LIPB1_HUMAN/720-780LD---D...I.GL....PQYKTQF.DEGRVDGRML--HYMTVDD..L---LS.LKV-----VS-VLHHLSIKRAIQVLR-
Q93203_CAEEL/904-967LN---F...I.GL....QDYISNFVGAGYKHMAKL--TEIDWDTARL---MQ.LGV-----TR-PGHIARMLHS...FK-
SHAN2_RAT/1409-1472LE---S...L.NL....GEHKETF.MDNEIDGSHL--PNLQKED..L---ID.LGV-----TR-VGHRMNIERALKQLL-
Q9SFU7_ARATH/141-202LE---S...L.GL....EKYSTAF.QVEEVDMDAL--MHMTDDD..L---KA.M.L-----IP-MGPRKKILLAL.GSK-
SCML2_HUMAN/629-695MK---H...T.DPQ.ISGPLADLF.RQHEIDGKAL--FLLKSDV..M---MK.YMG-----LK-LGPALKLCYYIEKLK-
SMBT_DROME/1138-1201LR---V...N.DC....TAHCDTF.SRNKIDGKRL--LQLTKDD..I---MP.LLG-----MK-VGPALKISDLIAQLK-
Q9VMJ4_DROME/41-102LD---L...L.EL....QQYEGNL..QEFSTVDDV--VDITDKE..L---KQ.FGV-----RG-.AHRQRMVNSLLGVR-
Q9VR43_DROME/77-140IN---G...Y.GY....PQYMNTF.RVNMITGRKL--LLLDASA..L---CA.MNI-----KN-FDHIRHISYGIRMLF-
SHAN1_RAT/2102-2165LE---W...L.GL....SEHRAQF.LDHEIDGSHL--PALTKED..Y---VD.LGV-----TR-VGHRMNIDRALKFFL-
S23IP_HUMAN/642-703LE---A...L.SL....SEYFSTF.EKEKIDMESL--LMCTVDD..L---KE.MGI-----.P-LGPRKKIANFVEH.K-
C3XPM2_BRAFL/468-528LD---S...L.SL....GRYTENFLKAGFTNLDCV--AKITLRE..L---QS.IGV-----TM-IGHQKKIMNSAQMLR-
F1QSD6_DANRE/911-972LE---S...I.KM....AQYRETFALAGIKSFDQV--LRLKIED..I---GN.IGV-----RL-AGHQKRIAYSILGL.-
F1QX96_DANRE/887-948LR---A...I.KM....ERYEETFLQAGYTSMQLV--THINTED..L---LR.LGI-----TL-AGHQKKILSSIEAL.-
F1R5F3_DANRE/763-825LR---A...I.KM....ERYEDAFMQAGFTAIQHI--THISTED..L---LR.IGV-----TL-AGHQKKILSSVQTLR-
F7C2S3_XENTR/693-755LE---S...I.KM....QQYNEFFMASPYNSMDKI--ILMNQDD..I---KH.LGI-----RQ-TGHQKRIAFSILGLK-
F7G443_MACMU/679-740LE---S...I.HL....GEHRDRF.EDHEIEGAHL--PALTKDD..F---VE.LGV-----TR-VGHRMNIERALRQL.-
Q8IMC2_DROME/984-1043LE---H...I.KM....SRYCHHFKEANLINAQQI--SRLTAQQ..L---SD.MGI-----TL-VGHQKKILHQARQL.-
X1WB99_DANRE/651-714IQ---G...LPGC....KEQVRTF.RDEQIDGEAF--LLLTQVD..L---VKILSI-----.K-LGPALKIYNSILMFK-

PF09235

Q6CUY2_KLULA/2-76VK---A---ELGLTDG-DTFILDRIRENKITGSTL--SEITLAD------CKELCP-----DS-IS.AVRLKTCINKFVD
Q6FX88_CANGA/16-90CG---T---VLGKDEQ-EPLFTR.IRDNNIDGSVL--QELTLQD------CKELTD-----ND-LKEAIKLKLWLNKLID
STE50_YEAST/30-104CI---S---TLEVEET-DPLCQR.LRENDIVGDLL--PELCLQD------CQDLCD-----GD-LNKAIKFKILINKMRD

PF13543

Q7PXM5_ANOGA/57-187---
B4JHV4_DROGR/35-171---
B3S691_TRIAD/17-148---
B4NB95_DROWI/21-157---
B7P9M2_IXOSC/21-149---
C3ZV30_BRAFL/17-145---
B4QWW4_DROSI/33-166---
X1WHK8_DANRE/44-171---

PF02198

ELF3_HUMAN/48-132---
ELG_DROME/186-269---
ETS1_RAT/53-136---
ETV6_HUMAN/38-124---
PNT2_DROME/166-250---
SPDEF_HUMAN/131-213---
EHF_MOUSE/31-115---
ETS2_CHICK/90-173---
ELF5_HUMAN/45-129---
FLI1_HUMAN/114-198---
GABPA_HUMAN/170-251---
B4LTU0_DROVI/33-116---
F7E1T3_XENTR/87-169---
Q9VB52_DROME/1279-1366---
W4XHK4_STRPU/122-205---

PF07647

EPHB4_MOUSE/904-969---
EPHA4_MOUSE/908-973---
EPHA5_MOUSE/801-866---
LCP2_MOUSE/12-76---
ASZ1_MOUSE/271-334---
RHG07_HUMAN/451-513---
EPHB6_MOUSE/938-1003---
TNKS1_HUMAN/1024-1087---
SPLA_DICDI/1731-1796---
STE11_YEAST/17-82---
LIPB2_MOUSE/721-791---
EPHA7_HUMAN/920-985---
Q9W263_DROME/754-824---
SARM1_DROME/757-824---
LIPB_CAEEL/774-844---
DGKD_HUMAN/1142-1206---
SARM1_HUMAN/479-546---
EPHA3_DANRE/907-972---
NEB1_RAT/986-1050---
POB1_SCHPO/247-311---
BYR2_SCHPO/1-65---
EPHA3_MOUSE/908-973---
STE4_SCHPO/8-71---
BOB1_YEAST/225-290---
PHP_DROME/1510-1575---
BOI2_YEAST/263-328---
STIM_DROME/210-279---
EPHB5_CHICK/926-991---
VTS1_YEAST/448-510---
SAMH1_MOUSE/43-109---
SAM10_HUMAN/115-182---
Q9DG07_CHICK/12-76---
TNKS2_HUMAN/871-934---
SAMN1_HUMAN/238-303---
STIM2_HUMAN/133-202---
Q9SF10_ARATH/452-517---
P63_HUMAN/541-605---
Q9VM93_DROME/1115-1185---
Q9VU88_DROME/530-600---
Q9VUI0_DROME/173-237---
F1NHC7_CHICK/928-993---
F6QKP3_XENTR/910-974---
F6ZV43_XENTR/909-973---
F7CRM0_XENTR/898-963---
G4UGT7_NEUT9/219-286---
H2N9D2_PONAB/371-435---
H2ZQZ0_CIOSA/63-126---

PF00536

EPHA8_MOUSE/927-991---
LIPA2_HUMAN/1018-1082---
EPHA6_MOUSE/958-1022---
ANS1B_HUMAN/808-874---
ANS1B_HUMAN/882-947---
EPHA1_HUMAN/911-975---
CSKI2_HUMAN/487-550---
CSKI2_HUMAN/557-620---
EPHA2_HUMAN/902-966---
SPKA_DICDI/238-301---
Q9U2L2_CAEEL/244-306---
SCML1_HUMAN/256-322---
Q9VD37_DROME/3-64---
LIPB2_MOUSE/562-626---
LIPB2_MOUSE/637-697---
Q9W263_DROME/667-731---
ANS1A_HUMAN/697-760---
ANS1A_HUMAN/768-832---
PHC2_MOUSE/784-848---
LIPB_CAEEL/612-676---
SARM1_CAEEL/612-676---
SCMH1_HUMAN/591-656---
CNKR2_HUMAN/9-73---
EPHA7_CHICK/916-980---
O62258_CAEEL/2-65---
O64649_ARATH/237-300---
EPHB2_CHICK/929-993---
EPHA3_CHICK/909-973---
EPHB3_HUMAN/923-987---
EPHA5_CHICK/939-1003---
EPHB4_HUMAN/905-969---
Q09493_CAEEL/1046-1109---
Q18662_CAEEL/331-394---
Q18662_CAEEL/401-465---
SMSR1_CAEEL/12-78---
SMG_DROME/594-654---
BICC_DROME/803-866---
LIPB1_HUMAN/645-709---
LIPB1_HUMAN/720-780---
Q93203_CAEEL/904-967---
SHAN2_RAT/1409-1472---
Q9SFU7_ARATH/141-202---
SCML2_HUMAN/629-695---
SMBT_DROME/1138-1201---
Q9VMJ4_DROME/41-102---
Q9VR43_DROME/77-140---
SHAN1_RAT/2102-2165---
S23IP_HUMAN/642-703---
C3XPM2_BRAFL/468-528---
F1QSD6_DANRE/911-972---
F1QX96_DANRE/887-948---
F1R5F3_DANRE/763-825---
F7C2S3_XENTR/693-755---
F7G443_MACMU/679-740---
Q8IMC2_DROME/984-1043---
X1WB99_DANRE/651-714---

PF09235

Q6CUY2_KLULA/2-76TEE
Q6FX88_CANGA/16-90SQL
STE50_YEAST/30-104SKL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window