Sequence alignment for CL0004

PF00354

SAMP_MOUSE/27-220--------------------------------------------------------------------------------
CRP1_LIMPO/33-237--------------------------------------------------------------------------------
CRP_XENLA/23-219--------------------------------------------------------------------------------
CRP_RABIT/26-221--------------------------------------------------------------------------------
CRP_HUMAN/25-220--------------------------------------------------------------------------------
SAMP_HUMAN/26-219--------------------------------------------------------------------------------
Q542I3_MOUSE/26-221--------------------------------------------------------------------------------
FP_CRIMI/26-219--------------------------------------------------------------------------------

PF13385

A9V7L7_MONBE/717-870--------------------------------------------------------------------------------
A9V0U4_MONBE/809-963--------------------------------------------------------------------------------
A9VE19_MONBE/544-692--------------------------------------------------------------------------------
A9V0U4_MONBE/590-745--------------------------------------------------------------------------------
B9JMF4_AGRRK/595-752--------------------------------------------------------------------------------
C9ZAH4_STRSW/174-331--------------------------------------------------------------------------------
B5HCG7_STRPR/182-340--------------------------------------------------------------------------------
D3EBL1_GEOS4/644-797--------------------------------------------------------------------------------
Q82NZ6_STRAW/693-850--------------------------------------------------------------------------------
C7Q3C0_CATAD/682-839--------------------------------------------------------------------------------
C6WP14_ACTMD/1442-1597--------------------------------------------------------------------------------
A7RQU2_NEMVE/46-196--------------------------------------------------------------------------------
B3RTE4_TRIAD/419-588--------------------------------------------------------------------------------
Q11RF9_CYTH3/68-223--------------------------------------------------------------------------------
D2AYT0_STRRD/833-984--------------------------------------------------------------------------------
Q01PZ1_SOLUE/560-711--------------------------------------------------------------------------------
D0LXW7_HALO1/121-278--------------------------------------------------------------------------------
A9ERE1_SORC5/156-299--------------------------------------------------------------------------------
A7RK85_NEMVE/111-274--------------------------------------------------------------------------------
Q7UP09_RHOBA/489-653--------------------------------------------------------------------------------
D2QJX5_SPILD/494-660--------------------------------------------------------------------------------
A5G5W5_GEOUR/3125-3280--------------------------------------------------------------------------------
Q12UM1_METBU/211-367--------------------------------------------------------------------------------
A5G5W5_GEOUR/2834-2981--------------------------------------------------------------------------------
Q3A7I8_PELCD/252-409--------------------------------------------------------------------------------
Q2S986_HAHCH/536-688--------------------------------------------------------------------------------
C5BR34_TERTT/286-438--------------------------------------------------------------------------------
Q5E1F1_VIBF1/338-497--------------------------------------------------------------------------------
D0LH97_HALO1/423-584--------------------------------------------------------------------------------
Q2SIZ0_HAHCH/349-511--------------------------------------------------------------------------------
Q21ES8_SACD2/355-516--------------------------------------------------------------------------------
A1U1N6_MARHV/358-517--------------------------------------------------------------------------------
Q7UQA7_RHOBA/111-269--------------------------------------------------------------------------------
Q5JEI1_THEKO/104-250--------------------------------------------------------------------------------
D2RI28_ARCPA/205-357--------------------------------------------------------------------------------
D2QKT6_SPILD/67-225--------------------------------------------------------------------------------
A7RFD3_NEMVE/591-745--------------------------------------------------------------------------------
A5FGU3_FLAJ1/61-211--------------------------------------------------------------------------------
A5FGS6_FLAJ1/61-211--------------------------------------------------------------------------------
A5FKP6_FLAJ1/648-806--------------------------------------------------------------------------------
B1WQC8_CYAA5/1492-1639--------------------------------------------------------------------------------
B2J7Y5_NOSP7/1082-1239--------------------------------------------------------------------------------
B8GR77_THISH/232-391--------------------------------------------------------------------------------
A5US22_ROSS1/44-194--------------------------------------------------------------------------------
B8FIJ2_DESAA/1835-1990--------------------------------------------------------------------------------
B8FIJ2_DESAA/2139-2295--------------------------------------------------------------------------------
B8FIJ2_DESAA/3101-3258--------------------------------------------------------------------------------
B1WQC8_CYAA5/529-689--------------------------------------------------------------------------------
A0L6L9_MAGMM/6883-7036--------------------------------------------------------------------------------
A0L6L9_MAGMM/10297-10458--------------------------------------------------------------------------------
A0L6L9_MAGMM/11015-11176--------------------------------------------------------------------------------
A0L6L9_MAGMM/7697-7855--------------------------------------------------------------------------------
Q11V34_CYTH3/475-632--------------------------------------------------------------------------------
D1YWM2_METPS/639-793--------------------------------------------------------------------------------
A9AX01_HERA2/2983-3139--------------------------------------------------------------------------------
C5CYC7_VARPS/584-746--------------------------------------------------------------------------------
A9VEK3_MONBE/43-204--------------------------------------------------------------------------------
A9UYJ6_MONBE/611-770--------------------------------------------------------------------------------
A4CID0_ROBBH/183-344--------------------------------------------------------------------------------
Q01ZJ6_SOLUE/448-593--------------------------------------------------------------------------------
Q112U0_TRIEI/322-477--------------------------------------------------------------------------------
A9AVC5_HERA2/53-212--------------------------------------------------------------------------------
C3YCM4_BRAFL/399-559--------------------------------------------------------------------------------
A9AX01_HERA2/3464-3613--------------------------------------------------------------------------------
A9AX01_HERA2/1709-1859--------------------------------------------------------------------------------
A9AX01_HERA2/3687-3839--------------------------------------------------------------------------------
A9AVE2_HERA2/55-206--------------------------------------------------------------------------------
A0ZJ67_NODSP/534-687--------------------------------------------------------------------------------
A9WA06_CHLAA/1561-1710--------------------------------------------------------------------------------
D2GX75_AILME/1328-1494--------------------------------------------------------------------------------
GPR98_DANRE/1321-1486--------------------------------------------------------------------------------
B3PKP2_CELJU/973-1129--------------------------------------------------------------------------------
Q21FF7_SACD2/1013-1165--------------------------------------------------------------------------------
Q21FF7_SACD2/697-861--------------------------------------------------------------------------------
B8E3D6_DICTD/93-243--------------------------------------------------------------------------------
C6D6G1_PAESJ/694-843--------------------------------------------------------------------------------
Q9KBP7_BACHD/623-775--------------------------------------------------------------------------------
C7R5J8_JONDD/646-797--------------------------------------------------------------------------------
C7R5J7_JONDD/547-698--------------------------------------------------------------------------------
D4J0Z2_BUTFI/89-242--------------------------------------------------------------------------------
A5GAT0_GEOUR/82-245--------------------------------------------------------------------------------
C6W5Q6_DYAFD/72-233--------------------------------------------------------------------------------
D5SQB3_PLAL2/445-615--------------------------------------------------------------------------------
A0C6A9_PARTE/84-241--------------------------------------------------------------------------------
A4HMI3_LEIBR/697-852--------------------------------------------------------------------------------
A5JZZ5_PLAVS/101-250--------------------------------------------------------------------------------
D2W1V6_NAEGR/225-370--------------------------------------------------------------------------------
Q3A7I8_PELCD/471-622--------------------------------------------------------------------------------
B0R0F2_DANRE/89-248--------------------------------------------------------------------------------
B3RQA7_TRIAD/115-267--------------------------------------------------------------------------------
D3F200_CONWI/289-437--------------------------------------------------------------------------------
C6WK26_ACTMD/261-414--------------------------------------------------------------------------------
A0ZJ64_NODSP/411-564--------------------------------------------------------------------------------
P73139_SYNY3/1330-1483--------------------------------------------------------------------------------
D3F0R0_CONWI/85-255--------------------------------------------------------------------------------
C1F1C3_ACIC5/51-208--------------------------------------------------------------------------------
B5HK67_STRPR/818-980--------------------------------------------------------------------------------
D9TDD0_MICAI/805-962--------------------------------------------------------------------------------
Q82GV4_STRAW/292-440--------------------------------------------------------------------------------
D2BE74_STRRD/722-881--------------------------------------------------------------------------------
B5I5M1_9ACTN/761-922--------------------------------------------------------------------------------
B1VPR2_STRGG/846-1008--------------------------------------------------------------------------------
B5HSG2_9ACTN/789-950--------------------------------------------------------------------------------
B1VKK7_STRGG/744-905--------------------------------------------------------------------------------
C6WQK6_ACTMD/756-914--------------------------------------------------------------------------------
C9Z2C7_STRSW/793-953--------------------------------------------------------------------------------
D2PTR0_KRIFD/729-887--------------------------------------------------------------------------------
D2PTR0_KRIFD/514-676--------------------------------------------------------------------------------
B5H1J2_STRC2/810-972--------------------------------------------------------------------------------
B5H1J2_STRC2/1032-1193--------------------------------------------------------------------------------
C6WL54_ACTMD/905-1058--------------------------------------------------------------------------------
E6W606_DESIS/780-953--------------------------------------------------------------------------------
C5C072_BEUC1/602-756--------------------------------------------------------------------------------
A0L6L9_MAGMM/10522-10674--------------------------------------------------------------------------------
D0LH97_HALO1/144-304--------------------------------------------------------------------------------
Q12UM1_METBU/421-574--------------------------------------------------------------------------------
D3SUF1_NATMM/128-286--------------------------------------------------------------------------------
Q12UM1_METBU/635-797--------------------------------------------------------------------------------
B1Y080_LEPCP/302-473--------------------------------------------------------------------------------
Q025I9_SOLUE/271-426--------------------------------------------------------------------------------
Q025I9_SOLUE/616-778--------------------------------------------------------------------------------
C6XUD8_PEDHD/202-348--------------------------------------------------------------------------------
E6W633_DESIS/617-776--------------------------------------------------------------------------------
B8FF04_DESAA/2231-2395--------------------------------------------------------------------------------
C7PKJ2_CHIPD/89-251--------------------------------------------------------------------------------
D2PTT7_KRIFD/1092-1258--------------------------------------------------------------------------------
D2PTT7_KRIFD/1416-1585--------------------------------------------------------------------------------

PF02973

NANA_STRR6/118-309--------------------------------------------------------------------------------
Q8CWP8_STRR6/42-227--------------------------------------------------------------------------------
Q8XMG4_CLOPE/50-236--------------------------------------------------------------------------------

PF07953

A7GBG3_CLOBL/878-1072--------------------------------------------------------------------------------
F4AAX8_CLOBO/847-1023--------------------------------------------------------------------------------
O87710_9CLOT/811-986--------------------------------------------------------------------------------
B1INP6_CLOBK/847-1023--------------------------------------------------------------------------------
Q8GR96_CLOBO/872-1066--------------------------------------------------------------------------------
BXE_CLOBO/859-1054--------------------------------------------------------------------------------
O69276_CLOBO/816-992--------------------------------------------------------------------------------
BXEN_CLOBU/812-988--------------------------------------------------------------------------------
Q3ZUA3_9CLOT/40-243--------------------------------------------------------------------------------
O06018_CLOBO/848-1024--------------------------------------------------------------------------------
Q841S3_CLOBO/880-1071--------------------------------------------------------------------------------
BXA1_CLOBH/885-1079--------------------------------------------------------------------------------
BXG_CLOBO/877-1074--------------------------------------------------------------------------------

PF06439

A3HZT9_9BACT/35-266--------------------------------------------------------------------------------
A6LBG6_PARD8/26-215--------------------------------------------------------------------------------
B0T1W6_CAUSK/37-271--------------------------------------------------------------------------------
A4SXW4_POLSQ/31-195--------------------------------------------------------------------------------
A6DIW7_9BACT/14-204--------------------------------------------------------------------------------
A7LWH3_BACO1/242-448--------------------------------------------------------------------------------
A6LFX0_PARD8/51-268--------------------------------------------------------------------------------
Q1IP75_KORVE/134-305--------------------------------------------------------------------------------
Q01PY8_SOLUE/18-214--------------------------------------------------------------------------------
Q021Z2_SOLUE/148-318--------------------------------------------------------------------------------
A6C286_9PLAN/26-230--------------------------------------------------------------------------------
A6L9A1_PARD8/27-220--------------------------------------------------------------------------------
Q7UXM1_RHOBA/116-314--------------------------------------------------------------------------------
Q7UGT3_RHOBA/50-260--------------------------------------------------------------------------------
A6DGN3_9BACT/486-705--------------------------------------------------------------------------------
Q026J2_SOLUE/86-285--------------------------------------------------------------------------------
A7AJH3_9PORP/62-268--------------------------------------------------------------------------------
A4AVD2_MARSH/28-192--------------------------------------------------------------------------------
A6CF10_9PLAN/1565-1736--------------------------------------------------------------------------------
A4Z0W7_BRASO/36-203--------------------------------------------------------------------------------
Q7URI3_RHOBA/55-252--------------------------------------------------------------------------------
Q022Y3_SOLUE/158-351--------------------------------------------------------------------------------
A3ZYX9_9PLAN/31-241--------------------------------------------------------------------------------
Q7UYC2_RHOBA/27-225--------------------------------------------------------------------------------
Q08RB4_STIAD/354-520--------------------------------------------------------------------------------
B1KP96_SHEWM/43-237--------------------------------------------------------------------------------
Q7ULY5_RHOBA/53-228--------------------------------------------------------------------------------
Q9XAM0_STRCO/521-727--------------------------------------------------------------------------------
A6LD72_PARD8/35-236--------------------------------------------------------------------------------
A5V6S7_SPHWW/38-269--------------------------------------------------------------------------------
A3ZPX1_9PLAN/148-325--------------------------------------------------------------------------------
A6E8U4_9SPHI/241-449--------------------------------------------------------------------------------
Q7UFF8_RHOBA/54-264--------------------------------------------------------------------------------
A4SYN3_POLSQ/50-213--------------------------------------------------------------------------------
Q01QD3_SOLUE/67-266--------------------------------------------------------------------------------
Q21G79_SACD2/27-266--------------------------------------------------------------------------------
Q15XP9_PSEA6/43-289--------------------------------------------------------------------------------
A7NM29_ROSCS/68-253--------------------------------------------------------------------------------
Q02AV5_SOLUE/47-254--------------------------------------------------------------------------------
Q024T5_SOLUE/20-224--------------------------------------------------------------------------------
A6CH23_9PLAN/11-222--------------------------------------------------------------------------------
Q5LID8_BACFN/75-244--------------------------------------------------------------------------------
A4AN55_MARSH/13-232--------------------------------------------------------------------------------
Q7UP53_RHOBA/254-436--------------------------------------------------------------------------------
A3HYW7_9BACT/39-258--------------------------------------------------------------------------------
Q020M5_SOLUE/283-466--------------------------------------------------------------------------------
A7LZB4_BACO1/60-285--------------------------------------------------------------------------------
A6L8C0_PARD8/23-196--------------------------------------------------------------------------------
A4XES2_NOVAD/37-271--------------------------------------------------------------------------------
Q024G0_SOLUE/10-210--------------------------------------------------------------------------------
Q7UP53_RHOBA/88-251--------------------------------------------------------------------------------
Q7UJ71_RHOBA/62-282--------------------------------------------------------------------------------
A6C9B4_9PLAN/53-240--------------------------------------------------------------------------------
A0ACR9_STRAM/807-998--------------------------------------------------------------------------------
A6DSM6_9BACT/29-216--------------------------------------------------------------------------------
Q9XBE0_AMYOR/795-985--------------------------------------------------------------------------------
A6LB52_PARD8/744-943--------------------------------------------------------------------------------
A0M051_GRAFK/45-249--------------------------------------------------------------------------------
A6DM12_9BACT/183-370--------------------------------------------------------------------------------
A4ASP9_MARSH/24-229--------------------------------------------------------------------------------
A4ATY8_MARSH/64-260--------------------------------------------------------------------------------
A4ASM0_MARSH/38-261--------------------------------------------------------------------------------
Q15XH8_PSEA6/28-257--------------------------------------------------------------------------------
A6BZI2_9PLAN/34-270--------------------------------------------------------------------------------
A6DJ51_9BACT/30-221--------------------------------------------------------------------------------
A3ZYG0_9PLAN/42-220--------------------------------------------------------------------------------
A6LFJ8_PARD8/58-253--------------------------------------------------------------------------------
B4SNA4_STRM5/52-245--------------------------------------------------------------------------------
Q021Q3_SOLUE/25-318--------------------------------------------------------------------------------
A6DFB8_9BACT/988-1186--------------------------------------------------------------------------------
A6CBU4_9PLAN/476-662--------------------------------------------------------------------------------
Q7UTD6_RHOBA/106-307--------------------------------------------------------------------------------
A4CGG3_ROBBH/26-212--------------------------------------------------------------------------------
A4AUV7_MARSH/139-306--------------------------------------------------------------------------------
B0T1X3_CAUSK/51-253--------------------------------------------------------------------------------
A6C9Y7_9PLAN/38-232--------------------------------------------------------------------------------
A3I2W3_9BACT/58-253--------------------------------------------------------------------------------
A6DGC3_9BACT/39-228--------------------------------------------------------------------------------
A6BYQ3_9PLAN/523-721--------------------------------------------------------------------------------
Q9A9B2_CAUCR/42-285--------------------------------------------------------------------------------
Q01U12_SOLUE/21-204--------------------------------------------------------------------------------
Q7UTD6_RHOBA/325-510--------------------------------------------------------------------------------
A4ARZ0_MARSH/21-221--------------------------------------------------------------------------------
Q01PI7_SOLUE/133-305--------------------------------------------------------------------------------
Q09C00_STIAD/650-816--------------------------------------------------------------------------------
A3ZT25_9PLAN/28-228--------------------------------------------------------------------------------
A4A1V7_9PLAN/150-329--------------------------------------------------------------------------------
A0YAF8_9GAMM/30-260--------------------------------------------------------------------------------
A6DSF7_9BACT/22-217--------------------------------------------------------------------------------
A4BYH9_9FLAO/26-192--------------------------------------------------------------------------------
A0ACX0_STRAM/280-457--------------------------------------------------------------------------------
Q01NY0_SOLUE/48-250--------------------------------------------------------------------------------
A6CCA5_9PLAN/71-236--------------------------------------------------------------------------------
A3I170_9BACT/40-240--------------------------------------------------------------------------------
A7AAJ2_9PORP/957-1147--------------------------------------------------------------------------------
A5IIW8_THEP1/74-230--------------------------------------------------------------------------------
A7LWH3_BACO1/23-209--------------------------------------------------------------------------------
Q01WT7_SOLUE/22-227--------------------------------------------------------------------------------
A6DM09_9BACT/22-216--------------------------------------------------------------------------------
Q02B64_SOLUE/22-209--------------------------------------------------------------------------------
A6DTC7_9BACT/37-227--------------------------------------------------------------------------------
A6CA29_9PLAN/352-540--------------------------------------------------------------------------------
A6C8Y3_9PLAN/63-235--------------------------------------------------------------------------------
A3XPN2_LEEBM/32-218--------------------------------------------------------------------------------
A4A0Q4_9PLAN/26-218--------------------------------------------------------------------------------
A6E8U4_9SPHI/25-211--------------------------------------------------------------------------------
Q01UN1_SOLUE/9-241--------------------------------------------------------------------------------
A3ZQS2_9PLAN/31-212--------------------------------------------------------------------------------
A6DG40_9BACT/159-340--------------------------------------------------------------------------------
A6DLT3_9BACT/234-440--------------------------------------------------------------------------------
A6EKV1_9SPHI/655-832--------------------------------------------------------------------------------
A3ZY13_9PLAN/44-228--------------------------------------------------------------------------------
A6DLT3_9BACT/28-216--------------------------------------------------------------------------------
Q1AST8_RUBXD/20-211--------------------------------------------------------------------------------
A4FDZ7_SACEN/121-335--------------------------------------------------------------------------------
R6X5T3_9PORP/62-257--------------------------------------------------------------------------------
A6BYS0_9PLAN/54-263--------------------------------------------------------------------------------
Q01XX3_SOLUE/25-191--------------------------------------------------------------------------------
Q2Y669_NITMU/16-255--------------------------------------------------------------------------------
A3ZWI0_9PLAN/615-790--------------------------------------------------------------------------------
A3ZR79_9PLAN/39-201--------------------------------------------------------------------------------
A6CAH6_9PLAN/67-283--------------------------------------------------------------------------------
Q01TF2_SOLUE/30-207--------------------------------------------------------------------------------
Q2RZK0_SALRD/15-220--------------------------------------------------------------------------------
A6CGD1_9PLAN/671-851--------------------------------------------------------------------------------
A6C1K2_9PLAN/155-332--------------------------------------------------------------------------------
Q7UTX3_RHOBA/29-219--------------------------------------------------------------------------------
Q7UYB9_RHOBA/49-246--------------------------------------------------------------------------------
A3ZS39_9PLAN/38-281--------------------------------------------------------------------------------
Q026J8_SOLUE/86-284--------------------------------------------------------------------------------
A6EFU0_9SPHI/28-228--------------------------------------------------------------------------------
A7AG24_9PORP/243-456--------------------------------------------------------------------------------
A3ZX11_9PLAN/36-237--------------------------------------------------------------------------------
A6C3G1_9PLAN/151-333--------------------------------------------------------------------------------
Q7UWR3_RHOBA/519-700--------------------------------------------------------------------------------
Q7UZ09_RHOBA/53-231--------------------------------------------------------------------------------
A3ZQR2_9PLAN/150-327--------------------------------------------------------------------------------
A6C1I1_9PLAN/43-215--------------------------------------------------------------------------------
A6C5D8_9PLAN/56-241--------------------------------------------------------------------------------
A6DGI4_9BACT/22-219--------------------------------------------------------------------------------
Q7UKZ1_RHOBA/77-278--------------------------------------------------------------------------------
Q7ULK4_RHOBA/125-306--------------------------------------------------------------------------------
Q2Y774_NITMU/671-893--------------------------------------------------------------------------------
A6C6K0_9PLAN/64-244--------------------------------------------------------------------------------
A6LCM7_PARD8/20-194--------------------------------------------------------------------------------
Q027F9_SOLUE/8-228--------------------------------------------------------------------------------
A6DM04_9BACT/25-206--------------------------------------------------------------------------------
Q024Y0_SOLUE/27-212--------------------------------------------------------------------------------
A6CCA5_9PLAN/239-425--------------------------------------------------------------------------------
A3ZTD9_9PLAN/1170-1342--------------------------------------------------------------------------------
A3I2B6_9BACT/23-203--------------------------------------------------------------------------------
A4A0D3_9PLAN/28-213--------------------------------------------------------------------------------
Q7ULY5_RHOBA/234-440--------------------------------------------------------------------------------
A2U0D4_9FLAO/30-260--------------------------------------------------------------------------------
A3ZSI6_9PLAN/804-979--------------------------------------------------------------------------------
A4ASP0_MARSH/33-262--------------------------------------------------------------------------------
A6DNR0_9BACT/77-264--------------------------------------------------------------------------------
Q7UTX3_RHOBA/225-416--------------------------------------------------------------------------------
A4A202_9PLAN/27-207--------------------------------------------------------------------------------
Q7UYD6_RHOBA/61-249--------------------------------------------------------------------------------
A6DQD4_9BACT/44-244--------------------------------------------------------------------------------
Q7UYI5_RHOBA/85-260--------------------------------------------------------------------------------
A4APB3_MARSH/31-262--------------------------------------------------------------------------------
A4CHF9_ROBBH/43-248--------------------------------------------------------------------------------
A6LD40_PARD8/42-255--------------------------------------------------------------------------------
Q2GAA2_NOVAD/60-315--------------------------------------------------------------------------------
A3ZWI1_9PLAN/266-442--------------------------------------------------------------------------------
A3XQG8_LEEBM/44-246--------------------------------------------------------------------------------
Q7UPZ9_RHOBA/40-226--------------------------------------------------------------------------------
Q7URK6_RHOBA/266-443--------------------------------------------------------------------------------
A6LER8_PARD8/252-428--------------------------------------------------------------------------------
Q7US53_RHOBA/171-350--------------------------------------------------------------------------------
Q026X4_SOLUE/31-258--------------------------------------------------------------------------------
A3HX26_9BACT/40-244--------------------------------------------------------------------------------
A3HS07_9BACT/30-219--------------------------------------------------------------------------------
A3ZR79_9PLAN/204-387--------------------------------------------------------------------------------
A3I0Y0_9BACT/33-262--------------------------------------------------------------------------------
A3ZT60_9PLAN/22-206--------------------------------------------------------------------------------
Q01RN4_SOLUE/31-268--------------------------------------------------------------------------------
A6C7J3_9PLAN/515-746--------------------------------------------------------------------------------
A3I2F1_9BACT/51-252--------------------------------------------------------------------------------
A4CGG3_ROBBH/243-451--------------------------------------------------------------------------------
Q7UXU2_RHOBA/55-243--------------------------------------------------------------------------------
Q7UGD2_RHOBA/163-356--------------------------------------------------------------------------------
Q7UYA4_RHOBA/58-260--------------------------------------------------------------------------------

PF00337

Q9VPI7_DROME/41-166--------------------------------------------------------------------------------
Q9VPI7_DROME/226-369--------------------------------------------------------------------------------
Q7QF77_ANOGA/4-145--------------------------------------------------------------------------------
Q7QF77_ANOGA/165-293--------------------------------------------------------------------------------
Q7PPI9_ANOGA/742-883--------------------------------------------------------------------------------
Q7QHP5_ANOGA/12-144--------------------------------------------------------------------------------
Q18813_CAEEL/34-172--------------------------------------------------------------------------------
Q18813_CAEEL/180-310--------------------------------------------------------------------------------
LEG8_HUMAN/18-151--------------------------------------------------------------------------------
LEG8_HUMAN/186-316--------------------------------------------------------------------------------
Q9XVD0_CAEEL/131-257--------------------------------------------------------------------------------
B3GTH_ARATH/184-393--------------------------------------------------------------------------------
B3GTK_ARATH/190-404--------------------------------------------------------------------------------
LEG7_MOUSE/5-135--------------------------------------------------------------------------------
LEG3_MOUSE/131-261--------------------------------------------------------------------------------
LEG4_CHICK/4-134--------------------------------------------------------------------------------
Q7Q2T6_ANOGA/13-143--------------------------------------------------------------------------------
Q7PWU9_ANOGA/113-239--------------------------------------------------------------------------------
Q7PWU9_ANOGA/285-422--------------------------------------------------------------------------------
Q18625_CAEEL/13-145--------------------------------------------------------------------------------
LEG9_HUMAN/16-147--------------------------------------------------------------------------------
LEG4_PIG/18-149--------------------------------------------------------------------------------
LEG9_HUMAN/226-355--------------------------------------------------------------------------------
LEG4_PIG/193-323--------------------------------------------------------------------------------
LEC7_CAEEL/10-137--------------------------------------------------------------------------------
Q94215_CAEEL/11-140--------------------------------------------------------------------------------
Q9VPU6_DROME/164-300--------------------------------------------------------------------------------
Q9VPU6_DROME/3-145--------------------------------------------------------------------------------
Q7ZZ26_DANRE/9-141--------------------------------------------------------------------------------
O01329_CAEEL/100-226--------------------------------------------------------------------------------
O62353_CAEEL/138-266--------------------------------------------------------------------------------
Q18625_CAEEL/153-281--------------------------------------------------------------------------------
TECPR_DROME/815-954--------------------------------------------------------------------------------
LEG6_CHICK/3-133--------------------------------------------------------------------------------
Q9U2I7_CAEEL/14-147--------------------------------------------------------------------------------
GRIFN_RAT/4-132--------------------------------------------------------------------------------
GRIFN_DANRE/4-133--------------------------------------------------------------------------------
Q6AV44_ORYSJ/145-340--------------------------------------------------------------------------------
Q84T07_ORYSJ/162-372--------------------------------------------------------------------------------
B3GTI_ARATH/190-391--------------------------------------------------------------------------------
B3GTF_ARATH/170-363--------------------------------------------------------------------------------
B3GTG_ARATH/165-343--------------------------------------------------------------------------------
Q9VPI6_DROME/339-481--------------------------------------------------------------------------------
Q8SXU5_DROME/5-142--------------------------------------------------------------------------------
A1ZBB1_DROME/5-138--------------------------------------------------------------------------------
A4IHU8_XENTR/12-143--------------------------------------------------------------------------------
E7FEQ1_DANRE/97-223--------------------------------------------------------------------------------
F1QX26_DANRE/15-145--------------------------------------------------------------------------------
F6YWA7_MACMU/6-136--------------------------------------------------------------------------------
K1QS74_CRAGI/373-496--------------------------------------------------------------------------------
LEG2_HUMAN/7-128--------------------------------------------------------------------------------
LEG10_HUMAN/11-136--------------------------------------------------------------------------------
LEG12_MOUSE/29-158--------------------------------------------------------------------------------
W5JM94_ANODA/12-140--------------------------------------------------------------------------------

PF02210

Q7PSM9_ANOGA/919-1050--------------------------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------------------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------------------------------------------------------------------------
STAN_DROME/1826-1946--------------------------------------------------------------------------------
CNTP2_HUMAN/401-529--------------------------------------------------------------------------------
G5E9F8_HUMAN/383-516--------------------------------------------------------------------------------
Q18291_CAEEL/495-627--------------------------------------------------------------------------------
F1RCV3_DANRE/1180-1305--------------------------------------------------------------------------------
B4QRF1_DROSI/2162-2289--------------------------------------------------------------------------------
B4NSJ9_DROSI/32-158--------------------------------------------------------------------------------
STAN_DROME/1584-1736--------------------------------------------------------------------------------
G3HJH2_CRIGR/1596-1721--------------------------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------------------------------------------------------------------------
NRX3A_HUMAN/55-184--------------------------------------------------------------------------------
Q8IQH0_DROME/220-342--------------------------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------------------------------------------------------------------------
NRX1A_BOVIN/58-192--------------------------------------------------------------------------------
NRX2A_RAT/57-187--------------------------------------------------------------------------------
F1QGG9_DANRE/493-622--------------------------------------------------------------------------------
Q22574_CAEEL/415-539--------------------------------------------------------------------------------
Q22574_CAEEL/136-267--------------------------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------------------------------------------------------------------------
Q18291_CAEEL/722-843--------------------------------------------------------------------------------
CRUM1_HUMAN/743-860--------------------------------------------------------------------------------
CRUM1_MOUSE/513-650--------------------------------------------------------------------------------
EGFLA_HUMAN/868-996--------------------------------------------------------------------------------
W4YVD3_STRPU/2-125--------------------------------------------------------------------------------
Q9VCZ9_DROME/1230-1355--------------------------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------------------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------------------------------------------------------------------------
GAS6_MOUSE/322-451--------------------------------------------------------------------------------
NRX2B_RAT/119-268--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------------------------------------------------------------------------
CNTP2_HUMAN/216-345--------------------------------------------------------------------------------
NRX3A_MOUSE/475-619--------------------------------------------------------------------------------
CADN2_DROME/1039-1200--------------------------------------------------------------------------------
M9NF15_DROME/1112-1240--------------------------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------------------------------------------------------------------------
NRX1A_MOUSE/753-884--------------------------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------------------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------------------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------------------------------------------------------------------------
COBA2_MOUSE/90-213--------------------------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------------------------------------------------------------------------
O45000_CAEEL/275-391--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------------------------------------------------------------------------
CNTP4_HUMAN/821-940--------------------------------------------------------------------------------
F6X197_CIOIN/150-277--------------------------------------------------------------------------------
CADN_DROME/2407-2568--------------------------------------------------------------------------------
LAMA_DROME/2704-2846--------------------------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------------------------------------------------------------------------
CADE_DROME/1153-1296--------------------------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------------------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------------------------------------------------------------------------
LAMA_DROME/3379-3514--------------------------------------------------------------------------------
LAMA_DROME/2905-3031--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------------------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------------------------------------------------------------------------
NRX2A_HUMAN/760-890--------------------------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------------------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------------------------------------------------------------------------
F1QQE4_DANRE/1171-1299--------------------------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------------------------------------------------------------------------
CELR2_RAT/869-995--------------------------------------------------------------------------------
CELR3_RAT/1534-1693--------------------------------------------------------------------------------
C3ZLC2_BRAFL/400-535--------------------------------------------------------------------------------
B4Q5I2_DROSI/631-762--------------------------------------------------------------------------------
NRX2A_RAT/949-1077--------------------------------------------------------------------------------
NRX4_DROME/824-943--------------------------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------------------------------------------------------------------------
CADN_DROME/2661-2796--------------------------------------------------------------------------------
Q9VZ96_DROME/514-640--------------------------------------------------------------------------------
CNTP5_HUMAN/209-338--------------------------------------------------------------------------------
G3UNZ8_MELGA/754-882--------------------------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------------------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------------------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------------------------------------------------------------------------
CNTP4_MOUSE/400-526--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------------------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------------------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------------------------------------------------------------------------
LAMA_DROME/3083-3205--------------------------------------------------------------------------------
Q8MPN3_DROME/3801-3930--------------------------------------------------------------------------------
Q19350_CAEEL/789-914--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------------------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------------------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------------------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------------------------------------------------------------------------
NRX3A_HUMAN/287-413--------------------------------------------------------------------------------
NRX1A_CHICK/364-508--------------------------------------------------------------------------------
EGFLA_MOUSE/641-767--------------------------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------------------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------------------------------------------------------------------------
CSPG4_HUMAN/55-178--------------------------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------------------------------------------------------------------------
Q9VZ96_DROME/698-817--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------------------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------------------------------------------------------------------------
EYS_DROME/1723-1856--------------------------------------------------------------------------------
CNTP5_HUMAN/819-938--------------------------------------------------------------------------------
CNTP1_HUMAN/813-939--------------------------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------------------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------------------------------------------------------------------------
FAT2_RAT/3802-3923--------------------------------------------------------------------------------
F7ER04_CALJA/128-246--------------------------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------------------------------------------------------------------------
CRB_DROME/1585-1722--------------------------------------------------------------------------------
CNTP5_HUMAN/395-521--------------------------------------------------------------------------------
CNTP1_RAT/1089-1219--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------------------------------------------------------------------------
E9PDN6_HUMAN/215-344--------------------------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------------------------------------------------------------------------
NRX2A_HUMAN/521-666--------------------------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------------------------------------------------------------------------
CRUM1_HUMAN/514-651--------------------------------------------------------------------------------
NRX3B_HUMAN/117-236--------------------------------------------------------------------------------
F1R9W4_DANRE/32-164--------------------------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------------------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------------------------------------------------------------------------
B1AM99_HUMAN/398-522--------------------------------------------------------------------------------
LAMA_DROME/3563-3691--------------------------------------------------------------------------------
NRX1A_CHICK/789-917--------------------------------------------------------------------------------
PROS_RABIT/485-617--------------------------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------------------------------------------------------------------------
H9H2C7_MELGA/306-434--------------------------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------------------------------------------------------------------------
CNTP1_HUMAN/203-332--------------------------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------------------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------------------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------------------------------------------------------------------------
LAMA3_MOUSE/3183-3308--------------------------------------------------------------------------------
Q9VJ82_DROME/55-178--------------------------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------------------------------------------------------------------------
Q9VJ82_DROME/238-367--------------------------------------------------------------------------------
CSPG4_HUMAN/230-363--------------------------------------------------------------------------------
Q19617_CAEEL/154-276--------------------------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------------------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------------------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------------------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------------------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------------------------------------------------------------------------
Q18291_CAEEL/906-1035--------------------------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------------------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------------------------------------------------------------------------
EYS_HUMAN/3007-3141--------------------------------------------------------------------------------
Q18291_CAEEL/303-430--------------------------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------------------------------------------------------------------------
CNTP1_MOUSE/390-516--------------------------------------------------------------------------------
A0A0G2JDY0_MOUSE/681-798--------------------------------------------------------------------------------
Q9VZ96_DROME/275-414--------------------------------------------------------------------------------
C1P641_CAEEL/3508-3630--------------------------------------------------------------------------------

PF00054

AGRIN_CHICK/1416-1546--------------------------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------------------------------------------------------------------------
AGRIN_CHICK/1933-2064--------------------------------------------------------------------------------
LAMA1_HUMAN/2920-3051--------------------------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------------------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------------------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------------------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------------------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------------------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------------------------------------------------------------------------
CSPG4_RAT/55-182--------------------------------------------------------------------------------
AGRIN_RAT/1291-1422--------------------------------------------------------------------------------
AGRIN_RAT/1559-1694--------------------------------------------------------------------------------
SHBG_RAT/76-206--------------------------------------------------------------------------------
CRB_DROME/1048-1183--------------------------------------------------------------------------------
AGRIN_RAT/1811-1942--------------------------------------------------------------------------------
SLIT_DROME/1204-1335--------------------------------------------------------------------------------
PROS_HUMAN/329-459--------------------------------------------------------------------------------
CRB_DROME/1281-1443--------------------------------------------------------------------------------
SHBG_HUMAN/75-205--------------------------------------------------------------------------------
FAT_DROME/4156-4306--------------------------------------------------------------------------------

PF00722

XTH8_ARATH/38-224--------------------------------------------------------------------------------
XTH1_ARATH/36-215--------------------------------------------------------------------------------
Q6BHG8_DEBHA/45-215--------------------------------------------------------------------------------
Q6BH77_DEBHA/56-228--------------------------------------------------------------------------------
Q6BH39_DEBHA/52-224--------------------------------------------------------------------------------
Q6BRL2_DEBHA/100-275--------------------------------------------------------------------------------
Q7CTY9_AGRFC/57-234--------------------------------------------------------------------------------
Q7CSS8_AGRFC/263-456--------------------------------------------------------------------------------
EXOK_RHIME/58-245--------------------------------------------------------------------------------
XTH2_SOYBN/32-213--------------------------------------------------------------------------------
Q6FNU8_CANGA/147-325--------------------------------------------------------------------------------
XTH10_ARATH/37-218--------------------------------------------------------------------------------
CRH2_YEAST/96-273--------------------------------------------------------------------------------
CRR1_ASHGO/155-333--------------------------------------------------------------------------------
XTH13_ARATH/26-207--------------------------------------------------------------------------------
Q7XTP9_ORYSJ/31-215--------------------------------------------------------------------------------
Q6ES26_ORYSJ/32-215--------------------------------------------------------------------------------
XTH31_ARATH/39-223--------------------------------------------------------------------------------
Q5AXN2_EMENI/49-224--------------------------------------------------------------------------------
Q6FWX2_CANGA/97-274--------------------------------------------------------------------------------
XTH33_ARATH/43-226--------------------------------------------------------------------------------
GUB_BACSU/54-238--------------------------------------------------------------------------------
Q6ZAN9_ORYSJ/28-212--------------------------------------------------------------------------------
Q7XNY6_ORYSJ/36-222--------------------------------------------------------------------------------
Q6Z2L4_ORYSJ/35-220--------------------------------------------------------------------------------
Q6RHY1_SOLLC/27-212--------------------------------------------------------------------------------
Q6CIZ6_KLULA/49-219--------------------------------------------------------------------------------
Q84T83_ORYSJ/36-221--------------------------------------------------------------------------------
Q8H7Q1_ORYSJ/3-189--------------------------------------------------------------------------------
Q8GVQ2_ORYSJ/40-224--------------------------------------------------------------------------------
Q6C4P9_YARLI/48-219--------------------------------------------------------------------------------
CRH1_YEAST/65-235--------------------------------------------------------------------------------
XTH17_ARATH/29-211--------------------------------------------------------------------------------
Q6ZAN8_ORYSJ/30-214--------------------------------------------------------------------------------
XTH2_ARATH/32-212--------------------------------------------------------------------------------
Q8GVR3_ORYSJ/46-232--------------------------------------------------------------------------------
XTH28_ARATH/31-216--------------------------------------------------------------------------------
Q7SGL2_NEUCR/50-224--------------------------------------------------------------------------------
Q5KNP5_CRYNJ/97-278--------------------------------------------------------------------------------
Q6YUP5_ORYSJ/36-221--------------------------------------------------------------------------------
Q9FZ05_SOLLC/27-209--------------------------------------------------------------------------------
Q825L5_STRAW/78-287--------------------------------------------------------------------------------
UTR2_CANAL/100-275--------------------------------------------------------------------------------
Q7S222_NEUCR/48-222--------------------------------------------------------------------------------
Q6Z998_ORYSJ/39-226--------------------------------------------------------------------------------
Q7N1F8_PHOLL/52-255--------------------------------------------------------------------------------
Q97FD3_CLOAB/57-242--------------------------------------------------------------------------------
CRR1_YEAST/147-325--------------------------------------------------------------------------------
Q7XBU8_ORYSJ/32-215--------------------------------------------------------------------------------
XTH32_ARATH/43-227--------------------------------------------------------------------------------
XTH26_ARATH/29-208--------------------------------------------------------------------------------
Q82M60_STRAW/400-624--------------------------------------------------------------------------------
Q6K9X1_ORYSJ/50-242--------------------------------------------------------------------------------
XTH21_ARATH/28-209--------------------------------------------------------------------------------
Q7S7D0_NEUCR/61-233--------------------------------------------------------------------------------
XTH25_ARATH/30-211--------------------------------------------------------------------------------
Q6FSM3_CANGA/48-218--------------------------------------------------------------------------------
Q6ES25_ORYSJ/25-208--------------------------------------------------------------------------------
Q5Z746_ORYSJ/26-208--------------------------------------------------------------------------------
CRH11_CANAL/50-220--------------------------------------------------------------------------------
Q5B4L5_EMENI/96-273--------------------------------------------------------------------------------
Q5Z6H1_ORYSJ/36-217--------------------------------------------------------------------------------
XTH24_ARATH/24-205--------------------------------------------------------------------------------
Q98C78_RHILO/80-268--------------------------------------------------------------------------------
Q7SBQ2_NEUCR/99-274--------------------------------------------------------------------------------
Q8XNF8_CLOPE/412-635--------------------------------------------------------------------------------
XTH1_SOLLC/33-214--------------------------------------------------------------------------------
Q7XTP8_ORYSJ/24-207--------------------------------------------------------------------------------
Q6CL87_KLULA/145-322--------------------------------------------------------------------------------
XTH3_ARATH/35-213--------------------------------------------------------------------------------
GUB_CLOTH/57-238--------------------------------------------------------------------------------
B9RG34_RICCO/58-238--------------------------------------------------------------------------------
C5Z8T4_SORBI/33-213--------------------------------------------------------------------------------
D3EBX7_GEOS4/64-257--------------------------------------------------------------------------------
D7SNC1_VITVI/38-220--------------------------------------------------------------------------------
E7FHE7_PYRFU/86-290--------------------------------------------------------------------------------
F2D903_HORVD/30-212--------------------------------------------------------------------------------
F2DT99_HORVD/27-208--------------------------------------------------------------------------------
F2DUU5_HORVD/27-204--------------------------------------------------------------------------------
G2XIS4_VERDV/50-220--------------------------------------------------------------------------------
G4NC59_MAGO7/98-270--------------------------------------------------------------------------------
K4DD58_SOLLC/24-203--------------------------------------------------------------------------------
M1AN43_SOLTU/24-201--------------------------------------------------------------------------------
M4EZF0_BRARP/17-194--------------------------------------------------------------------------------
Q5L861_BACFN/78-272--------------------------------------------------------------------------------
Q9WXN1_THEMA/253-454--------------------------------------------------------------------------------
T0UMT6_9STRE/50-231--------------------------------------------------------------------------------
V4IZ43_9ACTN/74-282--------------------------------------------------------------------------------
W5I2U1_WHEAT/24-204--------------------------------------------------------------------------------

PF03935

Q6BW61_DEBHA/174-674FPLHIDEKEPDDYLHNPDPLKDAAYDKNRFFYDLKNMDRRSMGGLLGVVFLIVAAVVVFILLPILTYS...GITEPYTP.
Q0UQN1_PHANO/94-573WPLIGDKDESDDEMHMP....REDDDIKYKAKLSDHFNRDSIASTIGLAIMIVGLLFIFIALPVMSFT...GAIEYNSSW
A5DEX4_PICGU/157-655FPLHIDEKEPDDYLHNPDPIADASYDKNRFMYDLKNMDRRSMGGLFGIIFLVIAVICVFILFPVLTYS...GVADHYTP.
A1C6M7_ASPCL/154-653LLLFPEDVEKDDHLHNPDP........SDREGQCDLWNRRGIINVAGLILLTLGFLILFIGYPMITAMK.GTVKSGPTCD
Q752M9_ASHGO/153-654FPLLIDEKEDDDYLHNPDPEEESRLDKQRFLLDLKHMDKRSAGGFVGILLLFIGGLMLFIVLPVLTYT...GAVEHHHA.
Q5KJ60_CRYNJ/92-619QGPIDDDDDMDDHLHTF.....TAAEKKDLSTPFNISSWRGWANALTLAVLAGGGVMLFAGYPIISFYY.GDDSSSGSNT
A0A0D1DSS3_USTMA/148-679GIASSFQDEDDDWLHDP.......KAKSTVGTAESLTSMRGLLNVGTLLLIGLCLLMLFLGYPVLIEI...RKKYADGT.
A5DZI8_LODEL/240-745FPLSIDEKEPDDYLHNPDPVKDAEYEKNRFVYDMKNLDRRSLGGLIGLIVMALGALCVFVVLPALTYS...GATEHYKP.
A0A0D1CCS8_USTMA/384-919WGDYDAESEPDDYLHEPDAEKYRNASSAK.....EMLSPRGLLNIGTLTVIGLGLILLFGGYPVISWL....SRSKASTK
A0A0D1CPF2_USTMA/197-732WDTMDGKQEPDDDLHDP.....QVLPDIKHGWFGGAVGSRGVLNVGVLALLSMALVLLFGGYPIISYF....GRRHESTK
YEPB_SCHPO/124-627LSWVYRSKEEDDDFHDP......KSSVVSLMGEEDYLGWSRFCDLFFLFVLSLGIGLLFIVFPALTFT...GNITPSKEK
YEOB_SCHPO/134-636FSLSREDKEIDDFLHYPLPAKDAK.......KLSYFVGGEGLMQLLFLLFLAAGTGMLFIGLPILTYT...GHNSLAS..
A7TTP7_VANPO/229-744FPLLFDEKEDDDFLHNPDPEEEARLYKKRFVYDLQHMSRRSIGGWLGILLLLCGGAVVFIVIPALTYT...GFVDRGDRP
A5DZ87_LODEL/332-841FPLDINDKEADDHLHNPDPIQDAKYEKNRFWYDLKNGDSRSRLGIAGFVFLLAAAIAVFVVLPSLTYT...GVTDHKAVP
Q6FUB1_CANGA/183-684FPLLMEEKEDDDYLHNPDPEEEARLDRKRFSNDFKYMDKRSAGGLAGVLFLFIGLGCLFILLPALTYT...GVTEHAKP.
A7E6J8_SCLS1/168-668LLLFPEDVEKDDYLHNPDP.......SDKDLDKCDIWNRRGLTNVGGLIFIVLGVLALFVAYPVVTFVKDKIDPTHGAC.
Q5AEC0_CANAL/212-718FPLNIDEKEPDDYLHNPDPVHDVIYEKNRFWNDLKTADRKSFGGILGFLFLIAAAVAVFVVVPALTYS...GVTTHSPP.
A3LPW0_PICST/189-695FPLHIDEKEADDYLHNPDPVVDAEYDKNRFIYDLKNMDKRSLGGLIGLIVLFIAGLCVFVVLPALTFS...NVTHHSSI.
A7EWT0_SCLS1/211-717FILYDDEIEDDDDLHMP....HDNDDRDFKPTWYEWLERRSLINAIGGVFMVIGLLCVFILLPVLTFATRVWSTGREGSG
Q5KHK4_CRYNJ/69-588WGPMTTGPEEDDWMHNPDPIKNRNYDRGT......IFTPRGLINVGCLVMLILCLVTLFAGYPIITHF....TDTEIKTN
Q0UKL9_PHANO/161-653LLLFPEDVEKDDYLHNPDP.......NEKEQRDCDIFTRRGMVNVGGLAFLALGLLALFVGYPVLTFVDKMTKPEKGPCT
A3LPU3_PICST/148-653FPLYIDEKEPDDYLHNPDPVKDAEYDKNRFVYDLKTLDKRALGGLLGVIFLLVAAICVFVVLPVLTFS...RAGVHYTP.
Q6FQ11_CANGA/223-736FPLSMDEKEDDDFLHNPDPEEEARLDKHRFSEDLKHMNKKSFGGILGVLFLFLGAIALFIILPVLTYS...GAVDHHDNN
E7LUU1_YEASV/250-763.PLTLDEKEDDDYIHNPNVEEEAKLDRRRFVDDFKHMDRRSFLGLLGILFLFMAGIFIFIVLPAITFS...GVVYHHEHV
M7NJX3_PNEMU/194-674.....NIAEPDDYLHNP........ATKEKRKDYCIFTKRGILNIGSLVILIFGIISFFIGYPILLYA...RKIYEDIH.
Q5A4H2_CANAL/99-596.PLSIDEKEPDDYLHNPDPVQDAEYDKNRFLYDLKTMDKKSMNGLIAFIVMFLIAIAIFIILPVFTYT...GYNPKAKN.

PF10287

K0KZR6_WICCF/233-464--------------------------------------------------------------------------------
I2H1W8_TETBL/107-341--------------------------------------------------------------------------------
D0N3P2_PHYIT/250-486--------------------------------------------------------------------------------
A7TFI3_VANPO/109-343--------------------------------------------------------------------------------
N1PMX9_DOTSN/238-461--------------------------------------------------------------------------------
G0VAP6_NAUCC/104-338--------------------------------------------------------------------------------
S9W8F8_SCHCR/234-466--------------------------------------------------------------------------------
C5GJ05_AJEDR/167-389--------------------------------------------------------------------------------
K3W690_PYTUL/247-486--------------------------------------------------------------------------------
I2GUP8_TETBL/154-386--------------------------------------------------------------------------------
A5DXV9_LODEL/227-457--------------------------------------------------------------------------------
C4XY08_CLAL4/110-342--------------------------------------------------------------------------------
M3A440_PSEFD/207-432--------------------------------------------------------------------------------
D0MRW8_PHYIT/313-551--------------------------------------------------------------------------------
W1QLM9_OGAPD/217-448--------------------------------------------------------------------------------
C5DKG4_LACTC/102-336--------------------------------------------------------------------------------
J7R3E5_KAZNA/106-340--------------------------------------------------------------------------------
G0VBJ0_NAUCC/237-460--------------------------------------------------------------------------------
I2H8C5_TETBL/275-505--------------------------------------------------------------------------------
Q75A62_ASHGO/259-490--------------------------------------------------------------------------------
E3RIT6_PYRTT/99-331--------------------------------------------------------------------------------
B6JWV1_SCHJY/233-464--------------------------------------------------------------------------------
A5DNR6_PICGU/97-330--------------------------------------------------------------------------------
G8Y3C3_PICSO/237-463--------------------------------------------------------------------------------
C5M9J2_CANTT/224-453--------------------------------------------------------------------------------
G3AKA2_SPAPN/103-336--------------------------------------------------------------------------------
G3ARF7_SPAPN/199-428--------------------------------------------------------------------------------
G3JJN7_CORMM/201-421--------------------------------------------------------------------------------
C7YIC0_NECH7/221-441--------------------------------------------------------------------------------
Q0UV14_PHANO/96-328--------------------------------------------------------------------------------
K0KM65_WICCF/142-376--------------------------------------------------------------------------------
G1XB81_ARTOA/196-429--------------------------------------------------------------------------------
M1W9S2_CLAP2/235-455--------------------------------------------------------------------------------
Q6FJK5_CANGA/212-435--------------------------------------------------------------------------------
R1ESJ6_BOTPV/247-467--------------------------------------------------------------------------------
D0N6Y2_PHYIT/175-409--------------------------------------------------------------------------------
C5DIE9_LACTC/221-452--------------------------------------------------------------------------------
G8BET5_CANPC/99-332--------------------------------------------------------------------------------
G8JQC7_ERECY/209-441--------------------------------------------------------------------------------
E3G0R9_STIAD/153-380--------------------------------------------------------------------------------
C4R9F6_PICPG/189-423--------------------------------------------------------------------------------
L8G239_PSED2/205-429--------------------------------------------------------------------------------
A7TMJ4_VANPO/222-451--------------------------------------------------------------------------------
C5DXY8_ZYGRC/256-484--------------------------------------------------------------------------------
G3B3K2_CANTC/207-428--------------------------------------------------------------------------------
G0W356_NAUDC/104-338--------------------------------------------------------------------------------
Q7SG43_NEUCR/112-341--------------------------------------------------------------------------------
K3WLE5_PYTUL/196-423--------------------------------------------------------------------------------
S3DKR2_GLAL2/298-524--------------------------------------------------------------------------------
F2PH39_TRIEC/193-423--------------------------------------------------------------------------------
M2N8D8_BAUCO/220-449--------------------------------------------------------------------------------
Q6BRM6_DEBHA/197-423--------------------------------------------------------------------------------
C5M5H0_CANTT/101-334--------------------------------------------------------------------------------
G8ZNQ8_TORDC/230-458--------------------------------------------------------------------------------
D5GIX3_TUBMM/208-444--------------------------------------------------------------------------------
A3LP10_PICST/207-435--------------------------------------------------------------------------------
R4XDU4_TAPDE/242-471--------------------------------------------------------------------------------
A7TGR9_VANPO/102-336--------------------------------------------------------------------------------
H3H0J0_PHYRM/316-553--------------------------------------------------------------------------------
Q757Z0_ASHGO/117-351--------------------------------------------------------------------------------
Q5AJN2_CANAL/226-456--------------------------------------------------------------------------------
M3D6U8_SPHMS/213-438--------------------------------------------------------------------------------
H3GMI5_PHYRM/341-578--------------------------------------------------------------------------------
I2H9Q2_TETBL/105-339--------------------------------------------------------------------------------
G8ZYU9_TORDC/104-337--------------------------------------------------------------------------------
S0DQ79_GIBF5/217-437--------------------------------------------------------------------------------
M4BGZ3_HYAAE/337-572--------------------------------------------------------------------------------
F9XBT5_ZYMTI/245-464--------------------------------------------------------------------------------
G8BXS9_TETPH/170-397--------------------------------------------------------------------------------
H2AXG7_KAZAF/104-337--------------------------------------------------------------------------------
U4LN65_PYROM/147-371--------------------------------------------------------------------------------
J7RTK3_KAZNA/245-466--------------------------------------------------------------------------------
C5FXD0_ARTOC/196-427--------------------------------------------------------------------------------
Q6CGN1_YARLI/220-451--------------------------------------------------------------------------------
G2WT64_VERDV/218-439--------------------------------------------------------------------------------
Q6FJ92_CANGA/109-343--------------------------------------------------------------------------------
G4U9Y4_NEUT9/21-245--------------------------------------------------------------------------------
E4ZV72_LEPMJ/267-498--------------------------------------------------------------------------------
G8BU49_TETPH/100-334--------------------------------------------------------------------------------
W1QLK8_OGAPD/133-365--------------------------------------------------------------------------------
G8JX30_ERECY/121-347--------------------------------------------------------------------------------
Q6CXP7_KLULA/106-342--------------------------------------------------------------------------------
C4JID9_UNCRE/192-415--------------------------------------------------------------------------------
Q6CVS7_KLULA/216-447--------------------------------------------------------------------------------
H2AXG9_KAZAF/107-341--------------------------------------------------------------------------------
A7TQU3_VANPO/143-371--------------------------------------------------------------------------------
K3XBG2_PYTUL/358-594--------------------------------------------------------------------------------
M7SLD2_EUTLA/204-432--------------------------------------------------------------------------------
R7YJQ9_CONA1/229-450--------------------------------------------------------------------------------
H6BRJ0_EXODN/215-434--------------------------------------------------------------------------------
K3X9Z2_PYTUL/110-344--------------------------------------------------------------------------------
L2FRA0_COLGN/221-441--------------------------------------------------------------------------------
Q7SG41_NEUCR/178-394--------------------------------------------------------------------------------
A5DBA4_PICGU/200-428--------------------------------------------------------------------------------
K2RHU7_MACPH/245-465--------------------------------------------------------------------------------
Q7SG42_NEUCR/163-390--------------------------------------------------------------------------------
YH6B_SCHPO/264-495--------------------------------------------------------------------------------
J8Q0R9_SACAR/105-339--------------------------------------------------------------------------------
K1XZI2_MARBU/332-545--------------------------------------------------------------------------------
F0UMR1_AJEC8/199-421--------------------------------------------------------------------------------
I2H2C5_TETBL/110-343--------------------------------------------------------------------------------
E9EMJ7_METRA/226-457--------------------------------------------------------------------------------
G3AYC4_CANTC/101-337--------------------------------------------------------------------------------
H2AVQ7_KAZAF/220-440--------------------------------------------------------------------------------
E4UXS3_ARTGP/195-422--------------------------------------------------------------------------------
U1HUX4_ENDPU/201-424--------------------------------------------------------------------------------
A7F2W5_SCLS1/255-477--------------------------------------------------------------------------------
C4R2B9_PICPG/119-353--------------------------------------------------------------------------------
F2SIK0_TRIRC/197-428--------------------------------------------------------------------------------
C4Y1A3_CLAL4/229-457--------------------------------------------------------------------------------

PF00840

K1WCU0_MARBU/20-452--------------------------------------------------------------------------------
G3XZK9_ASPNA/20-448--------------------------------------------------------------------------------
F4PY37_DICFS/22-455--------------------------------------------------------------------------------
G1XV93_ARTOA/22-459--------------------------------------------------------------------------------
L8WSW0_THACA/22-455--------------------------------------------------------------------------------
G2QZA7_THITE/22-417--------------------------------------------------------------------------------
E4ZFU3_LEPMJ/20-452--------------------------------------------------------------------------------
M2UA27_COCH5/21-452--------------------------------------------------------------------------------
E3L6D5_PUCGT/29-447--------------------------------------------------------------------------------
S3D4J2_GLAL2/21-452--------------------------------------------------------------------------------
I1FU52_AMPQE/20-456--------------------------------------------------------------------------------
B6QIG2_PENMQ/28-458--------------------------------------------------------------------------------
G2WXB9_VERDV/20-447--------------------------------------------------------------------------------
Q7S390_NEUCR/20-440--------------------------------------------------------------------------------
V2WZE7_MONRO/22-456--------------------------------------------------------------------------------
A7EUL3_SCLS1/19-449--------------------------------------------------------------------------------
S3CP84_GLAL2/21-459--------------------------------------------------------------------------------
N4UZJ1_COLOR/19-440--------------------------------------------------------------------------------
G7XKW4_ASPKW/24-460--------------------------------------------------------------------------------
F7W7F9_SORMK/30-440--------------------------------------------------------------------------------
G2YS63_BOTF4/20-452--------------------------------------------------------------------------------
E3K8B1_PUCGT/22-457--------------------------------------------------------------------------------
Q55FE6_DICDI/22-455--------------------------------------------------------------------------------
M2N728_BAUCO/20-450--------------------------------------------------------------------------------
R8BSD2_TOGMI/20-444--------------------------------------------------------------------------------
G2Q359_THIHA/20-453--------------------------------------------------------------------------------
G4V088_NEUT9/21-421--------------------------------------------------------------------------------
B2AQ71_PODAN/25-431--------------------------------------------------------------------------------
S7ZRD6_PENO1/28-461--------------------------------------------------------------------------------
CBHB_ASPFU/29-463--------------------------------------------------------------------------------
U4LWF8_PYROM/21-452--------------------------------------------------------------------------------
F7W4B0_SORMK/24-424--------------------------------------------------------------------------------
G2WQW0_VERDV/20-447--------------------------------------------------------------------------------
B2A8V6_PODAN/19-451--------------------------------------------------------------------------------
R8BMF8_TOGMI/19-453--------------------------------------------------------------------------------
L2FC27_COLGN/19-441--------------------------------------------------------------------------------
H1W5V0_COLHI/19-443--------------------------------------------------------------------------------
A0A0C4ECL7_MAGP6/30-424--------------------------------------------------------------------------------
M2QWB1_CERS8/85-519--------------------------------------------------------------------------------
D8QBJ3_SCHCM/21-453--------------------------------------------------------------------------------
E3KSU8_PUCGT/22-454--------------------------------------------------------------------------------
U4L139_PYROM/20-454--------------------------------------------------------------------------------
S3CAD2_OPHP1/20-451--------------------------------------------------------------------------------
G0S477_CHATD/21-451--------------------------------------------------------------------------------
C7ZHP8_NECH7/23-415--------------------------------------------------------------------------------
R0K7Q4_SETT2/24-451--------------------------------------------------------------------------------
M4BUX1_HYAAE/30-470--------------------------------------------------------------------------------
G2WZP1_VERDV/20-456--------------------------------------------------------------------------------
N4UQR7_COLOR/21-445--------------------------------------------------------------------------------
U7Q8V8_SPOS1/21-424--------------------------------------------------------------------------------
A0A0C4EX39_PUCT1/27-447--------------------------------------------------------------------------------
A0A0C4E9V9_MAGP6/27-444--------------------------------------------------------------------------------
B6HC69_PENCW/20-452--------------------------------------------------------------------------------
Q2GUM4_CHAGB/23-447--------------------------------------------------------------------------------
U7PKV6_SPOS1/26-451--------------------------------------------------------------------------------
K1WM38_MARBU/21-461--------------------------------------------------------------------------------
G0RVK1_HYPJQ/20-446--------------------------------------------------------------------------------
H3G8U1_PHYRM/34-471--------------------------------------------------------------------------------
M7SVI4_EUTLA/21-454--------------------------------------------------------------------------------
A0A0C4DNY4_MAGP6/20-447--------------------------------------------------------------------------------
R8BQZ2_TOGMI/20-451--------------------------------------------------------------------------------
S3D235_GLAL2/20-454--------------------------------------------------------------------------------
F0XKB1_GROCL/20-444--------------------------------------------------------------------------------
C7YH34_NECH7/20-451--------------------------------------------------------------------------------
F9FPS1_FUSOF/20-451--------------------------------------------------------------------------------
CBHA_EMENI/20-446--------------------------------------------------------------------------------
F4RKA2_MELLP/26-456--------------------------------------------------------------------------------
A0A0C4EZJ7_PUCT1/22-425--------------------------------------------------------------------------------
G4N143_MAGO7/22-445--------------------------------------------------------------------------------
E3JU73_PUCGT/29-437--------------------------------------------------------------------------------
L8WJB0_THACA/84-513--------------------------------------------------------------------------------
M7TJ66_BOTF1/21-446--------------------------------------------------------------------------------
F4S1M9_MELLP/23-458--------------------------------------------------------------------------------
M5BZ75_THACB/20-450--------------------------------------------------------------------------------
CELB_ASPFN/20-414--------------------------------------------------------------------------------
K5WYE3_AGABU/21-450--------------------------------------------------------------------------------
F4RTE7_MELLP/22-447--------------------------------------------------------------------------------
N1PY93_DOTSN/21-450--------------------------------------------------------------------------------
F0ZJZ1_DICPU/21-454--------------------------------------------------------------------------------
G4NI68_MAGO7/22-416--------------------------------------------------------------------------------
H1VQX8_COLHI/20-456--------------------------------------------------------------------------------
M2SZK0_COCSN/20-452--------------------------------------------------------------------------------
D0N841_PHYIT/25-462--------------------------------------------------------------------------------
A8NU36_COPC7/21-457--------------------------------------------------------------------------------
L2FY65_COLGN/20-452--------------------------------------------------------------------------------
G4MMG0_MAGO7/20-450--------------------------------------------------------------------------------
A0A016PHW6_GIBZA/22-419--------------------------------------------------------------------------------
H3GA97_PHYRM/27-460--------------------------------------------------------------------------------
M3ARV6_PSEFD/20-450--------------------------------------------------------------------------------
S8A7U8_DACHA/23-453--------------------------------------------------------------------------------
F4RKA1_MELLP/25-454--------------------------------------------------------------------------------
R1GZN3_BOTPV/19-452--------------------------------------------------------------------------------
S3DFW5_GLAL2/20-452--------------------------------------------------------------------------------
G4TMW4_PIRID/20-450--------------------------------------------------------------------------------
CBHA_ASPFU/20-450--------------------------------------------------------------------------------
U7Q430_SPOS1/20-452--------------------------------------------------------------------------------
E9G5J5_DAPPU/22-463--------------------------------------------------------------------------------
F4S1M8_MELLP/21-456--------------------------------------------------------------------------------
F4S1N8_MELLP/22-461--------------------------------------------------------------------------------
S7ZJL3_PENO1/20-451--------------------------------------------------------------------------------
K5ULV7_PHACS/21-445--------------------------------------------------------------------------------
N4V9B4_COLOR/24-453--------------------------------------------------------------------------------
G2QNN8_THIHA/23-447--------------------------------------------------------------------------------
R1EEG3_BOTPV/22-455--------------------------------------------------------------------------------
M4BJM4_HYAAE/27-464--------------------------------------------------------------------------------
E3K8C2_PUCGT/23-457--------------------------------------------------------------------------------
K3X3U7_PYTUL/24-462--------------------------------------------------------------------------------
F9XAF9_ZYMTI/21-444--------------------------------------------------------------------------------
L2FAS8_COLGN/19-444--------------------------------------------------------------------------------
K5WIZ5_PHACS/21-445--------------------------------------------------------------------------------
S8AFI7_DACHA/25-419--------------------------------------------------------------------------------
E3QH29_COLGM/20-451--------------------------------------------------------------------------------
M1WAR4_CLAP2/22-453--------------------------------------------------------------------------------
B2ACE0_PODAN/21-453--------------------------------------------------------------------------------
H3G7U3_PHYRM/13-452--------------------------------------------------------------------------------
G4NIA4_MAGO7/20-446--------------------------------------------------------------------------------
G4ULV4_NEUT9/157-586--------------------------------------------------------------------------------
F9FY42_FUSOF/22-415--------------------------------------------------------------------------------
B2ASX1_PODAN/25-450--------------------------------------------------------------------------------
C7ZHU8_NECH7/20-451--------------------------------------------------------------------------------
D8PLS5_SCHCM/21-454--------------------------------------------------------------------------------
S8AA61_DACHA/19-434--------------------------------------------------------------------------------
CBHB_EMENI/26-460--------------------------------------------------------------------------------
N4V9A4_COLOR/19-434--------------------------------------------------------------------------------
B8NIG8_ASPFN/28-463--------------------------------------------------------------------------------
G1XLC3_ARTOA/25-418--------------------------------------------------------------------------------
CELB_EMENI/21-427--------------------------------------------------------------------------------
G2QZD9_THITE/20-450--------------------------------------------------------------------------------
G0RYS9_CHATD/25-449--------------------------------------------------------------------------------

PF00139

I1J0Z7_BRADI/24-270--------------------------------------------------------------------------------
M0UWM0_HORVD/54-310--------------------------------------------------------------------------------
K3YQI1_SETIT/31-293--------------------------------------------------------------------------------
D7MX72_ARALL/27-278--------------------------------------------------------------------------------
I1QF95_ORYGL/9-257--------------------------------------------------------------------------------
B9SDJ5_RICCO/21-269--------------------------------------------------------------------------------
M4EIG5_BRARP/19-266--------------------------------------------------------------------------------
I1KL69_SOYBN/32-282--------------------------------------------------------------------------------
I1GT36_BRADI/22-278--------------------------------------------------------------------------------
M4DR71_BRARP/23-281--------------------------------------------------------------------------------
K7UKG6_MAIZE/22-274--------------------------------------------------------------------------------
C5Z960_SORBI/22-274--------------------------------------------------------------------------------
J3MID1_ORYBR/697-950--------------------------------------------------------------------------------
C5YGS5_SORBI/740-993--------------------------------------------------------------------------------
F6HBM8_VITVI/38-285--------------------------------------------------------------------------------
M0ZZ78_SOLTU/22-275--------------------------------------------------------------------------------
J3MID6_ORYBR/47-299--------------------------------------------------------------------------------
I1KL68_SOYBN/57-300--------------------------------------------------------------------------------
B9S3F5_RICCO/21-271--------------------------------------------------------------------------------
B9SXJ7_RICCO/26-271--------------------------------------------------------------------------------
M0VXQ0_HORVD/20-275--------------------------------------------------------------------------------
I1GT33_BRADI/25-286--------------------------------------------------------------------------------
B9SXJ9_RICCO/25-271--------------------------------------------------------------------------------
M7ZXG6_TRIUA/26-279--------------------------------------------------------------------------------
B9SDJ4_RICCO/29-277--------------------------------------------------------------------------------
B9RKX4_RICCO/32-295--------------------------------------------------------------------------------
J3MID3_ORYBR/25-284--------------------------------------------------------------------------------
A9STE4_PHYPA/28-284--------------------------------------------------------------------------------
K7LD59_SOYBN/26-276--------------------------------------------------------------------------------
F6HW43_VITVI/37-287--------------------------------------------------------------------------------
B9SPG3_RICCO/28-274--------------------------------------------------------------------------------
I1I8J5_BRADI/41-316--------------------------------------------------------------------------------
C5WQT3_SORBI/3-256--------------------------------------------------------------------------------
M7Z7K8_TRIUA/24-276--------------------------------------------------------------------------------
M7Z873_TRIUA/26-278--------------------------------------------------------------------------------
I1Q9S6_ORYGL/27-278--------------------------------------------------------------------------------
B9RX67_RICCO/38-289--------------------------------------------------------------------------------
Q7XZX1_ORYSJ/59-312--------------------------------------------------------------------------------
I1H3V1_BRADI/27-275--------------------------------------------------------------------------------
C5YTD3_SORBI/42-297--------------------------------------------------------------------------------
C5WZ65_SORBI/40-297--------------------------------------------------------------------------------
F6HWD4_VITVI/48-292--------------------------------------------------------------------------------
M4C9K1_BRARP/30-282--------------------------------------------------------------------------------
D7L7Q8_ARALL/26-272--------------------------------------------------------------------------------
I1LMH1_SOYBN/27-284--------------------------------------------------------------------------------
I1Q7T2_ORYGL/56-310--------------------------------------------------------------------------------
K7UIK5_MAIZE/47-318--------------------------------------------------------------------------------
B9S3F7_RICCO/27-283--------------------------------------------------------------------------------
Q6Z8M4_ORYSJ/40-308--------------------------------------------------------------------------------
M4F2M7_BRARP/21-273--------------------------------------------------------------------------------
M0Y8Y9_HORVD/24-281--------------------------------------------------------------------------------
B9RX81_RICCO/37-286--------------------------------------------------------------------------------
Q7XUC7_ORYSJ/28-274--------------------------------------------------------------------------------
Q6K8L8_ORYSJ/26-289--------------------------------------------------------------------------------
I1L3I1_SOYBN/35-302--------------------------------------------------------------------------------
M4EJC2_BRARP/29-277--------------------------------------------------------------------------------
F6HWD7_VITVI/37-289--------------------------------------------------------------------------------
F6HW36_VITVI/35-286--------------------------------------------------------------------------------
M1DPR0_SOLTU/22-264--------------------------------------------------------------------------------
K4D2U1_SOLLC/29-283--------------------------------------------------------------------------------
I1H2L8_BRADI/27-276--------------------------------------------------------------------------------
C5XCD6_SORBI/32-291--------------------------------------------------------------------------------
K3Y5L7_SETIT/33-273--------------------------------------------------------------------------------
M1BJQ2_SOLTU/21-281--------------------------------------------------------------------------------
I1LM84_SOYBN/28-267--------------------------------------------------------------------------------
M4CN93_BRARP/29-292--------------------------------------------------------------------------------
Q8H4J3_ORYSJ/28-282--------------------------------------------------------------------------------
B9RX64_RICCO/27-280--------------------------------------------------------------------------------
J3MPZ5_ORYBR/33-302--------------------------------------------------------------------------------
Q84ZH8_ORYSJ/24-276--------------------------------------------------------------------------------
M0YJP2_HORVD/48-317--------------------------------------------------------------------------------
K3Y3M9_SETIT/30-282--------------------------------------------------------------------------------
F6HL81_VITVI/33-286--------------------------------------------------------------------------------
LRK61_ARATH/33-294--------------------------------------------------------------------------------
B9T8H0_RICCO/20-272--------------------------------------------------------------------------------
M1AHJ3_SOLTU/28-281--------------------------------------------------------------------------------
M7YY54_TRIUA/30-272--------------------------------------------------------------------------------
M4CLT1_BRARP/22-275--------------------------------------------------------------------------------
B9SML1_RICCO/44-289--------------------------------------------------------------------------------
M4DP68_BRARP/19-264--------------------------------------------------------------------------------
Q0D8S6_ORYSJ/77-329--------------------------------------------------------------------------------
M8A5Y7_TRIUA/53-300--------------------------------------------------------------------------------
C5Z959_SORBI/30-282--------------------------------------------------------------------------------
LRKS1_ARATH/29-288--------------------------------------------------------------------------------
M4ESL4_BRARP/22-290--------------------------------------------------------------------------------
B9SKY8_RICCO/25-281--------------------------------------------------------------------------------
M4FFA7_BRARP/24-263--------------------------------------------------------------------------------
J3LWI6_ORYBR/44-294--------------------------------------------------------------------------------
K7L999_SOYBN/59-308--------------------------------------------------------------------------------
M7YCL0_TRIUA/32-284--------------------------------------------------------------------------------
D7MR66_ARALL/26-282--------------------------------------------------------------------------------
J3MPZ8_ORYBR/32-293--------------------------------------------------------------------------------
F6GUY7_VITVI/27-280--------------------------------------------------------------------------------
B9HG10_POPTR/32-282--------------------------------------------------------------------------------
B9GZH8_POPTR/30-270--------------------------------------------------------------------------------
B9HCZ3_POPTR/23-280--------------------------------------------------------------------------------
I1JFJ9_SOYBN/45-285--------------------------------------------------------------------------------
I1MX65_SOYBN/42-290--------------------------------------------------------------------------------
M7Y9L8_TRIUA/34-283--------------------------------------------------------------------------------
Q652V6_ORYSJ/38-298--------------------------------------------------------------------------------
Q6ZFB7_ORYSJ/37-281--------------------------------------------------------------------------------
Q6ZIQ8_ORYSJ/39-305--------------------------------------------------------------------------------
Q6ZLL9_ORYSJ/30-291--------------------------------------------------------------------------------
Q7XUN6_ORYSJ/30-280--------------------------------------------------------------------------------
Q84ZI0_ORYSJ/31-304--------------------------------------------------------------------------------
U5G5V7_POPTR/26-278--------------------------------------------------------------------------------
W5AMW1_WHEAT/26-276--------------------------------------------------------------------------------
W5AND9_WHEAT/35-289--------------------------------------------------------------------------------
W5GWA8_WHEAT/27-281--------------------------------------------------------------------------------

PF03388

YQF8_SCHPO/24-250--------------------------------------------------------------------------------
YOC5_SCHPO/23-229--------------------------------------------------------------------------------
EMP47_YEAST/36-253--------------------------------------------------------------------------------
LMAN1_HUMAN/44-269--------------------------------------------------------------------------------
Q9V3A8_DROME/33-259--------------------------------------------------------------------------------
Q9VCC2_DROME/33-258--------------------------------------------------------------------------------
LMAN2_CANFA/52-278--------------------------------------------------------------------------------
Q22170_CAEEL/43-272--------------------------------------------------------------------------------

PF00457

U5MR46_CLOSA/70-253--------------------------------------------------------------------------------
XYNB_ASPFU/42-219--------------------------------------------------------------------------------
XYN3_MAGO7/54-234--------------------------------------------------------------------------------
F8DB45_HALXS/87-262--------------------------------------------------------------------------------
F9XDM7_ZYMTI/45-223--------------------------------------------------------------------------------
M2QR82_CERS8/44-221--------------------------------------------------------------------------------
G7XIG9_ASPKW/42-219--------------------------------------------------------------------------------
A9G323_SORC5/221-397--------------------------------------------------------------------------------
G2QUC8_THITE/35-208--------------------------------------------------------------------------------
E3Q8W7_COLGM/43-217--------------------------------------------------------------------------------
A7EQZ6_SCLS1/49-220--------------------------------------------------------------------------------
K0J5P9_AMPXN/62-246--------------------------------------------------------------------------------
G4TKV8_PIRID/43-220--------------------------------------------------------------------------------
S8ATR1_PENO1/29-208--------------------------------------------------------------------------------
T0MBU2_COLGC/37-214--------------------------------------------------------------------------------
Q2UFR7_ASPOR/71-245--------------------------------------------------------------------------------
F7PGE0_9EURY/60-235--------------------------------------------------------------------------------
M9LS78_PSEA3/38-220--------------------------------------------------------------------------------
G1X5P3_ARTOA/57-231--------------------------------------------------------------------------------
E6UKJ6_RUMA7/55-250--------------------------------------------------------------------------------
G2XS85_BOTF4/46-225--------------------------------------------------------------------------------
C7Q365_CATAD/61-236--------------------------------------------------------------------------------
S7ZJ07_PENO1/39-216--------------------------------------------------------------------------------
E3QVD0_COLGM/44-216--------------------------------------------------------------------------------
G2X5X8_VERDV/37-215--------------------------------------------------------------------------------
C6WIK2_ACTMD/54-231--------------------------------------------------------------------------------
B1ZMX2_OPITP/39-216--------------------------------------------------------------------------------
A9EQP3_SORC5/210-404--------------------------------------------------------------------------------
F4H710_CELFA/52-228--------------------------------------------------------------------------------
S3E0R3_GLAL2/19-199--------------------------------------------------------------------------------
R0K9J6_SETT2/42-213--------------------------------------------------------------------------------
M7TVV3_BOTF1/41-218--------------------------------------------------------------------------------
T0KW32_COLGC/75-251--------------------------------------------------------------------------------
G0S9X3_CHATD/56-233--------------------------------------------------------------------------------
K5X1T9_AGABU/46-223--------------------------------------------------------------------------------
S3DEM3_GLAL2/50-221--------------------------------------------------------------------------------
B8M5E1_TALSN/53-227--------------------------------------------------------------------------------
V5FWP5_BYSSN/38-215--------------------------------------------------------------------------------
D9SP57_CLOC7/41-225--------------------------------------------------------------------------------
A8P4P6_COPC7/104-288--------------------------------------------------------------------------------
Q0UI10_PHANO/28-204--------------------------------------------------------------------------------
Q47QL8_THEFY/52-227--------------------------------------------------------------------------------
G2QWT6_THITE/50-225--------------------------------------------------------------------------------
R6YEV7_9FIRM/39-222--------------------------------------------------------------------------------
Q21G61_SACD2/43-220--------------------------------------------------------------------------------
F7W2U2_SORMK/27-207--------------------------------------------------------------------------------
R4LPY0_9ACTN/53-232--------------------------------------------------------------------------------
XYNB_ASPFN/42-219--------------------------------------------------------------------------------
C9RK54_FIBSS/46-247--------------------------------------------------------------------------------
XYNC_STRCO/61-238--------------------------------------------------------------------------------
S7ZVQ9_PENO1/51-226--------------------------------------------------------------------------------
G4UC47_NEUT9/40-217--------------------------------------------------------------------------------
E3QHP2_COLGM/50-227--------------------------------------------------------------------------------
M1W9A1_CLAP2/39-214--------------------------------------------------------------------------------
A8NZY3_COPC7/34-216--------------------------------------------------------------------------------
G2Q4M3_THIHA/47-221--------------------------------------------------------------------------------
A8NW94_COPC7/49-232--------------------------------------------------------------------------------
E3S3R6_PYRTT/42-215--------------------------------------------------------------------------------
G4TKT5_PIRID/54-231--------------------------------------------------------------------------------
Q2HCI0_CHAGB/40-217--------------------------------------------------------------------------------
I3VTR8_THESW/29-209--------------------------------------------------------------------------------
B3PIN1_CELJU/38-224--------------------------------------------------------------------------------
K5WVZ1_PHACS/44-221--------------------------------------------------------------------------------
G0SAF9_CHATD/37-199--------------------------------------------------------------------------------
G4TKT3_PIRID/54-231--------------------------------------------------------------------------------
S8AJR6_DACHA/43-221--------------------------------------------------------------------------------
M1LSN7_9CLOT/30-211--------------------------------------------------------------------------------
F0XC21_GROCL/46-221--------------------------------------------------------------------------------
A0A0C4EAA2_MAGP6/41-223--------------------------------------------------------------------------------
B2A9I4_PODAN/43-221--------------------------------------------------------------------------------
G2X4G1_VERDV/41-216--------------------------------------------------------------------------------
B8MND2_TALSN/59-232--------------------------------------------------------------------------------
A9GHF8_SORC5/306-501--------------------------------------------------------------------------------
E5A0Q4_LEPMJ/78-250--------------------------------------------------------------------------------
G4U378_PIRID/48-223--------------------------------------------------------------------------------
C9RLL3_FIBSS/44-238--------------------------------------------------------------------------------
B2WG17_PYRTR/46-223--------------------------------------------------------------------------------
XYNA_BACSU/29-211--------------------------------------------------------------------------------
XYNA_EMENI/46-223--------------------------------------------------------------------------------
XYN3_ASPKW/29-208--------------------------------------------------------------------------------
E6UBP6_RUMA7/65-254--------------------------------------------------------------------------------
C7YSL3_NECH7/42-220--------------------------------------------------------------------------------
N1PCA4_DOTSN/49-227--------------------------------------------------------------------------------
G0R947_HYPJQ/52-226--------------------------------------------------------------------------------
G2Q913_THIHA/39-217--------------------------------------------------------------------------------
B2B3J5_PODAN/53-231--------------------------------------------------------------------------------
Q9KEF3_BACHD/29-208--------------------------------------------------------------------------------
Q2GN95_CHAGB/35-214--------------------------------------------------------------------------------
A9EUR0_SORC5/153-329--------------------------------------------------------------------------------
S8AS02_DACHA/46-242--------------------------------------------------------------------------------
U7Q3B8_SPOS1/53-234--------------------------------------------------------------------------------
J3NW75_GAGT3/48-227--------------------------------------------------------------------------------
G4TKT1_PIRID/54-222--------------------------------------------------------------------------------
A0A0D1E285_USTMA/36-218--------------------------------------------------------------------------------
M7SU57_EUTLA/19-190--------------------------------------------------------------------------------
B6QV47_PENMQ/55-228--------------------------------------------------------------------------------
M3CYK1_SPHMS/48-225--------------------------------------------------------------------------------
K1X7K7_MARBU/40-238--------------------------------------------------------------------------------
G2NBA0_STREK/53-228--------------------------------------------------------------------------------
U7PQP8_SPOS1/44-215--------------------------------------------------------------------------------
G0RUP7_HYPJQ/43-221--------------------------------------------------------------------------------
G8LXE2_CLOCD/39-223--------------------------------------------------------------------------------
T0L8D6_COLGC/39-215--------------------------------------------------------------------------------
G2QV82_THITE/46-224--------------------------------------------------------------------------------
Q2H5I3_CHAGB/51-228--------------------------------------------------------------------------------
XYN4_MAGO7/51-228--------------------------------------------------------------------------------
G8LXE2_CLOCD/424-608--------------------------------------------------------------------------------
K1WWU0_MARBU/46-224--------------------------------------------------------------------------------
C7PX63_CATAD/51-229--------------------------------------------------------------------------------
S8AMN0_PENO1/42-221--------------------------------------------------------------------------------
F4FB94_VERMA/40-218--------------------------------------------------------------------------------
E3S9S5_PYRTT/49-227--------------------------------------------------------------------------------
B8NYB7_ASPFN/69-243--------------------------------------------------------------------------------
J3NLQ4_GAGT3/38-211--------------------------------------------------------------------------------
L7VQD8_CLOSH/42-225--------------------------------------------------------------------------------
L0EBB6_THECK/28-208--------------------------------------------------------------------------------
A8FE31_BACP2/38-219--------------------------------------------------------------------------------
G4U379_PIRID/50-216--------------------------------------------------------------------------------
E3Q964_COLGM/44-223--------------------------------------------------------------------------------
C5BU21_TERTT/52-237--------------------------------------------------------------------------------
B8I7X1_CLOCE/38-221--------------------------------------------------------------------------------
A8NKZ6_COPC7/44-228--------------------------------------------------------------------------------
Q11SH7_CYTH3/43-226--------------------------------------------------------------------------------
B8I371_CLOCE/30-210--------------------------------------------------------------------------------
I2FN07_USTH4/36-218--------------------------------------------------------------------------------
G4TKT4_PIRID/54-231--------------------------------------------------------------------------------
C9Z2V1_STRSW/53-229--------------------------------------------------------------------------------
S8AP92_PENO1/40-211--------------------------------------------------------------------------------
T0K1I6_COLGC/42-222--------------------------------------------------------------------------------
C7ZN05_NECH7/1-172--------------------------------------------------------------------------------
XYNC_FIBSS/52-240--------------------------------------------------------------------------------
G1X9B1_ARTOA/43-221--------------------------------------------------------------------------------
A9GEL6_SORC5/142-318--------------------------------------------------------------------------------
K2RN85_MACPH/42-220--------------------------------------------------------------------------------
R4LM27_9ACTN/54-231--------------------------------------------------------------------------------
D5UGI1_CELFN/51-229--------------------------------------------------------------------------------
Q2HI25_CHAGB/36-208--------------------------------------------------------------------------------
XYNC_FIBSS/327-512--------------------------------------------------------------------------------
G4N696_MAGO7/47-225--------------------------------------------------------------------------------
G8SKM4_ACTS5/52-226--------------------------------------------------------------------------------
M2TBN8_COCH5/42-219--------------------------------------------------------------------------------
N1PGQ5_DOTSN/47-227--------------------------------------------------------------------------------
Q7ZA57_GIBZA/50-227--------------------------------------------------------------------------------
B2WK18_PYRTR/41-214--------------------------------------------------------------------------------
S8AF15_DACHA/44-214--------------------------------------------------------------------------------
C5BMU2_TERTT/37-214--------------------------------------------------------------------------------
B6QNP6_PENMQ/54-227--------------------------------------------------------------------------------
U7PKR6_SPOS1/52-230--------------------------------------------------------------------------------
G3XY88_ASPNA/57-232--------------------------------------------------------------------------------
G9NQ12_HYPAI/48-222--------------------------------------------------------------------------------
F7W777_SORMK/45-222--------------------------------------------------------------------------------
Q0UBJ9_PHANO/41-216--------------------------------------------------------------------------------
T0JLP7_COLGC/68-241--------------------------------------------------------------------------------
D8PN69_SCHCM/41-226--------------------------------------------------------------------------------
C7ZC92_NECH7/39-216--------------------------------------------------------------------------------
B8E1P4_DICTD/41-222--------------------------------------------------------------------------------
D1BXH1_XYLCX/54-230--------------------------------------------------------------------------------
F0S4T0_PSESL/87-269--------------------------------------------------------------------------------
G9MV13_HYPVG/54-228--------------------------------------------------------------------------------
Q2HCI7_CHAGB/53-216--------------------------------------------------------------------------------
L0E9J8_THECK/24-202--------------------------------------------------------------------------------
E4N0N4_KITSK/54-229--------------------------------------------------------------------------------
J3PC50_GAGT3/50-229--------------------------------------------------------------------------------
Q0CMZ1_ASPTN/41-218--------------------------------------------------------------------------------
S3D920_GLAL2/48-226--------------------------------------------------------------------------------
E6X8Q5_CELAD/57-241--------------------------------------------------------------------------------
F9F5R3_FUSOF/43-220--------------------------------------------------------------------------------
XYNB_ASPCL/42-219--------------------------------------------------------------------------------
G2Q4S6_THIHA/47-224--------------------------------------------------------------------------------
Q0UBV5_PHANO/22-194--------------------------------------------------------------------------------
G2X8M4_VERDV/40-224--------------------------------------------------------------------------------
H1YIW2_9SPHI/65-249--------------------------------------------------------------------------------
M7STD0_EUTLA/43-222--------------------------------------------------------------------------------
D4LFB0_RUMC1/42-232--------------------------------------------------------------------------------

PF01670

GUNA_ASPKW/28-239--------------------------------------------------------------------------------
G0RRG8_HYPJQ/29-234--------------------------------------------------------------------------------
Q2UFR8_ASPOR/29-239--------------------------------------------------------------------------------
Q9RJY3_STRCO/54-261--------------------------------------------------------------------------------
Q9S5X8_THEMA/18-255--------------------------------------------------------------------------------

PF07675

Q7MUZ4_PORGI/41-208--------------------------------------------------------------------------------
HAGA1_PORGI/230-407--------------------------------------------------------------------------------
F5HGU5_PORGI/47-200--------------------------------------------------------------------------------
Q7MTE2_PORGI/1142-1311--------------------------------------------------------------------------------

PF00629

H3CJZ0_TETNG/591-747--------------------------------------------------------------------------------
F6ZQ08_XENTR/641-801--------------------------------------------------------------------------------
MAMC2_HUMAN/509-665--------------------------------------------------------------------------------
F1Q7F6_DANRE/345-500--------------------------------------------------------------------------------
Q28WN9_DROPS/509-694--------------------------------------------------------------------------------
F6TDH8_CIOIN/81-235--------------------------------------------------------------------------------
F1QL06_DANRE/266-425--------------------------------------------------------------------------------
L9KUF8_TUPCH/628-792--------------------------------------------------------------------------------
AEGP_MOUSE/979-1143--------------------------------------------------------------------------------
F1R3K1_DANRE/3-160--------------------------------------------------------------------------------
Q17E33_AEDAE/237-420--------------------------------------------------------------------------------
PTPRU_HUMAN/27-187--------------------------------------------------------------------------------
MEP1B_RAT/266-429--------------------------------------------------------------------------------
MAMC2_HUMAN/170-328--------------------------------------------------------------------------------
AEGP_HUMAN/813-968--------------------------------------------------------------------------------
H3DMT5_TETNG/350-507--------------------------------------------------------------------------------
AEGP_MOUSE/661-814--------------------------------------------------------------------------------
F6RM13_MACMU/211-367--------------------------------------------------------------------------------
AEGP_MOUSE/67-222--------------------------------------------------------------------------------
ZAN_RABIT/152-314--------------------------------------------------------------------------------
PTPRU_DANRE/26-183--------------------------------------------------------------------------------
PTPRU_CHICK/27-186--------------------------------------------------------------------------------
Q5TG12_HUMAN/36-193--------------------------------------------------------------------------------
B4QA49_DROSI/136-311--------------------------------------------------------------------------------
ALK_HUMAN/480-635--------------------------------------------------------------------------------
F1RDD1_DANRE/748-922--------------------------------------------------------------------------------
AEGP_HUMAN/493-643--------------------------------------------------------------------------------
AEGP_HUMAN/656-808--------------------------------------------------------------------------------
MEP1B_HUMAN/265-428--------------------------------------------------------------------------------
H3CE92_TETNG/270-434--------------------------------------------------------------------------------
F5H0T8_HUMAN/373-535--------------------------------------------------------------------------------
MEP1A_RAT/270-433--------------------------------------------------------------------------------
AEGP_RAT/273-426--------------------------------------------------------------------------------
H3CU29_TETNG/52-210--------------------------------------------------------------------------------
H3DPC5_TETNG/223-385--------------------------------------------------------------------------------
D2HWA9_AILME/125-297--------------------------------------------------------------------------------
NRP1_RAT/650-810--------------------------------------------------------------------------------
H3CQ93_TETNG/344-500--------------------------------------------------------------------------------
PTPRM_HUMAN/27-183--------------------------------------------------------------------------------
Q17E33_AEDAE/18-191--------------------------------------------------------------------------------
B8JKC0_DANRE/268-431--------------------------------------------------------------------------------
AEGP_RAT/817-972--------------------------------------------------------------------------------
F6PMK1_XENTR/270-431--------------------------------------------------------------------------------
Q1RLY9_DANRE/637-803--------------------------------------------------------------------------------
H3BWX9_TETNG/646-802--------------------------------------------------------------------------------
MEP1A_HUMAN/269-432--------------------------------------------------------------------------------
AEGP_MOUSE/494-648--------------------------------------------------------------------------------
Q176I3_AEDAE/155-324--------------------------------------------------------------------------------
NRP1_CHICK/641-800--------------------------------------------------------------------------------
Q7PZL9_ANOGA/167-334--------------------------------------------------------------------------------
AEGP_HUMAN/271-424--------------------------------------------------------------------------------
B0S6D0_DANRE/630-787--------------------------------------------------------------------------------
H3CJZ0_TETNG/58-219--------------------------------------------------------------------------------
ENTK_MOUSE/392-548--------------------------------------------------------------------------------
ZAN_PIG/149-311--------------------------------------------------------------------------------
MAMC2_MOUSE/342-497--------------------------------------------------------------------------------
H3BVJ4_TETNG/269-431--------------------------------------------------------------------------------
F5H4B5_HUMAN/41-203--------------------------------------------------------------------------------
B4HP69_DROSE/94-269--------------------------------------------------------------------------------
Q176I4_AEDAE/127-297--------------------------------------------------------------------------------
A2AJX4_MOUSE/1695-1857--------------------------------------------------------------------------------
ENTK_BOVIN/363-519--------------------------------------------------------------------------------
E9PWQ7_MOUSE/217-373--------------------------------------------------------------------------------
Q28DN2_XENTR/27-183--------------------------------------------------------------------------------
NRP2_HUMAN/646-801--------------------------------------------------------------------------------
F6Q2U5_XENTR/171-329--------------------------------------------------------------------------------
Q9VQS2_DROME/132-307--------------------------------------------------------------------------------

PF00354

SAMP_MOUSE/27-220-------------------------------------------------------------KV---FVFPRES-------
CRP1_LIMPO/33-237-------------------------------------------------------------KV---.KFPPSS-------
CRP_XENLA/23-219-------------------------------------------------------------NV---FLFPKPS-------
CRP_RABIT/26-221-------------------------------------------------------------KA---FVFPKES-------
CRP_HUMAN/25-220-------------------------------------------------------------KA---FVFPKES-------
SAMP_HUMAN/26-219-------------------------------------------------------------KV---FVFPRES-------
Q542I3_MOUSE/26-221-------------------------------------------------------------KA---FVFPKES-------
FP_CRIMI/26-219-------------------------------------------------------------KV---FVFPRES-------

PF13385

A9V7L7_MONBE/717-870-----------------------------------------------------------------------VG-------
A9V0U4_MONBE/809-963-----------------------------------------------------------------------VG-------
A9VE19_MONBE/544-692-----------------------------------------------------------------------PG-------
A9V0U4_MONBE/590-745-----------------------------------------------------------------------DG-------
B9JMF4_AGRRK/595-752-----------------------------------------------------------------------SS-------
C9ZAH4_STRSW/174-331-----------------------------------------------------------------------RG-------
B5HCG7_STRPR/182-340-----------------------------------------------------------------------PR-------
D3EBL1_GEOS4/644-797-----------------------------------------------------------------------NG-------
Q82NZ6_STRAW/693-850-----------------------------------------------------------------------DG-------
C7Q3C0_CATAD/682-839-----------------------------------------------------------------------DG-------
C6WP14_ACTMD/1442-1597-----------------------------------------------------------------------HG-------
A7RQU2_NEMVE/46-196-----------------------------------------------------------------------NG-------
B3RTE4_TRIAD/419-588-----------------------------------------------------------------------RS-------
Q11RF9_CYTH3/68-223-----------------------------------------------------------------------FT-------
D2AYT0_STRRD/833-984-----------------------------------------------------------------------LG-------
Q01PZ1_SOLUE/560-711-----------------------------------------------------------------------DG-------
D0LXW7_HALO1/121-278-----------------------------------------------------------------------FS-------
A9ERE1_SORC5/156-299-----------------------------------------------------------------------TM-------
A7RK85_NEMVE/111-274-----------------------------------------------------------------------LT-------
Q7UP09_RHOBA/489-653-----------------------------------------------------------------------LT-------
D2QJX5_SPILD/494-660-----------------------------------------------------------------------SN-------
A5G5W5_GEOUR/3125-3280-----------------------------------------------------------------------DG-------
Q12UM1_METBU/211-367-----------------------------------------------------------------------HD-------
A5G5W5_GEOUR/2834-2981-----------------------------------------------------------------------DG-------
Q3A7I8_PELCD/252-409-----------------------------------------------------------------------LD-------
Q2S986_HAHCH/536-688-----------------------------------------------------------------------NG-------
C5BR34_TERTT/286-438-----------------------------------------------------------------------DG-------
Q5E1F1_VIBF1/338-497-----------------------------------------------------------------------KS-------
D0LH97_HALO1/423-584-----------------------------------------------------------------------SG-------
Q2SIZ0_HAHCH/349-511-----------------------------------------------------------------------GA-------
Q21ES8_SACD2/355-516-----------------------------------------------------------------------GS-------
A1U1N6_MARHV/358-517-----------------------------------------------------------------------GS-------
Q7UQA7_RHOBA/111-269-----------------------------------------------------------------------ES-------
Q5JEI1_THEKO/104-250-----------------------------------------------------------------------KT-------
D2RI28_ARCPA/205-357-----------------------------------------------------------------------DG-------
D2QKT6_SPILD/67-225-----------------------------------------------------------------------FN-------
A7RFD3_NEMVE/591-745-----------------------------------------------------------------------LG-------
A5FGU3_FLAJ1/61-211-----------------------------------------------------------------------NN-------
A5FGS6_FLAJ1/61-211-----------------------------------------------------------------------NN-------
A5FKP6_FLAJ1/648-806-----------------------------------------------------------------------NG-------
B1WQC8_CYAA5/1492-1639-----------------------------------------------------------------------FN-------
B2J7Y5_NOSP7/1082-1239-----------------------------------------------------------------------NG-------
B8GR77_THISH/232-391-----------------------------------------------------------------------DG-------
A5US22_ROSS1/44-194-----------------------------------------------------------------------LS-------
B8FIJ2_DESAA/1835-1990-----------------------------------------------------------------------TG-------
B8FIJ2_DESAA/2139-2295-----------------------------------------------------------------------DG-------
B8FIJ2_DESAA/3101-3258-----------------------------------------------------------------------DG-------
B1WQC8_CYAA5/529-689-----------------------------------------------------------------------DG-------
A0L6L9_MAGMM/6883-7036-----------------------------------------------------------------------DG-------
A0L6L9_MAGMM/10297-10458-----------------------------------------------------------------------ST-------
A0L6L9_MAGMM/11015-11176-----------------------------------------------------------------------FD-------
A0L6L9_MAGMM/7697-7855-----------------------------------------------------------------------FD-------
Q11V34_CYTH3/475-632-----------------------------------------------------------------------FS-------
D1YWM2_METPS/639-793-----------------------------------------------------------------------FN-------
A9AX01_HERA2/2983-3139-----------------------------------------------------------------------FG-------
C5CYC7_VARPS/584-746-----------------------------------------------------------------------AN-------
A9VEK3_MONBE/43-204-----------------------------------------------------------------------LD-------
A9UYJ6_MONBE/611-770-----------------------------------------------------------------------NA-------
A4CID0_ROBBH/183-344-----------------------------------------------------------------------GA-------
Q01ZJ6_SOLUE/448-593-----------------------------------------------------------------------NG-------
Q112U0_TRIEI/322-477-----------------------------------------------------------------------DG-------
A9AVC5_HERA2/53-212-----------------------------------------------------------------------FD-------
C3YCM4_BRAFL/399-559-----------------------------------------------------------------------FG-------
A9AX01_HERA2/3464-3613-----------------------------------------------------------------------DG-------
A9AX01_HERA2/1709-1859-----------------------------------------------------------------------DG-------
A9AX01_HERA2/3687-3839-----------------------------------------------------------------------DG-------
A9AVE2_HERA2/55-206-----------------------------------------------------------------------FD-------
A0ZJ67_NODSP/534-687-----------------------------------------------------------------------DG-------
A9WA06_CHLAA/1561-1710-----------------------------------------------------------------------FD-------
D2GX75_AILME/1328-1494-----------------------------------------------------------------------FS-------
GPR98_DANRE/1321-1486-----------------------------------------------------------------------FS-------
B3PKP2_CELJU/973-1129-----------------------------------------------------------------------LD-------
Q21FF7_SACD2/1013-1165-----------------------------------------------------------------------LG-------
Q21FF7_SACD2/697-861-----------------------------------------------------------------------LN-------
B8E3D6_DICTD/93-243-----------------------------------------------------------------------DG-------
C6D6G1_PAESJ/694-843-----------------------------------------------------------------------DG-------
Q9KBP7_BACHD/623-775-----------------------------------------------------------------------DG-------
C7R5J8_JONDD/646-797-----------------------------------------------------------------------LD-------
C7R5J7_JONDD/547-698-----------------------------------------------------------------------LN-------
D4J0Z2_BUTFI/89-242-----------------------------------------------------------------------LD-------
A5GAT0_GEOUR/82-245-----------------------------------------------------------------------DG-------
C6W5Q6_DYAFD/72-233-----------------------------------------------------------------------DG-------
D5SQB3_PLAL2/445-615-----------------------------------------------------------------------NA-------
A0C6A9_PARTE/84-241-----------------------------------------------------------------------SG-------
A4HMI3_LEIBR/697-852-----------------------------------------------------------------------FP-------
A5JZZ5_PLAVS/101-250-----------------------------------------------------------------------RK-------
D2W1V6_NAEGR/225-370-----------------------------------------------------------------------DG-------
Q3A7I8_PELCD/471-622-----------------------------------------------------------------------DE-------
B0R0F2_DANRE/89-248-----------------------------------------------------------------------TG-------
B3RQA7_TRIAD/115-267-----------------------------------------------------------------------LG-------
D3F200_CONWI/289-437-----------------------------------------------------------------------LD-------
C6WK26_ACTMD/261-414-----------------------------------------------------------------------PT-------
A0ZJ64_NODSP/411-564-----------------------------------------------------------------------FD-------
P73139_SYNY3/1330-1483-----------------------------------------------------------------------FQ-------
D3F0R0_CONWI/85-255-----------------------------------------------------------------------SA-------
C1F1C3_ACIC5/51-208-----------------------------------------------------------------------LE-------
B5HK67_STRPR/818-980-----------------------------------------------------------------------DG-------
D9TDD0_MICAI/805-962-----------------------------------------------------------------------DG-------
Q82GV4_STRAW/292-440-----------------------------------------------------------------------DG-------
D2BE74_STRRD/722-881-----------------------------------------------------------------------DG-------
B5I5M1_9ACTN/761-922-----------------------------------------------------------------------NG-------
B1VPR2_STRGG/846-1008-----------------------------------------------------------------------LA-------
B5HSG2_9ACTN/789-950-----------------------------------------------------------------------NG-------
B1VKK7_STRGG/744-905-----------------------------------------------------------------------FN-------
C6WQK6_ACTMD/756-914-----------------------------------------------------------------------NG-------
C9Z2C7_STRSW/793-953-----------------------------------------------------------------------NG-------
D2PTR0_KRIFD/729-887-----------------------------------------------------------------------DG-------
D2PTR0_KRIFD/514-676-----------------------------------------------------------------------NG-------
B5H1J2_STRC2/810-972-----------------------------------------------------------------------DG-------
B5H1J2_STRC2/1032-1193-----------------------------------------------------------------------DG-------
C6WL54_ACTMD/905-1058-----------------------------------------------------------------------TG-------
E6W606_DESIS/780-953-----------------------------------------------------------------------AG-------
C5C072_BEUC1/602-756-----------------------------------------------------------------------GS-------
A0L6L9_MAGMM/10522-10674-----------------------------------------------------------------------NG-------
D0LH97_HALO1/144-304-----------------------------------------------------------------------DA-------
Q12UM1_METBU/421-574-----------------------------------------------------------------------DG-------
D3SUF1_NATMM/128-286-----------------------------------------------------------------------TG-------
Q12UM1_METBU/635-797-----------------------------------------------------------------------DD-------
B1Y080_LEPCP/302-473-----------------------------------------------------------------------SS-------
Q025I9_SOLUE/271-426-----------------------------------------------------------------------GS-------
Q025I9_SOLUE/616-778-----------------------------------------------------------------------SG-------
C6XUD8_PEDHD/202-348-----------------------------------------------------------------------NG-------
E6W633_DESIS/617-776-----------------------------------------------------------------------DG-------
B8FF04_DESAA/2231-2395-----------------------------------------------------------------------DG-------
C7PKJ2_CHIPD/89-251-----------------------------------------------------------------------SG-------
D2PTT7_KRIFD/1092-1258-----------------------------------------------------------------------PG-------
D2PTT7_KRIFD/1416-1585-----------------------------------------------------------------------PG-------

PF02973

NANA_STRR6/118-309--------------------------------------------------------------------VETVI-------
Q8CWP8_STRR6/42-227--------------------------------------------------------------------IFQGG-------
Q8XMG4_CLOPE/50-236--------------------------------------------------------------------..SLG-------

PF07953

A7GBG3_CLOBL/878-1072-------------------------------------------------------------NN---KFIDISG-------
F4AAX8_CLOBO/847-1023-------------------------------------------------------------SN---IIEDISG-------
O87710_9CLOT/811-986-------------------------------------------------------------KN---VIGDGSG-------
B1INP6_CLOBK/847-1023-------------------------------------------------------------NK---VIEDISG-------
Q8GR96_CLOBO/872-1066-------------------------------------------------------------DN---NLIDLSG-------
BXE_CLOBO/859-1054-------------------------------------------------------------ND---KYVDTSG-------
O69276_CLOBO/816-992-------------------------------------------------------------NN---AIGDASG-------
BXEN_CLOBU/812-988-------------------------------------------------------------NN---VIGDTSG-------
Q3ZUA3_9CLOT/40-243-------------------------------------------------------------ND---IISDISG-------
O06018_CLOBO/848-1024-------------------------------------------------------------RK---VIKDISG-------
Q841S3_CLOBO/880-1071-------------------------------------------------------------KN---ALVDTSG-------
BXA1_CLOBH/885-1079-------------------------------------------------------------SN---HLIDLSR-------
BXG_CLOBO/877-1074-------------------------------------------------------------GG---RLIDSSG-------

PF06439

A3HZT9_9BACT/35-266-------------------------------------------------------------DW...QVMF..N.......
A6LBG6_PARD8/26-215-------------------------------------------------------------KT...EKLF..N.......
B0T1W6_CAUSK/37-271-------------------------------------------------------------PW...RPLF..D.......
A4SXW4_POLSQ/31-195-------------------------------------------------------------GF...VDLI..D.......
A6DIW7_9BACT/14-204-------------------------------------------------------------SF...KKLF..N.......
A7LWH3_BACO1/242-448-------------------------------------------------------------GW...TLLW..D.......
A6LFX0_PARD8/51-268-------------------------------------------------------------EW...ITMF..D.......
Q1IP75_KORVE/134-305-------------------------------------------------------------KP...IDLF..N.......
Q01PY8_SOLUE/18-214-------------------------------------------------------------AE...IKLW..N.......
Q021Z2_SOLUE/148-318-------------------------------------------------------------KP...IELF..N.......
A6C286_9PLAN/26-230-------------------------------------------------------------GF...TPLF..N.......
A6L9A1_PARD8/27-220-------------------------------------------------------------KW...KPLF..........
Q7UXM1_RHOBA/116-314-------------------------------------------------------------GA...ESLL..E.......
Q7UGT3_RHOBA/50-260-------------------------------------------------------------GL...TSIF..N.......
A6DGN3_9BACT/486-705-------------------------------------------------------------RV...KALI..P.......
Q026J2_SOLUE/86-285-------------------------------------------------------------DA...IVLF..D.......
A7AJH3_9PORP/62-268-------------------------------------------------------------GW...TLLF..N.......
A4AVD2_MARSH/28-192-------------------------------------------------------------KP...AELFKKN.......
A6CF10_9PLAN/1565-1736-------------------------------------------------------------NL...KLFF..N.......
A4Z0W7_BRASO/36-203-------------------------------------------------------------GW...VTLVDGDKKVEFTE
Q7URI3_RHOBA/55-252-------------------------------------------------------------KW...ETLF..D.......
Q022Y3_SOLUE/158-351-------------------------------------------------------------KA...VVLF..D.......
A3ZYX9_9PLAN/31-241-------------------------------------------------------------LP...KAFI..D.......
Q7UYC2_RHOBA/27-225-------------------------------------------------------------SF...ENLF..N.......
Q08RB4_STIAD/354-520-------------------------------------------------------------PF...SDDF..N.......
B1KP96_SHEWM/43-237-------------------------------------------------------------GW...QLLF..N.......
Q7ULY5_RHOBA/53-228-------------------------------------------------------------EM...QSLF..D.......
Q9XAM0_STRCO/521-727-------------------------------------------------------------GY...RTIL..D.......
A6LD72_PARD8/35-236-------------------------------------------------------------GW...ELLF..D.......
A5V6S7_SPHWW/38-269-------------------------------------------------------------AW...RPLF..N.......
A3ZPX1_9PLAN/148-325-------------------------------------------------------------DA...RVLF..D.......
A6E8U4_9SPHI/241-449-------------------------------------------------------------GY...SLLW..D.......
Q7UFF8_RHOBA/54-264-------------------------------------------------------------VS...VKIF..D.......
A4SYN3_POLSQ/50-213-------------------------------------------------------------TP...IPLF..N.......
Q01QD3_SOLUE/67-266-------------------------------------------------------------DA...IVLF..D.......
Q21G79_SACD2/27-266-------------------------------------------------------------GW...QSLF..N.......
Q15XP9_PSEA6/43-289-------------------------------------------------------------QW...RYLL..........
A7NM29_ROSCS/68-253-------------------------------------------------------------LA...TASF..E.......
Q02AV5_SOLUE/47-254-------------------------------------------------------------GF...KPIF..D.......
Q024T5_SOLUE/20-224-------------------------------------------------------------DG...KPLF..N.......
A6CH23_9PLAN/11-222-------------------------------------------------------------DA...EILL..D.......
Q5LID8_BACFN/75-244-------------------------------------------------------------EP...VSMD..NFIGFTRC
A4AN55_MARSH/13-232-------------------------------------------------------------GF...RAIF..N.......
Q7UP53_RHOBA/254-436-------------------------------------------------------------GL...KNLL..........
A3HYW7_9BACT/39-258-------------------------------------------------------------GF...KSIF..D.......
Q020M5_SOLUE/283-466-------------------------------------------------------------GW...RPLF..N.......
A7LZB4_BACO1/60-285-------------------------------------------------------------GY...ITIF..D.......
A6L8C0_PARD8/23-196-------------------------------------------------------------GS...GTLF..D.......
A4XES2_NOVAD/37-271-------------------------------------------------------------PW...RALF..N.......
Q024G0_SOLUE/10-210-------------------------------------------------------------EW...RTLF..D.......
Q7UP53_RHOBA/88-251-------------------------------------------------------------GW...IRLF..D.......
Q7UJ71_RHOBA/62-282-------------------------------------------------------------RS...RSLF..D.......
A6C9B4_9PLAN/53-240-------------------------------------------------------------DA...IVLF..D.......
A0ACR9_STRAM/807-998-------------------------------------------------------------AR...VALF..D.......
A6DSM6_9BACT/29-216-------------------------------------------------------------GPEGIKNLV..N.......
Q9XBE0_AMYOR/795-985-------------------------------------------------------------NR...VTLF..N.......
A6LB52_PARD8/744-943-------------------------------------------------------------GF...VSIF..N.......
A0M051_GRAFK/45-249-------------------------------------------------------------EW...QELF..N.......
A6DM12_9BACT/183-370-------------------------------------------------------------GW...EDIA..D.......
A4ASP9_MARSH/24-229-------------------------------------------------------------GF...TDLF..N.......
A4ATY8_MARSH/64-260-------------------------------------------------------------DA...IILF..D.......
A4ASM0_MARSH/38-261-------------------------------------------------------------DW...ITLF..D.......
Q15XH8_PSEA6/28-257-------------------------------------------------------------GW...HTLF..N.......
A6BZI2_9PLAN/34-270-------------------------------------------------------------GV...IHLF..N.......
A6DJ51_9BACT/30-221-------------------------------------------------------------GW...QLLF..D.......
A3ZYG0_9PLAN/42-220-------------------------------------------------------------AW...RSLF..D.......
A6LFJ8_PARD8/58-253-------------------------------------------------------------DA...IILF..D.......
B4SNA4_STRM5/52-245-------------------------------------------------------------DA...IVLF..D.......
Q021Q3_SOLUE/25-318-------------------------------------------------------------GS...ISLF..D.......
A6DFB8_9BACT/988-1186-------------------------------------------------------------GA...TSLF..N.......
A6CBU4_9PLAN/476-662-------------------------------------------------------------DY...KPLF..N.......
Q7UTD6_RHOBA/106-307-------------------------------------------------------------GW...ATLF..N.......
A4CGG3_ROBBH/26-212-------------------------------------------------------------PW...QELF..N.......
A4AUV7_MARSH/139-306-------------------------------------------------------------ES...KALF..N.......
B0T1X3_CAUSK/51-253-------------------------------------------------------------DA...IVLF..D.......
A6C9Y7_9PLAN/38-232-------------------------------------------------------------GY...KALF..N.......
A3I2W3_9BACT/58-253-------------------------------------------------------------DA...IVLF..D.......
A6DGC3_9BACT/39-228-------------------------------------------------------------GF...TALF..N.......
A6BYQ3_9PLAN/523-721-------------------------------------------------------------GF...VSVF..D.......
Q9A9B2_CAUCR/42-285-------------------------------------------------------------PS...VTLF..N.......
Q01U12_SOLUE/21-204-------------------------------------------------------------S....TDLL..P.......
Q7UTD6_RHOBA/325-510-------------------------------------------------------------NF...TSVF..D.......
A4ARZ0_MARSH/21-221-------------------------------------------------------------KS...ISLF..N.......
Q01PI7_SOLUE/133-305-------------------------------------------------------------AP...EPIF..N.......
Q09C00_STIAD/650-816-------------------------------------------------------------SF...TETFDAN.......
A3ZT25_9PLAN/28-228-------------------------------------------------------------GF...KSIF..D.......
A4A1V7_9PLAN/150-329-------------------------------------------------------------GA...VVLF..D.......
A0YAF8_9GAMM/30-260-------------------------------------------------------------KW...TSLF..N.......
A6DSF7_9BACT/22-217-------------------------------------------------------------NW...VELF..N.......
A4BYH9_9FLAO/26-192-------------------------------------------------------------TD...IPMNSSN.......
A0ACX0_STRAM/280-457-------------------------------------------------------------GY...TSLF..D.......
Q01NY0_SOLUE/48-250-------------------------------------------------------------GF...QPIF..D.......
A6CCA5_9PLAN/71-236-------------------------------------------------------------GW...IALF..D.......
A3I170_9BACT/40-240-------------------------------------------------------------ET...IKLF..D.......
A7AAJ2_9PORP/957-1147-------------------------------------------------------------GF...KVLF..D.......
A5IIW8_THEP1/74-230-------------------------------------------------------------PW...KVLE..E.......
A7LWH3_BACO1/23-209-------------------------------------------------------------NW...EPLF..N.......
Q01WT7_SOLUE/22-227-------------------------------------------------------------GY...TALF..N.......
A6DM09_9BACT/22-216-------------------------------------------------------------EW...QSLF..N.......
Q02B64_SOLUE/22-209-------------------------------------------------------------GF...TPLF..D.......
A6DTC7_9BACT/37-227-------------------------------------------------------------ES...INLIADN.......
A6CA29_9PLAN/352-540-------------------------------------------------------------GW...KLLF..N.......
A6C8Y3_9PLAN/63-235-------------------------------------------------------------KD...FEVF..N.......
A3XPN2_LEEBM/32-218-------------------------------------------------------------PW...QSLF..N.......
A4A0Q4_9PLAN/26-218-------------------------------------------------------------GW...IKPF..N.......
A6E8U4_9SPHI/25-211-------------------------------------------------------------QW...QQLF..N.......
Q01UN1_SOLUE/9-241-------------------------------------------------------------GW...KLLF..D.......
A3ZQS2_9PLAN/31-212-------------------------------------------------------------TA...EKLF..D.......
A6DG40_9BACT/159-340-------------------------------------------------------------GA...VVLF..D.......
A6DLT3_9BACT/234-440-------------------------------------------------------------GF...TQLF..N.......
A6EKV1_9SPHI/655-832-------------------------------------------------------------TF...NADF..N.......
A3ZY13_9PLAN/44-228-------------------------------------------------------------TH...TRLF..N.......
A6DLT3_9BACT/28-216-------------------------------------------------------------TF...TSLF..........
Q1AST8_RUBXD/20-211-------------------------------------------------------------GA...RLLL..P.......
A4FDZ7_SACEN/121-335-------------------------------------------------------------PY...EVIF..D.......
R6X5T3_9PORP/62-257-------------------------------------------------------------DA...IVLF..D.......
A6BYS0_9PLAN/54-263-------------------------------------------------------------GW...KLLF..D.......
Q01XX3_SOLUE/25-191-------------------------------------------------------------GW...IKMF..D.......
Q2Y669_NITMU/16-255-------------------------------------------------------------GF...RPLF..E.......
A3ZWI0_9PLAN/615-790-------------------------------------------------------------DW...VSVF..N.......
A3ZR79_9PLAN/39-201-------------------------------------------------------------GW...LLLF..D.......
A6CAH6_9PLAN/67-283-------------------------------------------------------------GY...TSLF..N.......
Q01TF2_SOLUE/30-207-------------------------------------------------------------QW...VQLF..N.......
Q2RZK0_SALRD/15-220-------------------------------------------------------------GW...TLLF..D.......
A6CGD1_9PLAN/671-851-------------------------------------------------------------GF...QSLF..N.......
A6C1K2_9PLAN/155-332-------------------------------------------------------------GA...TVLF..D.......
Q7UTX3_RHOBA/29-219-------------------------------------------------------------GF...VSLF..N.......
Q7UYB9_RHOBA/49-246-------------------------------------------------------------GY...TPLF..N.......
A3ZS39_9PLAN/38-281-------------------------------------------------------------ET...ISLL..G.......
Q026J8_SOLUE/86-284-------------------------------------------------------------DA...IVLF..N.......
A6EFU0_9SPHI/28-228-------------------------------------------------------------GF...KALS..D.......
A7AG24_9PORP/243-456-------------------------------------------------------------GW...KLLF..D.......
A3ZX11_9PLAN/36-237-------------------------------------------------------------GF...RALF..N.......
A6C3G1_9PLAN/151-333-------------------------------------------------------------GA...TVLF..D.......
Q7UWR3_RHOBA/519-700-------------------------------------------------------------GW...KSLF..D.......
Q7UZ09_RHOBA/53-231-------------------------------------------------------------DF...VELF..D.......
A3ZQR2_9PLAN/150-327-------------------------------------------------------------GA...TVLF..D.......
A6C1I1_9PLAN/43-215-------------------------------------------------------------GW...IELF..N.......
A6C5D8_9PLAN/56-241-------------------------------------------------------------GP...EKLL..N.......
A6DGI4_9BACT/22-219-------------------------------------------------------------PA...QDLF..N.......
Q7UKZ1_RHOBA/77-278-------------------------------------------------------------KT...VTLF..D.......
Q7ULK4_RHOBA/125-306-------------------------------------------------------------KA...TVLF..D.......
Q2Y774_NITMU/671-893-------------------------------------------------------------GF...TYLF..D.......
A6C6K0_9PLAN/64-244-------------------------------------------------------------KW...ISLF..N.......
A6LCM7_PARD8/20-194-------------------------------------------------------------TK...ENVS..D.......
Q027F9_SOLUE/8-228-------------------------------------------------------------GY...VSLF..D.......
A6DM04_9BACT/25-206-------------------------------------------------------------EA...INLL..S.......
Q024Y0_SOLUE/27-212-------------------------------------------------------------PW...IPLF..N.......
A6CCA5_9PLAN/239-425-------------------------------------------------------------RM...STIF..N.......
A3ZTD9_9PLAN/1170-1342-------------------------------------------------------------NA...GELF..N.......
A3I2B6_9BACT/23-203-------------------------------------------------------------EW...VELF..N.......
A4A0D3_9PLAN/28-213-------------------------------------------------------------GF...TTLF..N.......
Q7ULY5_RHOBA/234-440-------------------------------------------------------------EW...KPLF..D.......
A2U0D4_9FLAO/30-260-------------------------------------------------------------EW...KSIF..N.......
A3ZSI6_9PLAN/804-979-------------------------------------------------------------QW...ESIF..N.......
A4ASP0_MARSH/33-262-------------------------------------------------------------EW...ISMF..N.......
A6DNR0_9BACT/77-264-------------------------------------------------------------DA...TVLF..D.......
Q7UTX3_RHOBA/225-416-------------------------------------------------------------QW...QSFFVKNDDGEYGL
A4A202_9PLAN/27-207-------------------------------------------------------------GW...VSLT..D.......
Q7UYD6_RHOBA/61-249-------------------------------------------------------------GF...TSLF..N.......
A6DQD4_9BACT/44-244-------------------------------------------------------------KW.................
Q7UYI5_RHOBA/85-260-------------------------------------------------------------KW...TTLF..D.......
A4APB3_MARSH/31-262-------------------------------------------------------------VW...QDLF..N.......
A4CHF9_ROBBH/43-248-------------------------------------------------------------DW...IVLF..D.......
A6LD40_PARD8/42-255-------------------------------------------------------------GY...TLLF..N.......
Q2GAA2_NOVAD/60-315-------------------------------------------------------------AP...RNLF..N.......
A3ZWI1_9PLAN/266-442-------------------------------------------------------------GF...VSLF..N.......
A3XQG8_LEEBM/44-246-------------------------------------------------------------EW...EVLF..D.......
Q7UPZ9_RHOBA/40-226-------------------------------------------------------------GF...VSLF..D.......
Q7URK6_RHOBA/266-443-------------------------------------------------------------DA...LVLF..N.......
A6LER8_PARD8/252-428-------------------------------------------------------------KE...VNLF..N.......
Q7US53_RHOBA/171-350-------------------------------------------------------------HP...IALF..N.......
Q026X4_SOLUE/31-258-------------------------------------------------------------DWTFQGSSL..........
A3HX26_9BACT/40-244-------------------------------------------------------------EF...TPLF..E.......
A3HS07_9BACT/30-219-------------------------------------------------------------GW...VDLF..N.......
A3ZR79_9PLAN/204-387-------------------------------------------------------------GM...QSIF..N.......
A3I0Y0_9BACT/33-262-------------------------------------------------------------EW...RELF..N.......
A3ZT60_9PLAN/22-206-------------------------------------------------------------DA...TPIF..D.......
Q01RN4_SOLUE/31-268-------------------------------------------------------------DWTFIGSSL..........
A6C7J3_9PLAN/515-746-------------------------------------------------------------GW...RPLF..N.......
A3I2F1_9BACT/51-252-------------------------------------------------------------GW...MLLF..D.......
A4CGG3_ROBBH/243-451-------------------------------------------------------------GW...QLLW..D.......
Q7UXU2_RHOBA/55-243-------------------------------------------------------------DA...TVLF..........
Q7UGD2_RHOBA/163-356-------------------------------------------------------------DA...IVLF..D.......
Q7UYA4_RHOBA/58-260-------------------------------------------------------------DA...AVLF..D.......

PF00337

Q9VPI7_DROME/41-166-------------------------------------------------------------P.---.......-------
Q9VPI7_DROME/226-369-------------------------------------------------------------PF---YGKLLKE-------
Q7QF77_ANOGA/4-145-------------------------------------------------------------TF---AGTL.SC-------
Q7QF77_ANOGA/165-293-------------------------------------------------------------YF---SNDV.PK-------
Q7PPI9_ANOGA/742-883-------------------------------------------------------------PY---LTAL.HN-------
Q7QHP5_ANOGA/12-144-------------------------------------------------------------PF---LGLI.PG-------
Q18813_CAEEL/34-172-------------------------------------------------------------PY---LSRLDGN-------
Q18813_CAEEL/180-310-------------------------------------------------------------PY---TADI.PG-------
LEG8_HUMAN/18-151-------------------------------------------------------------PF---VGTI.PD-------
LEG8_HUMAN/186-316-------------------------------------------------------------PF---AARL.NT-------
Q9XVD0_CAEEL/131-257-------------------------------------------------------------PY---TIIFPDG-------
B3GTH_ARATH/184-393-------------------------------------------------------------SR---ILVL.PC-------
B3GTK_ARATH/190-404-------------------------------------------------------------NR---IMLL.PC-------
LEG7_MOUSE/5-135-------------------------------------------------------------HH---KTSL.PQ-------
LEG3_MOUSE/131-261-------------------------------------------------------------PY---DLPL.PG-------
LEG4_CHICK/4-134-------------------------------------------------------------QG---PVCT.NL-------
Q7Q2T6_ANOGA/13-143-------------------------------------------------------------PC---LGAI.LG-------
Q7PWU9_ANOGA/113-239-------------------------------------------------------------HT---VENI..T-------
Q7PWU9_ANOGA/285-422-------------------------------------------------------------PY---TGVL.QE-------
Q18625_CAEEL/13-145-------------------------------------------------------------PY---TSRL.GQ-------
LEG9_HUMAN/16-147-------------------------------------------------------------PF---SGTI.QG-------
LEG4_PIG/18-149-------------------------------------------------------------PY---YKPI.PG-------
LEG9_HUMAN/226-355-------------------------------------------------------------PF---ITTI.LG-------
LEG4_PIG/193-323-------------------------------------------------------------PY---KTRL.QG-------
LEC7_CAEEL/10-137-------------------------------------------------------------PS---VYQI.EE-------
Q94215_CAEEL/11-140-------------------------------------------------------------PL---TTPI.YE-------
Q9VPU6_DROME/164-300-------------------------------------------------------------AF---QSDV.PR-------
Q9VPU6_DROME/3-145-------------------------------------------------------------VW---KAKV.LT-------
Q7ZZ26_DANRE/9-141-------------------------------------------------------------FY---VGIC.SV-------
O01329_CAEEL/100-226-------------------------------------------------------------TT---TLPI.PG-------
O62353_CAEEL/138-266-------------------------------------------------------------PY---MSRIPKT-------
Q18625_CAEEL/153-281-------------------------------------------------------------PW---ETAF.PA-------
TECPR_DROME/815-954-------------------------------------------------------------PY---YNTL.YN-------
LEG6_CHICK/3-133-------------------------------------------------------------QG---LVVT.QL-------
Q9U2I7_CAEEL/14-147-------------------------------------------------------------HF---QMIRFAR-------
GRIFN_RAT/4-132-------------------------------------------------------------QF---EAFC.AG-------
GRIFN_DANRE/4-133-------------------------------------------------------------RF---EASC.PD-------
Q6AV44_ORYSJ/145-340-------------------------------------------------------------GD---ALAL.PC-------
Q84T07_ORYSJ/162-372-------------------------------------------------------------GV---TVEL.PC-------
B3GTI_ARATH/190-391-------------------------------------------------------------NK---LMEL.PC-------
B3GTF_ARATH/170-363-------------------------------------------------------------SL---KLQI.PC-------
B3GTG_ARATH/165-343-------------------------------------------------------------HV---LLEL.PC-------
Q9VPI6_DROME/339-481-------------------------------------------------------------PY---YGALPPN-------
Q8SXU5_DROME/5-142-------------------------------------------------------------KF---FAVL.PT-------
A1ZBB1_DROME/5-138-------------------------------------------------------------.F---AGNL.SH-------
A4IHU8_XENTR/12-143-------------------------------------------------------------PF---TLPL.SH-------
E7FEQ1_DANRE/97-223-------------------------------------------------------------..---..PL.QN-------
F1QX26_DANRE/15-145-------------------------------------------------------------PF---SGPI.QG-------
F6YWA7_MACMU/6-136-------------------------------------------------------------.V---PYTL.PV-------
K1QS74_CRAGI/373-496-------------------------------------------------------------..---.EWL.PG-------
LEG2_HUMAN/7-128-------------------------------------------------------------..---..VK.NM-------
LEG10_HUMAN/11-136-------------------------------------------------------------..---.....AA-------
LEG12_MOUSE/29-158-------------------------------------------------------------..---.TTI.FG-------
W5JM94_ANODA/12-140-------------------------------------------------------------PF---LAHL.PA-------

PF02210

Q7PSM9_ANOGA/919-1050--------------------------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------------------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------------------------------------------------------------------------
STAN_DROME/1826-1946--------------------------------------------------------------------------------
CNTP2_HUMAN/401-529--------------------------------------------------------------------------------
G5E9F8_HUMAN/383-516--------------------------------------------------------------------------------
Q18291_CAEEL/495-627--------------------------------------------------------------------------------
F1RCV3_DANRE/1180-1305--------------------------------------------------------------------------------
B4QRF1_DROSI/2162-2289--------------------------------------------------------------------------------
B4NSJ9_DROSI/32-158--------------------------------------------------------------------------------
STAN_DROME/1584-1736--------------------------------------------------------------------------------
G3HJH2_CRIGR/1596-1721--------------------------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------------------------------------------------------------------------
NRX3A_HUMAN/55-184--------------------------------------------------------------------------------
Q8IQH0_DROME/220-342--------------------------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------------------------------------------------------------------------
NRX1A_BOVIN/58-192--------------------------------------------------------------------------------
NRX2A_RAT/57-187--------------------------------------------------------------------------------
F1QGG9_DANRE/493-622--------------------------------------------------------------------------------
Q22574_CAEEL/415-539--------------------------------------------------------------------------------
Q22574_CAEEL/136-267--------------------------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------------------------------------------------------------------------
Q18291_CAEEL/722-843--------------------------------------------------------------------------------
CRUM1_HUMAN/743-860--------------------------------------------------------------------------------
CRUM1_MOUSE/513-650--------------------------------------------------------------------------------
EGFLA_HUMAN/868-996--------------------------------------------------------------------------------
W4YVD3_STRPU/2-125--------------------------------------------------------------------------------
Q9VCZ9_DROME/1230-1355--------------------------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------------------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------------------------------------------------------------------------
GAS6_MOUSE/322-451--------------------------------------------------------------------------------
NRX2B_RAT/119-268--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------------------------------------------------------------------------
CNTP2_HUMAN/216-345--------------------------------------------------------------------------------
NRX3A_MOUSE/475-619--------------------------------------------------------------------------------
CADN2_DROME/1039-1200--------------------------------------------------------------------------------
M9NF15_DROME/1112-1240--------------------------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------------------------------------------------------------------------
NRX1A_MOUSE/753-884--------------------------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------------------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------------------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------------------------------------------------------------------------
COBA2_MOUSE/90-213--------------------------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------------------------------------------------------------------------
O45000_CAEEL/275-391--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------------------------------------------------------------------------
CNTP4_HUMAN/821-940--------------------------------------------------------------------------------
F6X197_CIOIN/150-277--------------------------------------------------------------------------------
CADN_DROME/2407-2568--------------------------------------------------------------------------------
LAMA_DROME/2704-2846--------------------------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------------------------------------------------------------------------
CADE_DROME/1153-1296--------------------------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------------------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------------------------------------------------------------------------
LAMA_DROME/3379-3514--------------------------------------------------------------------------------
LAMA_DROME/2905-3031--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------------------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------------------------------------------------------------------------
NRX2A_HUMAN/760-890--------------------------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------------------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------------------------------------------------------------------------
F1QQE4_DANRE/1171-1299--------------------------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------------------------------------------------------------------------
CELR2_RAT/869-995--------------------------------------------------------------------------------
CELR3_RAT/1534-1693--------------------------------------------------------------------------------
C3ZLC2_BRAFL/400-535--------------------------------------------------------------------------------
B4Q5I2_DROSI/631-762--------------------------------------------------------------------------------
NRX2A_RAT/949-1077--------------------------------------------------------------------------------
NRX4_DROME/824-943--------------------------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------------------------------------------------------------------------
CADN_DROME/2661-2796--------------------------------------------------------------------------------
Q9VZ96_DROME/514-640--------------------------------------------------------------------------------
CNTP5_HUMAN/209-338--------------------------------------------------------------------------------
G3UNZ8_MELGA/754-882--------------------------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------------------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------------------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------------------------------------------------------------------------
CNTP4_MOUSE/400-526--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------------------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------------------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------------------------------------------------------------------------
LAMA_DROME/3083-3205--------------------------------------------------------------------------------
Q8MPN3_DROME/3801-3930--------------------------------------------------------------------------------
Q19350_CAEEL/789-914--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------------------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------------------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------------------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------------------------------------------------------------------------
NRX3A_HUMAN/287-413--------------------------------------------------------------------------------
NRX1A_CHICK/364-508--------------------------------------------------------------------------------
EGFLA_MOUSE/641-767--------------------------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------------------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------------------------------------------------------------------------
CSPG4_HUMAN/55-178--------------------------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------------------------------------------------------------------------
Q9VZ96_DROME/698-817--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------------------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------------------------------------------------------------------------
EYS_DROME/1723-1856--------------------------------------------------------------------------------
CNTP5_HUMAN/819-938--------------------------------------------------------------------------------
CNTP1_HUMAN/813-939--------------------------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------------------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------------------------------------------------------------------------
FAT2_RAT/3802-3923--------------------------------------------------------------------------------
F7ER04_CALJA/128-246--------------------------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------------------------------------------------------------------------
CRB_DROME/1585-1722--------------------------------------------------------------------------------
CNTP5_HUMAN/395-521--------------------------------------------------------------------------------
CNTP1_RAT/1089-1219--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------------------------------------------------------------------------
E9PDN6_HUMAN/215-344--------------------------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------------------------------------------------------------------------
NRX2A_HUMAN/521-666--------------------------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------------------------------------------------------------------------
CRUM1_HUMAN/514-651--------------------------------------------------------------------------------
NRX3B_HUMAN/117-236--------------------------------------------------------------------------------
F1R9W4_DANRE/32-164--------------------------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------------------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------------------------------------------------------------------------
B1AM99_HUMAN/398-522--------------------------------------------------------------------------------
LAMA_DROME/3563-3691--------------------------------------------------------------------------------
NRX1A_CHICK/789-917--------------------------------------------------------------------------------
PROS_RABIT/485-617--------------------------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------------------------------------------------------------------------
H9H2C7_MELGA/306-434--------------------------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------------------------------------------------------------------------
CNTP1_HUMAN/203-332--------------------------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------------------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------------------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------------------------------------------------------------------------
LAMA3_MOUSE/3183-3308--------------------------------------------------------------------------------
Q9VJ82_DROME/55-178--------------------------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------------------------------------------------------------------------
Q9VJ82_DROME/238-367--------------------------------------------------------------------------------
CSPG4_HUMAN/230-363--------------------------------------------------------------------------------
Q19617_CAEEL/154-276--------------------------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------------------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------------------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------------------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------------------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------------------------------------------------------------------------
Q18291_CAEEL/906-1035--------------------------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------------------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------------------------------------------------------------------------
EYS_HUMAN/3007-3141--------------------------------------------------------------------------------
Q18291_CAEEL/303-430--------------------------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------------------------------------------------------------------------
CNTP1_MOUSE/390-516--------------------------------------------------------------------------------
A0A0G2JDY0_MOUSE/681-798--------------------------------------------------------------------------------
Q9VZ96_DROME/275-414--------------------------------------------------------------------------------
C1P641_CAEEL/3508-3630--------------------------------------------------------------------------------

PF00054

AGRIN_CHICK/1416-1546--------------------------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------------------------------------------------------------------------
AGRIN_CHICK/1933-2064--------------------------------------------------------------------------------
LAMA1_HUMAN/2920-3051--------------------------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------------------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------------------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------------------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------------------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------------------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------------------------------------------------------------------------
CSPG4_RAT/55-182--------------------------------------------------------------------------------
AGRIN_RAT/1291-1422--------------------------------------------------------------------------------
AGRIN_RAT/1559-1694--------------------------------------------------------------------------------
SHBG_RAT/76-206--------------------------------------------------------------------------------
CRB_DROME/1048-1183--------------------------------------------------------------------------------
AGRIN_RAT/1811-1942--------------------------------------------------------------------------------
SLIT_DROME/1204-1335--------------------------------------------------------------------------------
PROS_HUMAN/329-459--------------------------------------------------------------------------------
CRB_DROME/1281-1443--------------------------------------------------------------------------------
SHBG_HUMAN/75-205--------------------------------------------------------------------------------
FAT_DROME/4156-4306--------------------------------------------------------------------------------

PF00722

XTH8_ARATH/38-224--------------------------------------------------------------------------------
XTH1_ARATH/36-215--------------------------------------------------------------------------------
Q6BHG8_DEBHA/45-215--------------------------------------------------------------------------------
Q6BH77_DEBHA/56-228--------------------------------------------------------------------------------
Q6BH39_DEBHA/52-224--------------------------------------------------------------------------------
Q6BRL2_DEBHA/100-275--------------------------------------------------------------------------------
Q7CTY9_AGRFC/57-234--------------------------------------------------------------------------------
Q7CSS8_AGRFC/263-456--------------------------------------------------------------------------------
EXOK_RHIME/58-245--------------------------------------------------------------------------------
XTH2_SOYBN/32-213--------------------------------------------------------------------------------
Q6FNU8_CANGA/147-325--------------------------------------------------------------------------------
XTH10_ARATH/37-218--------------------------------------------------------------------------------
CRH2_YEAST/96-273--------------------------------------------------------------------------------
CRR1_ASHGO/155-333--------------------------------------------------------------------------------
XTH13_ARATH/26-207--------------------------------------------------------------------------------
Q7XTP9_ORYSJ/31-215--------------------------------------------------------------------------------
Q6ES26_ORYSJ/32-215--------------------------------------------------------------------------------
XTH31_ARATH/39-223--------------------------------------------------------------------------------
Q5AXN2_EMENI/49-224--------------------------------------------------------------------------------
Q6FWX2_CANGA/97-274--------------------------------------------------------------------------------
XTH33_ARATH/43-226--------------------------------------------------------------------------------
GUB_BACSU/54-238--------------------------------------------------------------------------------
Q6ZAN9_ORYSJ/28-212--------------------------------------------------------------------------------
Q7XNY6_ORYSJ/36-222--------------------------------------------------------------------------------
Q6Z2L4_ORYSJ/35-220--------------------------------------------------------------------------------
Q6RHY1_SOLLC/27-212--------------------------------------------------------------------------------
Q6CIZ6_KLULA/49-219--------------------------------------------------------------------------------
Q84T83_ORYSJ/36-221--------------------------------------------------------------------------------
Q8H7Q1_ORYSJ/3-189--------------------------------------------------------------------------------
Q8GVQ2_ORYSJ/40-224--------------------------------------------------------------------------------
Q6C4P9_YARLI/48-219--------------------------------------------------------------------------------
CRH1_YEAST/65-235--------------------------------------------------------------------------------
XTH17_ARATH/29-211--------------------------------------------------------------------------------
Q6ZAN8_ORYSJ/30-214--------------------------------------------------------------------------------
XTH2_ARATH/32-212--------------------------------------------------------------------------------
Q8GVR3_ORYSJ/46-232--------------------------------------------------------------------------------
XTH28_ARATH/31-216--------------------------------------------------------------------------------
Q7SGL2_NEUCR/50-224--------------------------------------------------------------------------------
Q5KNP5_CRYNJ/97-278--------------------------------------------------------------------------------
Q6YUP5_ORYSJ/36-221--------------------------------------------------------------------------------
Q9FZ05_SOLLC/27-209--------------------------------------------------------------------------------
Q825L5_STRAW/78-287--------------------------------------------------------------------------------
UTR2_CANAL/100-275--------------------------------------------------------------------------------
Q7S222_NEUCR/48-222--------------------------------------------------------------------------------
Q6Z998_ORYSJ/39-226--------------------------------------------------------------------------------
Q7N1F8_PHOLL/52-255--------------------------------------------------------------------------------
Q97FD3_CLOAB/57-242--------------------------------------------------------------------------------
CRR1_YEAST/147-325--------------------------------------------------------------------------------
Q7XBU8_ORYSJ/32-215--------------------------------------------------------------------------------
XTH32_ARATH/43-227--------------------------------------------------------------------------------
XTH26_ARATH/29-208--------------------------------------------------------------------------------
Q82M60_STRAW/400-624--------------------------------------------------------------------------------
Q6K9X1_ORYSJ/50-242--------------------------------------------------------------------------------
XTH21_ARATH/28-209--------------------------------------------------------------------------------
Q7S7D0_NEUCR/61-233--------------------------------------------------------------------------------
XTH25_ARATH/30-211--------------------------------------------------------------------------------
Q6FSM3_CANGA/48-218--------------------------------------------------------------------------------
Q6ES25_ORYSJ/25-208--------------------------------------------------------------------------------
Q5Z746_ORYSJ/26-208--------------------------------------------------------------------------------
CRH11_CANAL/50-220--------------------------------------------------------------------------------
Q5B4L5_EMENI/96-273--------------------------------------------------------------------------------
Q5Z6H1_ORYSJ/36-217--------------------------------------------------------------------------------
XTH24_ARATH/24-205--------------------------------------------------------------------------------
Q98C78_RHILO/80-268--------------------------------------------------------------------------------
Q7SBQ2_NEUCR/99-274--------------------------------------------------------------------------------
Q8XNF8_CLOPE/412-635--------------------------------------------------------------------------------
XTH1_SOLLC/33-214--------------------------------------------------------------------------------
Q7XTP8_ORYSJ/24-207--------------------------------------------------------------------------------
Q6CL87_KLULA/145-322--------------------------------------------------------------------------------
XTH3_ARATH/35-213--------------------------------------------------------------------------------
GUB_CLOTH/57-238--------------------------------------------------------------------------------
B9RG34_RICCO/58-238--------------------------------------------------------------------------------
C5Z8T4_SORBI/33-213--------------------------------------------------------------------------------
D3EBX7_GEOS4/64-257--------------------------------------------------------------------------------
D7SNC1_VITVI/38-220--------------------------------------------------------------------------------
E7FHE7_PYRFU/86-290--------------------------------------------------------------------------------
F2D903_HORVD/30-212--------------------------------------------------------------------------------
F2DT99_HORVD/27-208--------------------------------------------------------------------------------
F2DUU5_HORVD/27-204--------------------------------------------------------------------------------
G2XIS4_VERDV/50-220--------------------------------------------------------------------------------
G4NC59_MAGO7/98-270--------------------------------------------------------------------------------
K4DD58_SOLLC/24-203--------------------------------------------------------------------------------
M1AN43_SOLTU/24-201--------------------------------------------------------------------------------
M4EZF0_BRARP/17-194--------------------------------------------------------------------------------
Q5L861_BACFN/78-272--------------------------------------------------------------------------------
Q9WXN1_THEMA/253-454--------------------------------------------------------------------------------
T0UMT6_9STRE/50-231--------------------------------------------------------------------------------
V4IZ43_9ACTN/74-282--------------------------------------------------------------------------------
W5I2U1_WHEAT/24-204--------------------------------------------------------------------------------

PF03935

Q6BW61_DEBHA/174-674.............ESYEILTSYRYPLLSAIR.TGLVDPDTPEDALTKKTS.K.DATWKLVFSDEFNAAGR-TF-------
Q0UQN1_PHANO/94-573GKPFWA.ANIYKAEAWAHVNDVKYPFIQNIR.TGLIDPDTPKSAMKRKGE.Y.GDEYELVFSDEFNVENR-TF-------
A5DEX4_PICGU/157-655.............ESYEILTHYKYPILSAIR.TSLVDPDTPDEYLTRKVT.T.G.TWKLVFSDEFNKDGR-TF-------
A1C6M7_ASPCL/154-653P............RDTLCLDVGDRPLLSNIR.RGLIDPDTPKSARSKKSA.D.GKEWKLVFSDEFNTDGR-TF-------
Q752M9_ASHGO/153-654.............KLTEVLSPYQYPQLSAIR.TSLVDPDTPKDARKRKSL.K.GETWPLVFSDEFNAVGR-TF-------
Q5KJ60_CRYNJ/92-619SG..........YNLGGINASGQYPSITGLP..SLIDSDTPEYLYTRTGF.D.GKEWTLVFSDEFEKDGR-TF-------
A0A0D1DSS3_USTMA/148-679.............ASASLSTTTTFTTFPVNMKRGLVDQETPQSAYKRTSPVD.NSAWHLVFSDEFNTPGR-TF-------
A5DZI8_LODEL/240-745.............ESYEVLTRYSYPMLSAIR.QSLIDPDTPLDAMLKKSK.L.GDTWPLVFSDEFNVEGR-TF-------
A0A0D1CCS8_USTMA/384-919GG..........FNLGGANATGQVADLKIGR..GLIDPDTPESVKTRTTLNGSGKKMNLVFSDEFNRDGR-SF-------
A0A0D1CPF2_USTMA/197-732GG..........YNLGGVNASGQIASIPGLR.SSLIDPDTPQDARTRLSP.DGTKTMKLVFSDEFNTPGR-SF-------
YEPB_SCHPO/124-627FD..........AIMANQITDHLFAHMRVPR.TNLIDKDTPSTAYHRTGY.N.GRKYNLVFSDEFNKEGR-SF-------
YEOB_SCHPO/134-636.............TRVTGITNHQFRILRLLRYGSLIDPDTPESAYTFDSQ.D.LGTLDLVFSDEFNYPGR-AF-------
A7TTP7_VANPO/229-744RQGGSSSGGGSQNGDNEYLTAYTYPQLAAIR.TTLVDPDTPSAAKTRKAK.D.GSSWNLVFSDEFNAEGR-TF-------
A5DZ87_LODEL/332-841.............LTYLILTQYKYPTLSAIR.QSLIDPDTPLDARTIEAR.D.GSDWSLVFSDEFNVVGR-TF-------
Q6FUB1_CANGA/183-684.............VVQEILSAYQYPQLSAIR.TKLVDPDTPQSALSRQAR.D.GSYWKLVFSDEFNAEGR-TF-------
A7E6J8_SCLS1/168-668.............AAAIDCLSIKIPLLKNVR.TGLIDPDTPDSVKSKTAQ.D.GTKLKLVFSDEFNTDGR-TF-------
Q5AEC0_CANAL/212-718.............QEYEILSHYSYPLLSAIR.TSLIDPDTPQDALKMKAK.D.GSNWSLVFSDEFNIMGR-TF-------
A3LPW0_PICST/189-695.............QSYEILTDYTYPLLSAIR.TSLVDPDTPSSAFNHTAQ.N.GDVWTLVFSDEFNAEGR-TF-------
A7EWT0_SCLS1/211-717SGYV......DYGPAWAHVNNNTYPLLKNVR.TTLIDPDTPQTARTRESTFN.GETLNLVFSDEFNNNNR-TF-------
Q5KHK4_CRYNJ/69-588GA..........YNIGGINSTGQVPLISNIP..TVIDSDTPVDKYTRTGF.D.GKTYSLVFSDEFEKEGR-TF-------
Q0UKL9_PHANO/161-653G............NPLCIQGKQNEPILSTYE.RG..S.STPT...............QLGFSDEFNVDGP-LF-------
A3LPU3_PICST/148-653.............EEYEILTHYQYPLLSAIR.TNLVDPDTPSDALTIKAQ.D.GSNWSLVFSDEFNAEGR-TF-------
Q6FQ11_CANGA/223-736IHPANS..TNFTNHNAVPLSLYQYPQLSAIR.TSLVDPDTPQSALTRKAK.D.GSDWRLVFSDEFNAAGR-TF-------
E7LUU1_YEASV/250-763HAANSA.GSSSSNTTSKSLTEYQYPQLAAIR.TTLVDPDTPDSAKTRVAK.D.GSKWQLVFSDEFNAEGR-TF-------
M7NJX3_PNEMU/194-674.............RCPDCIKTLPIDLLGATR..GLIDPDTPEEFYELKNS.D.GKVYKLVFSDEFNKDGR-TF-------
Q5A4H2_CANAL/99-596F............ENYEVLTRYSYPRLSAIR.TSLIDPDTPEDALFWKSK.N.GEEWPLVFSDEFNAEGR-TF-------

PF10287

K0KZR6_WICCF/233-464--------------------------------------------------------------------------------
I2H1W8_TETBL/107-341--------------------------------------------------------------------------------
D0N3P2_PHYIT/250-486--------------------------------------------------------------------------------
A7TFI3_VANPO/109-343--------------------------------------------------------------------------------
N1PMX9_DOTSN/238-461--------------------------------------------------------------------------------
G0VAP6_NAUCC/104-338--------------------------------------------------------------------------------
S9W8F8_SCHCR/234-466--------------------------------------------------------------------------------
C5GJ05_AJEDR/167-389--------------------------------------------------------------------------------
K3W690_PYTUL/247-486--------------------------------------------------------------------------------
I2GUP8_TETBL/154-386--------------------------------------------------------------------------------
A5DXV9_LODEL/227-457--------------------------------------------------------------------------------
C4XY08_CLAL4/110-342--------------------------------------------------------------------------------
M3A440_PSEFD/207-432--------------------------------------------------------------------------------
D0MRW8_PHYIT/313-551--------------------------------------------------------------------------------
W1QLM9_OGAPD/217-448--------------------------------------------------------------------------------
C5DKG4_LACTC/102-336--------------------------------------------------------------------------------
J7R3E5_KAZNA/106-340--------------------------------------------------------------------------------
G0VBJ0_NAUCC/237-460--------------------------------------------------------------------------------
I2H8C5_TETBL/275-505--------------------------------------------------------------------------------
Q75A62_ASHGO/259-490--------------------------------------------------------------------------------
E3RIT6_PYRTT/99-331--------------------------------------------------------------------------------
B6JWV1_SCHJY/233-464--------------------------------------------------------------------------------
A5DNR6_PICGU/97-330--------------------------------------------------------------------------------
G8Y3C3_PICSO/237-463--------------------------------------------------------------------------------
C5M9J2_CANTT/224-453--------------------------------------------------------------------------------
G3AKA2_SPAPN/103-336--------------------------------------------------------------------------------
G3ARF7_SPAPN/199-428--------------------------------------------------------------------------------
G3JJN7_CORMM/201-421--------------------------------------------------------------------------------
C7YIC0_NECH7/221-441--------------------------------------------------------------------------------
Q0UV14_PHANO/96-328--------------------------------------------------------------------------------
K0KM65_WICCF/142-376--------------------------------------------------------------------------------
G1XB81_ARTOA/196-429--------------------------------------------------------------------------------
M1W9S2_CLAP2/235-455--------------------------------------------------------------------------------
Q6FJK5_CANGA/212-435--------------------------------------------------------------------------------
R1ESJ6_BOTPV/247-467--------------------------------------------------------------------------------
D0N6Y2_PHYIT/175-409--------------------------------------------------------------------------------
C5DIE9_LACTC/221-452--------------------------------------------------------------------------------
G8BET5_CANPC/99-332--------------------------------------------------------------------------------
G8JQC7_ERECY/209-441--------------------------------------------------------------------------------
E3G0R9_STIAD/153-380--------------------------------------------------------------------------------
C4R9F6_PICPG/189-423--------------------------------------------------------------------------------
L8G239_PSED2/205-429--------------------------------------------------------------------------------
A7TMJ4_VANPO/222-451--------------------------------------------------------------------------------
C5DXY8_ZYGRC/256-484--------------------------------------------------------------------------------
G3B3K2_CANTC/207-428--------------------------------------------------------------------------------
G0W356_NAUDC/104-338--------------------------------------------------------------------------------
Q7SG43_NEUCR/112-341--------------------------------------------------------------------------------
K3WLE5_PYTUL/196-423--------------------------------------------------------------------------------
S3DKR2_GLAL2/298-524--------------------------------------------------------------------------------
F2PH39_TRIEC/193-423--------------------------------------------------------------------------------
M2N8D8_BAUCO/220-449--------------------------------------------------------------------------------
Q6BRM6_DEBHA/197-423--------------------------------------------------------------------------------
C5M5H0_CANTT/101-334--------------------------------------------------------------------------------
G8ZNQ8_TORDC/230-458--------------------------------------------------------------------------------
D5GIX3_TUBMM/208-444--------------------------------------------------------------------------------
A3LP10_PICST/207-435--------------------------------------------------------------------------------
R4XDU4_TAPDE/242-471--------------------------------------------------------------------------------
A7TGR9_VANPO/102-336--------------------------------------------------------------------------------
H3H0J0_PHYRM/316-553--------------------------------------------------------------------------------
Q757Z0_ASHGO/117-351--------------------------------------------------------------------------------
Q5AJN2_CANAL/226-456--------------------------------------------------------------------------------
M3D6U8_SPHMS/213-438--------------------------------------------------------------------------------
H3GMI5_PHYRM/341-578--------------------------------------------------------------------------------
I2H9Q2_TETBL/105-339--------------------------------------------------------------------------------
G8ZYU9_TORDC/104-337--------------------------------------------------------------------------------
S0DQ79_GIBF5/217-437--------------------------------------------------------------------------------
M4BGZ3_HYAAE/337-572--------------------------------------------------------------------------------
F9XBT5_ZYMTI/245-464--------------------------------------------------------------------------------
G8BXS9_TETPH/170-397--------------------------------------------------------------------------------
H2AXG7_KAZAF/104-337--------------------------------------------------------------------------------
U4LN65_PYROM/147-371--------------------------------------------------------------------------------
J7RTK3_KAZNA/245-466--------------------------------------------------------------------------------
C5FXD0_ARTOC/196-427--------------------------------------------------------------------------------
Q6CGN1_YARLI/220-451--------------------------------------------------------------------------------
G2WT64_VERDV/218-439--------------------------------------------------------------------------------
Q6FJ92_CANGA/109-343--------------------------------------------------------------------------------
G4U9Y4_NEUT9/21-245--------------------------------------------------------------------------------
E4ZV72_LEPMJ/267-498--------------------------------------------------------------------------------
G8BU49_TETPH/100-334--------------------------------------------------------------------------------
W1QLK8_OGAPD/133-365--------------------------------------------------------------------------------
G8JX30_ERECY/121-347--------------------------------------------------------------------------------
Q6CXP7_KLULA/106-342--------------------------------------------------------------------------------
C4JID9_UNCRE/192-415--------------------------------------------------------------------------------
Q6CVS7_KLULA/216-447--------------------------------------------------------------------------------
H2AXG9_KAZAF/107-341--------------------------------------------------------------------------------
A7TQU3_VANPO/143-371--------------------------------------------------------------------------------
K3XBG2_PYTUL/358-594--------------------------------------------------------------------------------
M7SLD2_EUTLA/204-432--------------------------------------------------------------------------------
R7YJQ9_CONA1/229-450--------------------------------------------------------------------------------
H6BRJ0_EXODN/215-434--------------------------------------------------------------------------------
K3X9Z2_PYTUL/110-344--------------------------------------------------------------------------------
L2FRA0_COLGN/221-441--------------------------------------------------------------------------------
Q7SG41_NEUCR/178-394--------------------------------------------------------------------------------
A5DBA4_PICGU/200-428--------------------------------------------------------------------------------
K2RHU7_MACPH/245-465--------------------------------------------------------------------------------
Q7SG42_NEUCR/163-390--------------------------------------------------------------------------------
YH6B_SCHPO/264-495--------------------------------------------------------------------------------
J8Q0R9_SACAR/105-339--------------------------------------------------------------------------------
K1XZI2_MARBU/332-545--------------------------------------------------------------------------------
F0UMR1_AJEC8/199-421--------------------------------------------------------------------------------
I2H2C5_TETBL/110-343--------------------------------------------------------------------------------
E9EMJ7_METRA/226-457--------------------------------------------------------------------------------
G3AYC4_CANTC/101-337--------------------------------------------------------------------------------
H2AVQ7_KAZAF/220-440--------------------------------------------------------------------------------
E4UXS3_ARTGP/195-422--------------------------------------------------------------------------------
U1HUX4_ENDPU/201-424--------------------------------------------------------------------------------
A7F2W5_SCLS1/255-477--------------------------------------------------------------------------------
C4R2B9_PICPG/119-353--------------------------------------------------------------------------------
F2SIK0_TRIRC/197-428--------------------------------------------------------------------------------
C4Y1A3_CLAL4/229-457--------------------------------------------------------------------------------

PF00840

K1WCU0_MARBU/20-452----------------------------AGTNKPETHPPLEVSTC..TA............SG...CTTS.AQ-------
G3XZK9_ASPNA/20-448----------------------------AGTLTEEVHPSLTWQKC..TS............EG..SCTEQ.SG-------
F4PY37_DICFS/22-455----------------------------AGKLSPEVHPPITWQQC..DA............NG..QCNTV.QG-------
G1XV93_ARTOA/22-459----------------------------PGSVTAETHPGLTSSVC..TR............SG..GCTTK.NT-------
L8WSW0_THACA/22-455----------------------------VGTNKAEVHPTLTWQKC..TK............SG..GCQTQSQG-------
G2QZA7_THITE/22-417----------------------------IGKAVPEVHPKLTTQKC..TL............RG..GCKPV.RT-------
E4ZFU3_LEPMJ/20-452----------------------------VGTEQTETHPGMTWQTC..TA............KG..SCTAK.NG-------
M2UA27_COCH5/21-452----------------------------VGTSTAENHPKLTWQTC..TG............TGGTNCSNK.SG-------
E3L6D5_PUCGT/29-447----------------------------....LQESPPSLKIQNC..ES............DG..KCSEI.RM-------
S3D4J2_GLAL2/21-452----------------------------VGTQQKETHPSMTWQKC..TG............TGGTSCTTQ.NG-------
I1FU52_AMPQE/20-456----------------------------IGTNAPENHPPLSIQSC..TS............PG..QCQTQ.QA-------
B6QIG2_PENMQ/28-458----------------------------IGTLTTETHPPLTWSTC..KS............GG..SCTSN.SG-------
G2WXB9_VERDV/20-447----------------------------VGTETPETHPPLTWKDC..SS.............G..TCSDV.QG-------
Q7S390_NEUCR/20-440----------------------------PGKLTPEVHPKLPTWAC..TV............AD..GCIQK.DT-------
V2WZE7_MONRO/22-456----------------------------VGTNTAENHPKLSVSKC..SA............GG..SCATQ.QG-------
A7EUL3_SCLS1/19-449----------------------------IGTYTTETHPSLTWQSC..TA............KG..SCTTQ.SG-------
S3CP84_GLAL2/21-459----------------------------.ATLQPEVHPLMRWESC..SS............AG...CSKQ.NG-------
N4UZJ1_COLOR/19-440----------------------------AGTQQTETHPKLTWQQC..TA.............S..SCTNV.NG-------
G7XKW4_ASPKW/24-460----------------------------VGTYTTETHPSLTWQTC..TS............SG..SCTTN.NG-------
F7W7F9_SORMK/30-440----------------------------IGTGIPEVHPRFRTQKC..TK............FG..GCKNQ.QT-------
G2YS63_BOTF4/20-452----------------------------AGTLTTETHPPLSVSQC..TA............SG...CTTS.AQ-------
E3K8B1_PUCGT/22-457----------------------------.GKIKPEKPVPFIVKEC..AS............GS..NCKDL.SG-------
Q55FE6_DICDI/22-455----------------------------IGKLTPEVHPPMTFQKC..SE............GG..SCETI.QG-------
M2N728_BAUCO/20-450----------------------------AGTLTAEVHPPLTVSNC..TA............NG...CTTE.SH-------
R8BSD2_TOGMI/20-444----------------------------VGKEQTETHPKMSWKKC..TS............GG..SCTTT.NA-------
G2Q359_THIHA/20-453----------------------------AGTLTEEIHPSLPIEVC..TA............PG..SCTKE.DT-------
G4V088_NEUT9/21-421----------------------------IGTLTPESHPKLPTKRC..TL............SG..GCQTV.ST-------
B2AQ71_PODAN/25-431----------------------------IGTLTPELHPRFPTQQC..TS............SG..ICTTK.QT-------
S7ZRD6_PENO1/28-461----------------------------AGTLTAESHPALTWQKC..SA............GG..SCTPV.SG-------
CBHB_ASPFU/29-463----------------------------VGTSQAEVHPSMTWQSC..TA............GG..SCTTN.NG-------
U4LWF8_PYROM/21-452----------------------------AGTLTAENHPTMTWQQC..TK............SG...CTTT.NG-------
F7W4B0_SORMK/24-424----------------------------IGTFVPESHPKLPIKKC..TL............AG..GCQTV.NT-------
G2WQW0_VERDV/20-447----------------------------VGTEEPEVHPKITWKRCTGTN............GS..NCATV.NG-------
B2A8V6_PODAN/19-451----------------------------VGTYTAERHPSMPIQVC..TA............PG..QCTRE.ST-------
R8BMF8_TOGMI/19-453----------------------------IGTNTAEKHPSMPIQSC..SA............SG...CTTE.QT-------
L2FC27_COLGN/19-441----------------------------VGDLQQEIHPKLSWKQC..TS............ST...CDTV.QG-------
H1W5V0_COLHI/19-443----------------------------VGTEQSETHPRLNWQRC..TS.............G..SCSNV.NA-------
A0A0C4ECL7_MAGP6/30-424----------------------------....TKEVHPRLTTWKC..TT............SG..GCKSQ.NT-------
M2QWB1_CERS8/85-519----------------------------IGTQTAEVHPTLSWSQC..TA............DG..TCTSQ.SG-------
D8QBJ3_SCHCM/21-453----------------------------VGNLTAETHPSLSWQEC..TS............SG...CTDH.SA-------
E3KSU8_PUCGT/22-454----------------------------VGTMNPEVPPEITIDNC..TA............KG...CEPL.KG-------
U4L139_PYROM/20-454----------------------------VGTNTAESHPQLRSQTC..TK............SG..GCSTQ.ST-------
S3CAD2_OPHP1/20-451----------------------------VGNNTIEVHPRLTTWRC..TH............AG..GCTPR.NT-------
G0S477_CHATD/21-451----------------------------ACSLTTETHPRLTWKRC..TS............GG..NCSTV.NG-------
C7ZHP8_NECH7/23-415----------------------------...NTPEVHPRLDTFRC..TV............LG..GCKKQ.TN-------
R0K7Q4_SETT2/24-451----------------------------.GKEQTETHPKMTWQRC..TG............KGGTSCSNV.NG-------
M4BUX1_HYAAE/30-470----------------------------VGTSTAEVHPPLTTQTC..TK............DG...CKDD.KT-------
G2WZP1_VERDV/20-456----------------------------ACTSQAETHPPLTWQKCTGTG............GS..SCTNV.SG-------
N4UQR7_COLOR/21-445----------------------------IGDLQEEIHPKLSWTRC..NA............ST...CDTV.QG-------
U7Q8V8_SPOS1/21-424----------------------------IGTAVPEVHPKLPTQFC..TT............AG..GCKTM.QT-------
A0A0C4EX39_PUCT1/27-447----------------------------..KSTPEPNLPLHFEKC..TP............DH..GCKKV.PG-------
A0A0C4E9V9_MAGP6/27-444----------------------------EGT...EAHPELPTRFC..TK............AG..GCVTK.QT-------
B6HC69_PENCW/20-452----------------------------AGTLTAETHPSLTWQKC..TA............EG..SCTDQ.KG-------
Q2GUM4_CHAGB/23-447----------------------------VGTSTSETHPKITWKKC..SS............GG..SCSTV.NA-------
U7PKV6_SPOS1/26-451----------------------------VGTQQTETHPKMPYQKC..TA............KG..SCTTQ.QG-------
K1WM38_MARBU/21-461----------------------------.GTFTAEVHPPLTWQTC..TA............PG..SCTTI.NG-------
G0RVK1_HYPJQ/20-446----------------------------ACTLQSETHPPLTWQKC..SS............GG..TCTQQ.TG-------
H3G8U1_PHYRM/34-471----------------------------AGTSTPEVHPPLASKQC..SK............AG..GCVTE.AT-------
M7SVI4_EUTLA/21-454----------------------------VGEEDPETHPALTWSKC..TA............AG..ACTEV.AG-------
A0A0C4DNY4_MAGP6/20-447----------------------------VGKDTAETHPRMTWQKC..TA............PG..RCSNV.NG-------
R8BQZ2_TOGMI/20-451----------------------------VGTSTTETHPKMSWSKC..SS............GG..SCTSQ.SG-------
S3D235_GLAL2/20-454----------------------------IGTLTPEVHPPLTWQTC..TA............PG..SCTTV.NG-------
F0XKB1_GROCL/20-444----------------------------VGTQQTETHPTMTWKKC..TS............AG..QCAAV.NG-------
C7YH34_NECH7/20-451----------------------------ACTLNTENKPALTWAKC..TS............SG...CSNV.RG-------
F9FPS1_FUSOF/20-451----------------------------VCSLNTETKPALTWSKC..TS............SG...CSDV.KG-------
CBHA_EMENI/20-446----------------------------AGTAQEEVHPSLTWQRC..EA............SG..SCTEV.AG-------
F4RKA2_MELLP/26-456----------------------------ADTALKERHPRLNFESC..TK............AK..GCVKI.KA-------
A0A0C4EZJ7_PUCT1/22-425----------------------------AGSVNPEVPPPITIKNC..IG............KT...CKDV.TG-------
G4N143_MAGO7/22-445----------------------------VGTQTAENHPKMTWKKC..TG............KA..SCTTV.NG-------
E3JU73_PUCGT/29-437----------------------------.....AEPNLPLEIQTC..TV............GK..GCKRI.PG-------
L8WJB0_THACA/84-513----------------------------VGTSKAEVHPPLPWQKC..TK............SG..GCVTQSSG-------
M7TJ66_BOTF1/21-446----------------------------VGTSTAETHPALTVQKC..AA............GG..TCTDE.SD-------
F4S1M9_MELLP/23-458----------------------------VGTQTPEKPPPLSISSC..TK............GA..GCTEK.VR-------
M5BZ75_THACB/20-450----------------------------AGTVTAETHPSLPWQKC..TK............SG..GCVTQSSG-------
CELB_ASPFN/20-414----------------------------VGT.TADAHPRLTTYKC..TS............QN..GCTRQ.NT-------
K5WYE3_AGABU/21-450----------------------------VGTNMAENHPSLTWQRC..TS............SG...CQNV.NG-------
F4RTE7_MELLP/22-447----------------------------IGKLIPEVQPKLNYQTC..TK............AG..GCTKH.NG-------
N1PY93_DOTSN/21-450----------------------------AGTNTAETHPTLPISSC..TA............AE...CLNL.GT-------
F0ZJZ1_DICPU/21-454----------------------------VGKFSPEVHPPITWQEC..AD............DG..SCKTM.NG-------
G4NI68_MAGO7/22-416----------------------------.....TEVHPKITTYRC..TK............EG..GCTEK.TN-------
H1VQX8_COLHI/20-456----------------------------VCTSQVETHPPLQWQKX..AA............GG..SCTNV.AG-------
M2SZK0_COCSN/20-452----------------------------VGTQKEEVHPKLSWQSC..TA............PG..SCTTQ.NG-------
D0N841_PHYIT/25-462----------------------------AGSNKAETHPPFTTQTC..TK............SG...CTDE.DT-------
A8NU36_COPC7/21-457----------------------------VGREVAENHPRLPWQRC..TR............NG..GCQTVSNG-------
L2FY65_COLGN/20-452----------------------------VCTLNTETKPALTWSTC..AA............GG..SCTTN.NG-------
G4MMG0_MAGO7/20-450----------------------------ACSLTAETHPSLTWQKC..SS............GG..SCTNV.AG-------
A0A016PHW6_GIBZA/22-419----------------------------..DKTQEKHPKIETYRC..TK............AK..GCKKA.TN-------
H3GA97_PHYRM/27-460----------------------------AGTNIPEVHPSLPSQVC..TKVTNVLGQVDQVDAKVVNCVTE.KS-------
M3ARV6_PSEFD/20-450----------------------------AGTNTAETHPALPISEC..TA............SG...CSTL.DT-------
S8A7U8_DACHA/23-453----------------------------VGTQKAETHPSMSFETC..DG............SG..SCSSN.SG-------
F4RKA1_MELLP/25-454----------------------------.HTTPTEIQPKFNYELC..TK.............K..GCFKH.KG-------
R1GZN3_BOTPV/19-452----------------------------VGTQKSEVHPSLTWQTC..TS............SG...CTTN.QG-------
S3DFW5_GLAL2/20-452----------------------------AGTVTAETHPALTVSQC..TA............SG...CKTS.AQ-------
G4TMW4_PIRID/20-450----------------------------VGTQLAESHPSLSWQKC..TK............SG..GCTNV.AG-------
CBHA_ASPFU/20-450----------------------------VGTQTPETHPPLTWQKC..TA............AG..SCSQQ.SG-------
U7Q430_SPOS1/20-452----------------------------VGKETTETHPKMSWQKC..SG............AG..SCSTV.QG-------
E9G5J5_DAPPU/22-463----------------------------VGTQAAEEPLNLPISVC..TA............PG..NCQTE.AD-------
F4S1M8_MELLP/21-456----------------------------AGTNTPETGPALSVQTC..TK............GG..GCKKT.SS-------
F4S1N8_MELLP/22-461----------------------------AGSKTPEVHPKVTVQQC..SK............GG..SCKDL.SL-------
S7ZJL3_PENO1/20-451----------------------------VGTQKPETHPPLAWKEC..TS............SG...CTSK.DG-------
K5ULV7_PHACS/21-445----------------------------AGTQTPETHPSLSSQKC..TA............SG..GCVTQ.DT-------
N4V9B4_COLOR/24-453----------------------------VGKEQTETHPKLTWQKC..TA............PG..RCSNV.NG-------
G2QNN8_THIHA/23-447----------------------------AGNLQTETHPRLTWSKC..TA............PG..SCQQV.NG-------
R1EEG3_BOTPV/22-455----------------------------VGTQTAETHPKLTTQKC..TT............AG..GCADQ.ST-------
M4BJM4_HYAAE/27-464----------------------------VGTNTKEVHPPLISSRC..SK............TN..GCVHE.TT-------
E3K8C2_PUCGT/23-457----------------------------...KTPENPASFIITDC..GN............GS..KCKEV.SG-------
K3X3U7_PYTUL/24-462----------------------------IGTNQPEVHPALPSQTC..TS............GS..GCTTE.ST-------
F9XAF9_ZYMTI/21-444----------------------------IGTNTPEVNPSLPFSQC..TS............SG...CTKV.NT-------
L2FAS8_COLGN/19-444----------------------------VGTEEAEVHPKLSWSDC..TS.............G..SCSTK.SS-------
K5WIZ5_PHACS/21-445----------------------------AGTQTPETHPTLSSQKC..TT............AG..GCVNQ.ST-------
S8AFI7_DACHA/25-419----------------------------...KTREVHPKVTTYKC..TK............RG..GCKKN.TN-------
E3QH29_COLGM/20-451----------------------------ACKLTAETKPALSWSNC..AA............GG..TCTKV.NA-------
M1WAR4_CLAP2/22-453----------------------------ACSSKPETHPPLSWSRC..SR............SG...CRSV.QG-------
B2ACE0_PODAN/21-453----------------------------VCSLTPESHPPLTWQRC..SA............GG..SCTNV.AG-------
H3G7U3_PHYRM/13-452----------------------------AGSNRAETHPPLTTQTC..TK............AG...CTDE.DT-------
G4NIA4_MAGO7/20-446----------------------------VGTNEPEVHPKMTWKKC..SS............GG..SCSTV.NG-------
G4ULV4_NEUT9/157-586----------------------------VCSLTAETHPSLNWSKC..TS............SG...CTNV.AG-------
F9FY42_FUSOF/22-415----------------------------..DKAKEQHPKLETYRC..TK............AS..GCKKQ.TN-------
B2ASX1_PODAN/25-450----------------------------VGTQQTETHPRITWKRC..TG............KA..NCTTV.QA-------
C7ZHU8_NECH7/20-451----------------------------ACTSTQETHPPLTWSKC..TS............SG...CTEV.SG-------
D8PLS5_SCHCM/21-454----------------------------VGTLQSETHPSLTYQTC..TS............SG...CTSH.NG-------
S8AA61_DACHA/19-434----------------------------PGTLTPEVHPSLPIKTC..AT............NR..GCKTL.NT-------
CBHB_EMENI/26-460----------------------------VGTQQAEVHPGLTWQTC..TS............SG..SCTTV.NG-------
N4V9A4_COLOR/19-434----------------------------.GHFVPEVHPALSWSRC..TS............PG..SCDPV.DG-------
B8NIG8_ASPFN/28-463----------------------------VGTYQTETHPSMTWQTC..GN............GG..SCSTN.QG-------
G1XLC3_ARTOA/25-418----------------------------...KTKEKHPKLETYKC..TK............KG..GCKKQ.TN-------
CELB_EMENI/21-427----------------------------....TPEIRPRLTTYHC..TS............AN..GCTEQ.NT-------
G2QZD9_THITE/20-450----------------------------ACTLTAENHPTLSWSKC..TS............GG..SCTSV.SG-------
G0RYS9_CHATD/25-449----------------------------AGTQQTETHPRLSWKRC..SS............GG..NCQTV.NA-------

PF00139

I1J0Z7_BRADI/24-270--------------------------------------------------------------------------------
M0UWM0_HORVD/54-310--------------------------------------------------------------------------------
K3YQI1_SETIT/31-293--------------------------------------------------------------------------------
D7MX72_ARALL/27-278--------------------------------------------------------------------------------
I1QF95_ORYGL/9-257--------------------------------------------------------------------------------
B9SDJ5_RICCO/21-269--------------------------------------------------------------------------------
M4EIG5_BRARP/19-266--------------------------------------------------------------------------------
I1KL69_SOYBN/32-282--------------------------------------------------------------------------------
I1GT36_BRADI/22-278--------------------------------------------------------------------------------
M4DR71_BRARP/23-281--------------------------------------------------------------------------------
K7UKG6_MAIZE/22-274--------------------------------------------------------------------------------
C5Z960_SORBI/22-274--------------------------------------------------------------------------------
J3MID1_ORYBR/697-950--------------------------------------------------------------------------------
C5YGS5_SORBI/740-993--------------------------------------------------------------------------------
F6HBM8_VITVI/38-285--------------------------------------------------------------------------------
M0ZZ78_SOLTU/22-275--------------------------------------------------------------------------------
J3MID6_ORYBR/47-299--------------------------------------------------------------------------------
I1KL68_SOYBN/57-300--------------------------------------------------------------------------------
B9S3F5_RICCO/21-271--------------------------------------------------------------------------------
B9SXJ7_RICCO/26-271--------------------------------------------------------------------------------
M0VXQ0_HORVD/20-275--------------------------------------------------------------------------------
I1GT33_BRADI/25-286--------------------------------------------------------------------------------
B9SXJ9_RICCO/25-271--------------------------------------------------------------------------------
M7ZXG6_TRIUA/26-279--------------------------------------------------------------------------------
B9SDJ4_RICCO/29-277--------------------------------------------------------------------------------
B9RKX4_RICCO/32-295--------------------------------------------------------------------------------
J3MID3_ORYBR/25-284--------------------------------------------------------------------------------
A9STE4_PHYPA/28-284--------------------------------------------------------------------------------
K7LD59_SOYBN/26-276--------------------------------------------------------------------------------
F6HW43_VITVI/37-287--------------------------------------------------------------------------------
B9SPG3_RICCO/28-274--------------------------------------------------------------------------------
I1I8J5_BRADI/41-316--------------------------------------------------------------------------------
C5WQT3_SORBI/3-256--------------------------------------------------------------------------------
M7Z7K8_TRIUA/24-276--------------------------------------------------------------------------------
M7Z873_TRIUA/26-278--------------------------------------------------------------------------------
I1Q9S6_ORYGL/27-278--------------------------------------------------------------------------------
B9RX67_RICCO/38-289--------------------------------------------------------------------------------
Q7XZX1_ORYSJ/59-312--------------------------------------------------------------------------------
I1H3V1_BRADI/27-275--------------------------------------------------------------------------------
C5YTD3_SORBI/42-297--------------------------------------------------------------------------------
C5WZ65_SORBI/40-297--------------------------------------------------------------------------------
F6HWD4_VITVI/48-292--------------------------------------------------------------------------------
M4C9K1_BRARP/30-282--------------------------------------------------------------------------------
D7L7Q8_ARALL/26-272--------------------------------------------------------------------------------
I1LMH1_SOYBN/27-284--------------------------------------------------------------------------------
I1Q7T2_ORYGL/56-310--------------------------------------------------------------------------------
K7UIK5_MAIZE/47-318--------------------------------------------------------------------------------
B9S3F7_RICCO/27-283--------------------------------------------------------------------------------
Q6Z8M4_ORYSJ/40-308--------------------------------------------------------------------------------
M4F2M7_BRARP/21-273--------------------------------------------------------------------------------
M0Y8Y9_HORVD/24-281--------------------------------------------------------------------------------
B9RX81_RICCO/37-286--------------------------------------------------------------------------------
Q7XUC7_ORYSJ/28-274--------------------------------------------------------------------------------
Q6K8L8_ORYSJ/26-289--------------------------------------------------------------------------------
I1L3I1_SOYBN/35-302--------------------------------------------------------------------------------
M4EJC2_BRARP/29-277--------------------------------------------------------------------------------
F6HWD7_VITVI/37-289--------------------------------------------------------------------------------
F6HW36_VITVI/35-286--------------------------------------------------------------------------------
M1DPR0_SOLTU/22-264--------------------------------------------------------------------------------
K4D2U1_SOLLC/29-283--------------------------------------------------------------------------------
I1H2L8_BRADI/27-276--------------------------------------------------------------------------------
C5XCD6_SORBI/32-291--------------------------------------------------------------------------------
K3Y5L7_SETIT/33-273--------------------------------------------------------------------------------
M1BJQ2_SOLTU/21-281--------------------------------------------------------------------------------
I1LM84_SOYBN/28-267--------------------------------------------------------------------------------
M4CN93_BRARP/29-292--------------------------------------------------------------------------------
Q8H4J3_ORYSJ/28-282--------------------------------------------------------------------------------
B9RX64_RICCO/27-280--------------------------------------------------------------------------------
J3MPZ5_ORYBR/33-302--------------------------------------------------------------------------------
Q84ZH8_ORYSJ/24-276--------------------------------------------------------------------------------
M0YJP2_HORVD/48-317--------------------------------------------------------------------------------
K3Y3M9_SETIT/30-282--------------------------------------------------------------------------------
F6HL81_VITVI/33-286--------------------------------------------------------------------------------
LRK61_ARATH/33-294--------------------------------------------------------------------------------
B9T8H0_RICCO/20-272--------------------------------------------------------------------------------
M1AHJ3_SOLTU/28-281--------------------------------------------------------------------------------
M7YY54_TRIUA/30-272--------------------------------------------------------------------------------
M4CLT1_BRARP/22-275--------------------------------------------------------------------------------
B9SML1_RICCO/44-289--------------------------------------------------------------------------------
M4DP68_BRARP/19-264--------------------------------------------------------------------------------
Q0D8S6_ORYSJ/77-329--------------------------------------------------------------------------------
M8A5Y7_TRIUA/53-300--------------------------------------------------------------------------------
C5Z959_SORBI/30-282--------------------------------------------------------------------------------
LRKS1_ARATH/29-288--------------------------------------------------------------------------------
M4ESL4_BRARP/22-290--------------------------------------------------------------------------------
B9SKY8_RICCO/25-281--------------------------------------------------------------------------------
M4FFA7_BRARP/24-263--------------------------------------------------------------------------------
J3LWI6_ORYBR/44-294--------------------------------------------------------------------------------
K7L999_SOYBN/59-308--------------------------------------------------------------------------------
M7YCL0_TRIUA/32-284--------------------------------------------------------------------------------
D7MR66_ARALL/26-282--------------------------------------------------------------------------------
J3MPZ8_ORYBR/32-293--------------------------------------------------------------------------------
F6GUY7_VITVI/27-280--------------------------------------------------------------------------------
B9HG10_POPTR/32-282--------------------------------------------------------------------------------
B9GZH8_POPTR/30-270--------------------------------------------------------------------------------
B9HCZ3_POPTR/23-280--------------------------------------------------------------------------------
I1JFJ9_SOYBN/45-285--------------------------------------------------------------------------------
I1MX65_SOYBN/42-290--------------------------------------------------------------------------------
M7Y9L8_TRIUA/34-283--------------------------------------------------------------------------------
Q652V6_ORYSJ/38-298--------------------------------------------------------------------------------
Q6ZFB7_ORYSJ/37-281--------------------------------------------------------------------------------
Q6ZIQ8_ORYSJ/39-305--------------------------------------------------------------------------------
Q6ZLL9_ORYSJ/30-291--------------------------------------------------------------------------------
Q7XUN6_ORYSJ/30-280--------------------------------------------------------------------------------
Q84ZI0_ORYSJ/31-304--------------------------------------------------------------------------------
U5G5V7_POPTR/26-278--------------------------------------------------------------------------------
W5AMW1_WHEAT/26-276--------------------------------------------------------------------------------
W5AND9_WHEAT/35-289--------------------------------------------------------------------------------
W5GWA8_WHEAT/27-281--------------------------------------------------------------------------------

PF03388

YQF8_SCHPO/24-250--------------------------------------------------------------------------------
YOC5_SCHPO/23-229--------------------------------------------------------------------------------
EMP47_YEAST/36-253--------------------------------------------------------------------------------
LMAN1_HUMAN/44-269--------------------------------------------------------------------------------
Q9V3A8_DROME/33-259--------------------------------------------------------------------------------
Q9VCC2_DROME/33-258--------------------------------------------------------------------------------
LMAN2_CANFA/52-278--------------------------------------------------------------------------------
Q22170_CAEEL/43-272--------------------------------------------------------------------------------

PF00457

U5MR46_CLOSA/70-253--------------------------------------------------------------------------------
XYNB_ASPFU/42-219--------------------------------------------------------------------------------
XYN3_MAGO7/54-234--------------------------------------------------------------------------------
F8DB45_HALXS/87-262--------------------------------------------------------------------------------
F9XDM7_ZYMTI/45-223--------------------------------------------------------------------------------
M2QR82_CERS8/44-221--------------------------------------------------------------------------------
G7XIG9_ASPKW/42-219--------------------------------------------------------------------------------
A9G323_SORC5/221-397--------------------------------------------------------------------------------
G2QUC8_THITE/35-208--------------------------------------------------------------------------------
E3Q8W7_COLGM/43-217--------------------------------------------------------------------------------
A7EQZ6_SCLS1/49-220--------------------------------------------------------------------------------
K0J5P9_AMPXN/62-246--------------------------------------------------------------------------------
G4TKV8_PIRID/43-220--------------------------------------------------------------------------------
S8ATR1_PENO1/29-208--------------------------------------------------------------------------------
T0MBU2_COLGC/37-214--------------------------------------------------------------------------------
Q2UFR7_ASPOR/71-245--------------------------------------------------------------------------------
F7PGE0_9EURY/60-235--------------------------------------------------------------------------------
M9LS78_PSEA3/38-220--------------------------------------------------------------------------------
G1X5P3_ARTOA/57-231--------------------------------------------------------------------------------
E6UKJ6_RUMA7/55-250--------------------------------------------------------------------------------
G2XS85_BOTF4/46-225--------------------------------------------------------------------------------
C7Q365_CATAD/61-236--------------------------------------------------------------------------------
S7ZJ07_PENO1/39-216--------------------------------------------------------------------------------
E3QVD0_COLGM/44-216--------------------------------------------------------------------------------
G2X5X8_VERDV/37-215--------------------------------------------------------------------------------
C6WIK2_ACTMD/54-231--------------------------------------------------------------------------------
B1ZMX2_OPITP/39-216--------------------------------------------------------------------------------
A9EQP3_SORC5/210-404--------------------------------------------------------------------------------
F4H710_CELFA/52-228--------------------------------------------------------------------------------
S3E0R3_GLAL2/19-199--------------------------------------------------------------------------------
R0K9J6_SETT2/42-213--------------------------------------------------------------------------------
M7TVV3_BOTF1/41-218--------------------------------------------------------------------------------
T0KW32_COLGC/75-251--------------------------------------------------------------------------------
G0S9X3_CHATD/56-233--------------------------------------------------------------------------------
K5X1T9_AGABU/46-223--------------------------------------------------------------------------------
S3DEM3_GLAL2/50-221--------------------------------------------------------------------------------
B8M5E1_TALSN/53-227--------------------------------------------------------------------------------
V5FWP5_BYSSN/38-215--------------------------------------------------------------------------------
D9SP57_CLOC7/41-225--------------------------------------------------------------------------------
A8P4P6_COPC7/104-288--------------------------------------------------------------------------------
Q0UI10_PHANO/28-204--------------------------------------------------------------------------------
Q47QL8_THEFY/52-227--------------------------------------------------------------------------------
G2QWT6_THITE/50-225--------------------------------------------------------------------------------
R6YEV7_9FIRM/39-222--------------------------------------------------------------------------------
Q21G61_SACD2/43-220--------------------------------------------------------------------------------
F7W2U2_SORMK/27-207--------------------------------------------------------------------------------
R4LPY0_9ACTN/53-232--------------------------------------------------------------------------------
XYNB_ASPFN/42-219--------------------------------------------------------------------------------
C9RK54_FIBSS/46-247--------------------------------------------------------------------------------
XYNC_STRCO/61-238--------------------------------------------------------------------------------
S7ZVQ9_PENO1/51-226--------------------------------------------------------------------------------
G4UC47_NEUT9/40-217--------------------------------------------------------------------------------
E3QHP2_COLGM/50-227--------------------------------------------------------------------------------
M1W9A1_CLAP2/39-214--------------------------------------------------------------------------------
A8NZY3_COPC7/34-216--------------------------------------------------------------------------------
G2Q4M3_THIHA/47-221--------------------------------------------------------------------------------
A8NW94_COPC7/49-232--------------------------------------------------------------------------------
E3S3R6_PYRTT/42-215--------------------------------------------------------------------------------
G4TKT5_PIRID/54-231--------------------------------------------------------------------------------
Q2HCI0_CHAGB/40-217--------------------------------------------------------------------------------
I3VTR8_THESW/29-209--------------------------------------------------------------------------------
B3PIN1_CELJU/38-224--------------------------------------------------------------------------------
K5WVZ1_PHACS/44-221--------------------------------------------------------------------------------
G0SAF9_CHATD/37-199--------------------------------------------------------------------------------
G4TKT3_PIRID/54-231--------------------------------------------------------------------------------
S8AJR6_DACHA/43-221--------------------------------------------------------------------------------
M1LSN7_9CLOT/30-211--------------------------------------------------------------------------------
F0XC21_GROCL/46-221--------------------------------------------------------------------------------
A0A0C4EAA2_MAGP6/41-223--------------------------------------------------------------------------------
B2A9I4_PODAN/43-221--------------------------------------------------------------------------------
G2X4G1_VERDV/41-216--------------------------------------------------------------------------------
B8MND2_TALSN/59-232--------------------------------------------------------------------------------
A9GHF8_SORC5/306-501--------------------------------------------------------------------------------
E5A0Q4_LEPMJ/78-250--------------------------------------------------------------------------------
G4U378_PIRID/48-223--------------------------------------------------------------------------------
C9RLL3_FIBSS/44-238--------------------------------------------------------------------------------
B2WG17_PYRTR/46-223--------------------------------------------------------------------------------
XYNA_BACSU/29-211--------------------------------------------------------------------------------
XYNA_EMENI/46-223--------------------------------------------------------------------------------
XYN3_ASPKW/29-208--------------------------------------------------------------------------------
E6UBP6_RUMA7/65-254--------------------------------------------------------------------------------
C7YSL3_NECH7/42-220--------------------------------------------------------------------------------
N1PCA4_DOTSN/49-227--------------------------------------------------------------------------------
G0R947_HYPJQ/52-226--------------------------------------------------------------------------------
G2Q913_THIHA/39-217--------------------------------------------------------------------------------
B2B3J5_PODAN/53-231--------------------------------------------------------------------------------
Q9KEF3_BACHD/29-208--------------------------------------------------------------------------------
Q2GN95_CHAGB/35-214--------------------------------------------------------------------------------
A9EUR0_SORC5/153-329--------------------------------------------------------------------------------
S8AS02_DACHA/46-242--------------------------------------------------------------------------------
U7Q3B8_SPOS1/53-234--------------------------------------------------------------------------------
J3NW75_GAGT3/48-227--------------------------------------------------------------------------------
G4TKT1_PIRID/54-222--------------------------------------------------------------------------------
A0A0D1E285_USTMA/36-218--------------------------------------------------------------------------------
M7SU57_EUTLA/19-190--------------------------------------------------------------------------------
B6QV47_PENMQ/55-228--------------------------------------------------------------------------------
M3CYK1_SPHMS/48-225--------------------------------------------------------------------------------
K1X7K7_MARBU/40-238--------------------------------------------------------------------------------
G2NBA0_STREK/53-228--------------------------------------------------------------------------------
U7PQP8_SPOS1/44-215--------------------------------------------------------------------------------
G0RUP7_HYPJQ/43-221--------------------------------------------------------------------------------
G8LXE2_CLOCD/39-223--------------------------------------------------------------------------------
T0L8D6_COLGC/39-215--------------------------------------------------------------------------------
G2QV82_THITE/46-224--------------------------------------------------------------------------------
Q2H5I3_CHAGB/51-228--------------------------------------------------------------------------------
XYN4_MAGO7/51-228--------------------------------------------------------------------------------
G8LXE2_CLOCD/424-608--------------------------------------------------------------------------------
K1WWU0_MARBU/46-224--------------------------------------------------------------------------------
C7PX63_CATAD/51-229--------------------------------------------------------------------------------
S8AMN0_PENO1/42-221--------------------------------------------------------------------------------
F4FB94_VERMA/40-218--------------------------------------------------------------------------------
E3S9S5_PYRTT/49-227--------------------------------------------------------------------------------
B8NYB7_ASPFN/69-243--------------------------------------------------------------------------------
J3NLQ4_GAGT3/38-211--------------------------------------------------------------------------------
L7VQD8_CLOSH/42-225--------------------------------------------------------------------------------
L0EBB6_THECK/28-208--------------------------------------------------------------------------------
A8FE31_BACP2/38-219--------------------------------------------------------------------------------
G4U379_PIRID/50-216--------------------------------------------------------------------------------
E3Q964_COLGM/44-223--------------------------------------------------------------------------------
C5BU21_TERTT/52-237--------------------------------------------------------------------------------
B8I7X1_CLOCE/38-221--------------------------------------------------------------------------------
A8NKZ6_COPC7/44-228--------------------------------------------------------------------------------
Q11SH7_CYTH3/43-226--------------------------------------------------------------------------------
B8I371_CLOCE/30-210--------------------------------------------------------------------------------
I2FN07_USTH4/36-218--------------------------------------------------------------------------------
G4TKT4_PIRID/54-231--------------------------------------------------------------------------------
C9Z2V1_STRSW/53-229--------------------------------------------------------------------------------
S8AP92_PENO1/40-211--------------------------------------------------------------------------------
T0K1I6_COLGC/42-222--------------------------------------------------------------------------------
C7ZN05_NECH7/1-172--------------------------------------------------------------------------------
XYNC_FIBSS/52-240--------------------------------------------------------------------------------
G1X9B1_ARTOA/43-221--------------------------------------------------------------------------------
A9GEL6_SORC5/142-318--------------------------------------------------------------------------------
K2RN85_MACPH/42-220--------------------------------------------------------------------------------
R4LM27_9ACTN/54-231--------------------------------------------------------------------------------
D5UGI1_CELFN/51-229--------------------------------------------------------------------------------
Q2HI25_CHAGB/36-208--------------------------------------------------------------------------------
XYNC_FIBSS/327-512--------------------------------------------------------------------------------
G4N696_MAGO7/47-225--------------------------------------------------------------------------------
G8SKM4_ACTS5/52-226--------------------------------------------------------------------------------
M2TBN8_COCH5/42-219--------------------------------------------------------------------------------
N1PGQ5_DOTSN/47-227--------------------------------------------------------------------------------
Q7ZA57_GIBZA/50-227--------------------------------------------------------------------------------
B2WK18_PYRTR/41-214--------------------------------------------------------------------------------
S8AF15_DACHA/44-214--------------------------------------------------------------------------------
C5BMU2_TERTT/37-214--------------------------------------------------------------------------------
B6QNP6_PENMQ/54-227--------------------------------------------------------------------------------
U7PKR6_SPOS1/52-230--------------------------------------------------------------------------------
G3XY88_ASPNA/57-232--------------------------------------------------------------------------------
G9NQ12_HYPAI/48-222--------------------------------------------------------------------------------
F7W777_SORMK/45-222--------------------------------------------------------------------------------
Q0UBJ9_PHANO/41-216--------------------------------------------------------------------------------
T0JLP7_COLGC/68-241--------------------------------------------------------------------------------
D8PN69_SCHCM/41-226--------------------------------------------------------------------------------
C7ZC92_NECH7/39-216--------------------------------------------------------------------------------
B8E1P4_DICTD/41-222--------------------------------------------------------------------------------
D1BXH1_XYLCX/54-230--------------------------------------------------------------------------------
F0S4T0_PSESL/87-269--------------------------------------------------------------------------------
G9MV13_HYPVG/54-228--------------------------------------------------------------------------------
Q2HCI7_CHAGB/53-216--------------------------------------------------------------------------------
L0E9J8_THECK/24-202--------------------------------------------------------------------------------
E4N0N4_KITSK/54-229--------------------------------------------------------------------------------
J3PC50_GAGT3/50-229--------------------------------------------------------------------------------
Q0CMZ1_ASPTN/41-218--------------------------------------------------------------------------------
S3D920_GLAL2/48-226--------------------------------------------------------------------------------
E6X8Q5_CELAD/57-241--------------------------------------------------------------------------------
F9F5R3_FUSOF/43-220--------------------------------------------------------------------------------
XYNB_ASPCL/42-219--------------------------------------------------------------------------------
G2Q4S6_THIHA/47-224--------------------------------------------------------------------------------
Q0UBV5_PHANO/22-194--------------------------------------------------------------------------------
G2X8M4_VERDV/40-224--------------------------------------------------------------------------------
H1YIW2_9SPHI/65-249--------------------------------------------------------------------------------
M7STD0_EUTLA/43-222--------------------------------------------------------------------------------
D4LFB0_RUMC1/42-232--------------------------------------------------------------------------------

PF01670

GUNA_ASPKW/28-239--------------------------------------------------------------------------------
G0RRG8_HYPJQ/29-234--------------------------------------------------------------------------------
Q2UFR8_ASPOR/29-239--------------------------------------------------------------------------------
Q9RJY3_STRCO/54-261--------------------------------------------------------------------------------
Q9S5X8_THEMA/18-255--------------------------------------------------------------------------------

PF07675

Q7MUZ4_PORGI/41-208--------------------------------------------------------------------------------
HAGA1_PORGI/230-407--------------------------------------------------------------------------------
F5HGU5_PORGI/47-200--------------------------------------------------------------------------------
Q7MTE2_PORGI/1142-1311--------------------------------------------------------------------------------

PF00629

H3CJZ0_TETNG/591-747--------------------------------------------------------------------------------
F6ZQ08_XENTR/641-801--------------------------------------------------------------------------------
MAMC2_HUMAN/509-665--------------------------------------------------------------------------------
F1Q7F6_DANRE/345-500--------------------------------------------------------------------------------
Q28WN9_DROPS/509-694--------------------------------------------------------------------------------
F6TDH8_CIOIN/81-235--------------------------------------------------------------------------------
F1QL06_DANRE/266-425--------------------------------------------------------------------------------
L9KUF8_TUPCH/628-792--------------------------------------------------------------------------------
AEGP_MOUSE/979-1143--------------------------------------------------------------------------------
F1R3K1_DANRE/3-160--------------------------------------------------------------------------------
Q17E33_AEDAE/237-420--------------------------------------------------------------------------------
PTPRU_HUMAN/27-187--------------------------------------------------------------------------------
MEP1B_RAT/266-429--------------------------------------------------------------------------------
MAMC2_HUMAN/170-328--------------------------------------------------------------------------------
AEGP_HUMAN/813-968--------------------------------------------------------------------------------
H3DMT5_TETNG/350-507--------------------------------------------------------------------------------
AEGP_MOUSE/661-814--------------------------------------------------------------------------------
F6RM13_MACMU/211-367--------------------------------------------------------------------------------
AEGP_MOUSE/67-222--------------------------------------------------------------------------------
ZAN_RABIT/152-314--------------------------------------------------------------------------------
PTPRU_DANRE/26-183--------------------------------------------------------------------------------
PTPRU_CHICK/27-186--------------------------------------------------------------------------------
Q5TG12_HUMAN/36-193--------------------------------------------------------------------------------
B4QA49_DROSI/136-311--------------------------------------------------------------------------------
ALK_HUMAN/480-635--------------------------------------------------------------------------------
F1RDD1_DANRE/748-922--------------------------------------------------------------------------------
AEGP_HUMAN/493-643--------------------------------------------------------------------------------
AEGP_HUMAN/656-808--------------------------------------------------------------------------------
MEP1B_HUMAN/265-428--------------------------------------------------------------------------------
H3CE92_TETNG/270-434--------------------------------------------------------------------------------
F5H0T8_HUMAN/373-535--------------------------------------------------------------------------------
MEP1A_RAT/270-433--------------------------------------------------------------------------------
AEGP_RAT/273-426--------------------------------------------------------------------------------
H3CU29_TETNG/52-210--------------------------------------------------------------------------------
H3DPC5_TETNG/223-385--------------------------------------------------------------------------------
D2HWA9_AILME/125-297--------------------------------------------------------------------------------
NRP1_RAT/650-810--------------------------------------------------------------------------------
H3CQ93_TETNG/344-500--------------------------------------------------------------------------------
PTPRM_HUMAN/27-183--------------------------------------------------------------------------------
Q17E33_AEDAE/18-191--------------------------------------------------------------------------------
B8JKC0_DANRE/268-431--------------------------------------------------------------------------------
AEGP_RAT/817-972--------------------------------------------------------------------------------
F6PMK1_XENTR/270-431--------------------------------------------------------------------------------
Q1RLY9_DANRE/637-803--------------------------------------------------------------------------------
H3BWX9_TETNG/646-802--------------------------------------------------------------------------------
MEP1A_HUMAN/269-432--------------------------------------------------------------------------------
AEGP_MOUSE/494-648--------------------------------------------------------------------------------
Q176I3_AEDAE/155-324--------------------------------------------------------------------------------
NRP1_CHICK/641-800--------------------------------------------------------------------------------
Q7PZL9_ANOGA/167-334--------------------------------------------------------------------------------
AEGP_HUMAN/271-424--------------------------------------------------------------------------------
B0S6D0_DANRE/630-787--------------------------------------------------------------------------------
H3CJZ0_TETNG/58-219--------------------------------------------------------------------------------
ENTK_MOUSE/392-548--------------------------------------------------------------------------------
ZAN_PIG/149-311--------------------------------------------------------------------------------
MAMC2_MOUSE/342-497--------------------------------------------------------------------------------
H3BVJ4_TETNG/269-431--------------------------------------------------------------------------------
F5H4B5_HUMAN/41-203--------------------------------------------------------------------------------
B4HP69_DROSE/94-269--------------------------------------------------------------------------------
Q176I4_AEDAE/127-297--------------------------------------------------------------------------------
A2AJX4_MOUSE/1695-1857--------------------------------------------------------------------------------
ENTK_BOVIN/363-519--------------------------------------------------------------------------------
E9PWQ7_MOUSE/217-373--------------------------------------------------------------------------------
Q28DN2_XENTR/27-183--------------------------------------------------------------------------------
NRP2_HUMAN/646-801--------------------------------------------------------------------------------
F6Q2U5_XENTR/171-329--------------------------------------------------------------------------------
Q9VQS2_DROME/132-307--------------------------------------------------------------------------------

PF00354

SAMP_MOUSE/27-220-E------TD----HV----------------------------------------------------------------
CRP1_LIMPO/33-237-S------PS----FP----------------------------------------------------------------
CRP_XENLA/23-219-V------TT----YA----------------------------------------------------------------
CRP_RABIT/26-221-D------NS----YV----------------------------------------------------------------
CRP_HUMAN/25-220-D------TS----YV----------------------------------------------------------------
SAMP_HUMAN/26-219-V------TD----HV----------------------------------------------------------------
Q542I3_MOUSE/26-221-D------TS----YV----------------------------------------------------------------
FP_CRIMI/26-219-E------SD----YV----------------------------------------------------------------

PF13385

A9V7L7_MONBE/717-870-N.--...NS----YV----------------------------------------------------------------
A9V0U4_MONBE/809-963-N.--...GS----WV----------------------------------------------------------------
A9VE19_MONBE/544-692-N.--...GS----WV----------------------------------------------------------------
A9V0U4_MONBE/590-745-D.--...ND----YV----------------------------------------------------------------
B9JMF4_AGRRK/595-752-N.--...SA----YV----------------------------------------------------------------
C9ZAH4_STRSW/174-331-S.--...HQ----YV----------------------------------------------------------------
B5HCG7_STRPR/182-340-G.--..SYQ----FV----------------------------------------------------------------
D3EBL1_GEOS4/644-797-S.--...DG----YI----------------------------------------------------------------
Q82NZ6_STRAW/693-850-A.--...DG----HV----------------------------------------------------------------
C7Q3C0_CATAD/682-839-A.--...SG----YV----------------------------------------------------------------
C6WP14_ACTMD/1442-1597-G.--...QA----QV----------------------------------------------------------------
A7RQU2_NEMVE/46-196-T.--...AS----SV----------------------------------------------------------------
B3RTE4_TRIAD/419-588-E.--...DG----YA----------------------------------------------------------------
Q11RF9_CYTH3/68-223-Y.--...GN----SI----------------------------------------------------------------
D2AYT0_STRRD/833-984-G.--...ST----YL----------------------------------------------------------------
Q01PZ1_SOLUE/560-711-V.--...SG----QL----------------------------------------------------------------
D0LXW7_HALO1/121-278-G.--...DA----VL----------------------------------------------------------------
A9ERE1_SORC5/156-299-..--...GS----KL----------------------------------------------------------------
A7RK85_NEMVE/111-274-R.--...DG----NV----------------------------------------------------------------
Q7UP09_RHOBA/489-653-G.--...DD----AV----------------------------------------------------------------
D2QJX5_SPILD/494-660-G.--...DD----IL----------------------------------------------------------------
A5G5W5_GEOUR/3125-3280-S.--...ND----YV----------------------------------------------------------------
Q12UM1_METBU/211-367-D.--...SD----VV----------------------------------------------------------------
A5G5W5_GEOUR/2834-2981-A.--...ND----YI----------------------------------------------------------------
Q3A7I8_PELCD/252-409-G.--...SG----YL----------------------------------------------------------------
Q2S986_HAHCH/536-688-S.--...SQ----YI----------------------------------------------------------------
C5BR34_TERTT/286-438-N.--..TDG----YV----------------------------------------------------------------
Q5E1F1_VIBF1/338-497-Q.--...TQ----YI----------------------------------------------------------------
D0LH97_HALO1/423-584-G.--...EA----PN----------------------------------------------------------------
Q2SIZ0_HAHCH/349-511-T.--...SN----SK----------------------------------------------------------------
Q21ES8_SACD2/355-516-T.--...SG----SQ----------------------------------------------------------------
A1U1N6_MARHV/358-517-T.--...SA----SR----------------------------------------------------------------
Q7UQA7_RHOBA/111-269-V.--...HP----AT----------------------------------------------------------------
Q5JEI1_THEKO/104-250-G.--....A----GV----------------------------------------------------------------
D2RI28_ARCPA/205-357-E.--...DD----YV----------------------------------------------------------------
D2QKT6_SPILD/67-225-R.--...NA----YI----------------------------------------------------------------
A7RFD3_NEMVE/591-745-N.--..PKS----YI----------------------------------------------------------------
A5FGU3_FLAJ1/61-211-K.--...AL----EA----------------------------------------------------------------
A5FGS6_FLAJ1/61-211-K.--...AF----QA----------------------------------------------------------------
A5FKP6_FLAJ1/648-806-A.--...GS----YI----------------------------------------------------------------
B1WQC8_CYAA5/1492-1639-G.--..VNT----YI----------------------------------------------------------------
B2J7Y5_NOSP7/1082-1239-Q.--...SD----YV----------------------------------------------------------------
B8GR77_THISH/232-391-S.--...SA----YV----------------------------------------------------------------
A5US22_ROSS1/44-194-G.--...SG----YL----------------------------------------------------------------
B8FIJ2_DESAA/1835-1990-G.--...GG----YI----------------------------------------------------------------
B8FIJ2_DESAA/2139-2295-S.--...GD----YL----------------------------------------------------------------
B8FIJ2_DESAA/3101-3258-S.--...YD----YL----------------------------------------------------------------
B1WQC8_CYAA5/529-689-K.--...QD----YI----------------------------------------------------------------
A0L6L9_MAGMM/6883-7036-T.--...DD----AA----------------------------------------------------------------
A0L6L9_MAGMM/10297-10458-G.--..EAD----TL----------------------------------------------------------------
A0L6L9_MAGMM/11015-11176-G.--...DD----QI----------------------------------------------------------------
A0L6L9_MAGMM/7697-7855-G.--...VD----DV----------------------------------------------------------------
Q11V34_CYTH3/475-632-G.--...TT----YA----------------------------------------------------------------
D1YWM2_METPS/639-793-G.--...ST----YI----------------------------------------------------------------
A9AX01_HERA2/2983-3139-G.--...SG----AI----------------------------------------------------------------
C5CYC7_VARPS/584-746-R.--...TA----GV----------------------------------------------------------------
A9VEK3_MONBE/43-204-AG--..TTS----HV----------------------------------------------------------------
A9UYJ6_MONBE/611-770-A.--...AR----AL----------------------------------------------------------------
A4CID0_ROBBH/183-344-E.--...DS----YL----------------------------------------------------------------
Q01ZJ6_SOLUE/448-593-E.--....T----QI----------------------------------------------------------------
Q112U0_TRIEI/322-477-V.--...DD----YL----------------------------------------------------------------
A9AVC5_HERA2/53-212-G.--...NG----YL----------------------------------------------------------------
C3YCM4_BRAFL/399-559-G.--...AG----RL----------------------------------------------------------------
A9AX01_HERA2/3464-3613-N.--...ND----NL----------------------------------------------------------------
A9AX01_HERA2/1709-1859-L.--...ND----YL----------------------------------------------------------------
A9AX01_HERA2/3687-3839-V.--...ND----GL----------------------------------------------------------------
A9AVE2_HERA2/55-206-G.--...QS----WV----------------------------------------------------------------
A0ZJ67_NODSP/534-687-V.--...ND----YI----------------------------------------------------------------
A9WA06_CHLAA/1561-1710-G.--...ND----YL----------------------------------------------------------------
D2GX75_AILME/1328-1494-GL--EGAFG----TV----------------------------------------------------------------
GPR98_DANRE/1321-1486-GR--PGAYG----SI----------------------------------------------------------------
B3PKP2_CELJU/973-1129-G.--...TS----GV----------------------------------------------------------------
Q21FF7_SACD2/1013-1165-D.--..AGP----GA----------------------------------------------------------------
Q21FF7_SACD2/697-861-G.--...SN----GV----------------------------------------------------------------
B8E3D6_DICTD/93-243-N.--...SG----.V----------------------------------------------------------------
C6D6G1_PAESJ/694-843-N.--...SG----.V----------------------------------------------------------------
Q9KBP7_BACHD/623-775-T.--...TG----.I----------------------------------------------------------------
C7R5J8_JONDD/646-797-G.--...TN----GV----------------------------------------------------------------
C7R5J7_JONDD/547-698-G.--...SN----GV----------------------------------------------------------------
D4J0Z2_BUTFI/89-242-G.--...SY----GL----------------------------------------------------------------
A5GAT0_GEOUR/82-245-SY--.NAFD----FI----------------------------------------------------------------
C6W5Q6_DYAFD/72-233-I.--...DD----VI----------------------------------------------------------------
D5SQB3_PLAL2/445-615-S.--...QP----LI----------------------------------------------------------------
A0C6A9_PARTE/84-241-..--...EQ----YS----------------------------------------------------------------
A4HMI3_LEIBR/697-852-G.--...DG----YV----------------------------------------------------------------
A5JZZ5_PLAVS/101-250-N.--...YI----YI----------------------------------------------------------------
D2W1V6_NAEGR/225-370-K.--...KN----GL----------------------------------------------------------------
Q3A7I8_PELCD/471-622-Y.--...TD----AF----------------------------------------------------------------
B0R0F2_DANRE/89-248-R.--...GD----QL----------------------------------------------------------------
B3RQA7_TRIAD/115-267-E.--...YT----NE----------------------------------------------------------------
D3F200_CONWI/289-437-G.--...AG----HV----------------------------------------------------------------
C6WK26_ACTMD/261-414-A.--...SA----HC----------------------------------------------------------------
A0ZJ64_NODSP/411-564-G.--..FND----YV----------------------------------------------------------------
P73139_SYNY3/1330-1483-G.--...G.----GV----------------------------------------------------------------
D3F0R0_CONWI/85-255-N.--...TT----PL----------------------------------------------------------------
C1F1C3_ACIC5/51-208-G.--...GT----GL----------------------------------------------------------------
B5HK67_STRPR/818-980-T.--..SAA----YA----------------------------------------------------------------
D9TDD0_MICAI/805-962-T.--..ADA----HL----------------------------------------------------------------
Q82GV4_STRAW/292-440-G.--...DQ----AF----------------------------------------------------------------
D2BE74_STRRD/722-881-A.--...GG----HA----------------------------------------------------------------
B5I5M1_9ACTN/761-922-T.--...SS----YA----------------------------------------------------------------
B1VPR2_STRGG/846-1008-N.--...SA----YG----------------------------------------------------------------
B5HSG2_9ACTN/789-950-A.--...SA----YL----------------------------------------------------------------
B1VKK7_STRGG/744-905-G.--..TTG----YA----------------------------------------------------------------
C6WQK6_ACTMD/756-914-T.--...NA----SA----------------------------------------------------------------
C9Z2C7_STRSW/793-953-T.--...TD----HA----------------------------------------------------------------
D2PTR0_KRIFD/729-887-S.--...GG----TV----------------------------------------------------------------
D2PTR0_KRIFD/514-676-T.--..RTA----AV----------------------------------------------------------------
B5H1J2_STRC2/810-972-V.--...DD----HA----------------------------------------------------------------
B5H1J2_STRC2/1032-1193-K.--...DD----YA----------------------------------------------------------------
C6WL54_ACTMD/905-1058-S.--...NQ----YA----------------------------------------------------------------
E6W606_DESIS/780-953-G.--...YT----FL----------------------------------------------------------------
C5C072_BEUC1/602-756-T.--...NS----YG----------------------------------------------------------------
A0L6L9_MAGMM/10522-10674-T.--...NQ----YY----------------------------------------------------------------
D0LH97_HALO1/144-304-V.--..EGH----HV----------------------------------------------------------------
Q12UM1_METBU/421-574-S.--...ND----HV----------------------------------------------------------------
D3SUF1_NATMM/128-286-G.--...FD----RV----------------------------------------------------------------
Q12UM1_METBU/635-797-R.--...TE----YV----------------------------------------------------------------
B1Y080_LEPCP/302-473-T.--...SA----GV----------------------------------------------------------------
Q025I9_SOLUE/271-426-G.--...SQ----WV----------------------------------------------------------------
Q025I9_SOLUE/616-778-S.--...AQ----YL----------------------------------------------------------------
C6XUD8_PEDHD/202-348-S.--...TD----GM----------------------------------------------------------------
E6W633_DESIS/617-776-G.--.....----YI----------------------------------------------------------------
B8FF04_DESAA/2231-2395-A.--...SS----YG----------------------------------------------------------------
C7PKJ2_CHIPD/89-251-N.--..NNA----FI----------------------------------------------------------------
D2PTT7_KRIFD/1092-1258-GS--..NTN----AV----------------------------------------------------------------
D2PTT7_KRIFD/1416-1585-GA--AGTGN----QV----------------------------------------------------------------

PF02973

NANA_STRR6/118-309-E------KE----..----------------------------------------------------------------
Q8CWP8_STRR6/42-227-S------YQ----LN----------------------------------------------------------------
Q8XMG4_CLOPE/50-236-E------YK----DI----------------------------------------------------------------

PF07953

A7GBG3_CLOBL/878-1072-Y------GS----NI----------------------------------------------------------------
F4AAX8_CLOBO/847-1023-K------NT----LI----------------------------------------------------------------
O87710_9CLOT/811-986-K------NT----LV----------------------------------------------------------------
B1INP6_CLOBK/847-1023-K------NT----LV----------------------------------------------------------------
Q8GR96_CLOBO/872-1066-Y------GA----NV----------------------------------------------------------------
BXE_CLOBO/859-1054-Y------DS----NI----------------------------------------------------------------
O69276_CLOBO/816-992-K------NT----SI----------------------------------------------------------------
BXEN_CLOBU/812-988-K------NT----LV----------------------------------------------------------------
Q3ZUA3_9CLOT/40-243-F------NS----SV----------------------------------------------------------------
O06018_CLOBO/848-1024-K------DT----LV----------------------------------------------------------------
Q841S3_CLOBO/880-1071-Y------NA----EV----------------------------------------------------------------
BXA1_CLOBH/885-1079-Y------AS----KI----------------------------------------------------------------
BXG_CLOBO/877-1074-Y------GA----TM----------------------------------------------------------------

PF06439

A3HZT9_9BACT/35-266.GE..NL.DG....WI...PKIQHHE.TGDNYA...............................................
A6LBG6_PARD8/26-215.GK..DL.SN....WN...FV.......VDKNSVP.............................................
B0T1W6_CAUSK/37-271.GK..TL.DG....WT...PKVAKHP.AGENYR...............................................
A4SXW4_POLSQ/31-195.GV..SL.TD....WN...II.......GTAN................................................
A6DIW7_9BACT/14-204.GK..DL.SG....WV...DV.......NTSKA...............................................
A7LWH3_BACO1/242-448.GK..TT.DG....WR...GAKLSTFPAKGW.................................................
A6LFX0_PARD8/51-268.GK..TL.NG....WR...GYCRQDV.PLGW.................................................
Q1IP75_KORVE/134-305.GK..DL.TG....WT...MS.......DPKAT...............................................
Q01PY8_SOLUE/18-214.GK..NL.DG....WS...RLTRHEG.EADHAP...............................................
Q021Z2_SOLUE/148-318.GK..DL.SG....WK...PL.......NPGAE...............................................
A6C286_9PLAN/26-230.GK..NL.DG....WV...QHGGKAK.YD...................................................
A6L9A1_PARD8/27-220.GKNLENANYNPEVWS...ET...........................................................
Q7UXM1_RHOBA/116-314.G...NLADS....WE...GSLDDWTLE....................................................
Q7UGT3_RHOBA/50-260.GK..DL.TG....WS...GDDRLWSVR....................................................
A6DGN3_9BACT/486-705.G......SG....WR...KN...........................................................
Q026J2_SOLUE/86-285.GK..DL.SK....WS...AG..GGR.RGAVAAVT.............................................
A7AJH3_9PORP/62-268.GK..DF.TG....WR...QCNSTGM.ASNW.................................................
A4AVD2_MARSH/28-192.SK..ECFISGDATWN...FI...........................................................
A6CF10_9PLAN/1565-1736.GQ..DL.AG....WT...GNSQLWSVE....................................................
A4Z0W7_BRASO/36-203VGK.....AN....WE...AK...........................................................
Q7URI3_RHOBA/55-252.GS..NL.DA....WR...EYNRDSV.TSGW.................................................
Q022Y3_SOLUE/158-351.GS..NM.NL....WA...KM..KEK.DWLTEDGP.............................................
A3ZYX9_9PLAN/31-241.GQ....GDG....WR...ALGEADF.QNVNCFD..............................................
Q7UYC2_RHOBA/27-225.GK..DL.SG....WA...GNDSFWSVR....................................................
Q08RB4_STIAD/354-520.DG..NA.NG....W.............SVYGG...............................................
B1KP96_SHEWM/43-237.GK..DM.SQ....WR...NFKQQGV.NPKW.................................................
Q7ULY5_RHOBA/53-228.GK..SL.TG....WT...NPYEWGK.TE...................................................
Q9XAM0_STRCO/521-727.GSQESF.AK....WE...QVGGGSF.GL...................................................
A6LD72_PARD8/35-236.GE..TL.DG....WR...DYNGTAL.TGPW.................................................
A5V6S7_SPHWW/38-269.GH..DL.DG....WV...AKINHHP.LGDNAH...............................................
A3ZPX1_9PLAN/148-325.GT..ST.EF....FR...DG..K....L...................................................
A6E8U4_9SPHI/241-449.GR..TT.EG....WR...GAYKSTFPESGW.................................................
Q7UFF8_RHOBA/54-264.....TNAPG....WR...QLDGDDF.VRV..................................................
A4SYN3_POLSQ/50-213.GA..DL.GA....FD...HN.......KDRNGN..............................................
Q01QD3_SOLUE/67-266.GK..DL.SR....WM...Q....HG.RGADRGKD.............................................
Q21G79_SACD2/27-266.GK..NL.DG....WE...PYVSFQP.ETNEYLLVSKHTPR...................................GINN
Q15XP9_PSEA6/43-289.DS..EL.SQ....WN...AWMGVPH.SSVKGLPEG............................................
A7NM29_ROSCS/68-253.GS..DALNG....WR...IVDLEEA.PAERRA...............................................
Q02AV5_SOLUE/47-254.GK..SL.AG....WE...GDPKYWRVE....................................................
Q024T5_SOLUE/20-224.GK..NL.DG....WE...II.......GDGQ................................................
A6CH23_9PLAN/11-222.GSREML.DQKWTYWE...GP.......RFSSSLPI............................................
Q5LID8_BACFN/75-244EGV...........WK...LQ...........................................................
A4AN55_MARSH/13-232.GT..SL.SD....WE...GNRTYWRVE....................................................
Q7UP53_RHOBA/254-436.AD..GL.EG....WT...VREGMEG.EYR..................................................
A3HYW7_9BACT/39-258.GK..SL.DG....WK...GDPTYWSVQ....................................................
Q020M5_SOLUE/283-466.AK..SL.EG....WQ...PR.......GECL................................................
A7LZB4_BACO1/60-285.GE..TF.NG....WR...GYGKDRV.PTKW.................................................
A6L8C0_PARD8/23-196.GK..DS.NK....WK...MTGDVSVQ.....................................................
A4XES2_NOVAD/37-271.GR..DL.DD....WT...IYQDGEG.NRDAHD...............................................
Q024G0_SOLUE/10-210.GK..TS.AG....WL...EITGKPF.PATW.................................................
Q7UP53_RHOBA/88-251.GH..TL.FG....WV...IG.......GNAN................................................
Q7UJ71_RHOBA/62-282.GQ..IL.AG....FE...GDASWFRIE....................................................
A6C9B4_9PLAN/53-240.GK..NL.DK....WK...NG.......DQW.................................................
A0ACR9_STRAM/807-998.GTAASQ.EQ....WQ...HT...........................................................
A6DSM6_9BACT/29-216.EQ..NP.DQ.....K...LS..W....T...................................................
Q9XBE0_AMYOR/795-985.GT..NL.DA....WE...TT...........................................................
A6LB52_PARD8/744-943.GK..DL.TG....WK...GL.......VENPIARAKMKPAQLA............................KAQEQADE
A0M051_GRAFK/45-249.GE..NL.DG....WK...AFNKDSI.SDQW.................................................
A6DM12_9BACT/183-370.AK..AV.GHKLIVTE...EG...........................................................
A4ASP9_MARSH/24-229.GK..SL.DG....WH...SYGKDEI.NDGW.................................................
A4ATY8_MARSH/64-260.GS..NL.DQ....WV...SQ..IDN.TKPAP................................................
A4ASM0_MARSH/38-261.GV..ST.EG....WR...AYNGKAL.PPGW.................................................
Q15XH8_PSEA6/28-257.GE..NL.DG....WT...VKIHHHE.VGDNVD...............................................
A6BZI2_9PLAN/34-270.GK..NL.DGL.YVWN...RDTAYED.PREI.................................................
A6DJ51_9BACT/30-221.GK..TT.NG....WV...NYQSDKL.NPLW.................................................
A3ZYG0_9PLAN/42-220.GK..TL.GD....WK...SVNFGG.......................................................
A6LFJ8_PARD8/58-253.GK..DL.TK....WE...AA..GKD.GGSAK................................................
B4SNA4_STRM5/52-245.GK..DV.SA....WE...SE...Q..GGRVP................................................
Q021Q3_SOLUE/25-318.GK..TL.DG....WQ...QIENSAT.SLATGGITDATAFAARLASGPDAVSEFLRTQLQDVAKGPLPALVKGVNQILAG
A6DFB8_9BACT/988-1186.GK..DL.TG....WA...GDSKLWKVE....................................................
A6CBU4_9PLAN/476-662.GH..DL.SG....WTLKRANREGYHVE....................................................
Q7UTD6_RHOBA/106-307.GK..DL.SG....WH...GQ.......PHFDPYKLAEMSDEERA...........................SKIEEWTA
A4CGG3_ROBBH/26-212.GE..DL.SG....WT...QLGGEAE.YA...................................................
A4AUV7_MARSH/139-306.GK..NL.DG....WQ...AM.......GVNQ................................................
B0T1X3_CAUSK/51-253.GD..DL.DQ....WV...AA..LD..KSPAG................................................
A6C9Y7_9PLAN/38-232.GK..DL.TG....WK...GL.......VGSPKTRAKMSPEELA............................EAQKKADD
A3I2W3_9BACT/58-253.GT..SL.NN....FV...SA..RDG.SSPAE................................................
A6DGC3_9BACT/39-228.GK..DL.SG....WT...VRNGTGT.YR...................................................
A6BYQ3_9PLAN/523-721.GK..SL.RH....WS...GDPQYWSVE....................................................
Q9A9B2_CAUCR/42-285.GR..DL.KD....WD...AWLGYAD.PALTYKRPPVAPLG..................................VTAKS
Q01U12_SOLUE/21-204.DA..SL.KG....WT...RI.......PIPPTDGLKPKLQ..................................WHIDP
Q7UTD6_RHOBA/325-510.GK..TL.EG....WI...GAVADYEVT....................................................
A4ARZ0_MARSH/21-221.GE..DT.SG....WH...IDVPAMD.SIPDAI...............................................
Q01PI7_SOLUE/133-305.GK..DL.TG....WE...PT.......DPAAT...............................................
Q09C00_STIAD/650-816ASR...........W.............TTYGG...............................................
A3ZT25_9PLAN/28-228.GK..TL.NG....WR...GKEQFWSVQ....................................................
A4A1V7_9PLAN/150-329.GS..NL.DA....WM...NA..K....M...................................................
A0YAF8_9GAMM/30-260.GE..DL.DG....WI...VKVRYHP.LGENPS...............................................
A6DSF7_9BACT/22-217.GK..NL.DG....WT...EKTKEGS.FR...................................................
A4BYH9_9FLAO/26-192..............WK...IH...........................................................
A0ACX0_STRAM/280-457.GS..GT.TG....WQ...QAGPGGF.TL...................................................
Q01NY0_SOLUE/48-250.GK..SL.AG....WD...GDPGFWRVE....................................................
A6CCA5_9PLAN/71-236.GH..SL.SG....WK...PN.......NDV.................................................
A3I170_9BACT/40-240.GE..SL.EG....WH...MDVPDLE.ADSSLR...............................................
A7AAJ2_9PORP/957-1147.GT..NM.HE....WT...GNTVDYTLE....................................................
A5IIW8_THEP1/74-230.SP..HVEEG..................VQPDKT..............................................
A7LWH3_BACO1/23-209.GK..NL.KG....WK...KLNGKAE.YK...................................................
Q01WT7_SOLUE/22-227.GK..DL.SG....WR...GR.......QGTYSPHAEALLSKEELA.........................AKQQQWNAE
A6DM09_9BACT/22-216.GQ..DL.QG....WR...NYNSQGI.NGKW.................................................
Q02B64_SOLUE/22-209.GK..TL.NG....WKLVGGHGPGYVVQ....................................................
A6DTC7_9BACT/37-227.....SL.KA....WK...VT.......SSL.................................................
A6CA29_9PLAN/352-540.GK..DY.SG....WK...CNNGKPIAAP...................................................
A6C8Y3_9PLAN/63-235.AKSKEPVEGK..NWS...ET...........................................................
A3XPN2_LEEBM/32-218.GT..SL.DG....WK...QLNGKAA.YR...................................................
A4A0Q4_9PLAN/26-218.GK..DL.SG....WT...QKNGTAT.YV...................................................
A6E8U4_9SPHI/25-211.GK..DL.SG....WK...QLNGKAK.YE...................................................
Q01UN1_SOLUE/9-241.GK..SY.KN....WE...DPTKKSPPSNAF.................................................
A3ZQS2_9PLAN/31-212.GK..SL.AG....WK...IA....E.KGA..................................................
A6DG40_9BACT/159-340.GS..NI.EA....FT...KG..R....I...................................................
A6DLT3_9BACT/234-440.GK..DL.TN....WK...GL.......LDRPFDRPHKRKTLKADK........................LKELQAKADE
A6EKV1_9SPHI/655-832RGS...L.EG....W.............INYGG...............................................
A3ZY13_9PLAN/44-228.ER..DL.QG....WR...PAVCC........................................................
A6DLT3_9BACT/28-216.EKDADLATN....WI...GNTQGYKVE....................................................
Q1AST8_RUBXD/20-211GGG..GL.EG....WS...GLEWGVV.Y....................................................
A4FDZ7_SACEN/121-335.GTPESF.AA....WE...HVGGRGF.AL...................................................
R6X5T3_9PORP/62-257.GK..DL.SA....WQ...NA...K..GGPAE................................................
A6BYS0_9PLAN/54-263.GK..TT.DG....WR...NYKKEGV.SDGW.................................................
Q01XX3_SOLUE/25-191.GK..TL.NG....WK...AN.......EHPE................................................
Q2Y669_NITMU/16-255.GTDKTF.KE....WY...LAGPGGG.GML..................................................
A3ZWI0_9PLAN/615-790.GR..DM.RG....WS...IQ.......GPTL................................................
A3ZR79_9PLAN/39-201.GE..TT.FG....WK...SE.......GKID................................................
A6CAH6_9PLAN/67-283.GE..DF.TG....WK...VP.......EGDNG...............................................
Q01TF2_SOLUE/30-207.GK..DL.SG....WV...NVGHEKWTV....................................................
Q2RZK0_SALRD/15-220.GE..TA.AG....WR...GYNDEDFPDTGW.................................................
A6CGD1_9PLAN/671-851.GK..TF.DG....WH...GNKKIFRIE....................................................
A6C1K2_9PLAN/155-332.GT..ST.DM....LK...GA..E....I...................................................
Q7UTX3_RHOBA/29-219.GS..DL.SG....WV...KRGGSAK.YR...................................................
Q7UYB9_RHOBA/49-246.GK..DL.SG....WR...NPYSHGE.AS...................................................
A3ZS39_9PLAN/38-281.DG..DL.SKHFYTWL...TDGGYED.PRGVF................................................
Q026J8_SOLUE/86-284.GK..DL.SQ....WV...S....RQ.RGGAQTE..............................................
A6EFU0_9SPHI/28-228.GK..TT.AG....WH...TYGQATA.GEKW.................................................
A7AG24_9PORP/243-456.GK..TS.NG....WR...GAGQETFPENGW.................................................
A3ZX11_9PLAN/36-237.GH..DL.SG....WY...GL.......NPHLAAKLDGEEKDK..............................NLRTQRA
A6C3G1_9PLAN/151-333.SD..KA.EQTVKNFE...NG..Q....I...................................................
Q7UWR3_RHOBA/519-700.GK..TL.DG....WN...RKNGTAK.YR...................................................
Q7UZ09_RHOBA/53-231.GK..SF.DG....WE...H.......SGNW.................................................
A3ZQR2_9PLAN/150-327.GA..SA.DA....FE...NG..K....I...................................................
A6C1I1_9PLAN/43-215.GK..DL.TG....WT...VA.......EGGP................................................
A6C5D8_9PLAN/56-241.GG..NFWDH....WK...YI.......SEEEKEANRN.........................................V
A6DGI4_9BACT/22-219.GN..NL.AG....WK...GDLSYWSVK....................................................
Q7UKZ1_RHOBA/77-278.GK..TL.DG....WR...GREDLWSVD....................................................
Q7ULK4_RHOBA/125-306.GTKESA.DA...NWE...NA..R....V...................................................
Q2Y774_NITMU/671-893.GSDAQF.AN....WE...MAGGGSF.SR...................................................
A6C6K0_9PLAN/64-244.GK..NL.DG....WK...VPQFGG.......................................................
A6LCM7_PARD8/20-194.TV..DH.NA....WK...TTGVVVIQN....................................................
Q027F9_SOLUE/8-228.GV..SL.KG....WD...GN.......PKF.................................................
A6DM04_9BACT/25-206.ADELEMNSK....WV...LK...........................................................
Q024Y0_SOLUE/27-212.GN..DL.EG....WR...PS.......EHKD................................................
A6CCA5_9PLAN/239-425.GV..DL.AG....WN...VVPGSQS.TFE..................................................
A3ZTD9_9PLAN/1170-1342.GQ..DL.NG....WN...GDRNLWSVE....................................................
A3I2B6_9BACT/23-203.GQ..NF.EG....WK...IS.......ENPD................................................
A4A0D3_9PLAN/28-213.GK..DL.DG....WV...GAVKGYDVE....................................................
Q7ULY5_RHOBA/234-440.GK..SL.DG....WE...TVGGGTW.TV...................................................
A2U0D4_9FLAO/30-260.GK..NL.DG....WT...PKIAGYA.LGNNYK...............................................
A3ZSI6_9PLAN/804-979.GH..DL.TG....WS...ER.......GAPG................................................
A4ASP0_MARSH/33-262.GK..DL.EG....WT...PKVKGYT.YGENFN...............................................
A6DNR0_9BACT/77-264.GS..NL.DN....FK............NKK.................................................
Q7UTX3_RHOBA/225-416EGARFVLPEE....WS...FTK..........................................................
A4A202_9PLAN/27-207.GK..SF.DG....WK...IN.......ENEK................................................
Q7UYD6_RHOBA/61-249.GK..DL.SG....WT...AK..GG...SCT.................................................
A6DQD4_9BACT/44-244.....DL.SA....WQ...NIYPHG.......................................................
Q7UYI5_RHOBA/85-260.GE..SL.EG....WE...KV.......GRDDS...............................................
A4APB3_MARSH/31-262.GK..DI.AD....WT...TKIHHYE.TGDNHG...............................................
A4CHF9_ROBBH/43-248.GT..SF.DG....WK...GYNQEGV.PDTW.................................................
A6LD40_PARD8/42-255.GK..DF.TG....WK...MFNGGDV..KGW.................................................
Q2GAA2_NOVAD/60-315.GR..DL.TG....WD...SWLGVTV.PATTYGTPSSAPIG..................................LNHDT
A3ZWI1_9PLAN/266-442.GK..DL.TG....WQ...FHATPPRKGKPGGISRPEVPQAIA...............................FDGQTA
A3XQG8_LEEBM/44-246.GT..NI.DK....WH...AYNGGD..PTQW.................................................
Q7UPZ9_RHOBA/40-226.GE..SL.DG....WK...KS.......TENPD...............................................
Q7URK6_RHOBA/266-443.GE..NT.DQ....FT...KA..R....I...................................................
A6LER8_PARD8/252-428.GV..DL.TG....WE...PY.......GTEK................................................
Q7US53_RHOBA/171-350.GK..DL.TG....WV...TH.......EPDKT...............................................
Q026X4_SOLUE/31-258.GAARRLGSA...DWH...AE...........................................................
A3HX26_9BACT/40-244.GN..TF.AG....WH...KYGGGEV.GKAW.................................................
A3HS07_9BACT/30-219.GK..DL.SG....WK...AVAGTAN.FE...................................................
A3ZR79_9PLAN/204-387.GK..DL.TG....WK...TYPAMES.EFT..................................................
A3I0Y0_9BACT/33-262.GN..DL.EN....WV...VKISKHE.VNENFG...............................................
A3ZT60_9PLAN/22-206.GE..TL.EG....WE...GKSEWFHVA....................................................
Q01RN4_SOLUE/31-268.ASFRMLGAA...EWH...AE...........................................................
A6C7J3_9PLAN/515-746.GN..NL.DDVDTILA...TKTPIKD.PDKF.................................................
A3I2F1_9BACT/51-252.GS..DP.SG....WR...AFNGDTF.PEGW.................................................
A4CGG3_ROBBH/243-451.GE..ST.EG....WH...GARLEDFPDYGW.................................................
Q7UXU2_RHOBA/55-243.GSSDDV.KN....WK...NI.......SN..................................................
Q7UGD2_RHOBA/163-356.GS..NT.QA....WQ...NG..K....I...................................................
Q7UYA4_RHOBA/58-260.GS..GL.DA....WK...PF.......SWQWINPND..........................................D

PF00337

Q9VPI7_DROME/41-166-...RP...G----LC----------------------------------------------------------------
Q9VPI7_DROME/226-369-NFLIE...G----SS----------------------------------------------------------------
Q7QF77_ANOGA/4-145-PV.AT...G----HI----------------------------------------------------------------
Q7QF77_ANOGA/165-293-PF.LP...G----HI----------------------------------------------------------------
Q7PPI9_ANOGA/742-883-GM.LI...G----SR----------------------------------------------------------------
Q7QHP5_ANOGA/12-144-GL.SP...G----RM----------------------------------------------------------------
Q18813_CAEEL/34-172-QL.QT...G----QS----------------------------------------------------------------
Q18813_CAEEL/180-310-NF.YV...G----RK----------------------------------------------------------------
LEG8_HUMAN/18-151-QL.DP...G----TL----------------------------------------------------------------
LEG8_HUMAN/186-316-PM.GP...G----RT----------------------------------------------------------------
Q9XVD0_CAEEL/131-257-HF.KL...K----QS----------------------------------------------------------------
B3GTH_ARATH/184-393-GL.TL...G----SH----------------------------------------------------------------
B3GTK_ARATH/190-404-GL.AA...G----SS----------------------------------------------------------------
LEG7_MOUSE/5-135-GV.RV...G----TV----------------------------------------------------------------
LEG3_MOUSE/131-261-GV.MP...R----ML----------------------------------------------------------------
LEG4_CHICK/4-134-GL.KP...G----QR----------------------------------------------------------------
Q7Q2T6_ANOGA/13-143-GL.QP...G----KK----------------------------------------------------------------
Q7PWU9_ANOGA/113-239-EV.SP...G----LC----------------------------------------------------------------
Q7PWU9_ANOGA/285-422-PF.TN...G----RK----------------------------------------------------------------
Q18625_CAEEL/13-145-PL.DA...G----QT----------------------------------------------------------------
LEG9_HUMAN/16-147-GL.QD...G----LQ----------------------------------------------------------------
LEG4_PIG/18-149-GL.RV...G----MS----------------------------------------------------------------
LEG9_HUMAN/226-355-GL.YP...S----KS----------------------------------------------------------------
LEG4_PIG/193-323-GL.VA...R----RT----------------------------------------------------------------
LEC7_CAEEL/10-137-NL.KA...G----VE----------------------------------------------------------------
Q94215_CAEEL/11-140-GM.RE...H----SS----------------------------------------------------------------
Q9VPU6_DROME/164-300-RY.ET...G----TV----------------------------------------------------------------
Q9VPU6_DROME/3-145-EV.PF...G----HV----------------------------------------------------------------
Q7ZZ26_DANRE/9-141-AL.HSCNFV----HT----------------------------------------------------------------
O01329_CAEEL/100-226-GYWDT...G----KI----------------------------------------------------------------
O62353_CAEEL/138-266-QF.NE...G----QS----------------------------------------------------------------
Q18625_CAEEL/153-281-GFLEK...G----QR----------------------------------------------------------------
TECPR_DROME/815-954-GM.PC...G----TE----------------------------------------------------------------
LEG6_CHICK/3-133-DV.QP...G----EC----------------------------------------------------------------
Q9U2I7_CAEEL/14-147-AM.EV...G----DK----------------------------------------------------------------
GRIFN_RAT/4-132-GL.AP...G----WS----------------------------------------------------------------
GRIFN_DANRE/4-133-GL.CP...G----WS----------------------------------------------------------------
Q6AV44_ORYSJ/145-340-GL.GL...G----SH----------------------------------------------------------------
Q84T07_ORYSJ/162-372-GM.GV...G----SH----------------------------------------------------------------
B3GTI_ARATH/190-391-GL.TL...G----SH----------------------------------------------------------------
B3GTF_ARATH/170-363-GL.TQ...G----SS----------------------------------------------------------------
B3GTG_ARATH/165-343-GL.IE...D----SS----------------------------------------------------------------
Q9VPI6_DROME/339-481-SL.VD...G----RC----------------------------------------------------------------
Q8SXU5_DROME/5-142-NA.STSDRV----TR----------------------------------------------------------------
A1ZBB1_DROME/5-138-PL.EF...G----HV----------------------------------------------------------------
A4IHU8_XENTR/12-143-GL.HD...G----FL----------------------------------------------------------------
E7FEQ1_DANRE/97-223-GA.YN...K----ML----------------------------------------------------------------
F1QX26_DANRE/15-145-GL.QD...G----KS----------------------------------------------------------------
F6YWA7_MACMU/6-136-SL.SV...G----SC----------------------------------------------------------------
K1QS74_CRAGI/373-496-RL.QT...G----SW----------------------------------------------------------------
LEG2_HUMAN/7-128-DM.KP...G----ST----------------------------------------------------------------
LEG10_HUMAN/11-136-SL.ST...G----ST----------------------------------------------------------------
LEG12_MOUSE/29-158-GL.YA...G----KM----------------------------------------------------------------
W5JM94_ANODA/12-140-GL.GI...Y----RK----------------------------------------------------------------

PF02210

Q7PSM9_ANOGA/919-1050--------------FK----------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------FR----------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------FS----------------------------------------------------------------
STAN_DROME/1826-1946--------------LR----------------------------------------------------------------
CNTP2_HUMAN/401-529--------------FR----------------------------------------------------------------
G5E9F8_HUMAN/383-516--------------IR----------------------------------------------------------------
Q18291_CAEEL/495-627--------------FR----------------------------------------------------------------
F1RCV3_DANRE/1180-1305--------------VA----------------------------------------------------------------
B4QRF1_DROSI/2162-2289--------------IR----------------------------------------------------------------
B4NSJ9_DROSI/32-158--------------LK----------------------------------------------------------------
STAN_DROME/1584-1736--------------FA----------------------------------------------------------------
G3HJH2_CRIGR/1596-1721--------------IR----------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------FR----------------------------------------------------------------
NRX3A_HUMAN/55-184--------------FK----------------------------------------------------------------
Q8IQH0_DROME/220-342--------------FK----------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------LL----------------------------------------------------------------
NRX1A_BOVIN/58-192--------------LK----------------------------------------------------------------
NRX2A_RAT/57-187--------------LR----------------------------------------------------------------
F1QGG9_DANRE/493-622--------------LR----------------------------------------------------------------
Q22574_CAEEL/415-539--------------FK----------------------------------------------------------------
Q22574_CAEEL/136-267--------------FK----------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------VL----------------------------------------------------------------
Q18291_CAEEL/722-843--------------FR----------------------------------------------------------------
CRUM1_HUMAN/743-860--------------VR----------------------------------------------------------------
CRUM1_MOUSE/513-650--------------FH----------------------------------------------------------------
EGFLA_HUMAN/868-996--------------FK----------------------------------------------------------------
W4YVD3_STRPU/2-125--------------VR----------------------------------------------------------------
Q9VCZ9_DROME/1230-1355--------------FI----------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------FR----------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------MR----------------------------------------------------------------
GAS6_MOUSE/322-451--------------FR----------------------------------------------------------------
NRX2B_RAT/119-268--------------FS----------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------FA----------------------------------------------------------------
CNTP2_HUMAN/216-345--------------FK----------------------------------------------------------------
NRX3A_MOUSE/475-619--------------FR----------------------------------------------------------------
CADN2_DROME/1039-1200--------------FI----------------------------------------------------------------
M9NF15_DROME/1112-1240--------------FR----------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------FK----------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------FK----------------------------------------------------------------
NRX1A_MOUSE/753-884--------------FR----------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------FR----------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------FR----------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------FR----------------------------------------------------------------
COBA2_MOUSE/90-213--------------VR----------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------FK----------------------------------------------------------------
O45000_CAEEL/275-391--------------FR----------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------FR----------------------------------------------------------------
CNTP4_HUMAN/821-940--------------FK----------------------------------------------------------------
F6X197_CIOIN/150-277--------------IR----------------------------------------------------------------
CADN_DROME/2407-2568--------------FI----------------------------------------------------------------
LAMA_DROME/2704-2846--------------FR----------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------VR----------------------------------------------------------------
CADE_DROME/1153-1296--------------IT----------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------LR----------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------FR----------------------------------------------------------------
LAMA_DROME/3379-3514--------------FR----------------------------------------------------------------
LAMA_DROME/2905-3031--------------FK----------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------VR----------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------FA----------------------------------------------------------------
NRX2A_HUMAN/760-890--------------FM----------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------FS----------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------FM----------------------------------------------------------------
F1QQE4_DANRE/1171-1299--------------IA----------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------LR----------------------------------------------------------------
CELR2_RAT/869-995--------------FR----------------------------------------------------------------
CELR3_RAT/1534-1693--------------FA----------------------------------------------------------------
C3ZLC2_BRAFL/400-535--------------FR----------------------------------------------------------------
B4Q5I2_DROSI/631-762--------------FR----------------------------------------------------------------
NRX2A_RAT/949-1077--------------FK----------------------------------------------------------------
NRX4_DROME/824-943--------------FR----------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------FR----------------------------------------------------------------
CADN_DROME/2661-2796--------------FR----------------------------------------------------------------
Q9VZ96_DROME/514-640--------------FR----------------------------------------------------------------
CNTP5_HUMAN/209-338--------------FK----------------------------------------------------------------
G3UNZ8_MELGA/754-882--------------VA----------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------FR----------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------FV----------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------LR----------------------------------------------------------------
CNTP4_MOUSE/400-526--------------FR----------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------FR----------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------FR----------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------FK----------------------------------------------------------------
LAMA_DROME/3083-3205--------------FK----------------------------------------------------------------
Q8MPN3_DROME/3801-3930--------------VR----------------------------------------------------------------
Q19350_CAEEL/789-914--------------MH----------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------LR----------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------IR----------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------VR----------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------IK----------------------------------------------------------------
NRX3A_HUMAN/287-413--------------FK----------------------------------------------------------------
NRX1A_CHICK/364-508--------------FR----------------------------------------------------------------
EGFLA_MOUSE/641-767--------------FR----------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------FK----------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------FM----------------------------------------------------------------
CSPG4_HUMAN/55-178--------------FS----------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------LK----------------------------------------------------------------
Q9VZ96_DROME/698-817--------------FR----------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------FK----------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------FR----------------------------------------------------------------
EYS_DROME/1723-1856--------------LR----------------------------------------------------------------
CNTP5_HUMAN/819-938--------------FK----------------------------------------------------------------
CNTP1_HUMAN/813-939--------------FR----------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------II----------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------LR----------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------LK----------------------------------------------------------------
FAT2_RAT/3802-3923--------------LK----------------------------------------------------------------
F7ER04_CALJA/128-246--------------FK----------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------VR----------------------------------------------------------------
CRB_DROME/1585-1722--------------FR----------------------------------------------------------------
CNTP5_HUMAN/395-521--------------FR----------------------------------------------------------------
CNTP1_RAT/1089-1219--------------FS----------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------II----------------------------------------------------------------
E9PDN6_HUMAN/215-344--------------FK----------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------FT----------------------------------------------------------------
NRX2A_HUMAN/521-666--------------FR----------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------LR----------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------FR----------------------------------------------------------------
CRUM1_HUMAN/514-651--------------FQ----------------------------------------------------------------
NRX3B_HUMAN/117-236--------------FS----------------------------------------------------------------
F1R9W4_DANRE/32-164--------------FR----------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------FR----------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------FT----------------------------------------------------------------
B1AM99_HUMAN/398-522--------------FR----------------------------------------------------------------
LAMA_DROME/3563-3691--------------FR----------------------------------------------------------------
NRX1A_CHICK/789-917--------------FK----------------------------------------------------------------
PROS_RABIT/485-617--------------IR----------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------FK----------------------------------------------------------------
H9H2C7_MELGA/306-434--------------VS----------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------FK----------------------------------------------------------------
CNTP1_HUMAN/203-332--------------FK----------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------FT----------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------IA----------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------FR----------------------------------------------------------------
LAMA3_MOUSE/3183-3308--------------IR----------------------------------------------------------------
Q9VJ82_DROME/55-178--------------FR----------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------FR----------------------------------------------------------------
Q9VJ82_DROME/238-367--------------FR----------------------------------------------------------------
CSPG4_HUMAN/230-363--------------LT----------------------------------------------------------------
Q19617_CAEEL/154-276--------------FR----------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------FR----------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------FA----------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------LR----------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------IR----------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------FK----------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------LR----------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------IS----------------------------------------------------------------
Q18291_CAEEL/906-1035--------------FQ----------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------FS----------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------VR----------------------------------------------------------------
EYS_HUMAN/3007-3141--------------FS----------------------------------------------------------------
Q18291_CAEEL/303-430--------------FK----------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------FR----------------------------------------------------------------
CNTP1_MOUSE/390-516--------------FR----------------------------------------------------------------
A0A0G2JDY0_MOUSE/681-798--------------VR----------------------------------------------------------------
Q9VZ96_DROME/275-414--------------FR----------------------------------------------------------------
C1P641_CAEEL/3508-3630--------------MR----------------------------------------------------------------

PF00054

AGRIN_CHICK/1416-1546--------------FR----------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------FL----------------------------------------------------------------
AGRIN_CHICK/1933-2064--------------IK----------------------------------------------------------------
LAMA1_HUMAN/2920-3051--------------FR----------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------FA----------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------IR----------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------VR----------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------FS----------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------VK----------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------FR----------------------------------------------------------------
CSPG4_RAT/55-182--------------FS----------------------------------------------------------------
AGRIN_RAT/1291-1422--------------FR----------------------------------------------------------------
AGRIN_RAT/1559-1694--------------FL----------------------------------------------------------------
SHBG_RAT/76-206--------------FR----------------------------------------------------------------
CRB_DROME/1048-1183--------------FR----------------------------------------------------------------
AGRIN_RAT/1811-1942--------------LR----------------------------------------------------------------
SLIT_DROME/1204-1335--------------FS----------------------------------------------------------------
PROS_HUMAN/329-459--------------FR----------------------------------------------------------------
CRB_DROME/1281-1443--------------IR----------------------------------------------------------------
SHBG_HUMAN/75-205--------------VR----------------------------------------------------------------
FAT_DROME/4156-4306--------------FA----------------------------------------------------------------

PF00722

XTH8_ARATH/38-224-------F------ED----------------------------------------------------------------
XTH1_ARATH/36-215-------F------DD----------------------------------------------------------------
Q6BHG8_DEBHA/45-215-------K------SP----------------------------------------------------------------
Q6BH77_DEBHA/56-228-------G------QE----------------------------------------------------------------
Q6BH39_DEBHA/52-224-------N------ST----------------------------------------------------------------
Q6BRL2_DEBHA/100-275-------N------SS----------------------------------------------------------------
Q7CTY9_AGRFC/57-234-------N------GA----------------------------------------------------------------
Q7CSS8_AGRFC/263-456-------I------NP----------------------------------------------------------------
EXOK_RHIME/58-245-------N------GG----------------------------------------------------------------
XTH2_SOYBN/32-213-------F------YQ----------------------------------------------------------------
Q6FNU8_CANGA/147-325-------M------LM----------------------------------------------------------------
XTH10_ARATH/37-218-------F------NK----------------------------------------------------------------
CRH2_YEAST/96-273-------N------VS----------------------------------------------------------------
CRR1_ASHGO/155-333-------M------LE----------------------------------------------------------------
XTH13_ARATH/26-207-------F------YD----------------------------------------------------------------
Q7XTP9_ORYSJ/31-215-------M------TD----------------------------------------------------------------
Q6ES26_ORYSJ/32-215-------F------YE----------------------------------------------------------------
XTH31_ARATH/39-223-------F------DR----------------------------------------------------------------
Q5AXN2_EMENI/49-224-------T------LD----------------------------------------------------------------
Q6FWX2_CANGA/97-274-------N------AS----------------------------------------------------------------
XTH33_ARATH/43-226-------I------EN----------------------------------------------------------------
GUB_BACSU/54-238-------N------GN----------------------------------------------------------------
Q6ZAN9_ORYSJ/28-212-------L------TN----------------------------------------------------------------
Q7XNY6_ORYSJ/36-222-------F------RE----------------------------------------------------------------
Q6Z2L4_ORYSJ/35-220-------F------EE----------------------------------------------------------------
Q6RHY1_SOLLC/27-212-------F------NK----------------------------------------------------------------
Q6CIZ6_KLULA/49-219-------E------SS----------------------------------------------------------------
Q84T83_ORYSJ/36-221-------F------DE----------------------------------------------------------------
Q8H7Q1_ORYSJ/3-189-------F------GE----------------------------------------------------------------
Q8GVQ2_ORYSJ/40-224-------F------GD----------------------------------------------------------------
Q6C4P9_YARLI/48-219-------P------SD----------------------------------------------------------------
CRH1_YEAST/65-235-------S------SK----------------------------------------------------------------
XTH17_ARATH/29-211-------F------HK----------------------------------------------------------------
Q6ZAN8_ORYSJ/30-214-------M------TD----------------------------------------------------------------
XTH2_ARATH/32-212-------F------DV----------------------------------------------------------------
Q8GVR3_ORYSJ/46-232-------F------SR----------------------------------------------------------------
XTH28_ARATH/31-216-------F------DE----------------------------------------------------------------
Q7SGL2_NEUCR/50-224-------T------PK----------------------------------------------------------------
Q5KNP5_CRYNJ/97-278-------N------AT----------------------------------------------------------------
Q6YUP5_ORYSJ/36-221-------F------DE----------------------------------------------------------------
Q9FZ05_SOLLC/27-209-------F------DQ----------------------------------------------------------------
Q825L5_STRAW/78-287-------H------ER----------------------------------------------------------------
UTR2_CANAL/100-275-------N------ST----------------------------------------------------------------
Q7S222_NEUCR/48-222-------G------AD----------------------------------------------------------------
Q6Z998_ORYSJ/39-226-------M------YD----------------------------------------------------------------
Q7N1F8_PHOLL/52-255-------L------GV----------------------------------------------------------------
Q97FD3_CLOAB/57-242-------N------GN----------------------------------------------------------------
CRR1_YEAST/147-325-------M------LE----------------------------------------------------------------
Q7XBU8_ORYSJ/32-215-------F------DA----------------------------------------------------------------
XTH32_ARATH/43-227-------F------YK----------------------------------------------------------------
XTH26_ARATH/29-208-------F------SK----------------------------------------------------------------
Q82M60_STRAW/400-624-------G------ES----------------------------------------------------------------
Q6K9X1_ORYSJ/50-242-------F------GR----------------------------------------------------------------
XTH21_ARATH/28-209-------F------NQ----------------------------------------------------------------
Q7S7D0_NEUCR/61-233-------D------QA----------------------------------------------------------------
XTH25_ARATH/30-211-------F------DT----------------------------------------------------------------
Q6FSM3_CANGA/48-218-------E------SK----------------------------------------------------------------
Q6ES25_ORYSJ/25-208-------F------RD----------------------------------------------------------------
Q5Z746_ORYSJ/26-208-------F------QD----------------------------------------------------------------
CRH11_CANAL/50-220-------L------GP----------------------------------------------------------------
Q5B4L5_EMENI/96-273-------N------AT----------------------------------------------------------------
Q5Z6H1_ORYSJ/36-217-------F------HR----------------------------------------------------------------
XTH24_ARATH/24-205-------F------NT----------------------------------------------------------------
Q98C78_RHILO/80-268-------N------GS----------------------------------------------------------------
Q7SBQ2_NEUCR/99-274-------D------PS----------------------------------------------------------------
Q8XNF8_CLOPE/412-635-------G------MV----------------------------------------------------------------
XTH1_SOLLC/33-214-------F------WK----------------------------------------------------------------
Q7XTP8_ORYSJ/24-207-------I------DE----------------------------------------------------------------
Q6CL87_KLULA/145-322-------M------LR----------------------------------------------------------------
XTH3_ARATH/35-213-------F------GQ----------------------------------------------------------------
GUB_CLOTH/57-238-------.------GS----------------------------------------------------------------
B9RG34_RICCO/58-238-------.------GR----------------------------------------------------------------
C5Z8T4_SORBI/33-213-------.------YQ----------------------------------------------------------------
D3EBX7_GEOS4/64-257-------.------.L----------------------------------------------------------------
D7SNC1_VITVI/38-220-------.------NQ----------------------------------------------------------------
E7FHE7_PYRFU/86-290-------.------..----------------------------------------------------------------
F2D903_HORVD/30-212-------.------DD----------------------------------------------------------------
F2DT99_HORVD/27-208-------.------YD----------------------------------------------------------------
F2DUU5_HORVD/27-204-------.------..----------------------------------------------------------------
G2XIS4_VERDV/50-220-------.------GE----------------------------------------------------------------
G4NC59_MAGO7/98-270-------.------..----------------------------------------------------------------
K4DD58_SOLLC/24-203-------.------YQ----------------------------------------------------------------
M1AN43_SOLTU/24-201-------.------TD----------------------------------------------------------------
M4EZF0_BRARP/17-194-------.------EE----------------------------------------------------------------
Q5L861_BACFN/78-272-------.------..----------------------------------------------------------------
Q9WXN1_THEMA/253-454-------.------..----------------------------------------------------------------
T0UMT6_9STRE/50-231-------.------GG----------------------------------------------------------------
V4IZ43_9ACTN/74-282-------.------ES----------------------------------------------------------------
W5I2U1_WHEAT/24-204-------F------DK----------------------------------------------------------------

PF03935

Q6BW61_DEBHA/174-674-YEGDDQF------FQ----------------------------------------------------------------
Q0UQN1_PHANO/94-573-YEGDDPY------FY----------------------------------------------------------------
A5DEX4_PICGU/157-655-YDGDDQF------FT----------------------------------------------------------------
A1C6M7_ASPCL/154-653-YDGDDPF------YQ----------------------------------------------------------------
Q752M9_ASHGO/153-654-FEGDDQF------WT----------------------------------------------------------------
Q5KJ60_CRYNJ/92-619-FEGDDPF------WT----------------------------------------------------------------
A0A0D1DSS3_USTMA/148-679-WPGDDPF------WE----------------------------------------------------------------
A5DZI8_LODEL/240-745-YDGDDQF------FT----------------------------------------------------------------
A0A0D1CCS8_USTMA/384-919-YPGDDPF------WT----------------------------------------------------------------
A0A0D1CPF2_USTMA/197-732-YPGDDPF------WE----------------------------------------------------------------
YEPB_SCHPO/124-627-YSGNDQF------WE----------------------------------------------------------------
YEOB_SCHPO/134-636-YDGDDQF------WL----------------------------------------------------------------
A7TTP7_VANPO/229-744-YDGDDQF------WT----------------------------------------------------------------
A5DZ87_LODEL/332-841-YEGDDQF------FT----------------------------------------------------------------
Q6FUB1_CANGA/183-684-YDGEDQF------WT----------------------------------------------------------------
A7E6J8_SCLS1/168-668-YDGDDPF------FQ----------------------------------------------------------------
Q5AEC0_CANAL/212-718-YEGDDQF------WT----------------------------------------------------------------
A3LPW0_PICST/189-695-YEGDDQF------FT----------------------------------------------------------------
A7EWT0_SCLS1/211-717-YPGDDPF------WT----------------------------------------------------------------
Q5KHK4_CRYNJ/69-588-FPGDDPF------WT----------------------------------------------------------------
Q0UKL9_PHANO/161-653-YDGDDPY------FQ----------------------------------------------------------------
A3LPU3_PICST/148-653-YDGDDQF------FT----------------------------------------------------------------
Q6FQ11_CANGA/223-736-YDGDDQF------WT----------------------------------------------------------------
E7LUU1_YEASV/250-763-YDGDDQF------WT----------------------------------------------------------------
M7NJX3_PNEMU/194-674-YPGDDQF------WE----------------------------------------------------------------
Q5A4H2_CANAL/99-596-YEGDDQF------FT----------------------------------------------------------------

PF10287

K0KZR6_WICCF/233-464------SD------WE----------------------------------------------------------------
I2H1W8_TETBL/107-341------SD------WT----------------------------------------------------------------
D0N3P2_PHYIT/250-486------GS------WP----------------------------------------------------------------
A7TFI3_VANPO/109-343------VS------WD----------------------------------------------------------------
N1PMX9_DOTSN/238-461------.G------WT----------------------------------------------------------------
G0VAP6_NAUCC/104-338------SD------WT----------------------------------------------------------------
S9W8F8_SCHCR/234-466------SD------WV----------------------------------------------------------------
C5GJ05_AJEDR/167-389------GN------WG----------------------------------------------------------------
K3W690_PYTUL/247-486------GP------WT----------------------------------------------------------------
I2GUP8_TETBL/154-386------SS------WS----------------------------------------------------------------
A5DXV9_LODEL/227-457------GA------WT----------------------------------------------------------------
C4XY08_CLAL4/110-342------GT------WQ----------------------------------------------------------------
M3A440_PSEFD/207-432------SG------WT----------------------------------------------------------------
D0MRW8_PHYIT/313-551------SD------WT----------------------------------------------------------------
W1QLM9_OGAPD/217-448------SG------WS----------------------------------------------------------------
C5DKG4_LACTC/102-336------AD------WN----------------------------------------------------------------
J7R3E5_KAZNA/106-340------SA------WT----------------------------------------------------------------
G0VBJ0_NAUCC/237-460------GS------WQ----------------------------------------------------------------
I2H8C5_TETBL/275-505------GS------WI----------------------------------------------------------------
Q75A62_ASHGO/259-490------SG------WK----------------------------------------------------------------
E3RIT6_PYRTT/99-331------SN------WS----------------------------------------------------------------
B6JWV1_SCHJY/233-464------GS------WS----------------------------------------------------------------
A5DNR6_PICGU/97-330------.N------WD----------------------------------------------------------------
G8Y3C3_PICSO/237-463------GD------WE----------------------------------------------------------------
C5M9J2_CANTT/224-453------GA------WT----------------------------------------------------------------
G3AKA2_SPAPN/103-336------GE------FT----------------------------------------------------------------
G3ARF7_SPAPN/199-428------SA------WV----------------------------------------------------------------
G3JJN7_CORMM/201-421------QA------WD----------------------------------------------------------------
C7YIC0_NECH7/221-441------GA------WS----------------------------------------------------------------
Q0UV14_PHANO/96-328------AD------WN----------------------------------------------------------------
K0KM65_WICCF/142-376------SG------WT----------------------------------------------------------------
G1XB81_ARTOA/196-429------..------WK----------------------------------------------------------------
M1W9S2_CLAP2/235-455------SD------WD----------------------------------------------------------------
Q6FJK5_CANGA/212-435------GD------WS----------------------------------------------------------------
R1ESJ6_BOTPV/247-467------GS------WK----------------------------------------------------------------
D0N6Y2_PHYIT/175-409------GT------WA----------------------------------------------------------------
C5DIE9_LACTC/221-452------SG------WN----------------------------------------------------------------
G8BET5_CANPC/99-332------GD------WT----------------------------------------------------------------
G8JQC7_ERECY/209-441------SA------WK----------------------------------------------------------------
E3G0R9_STIAD/153-380------AS------WK----------------------------------------------------------------
C4R9F6_PICPG/189-423------GS------WS----------------------------------------------------------------
L8G239_PSED2/205-429------AA------YT----------------------------------------------------------------
A7TMJ4_VANPO/222-451------SG------WT----------------------------------------------------------------
C5DXY8_ZYGRC/256-484------GS------WS----------------------------------------------------------------
G3B3K2_CANTC/207-428------GD------WE----------------------------------------------------------------
G0W356_NAUDC/104-338------SD------WS----------------------------------------------------------------
Q7SG43_NEUCR/112-341------GS------YS----------------------------------------------------------------
K3WLE5_PYTUL/196-423------SS------WI----------------------------------------------------------------
S3DKR2_GLAL2/298-524------GV------YQ----------------------------------------------------------------
F2PH39_TRIEC/193-423------GQ------WG----------------------------------------------------------------
M2N8D8_BAUCO/220-449------..------WS----------------------------------------------------------------
Q6BRM6_DEBHA/197-423------GD------WE----------------------------------------------------------------
C5M5H0_CANTT/101-334------GN------WN----------------------------------------------------------------
G8ZNQ8_TORDC/230-458------GA------WV----------------------------------------------------------------
D5GIX3_TUBMM/208-444------GT------FK----------------------------------------------------------------
A3LP10_PICST/207-435------GD------WV----------------------------------------------------------------
R4XDU4_TAPDE/242-471------.V------WE----------------------------------------------------------------
A7TGR9_VANPO/102-336------AD------WT----------------------------------------------------------------
H3H0J0_PHYRM/316-553------GS------WS----------------------------------------------------------------
Q757Z0_ASHGO/117-351------GS------WQ----------------------------------------------------------------
Q5AJN2_CANAL/226-456------GA------WT----------------------------------------------------------------
M3D6U8_SPHMS/213-438------SG------WN----------------------------------------------------------------
H3GMI5_PHYRM/341-578------SD------WS----------------------------------------------------------------
I2H9Q2_TETBL/105-339------SD------WT----------------------------------------------------------------
G8ZYU9_TORDC/104-337------SD------WT----------------------------------------------------------------
S0DQ79_GIBF5/217-437------GH------WK----------------------------------------------------------------
M4BGZ3_HYAAE/337-572------.T------WT----------------------------------------------------------------
F9XBT5_ZYMTI/245-464------GN------WA----------------------------------------------------------------
G8BXS9_TETPH/170-397------SS------WN----------------------------------------------------------------
H2AXG7_KAZAF/104-337------DS------WT----------------------------------------------------------------
U4LN65_PYROM/147-371------GG------MS----------------------------------------------------------------
J7RTK3_KAZNA/245-466------GS------WE----------------------------------------------------------------
C5FXD0_ARTOC/196-427------GE------WG----------------------------------------------------------------
Q6CGN1_YARLI/220-451------SD------WK----------------------------------------------------------------
G2WT64_VERDV/218-439------GD------YT----------------------------------------------------------------
Q6FJ92_CANGA/109-343------QS------WN----------------------------------------------------------------
G4U9Y4_NEUT9/21-245------GS------YE----------------------------------------------------------------
E4ZV72_LEPMJ/267-498------.D------WS----------------------------------------------------------------
G8BU49_TETPH/100-334------DD------WS----------------------------------------------------------------
W1QLK8_OGAPD/133-365------GS------WS----------------------------------------------------------------
G8JX30_ERECY/121-347------GD------WE----------------------------------------------------------------
Q6CXP7_KLULA/106-342------TS------WS----------------------------------------------------------------
C4JID9_UNCRE/192-415------GE------WG----------------------------------------------------------------
Q6CVS7_KLULA/216-447------SA------WN----------------------------------------------------------------
H2AXG9_KAZAF/107-341------SS------WS----------------------------------------------------------------
A7TQU3_VANPO/143-371------SA------WQ----------------------------------------------------------------
K3XBG2_PYTUL/358-594------GT------FS----------------------------------------------------------------
M7SLD2_EUTLA/204-432------.D------FE----------------------------------------------------------------
R7YJQ9_CONA1/229-450------GD------WS----------------------------------------------------------------
H6BRJ0_EXODN/215-434------GQ------WG----------------------------------------------------------------
K3X9Z2_PYTUL/110-344------GS------WN----------------------------------------------------------------
L2FRA0_COLGN/221-441------GE------YS----------------------------------------------------------------
Q7SG41_NEUCR/178-394------..------AS----------------------------------------------------------------
A5DBA4_PICGU/200-428------GD------WE----------------------------------------------------------------
K2RHU7_MACPH/245-465------GE------WK----------------------------------------------------------------
Q7SG42_NEUCR/163-390------GS------YN----------------------------------------------------------------
YH6B_SCHPO/264-495------SD------WG----------------------------------------------------------------
J8Q0R9_SACAR/105-339------SD------WS----------------------------------------------------------------
K1XZI2_MARBU/332-545------HS------FK----------------------------------------------------------------
F0UMR1_AJEC8/199-421------GN------WA----------------------------------------------------------------
I2H2C5_TETBL/110-343------TS------WT----------------------------------------------------------------
E9EMJ7_METRA/226-457------SD------WD----------------------------------------------------------------
G3AYC4_CANTC/101-337------ED------WE----------------------------------------------------------------
H2AVQ7_KAZAF/220-440------GA------WE----------------------------------------------------------------
E4UXS3_ARTGP/195-422------GK------WG----------------------------------------------------------------
U1HUX4_ENDPU/201-424------GQ------WG----------------------------------------------------------------
A7F2W5_SCLS1/255-477------GS------YS----------------------------------------------------------------
C4R2B9_PICPG/119-353------AT------WE----------------------------------------------------------------
F2SIK0_TRIRC/197-428------GQ------WG----------------------------------------------------------------
C4Y1A3_CLAL4/229-457------GD------WT----------------------------------------------------------------

PF00840

K1WCU0_MARBU/20-452-SIVVDAN------WR----------------------------------------------------------------
G3XZK9_ASPNA/20-448-SVVIDSN------WR----------------------------------------------------------------
F4PY37_DICFS/22-455-EIVIDAN------WR----------------------------------------------------------------
G1XV93_ARTOA/22-459-KIVVDAN------WR----------------------------------------------------------------
L8WSW0_THACA/22-455-KIVLDAN------WR----------------------------------------------------------------
G2QZA7_THITE/22-417-SVVLDSS------AR----------------------------------------------------------------
E4ZFU3_LEPMJ/20-452-KVVIDAN------WR----------------------------------------------------------------
M2UA27_COCH5/21-452-SIVLDSN------WR----------------------------------------------------------------
E3L6D5_PUCGT/29-447-SVTLDAD------IR----------------------------------------------------------------
S3D4J2_GLAL2/21-452-KVVIDSN------WR----------------------------------------------------------------
I1FU52_AMPQE/20-456-SIVLDSN------WR----------------------------------------------------------------
B6QIG2_PENMQ/28-458-SIVLDAN------WR----------------------------------------------------------------
G2WXB9_VERDV/20-447-SVVVDAN------WR----------------------------------------------------------------
Q7S390_NEUCR/20-440-SLVLDSD------YR----------------------------------------------------------------
V2WZE7_MONRO/22-456-SVVLDSN------WR----------------------------------------------------------------
A7EUL3_SCLS1/19-449-SIVLDGN------WR----------------------------------------------------------------
S3CP84_GLAL2/21-459-SLVLDAE------WR----------------------------------------------------------------
N4UZJ1_COLOR/19-440-EVVIDAN------WR----------------------------------------------------------------
G7XKW4_ASPKW/24-460-AVVIDAN------WR----------------------------------------------------------------
F7W7F9_SORMK/30-440-YLVADSR------HR----------------------------------------------------------------
G2YS63_BOTF4/20-452-SIVVDAN------WR----------------------------------------------------------------
E3K8B1_PUCGT/22-457-GLTIDAN------WR----------------------------------------------------------------
Q55FE6_DICDI/22-455-EVVVDAN------WR----------------------------------------------------------------
M2N728_BAUCO/20-450-TIVLDAN------WR----------------------------------------------------------------
R8BSD2_TOGMI/20-444-EVVIDAN------WR----------------------------------------------------------------
G2Q359_THIHA/20-453-TVVLDAN------WR----------------------------------------------------------------
G4V088_NEUT9/21-421-SIVLDAF------QR----------------------------------------------------------------
B2AQ71_PODAN/25-431-SLVTDAL------SR----------------------------------------------------------------
S7ZRD6_PENO1/28-461-SVVIDAN------WR----------------------------------------------------------------
CBHB_ASPFU/29-463-KVVIDAN------WR----------------------------------------------------------------
U4LWF8_PYROM/21-452-KVVLDSN------WR----------------------------------------------------------------
F7W4B0_SORMK/24-424-LITIDAF------QR----------------------------------------------------------------
G2WQW0_VERDV/20-447-EIVIDAN------WR----------------------------------------------------------------
B2A8V6_PODAN/19-451-EVVLDAN------WR----------------------------------------------------------------
R8BMF8_TOGMI/19-453-SVVLDAN------WR----------------------------------------------------------------
L2FC27_COLGN/19-441-EITIDAE------YR----------------------------------------------------------------
H1W5V0_COLHI/19-443-EVVIDAN------WR----------------------------------------------------------------
A0A0C4ECL7_MAGP6/30-424-ALVIDSL------AH----------------------------------------------------------------
M2QWB1_CERS8/85-519-SVVLDAN------WR----------------------------------------------------------------
D8QBJ3_SCHCM/21-453-AITIDAN------WR----------------------------------------------------------------
E3KSU8_PUCGT/22-454-GATIDAN------WR----------------------------------------------------------------
U4L139_PYROM/20-454-SVVLDSN------WR----------------------------------------------------------------
S3CAD2_OPHP1/20-451-AVVLDAN------YR----------------------------------------------------------------
G0S477_CHATD/21-451-AVTIDAN------WR----------------------------------------------------------------
C7ZHP8_NECH7/23-415-YIVMESS------QH----------------------------------------------------------------
R0K7Q4_SETT2/24-451-EIVIDAN------WR----------------------------------------------------------------
M4BUX1_HYAAE/30-470-SVVLDSN------WR----------------------------------------------------------------
G2WZP1_VERDV/20-456-SVVLDSN------WR----------------------------------------------------------------
N4UQR7_COLOR/21-445-EITVDAE------FR----------------------------------------------------------------
U7Q8V8_SPOS1/21-424-SLVTDAL------SR----------------------------------------------------------------
A0A0C4EX39_PUCT1/27-447-GITLDAN------WR----------------------------------------------------------------
A0A0C4E9V9_MAGP6/27-444-KIVAKAE------NH----------------------------------------------------------------
B6HC69_PENCW/20-452-SVVIDSN------WR----------------------------------------------------------------
Q2GUM4_CHAGB/23-447-EVVIDAN------WR----------------------------------------------------------------
U7PKV6_SPOS1/26-451-EIVIDAN------WR----------------------------------------------------------------
K1WM38_MARBU/21-461-KVVLDSN------WR----------------------------------------------------------------
G0RVK1_HYPJQ/20-446-SVVIDAN------WR----------------------------------------------------------------
H3G8U1_PHYRM/34-471-SVVLDAN------WR----------------------------------------------------------------
M7SVI4_EUTLA/21-454-TVVIDSN------WR----------------------------------------------------------------
A0A0C4DNY4_MAGP6/20-447-EVTIDAN------WR----------------------------------------------------------------
R8BQZ2_TOGMI/20-451-EVVIDSN------WR----------------------------------------------------------------
S3D235_GLAL2/20-454-KIVLDSN------WR----------------------------------------------------------------
F0XKB1_GROCL/20-444-EVVVDAN------WR----------------------------------------------------------------
C7YH34_NECH7/20-451-SVVVDAN------WR----------------------------------------------------------------
F9FPS1_FUSOF/20-451-SVVIDAN------WR----------------------------------------------------------------
CBHA_EMENI/20-446-SVVLDSN------WR----------------------------------------------------------------
F4RKA2_MELLP/26-456-SVTLDAT------YR----------------------------------------------------------------
A0A0C4EZJ7_PUCT1/22-425-GATIDAN------WR----------------------------------------------------------------
G4N143_MAGO7/22-445-EVVIDAN------WR----------------------------------------------------------------
E3JU73_PUCGT/29-437-SITLDAN------WR----------------------------------------------------------------
L8WJB0_THACA/84-513-KVVLDAN------WR----------------------------------------------------------------
M7TJ66_BOTF1/21-446-SIVLDAN------WR----------------------------------------------------------------
F4S1M9_MELLP/23-458-SVTLDAN------WR----------------------------------------------------------------
M5BZ75_THACB/20-450-KIVLDSN------WR----------------------------------------------------------------
CELB_ASPFN/20-414-SVVLDAA------TH----------------------------------------------------------------
K5WYE3_AGABU/21-450-KVVLDAN------WR----------------------------------------------------------------
F4RTE7_MELLP/22-447-TVTLDSK------WR----------------------------------------------------------------
N1PY93_DOTSN/21-450-SITLDAN------WR----------------------------------------------------------------
F0ZJZ1_DICPU/21-454-EIVIDAN------WR----------------------------------------------------------------
G4NI68_MAGO7/22-416-YIVIDSL------AH----------------------------------------------------------------
H1VQX8_COLHI/20-456-SVVLDSN------WR----------------------------------------------------------------
M2SZK0_COCSN/20-452-EVVVDAN------WR----------------------------------------------------------------
D0N841_PHYIT/25-462-SIVLDAN------WR----------------------------------------------------------------
A8NU36_COPC7/21-457-QVVLDAN------WR----------------------------------------------------------------
L2FY65_COLGN/20-452-AITVDAN------WR----------------------------------------------------------------
G4MMG0_MAGO7/20-450-SVTIDAN------WR----------------------------------------------------------------
A0A016PHW6_GIBZA/22-419-YIVADAE------LH----------------------------------------------------------------
H3GA97_PHYRM/27-460-SVVIDAN------WR----------------------------------------------------------------
M3ARV6_PSEFD/20-450-SITLDAN------WR----------------------------------------------------------------
S8A7U8_DACHA/23-453-EVVIDAN------WR----------------------------------------------------------------
F4RKA1_MELLP/25-454-TVTADVS------YR----------------------------------------------------------------
R1GZN3_BOTPV/19-452-SIVVDAN------WR----------------------------------------------------------------
S3DFW5_GLAL2/20-452-SIVLDSN------WR----------------------------------------------------------------
G4TMW4_PIRID/20-450-SIVLDAN------WR----------------------------------------------------------------
CBHA_ASPFU/20-450-SVVIDAN------WR----------------------------------------------------------------
U7Q430_SPOS1/20-452-EVTIDSN------WR----------------------------------------------------------------
E9G5J5_DAPPU/22-463-AVVLDSN------WR----------------------------------------------------------------
F4S1M8_MELLP/21-456-KVTLDAN------WR----------------------------------------------------------------
F4S1N8_MELLP/22-461-SITLDAN------WR----------------------------------------------------------------
S7ZJL3_PENO1/20-451-SVVIDAN------WR----------------------------------------------------------------
K5ULV7_PHACS/21-445-SVVLDGN------WR----------------------------------------------------------------
N4V9B4_COLOR/24-453-EVVLDSN------WR----------------------------------------------------------------
G2QNN8_THIHA/23-447-EVVIDSN------WR----------------------------------------------------------------
R1EEG3_BOTPV/22-455-SIVLDAN------WR----------------------------------------------------------------
M4BJM4_HYAAE/27-464-SIVLDAN------WR----------------------------------------------------------------
E3K8C2_PUCGT/23-457-GLTIDAN------WR----------------------------------------------------------------
K3X3U7_PYTUL/24-462-KIVLDAN------WR----------------------------------------------------------------
F9XAF9_ZYMTI/21-444-GVTLDAN------WR----------------------------------------------------------------
L2FAS8_COLGN/19-444-DVVIDAN------WR----------------------------------------------------------------
K5WIZ5_PHACS/21-445-KVVLDSN------WR----------------------------------------------------------------
S8AFI7_DACHA/25-419-YVVLDAA------IH----------------------------------------------------------------
E3QH29_COLGM/20-451-AVTVDSN------WR----------------------------------------------------------------
M1WAR4_CLAP2/22-453-AVTVDAN------WR----------------------------------------------------------------
B2ACE0_PODAN/21-453-SVTLDSN------WR----------------------------------------------------------------
H3G7U3_PHYRM/13-452-SIVLDAN------WR----------------------------------------------------------------
G4NIA4_MAGO7/20-446-EVVIDGN------WR----------------------------------------------------------------
G4ULV4_NEUT9/157-586-SITVDAN------WR----------------------------------------------------------------
F9FY42_FUSOF/22-415-YIVADAG------IH----------------------------------------------------------------
B2ASX1_PODAN/25-450-EVVIDSN------WR----------------------------------------------------------------
C7ZHU8_NECH7/20-451-SVVVDAN------WR----------------------------------------------------------------
D8PLS5_SCHCM/21-454-KVVLDSN------WR----------------------------------------------------------------
S8AA61_DACHA/19-434-KVVLDSN------YR----------------------------------------------------------------
CBHB_EMENI/26-460-EVTIDAN------WR----------------------------------------------------------------
N4V9A4_COLOR/19-434-AVTIDAA------FR----------------------------------------------------------------
B8NIG8_ASPFN/28-463-SVVLDAN------WR----------------------------------------------------------------
G1XLC3_ARTOA/25-418-YVVLDSS------TH----------------------------------------------------------------
CELB_EMENI/21-427-SVVLDAA------TH----------------------------------------------------------------
G2QZD9_THITE/20-450-SVTIDAN------WR----------------------------------------------------------------
G0RYS9_CHATD/25-449-EIVIDAN------WR----------------------------------------------------------------

PF00139

I1J0Z7_BRADI/24-270-----SLQ..----FT----------------------------------------------------------------
M0UWM0_HORVD/54-310-----AIS..----FN----------------------------------------------------------------
K3YQI1_SETIT/31-293-----DDE..----FV----------------------------------------------------------------
D7MX72_ARALL/27-278-----EIK..----FL----------------------------------------------------------------
I1QF95_ORYGL/9-257-----ALS..----FN----------------------------------------------------------------
B9SDJ5_RICCO/21-269-----AVS..----FS----------------------------------------------------------------
M4EIG5_BRARP/19-266-----SVQ..----FN----------------------------------------------------------------
I1KL69_SOYBN/32-282-----SLS..----FN----------------------------------------------------------------
I1GT36_BRADI/22-278-----DGQ..----FT----------------------------------------------------------------
M4DR71_BRARP/23-281-----AIK..----FN----------------------------------------------------------------
K7UKG6_MAIZE/22-274-----E....----FT----------------------------------------------------------------
C5Z960_SORBI/22-274-----HEQ..----FV----------------------------------------------------------------
J3MID1_ORYBR/697-950-----DHQ..----FV----------------------------------------------------------------
C5YGS5_SORBI/740-993-----DDQ..----FL----------------------------------------------------------------
F6HBM8_VITVI/38-285-----SLS..----FN----------------------------------------------------------------
M0ZZ78_SOLTU/22-275-----SLS..----FN----------------------------------------------------------------
J3MID6_ORYBR/47-299-----DDQ..----LL----------------------------------------------------------------
I1KL68_SOYBN/57-300-----SLS..----FN----------------------------------------------------------------
B9S3F5_RICCO/21-271-----QNQ..----FI----------------------------------------------------------------
B9SXJ7_RICCO/26-271-----SLN..----FN----------------------------------------------------------------
M0VXQ0_HORVD/20-275-----DVQVQ----FA----------------------------------------------------------------
I1GT33_BRADI/25-286-----DGQ..----FS----------------------------------------------------------------
B9SXJ9_RICCO/25-271-----CLS..----FT----------------------------------------------------------------
M7ZXG6_TRIUA/26-279-----DNQ.R----FV----------------------------------------------------------------
B9SDJ4_RICCO/29-277-----TLS..----FN----------------------------------------------------------------
B9RKX4_RICCO/32-295-----KIN..----FT----------------------------------------------------------------
J3MID3_ORYBR/25-284-----EEN..----FV----------------------------------------------------------------
A9STE4_PHYPA/28-284-----LKTIE----FS----------------------------------------------------------------
K7LD59_SOYBN/26-276-----CLS..----FN----------------------------------------------------------------
F6HW43_VITVI/37-287-----SLS..----FN----------------------------------------------------------------
B9SPG3_RICCO/28-274-----SSS..----FS----------------------------------------------------------------
I1I8J5_BRADI/41-316-----ATT..----FS----------------------------------------------------------------
C5WQT3_SORBI/3-256-----ETA..----FT----------------------------------------------------------------
M7Z7K8_TRIUA/24-276-----SDE..----FI----------------------------------------------------------------
M7Z873_TRIUA/26-278-----DDQ..----FV----------------------------------------------------------------
I1Q9S6_ORYGL/27-278-----DNQ..----FA----------------------------------------------------------------
B9RX67_RICCO/38-289-----SLS..----FD----------------------------------------------------------------
Q7XZX1_ORYSJ/59-312-----DDR..----FV----------------------------------------------------------------
I1H3V1_BRADI/27-275-----E....----FL----------------------------------------------------------------
C5YTD3_SORBI/42-297-----SLS..----FS----------------------------------------------------------------
C5WZ65_SORBI/40-297-----ALS..----FN----------------------------------------------------------------
F6HWD4_VITVI/48-292-----SLD..----FN----------------------------------------------------------------
M4C9K1_BRARP/30-282-----NLE..----FT----------------------------------------------------------------
D7L7Q8_ARALL/26-272-----NSS..----FS----------------------------------------------------------------
I1LMH1_SOYBN/27-284-----SQQEE----FF----------------------------------------------------------------
I1Q7T2_ORYGL/56-310-----EHQ..----FV----------------------------------------------------------------
K7UIK5_MAIZE/47-318-----TTS..----FS----------------------------------------------------------------
B9S3F7_RICCO/27-283-----ADQ..----FI----------------------------------------------------------------
Q6Z8M4_ORYSJ/40-308-----AVS..----FS----------------------------------------------------------------
M4F2M7_BRARP/21-273-----TLN..----FT----------------------------------------------------------------
M0Y8Y9_HORVD/24-281-----DVD..----FT----------------------------------------------------------------
B9RX81_RICCO/37-286-----AIS..----FN----------------------------------------------------------------
Q7XUC7_ORYSJ/28-274-----CLQ..----FT----------------------------------------------------------------
Q6K8L8_ORYSJ/26-289-----DGQ..----FL----------------------------------------------------------------
I1L3I1_SOYBN/35-302-----SLS..----FS----------------------------------------------------------------
M4EJC2_BRARP/29-277-----DSS..----FS----------------------------------------------------------------
F6HWD7_VITVI/37-289-----SLS..----FN----------------------------------------------------------------
F6HW36_VITVI/35-286-----SLS..----FN----------------------------------------------------------------
M1DPR0_SOLTU/22-264-----SVS..----FQ----------------------------------------------------------------
K4D2U1_SOLLC/29-283-----CLS..----FN----------------------------------------------------------------
I1H2L8_BRADI/27-276-----CLR..----FT----------------------------------------------------------------
C5XCD6_SORBI/32-291-----DEQ..----FV----------------------------------------------------------------
K3Y5L7_SETIT/33-273-----CLQ..----FS----------------------------------------------------------------
M1BJQ2_SOLTU/21-281-----AVE..----FL----------------------------------------------------------------
I1LM84_SOYBN/28-267-----TTQ..----FD----------------------------------------------------------------
M4CN93_BRARP/29-292-----TTE..----FT----------------------------------------------------------------
Q8H4J3_ORYSJ/28-282-----EER..----FL----------------------------------------------------------------
B9RX64_RICCO/27-280-----QLN..----FS----------------------------------------------------------------
J3MPZ5_ORYBR/33-302-----ALS..----FN----------------------------------------------------------------
Q84ZH8_ORYSJ/24-276-----EEQ..----FI----------------------------------------------------------------
M0YJP2_HORVD/48-317-----SIT..----FS----------------------------------------------------------------
K3Y3M9_SETIT/30-282-----DDQ..----FV----------------------------------------------------------------
F6HL81_VITVI/33-286-----DVS..----FT----------------------------------------------------------------
LRK61_ARATH/33-294-----TAK..----FT----------------------------------------------------------------
B9T8H0_RICCO/20-272-----DLS..----FT----------------------------------------------------------------
M1AHJ3_SOLTU/28-281-----DLD..----FT----------------------------------------------------------------
M7YY54_TRIUA/30-272-----ALR..----FA----------------------------------------------------------------
M4CLT1_BRARP/22-275-----RTN..----FT----------------------------------------------------------------
B9SML1_RICCO/44-289-----SVN..----FT----------------------------------------------------------------
M4DP68_BRARP/19-264-----SLH..----FN----------------------------------------------------------------
Q0D8S6_ORYSJ/77-329-----DGQ..----FV----------------------------------------------------------------
M8A5Y7_TRIUA/53-300-----CLQ..----FT----------------------------------------------------------------
C5Z959_SORBI/30-282-----EDQ..----FV----------------------------------------------------------------
LRKS1_ARATH/29-288-----AID..----FL----------------------------------------------------------------
M4ESL4_BRARP/22-290-----AAR..----FN----------------------------------------------------------------
B9SKY8_RICCO/25-281-----SEE..----FT----------------------------------------------------------------
M4FFA7_BRARP/24-263-----TTE..----FD----------------------------------------------------------------
J3LWI6_ORYBR/44-294-----SLS..----FS----------------------------------------------------------------
K7L999_SOYBN/59-308-----CLS..----FN----------------------------------------------------------------
M7YCL0_TRIUA/32-284-----EHQ..----FS----------------------------------------------------------------
D7MR66_ARALL/26-282-----RDQ..----FL----------------------------------------------------------------
J3MPZ8_ORYBR/32-293-----ALS..----FN----------------------------------------------------------------
F6GUY7_VITVI/27-280-----EAQ..----FI----------------------------------------------------------------
B9HG10_POPTR/32-282-----SLS..----FN----------------------------------------------------------------
B9GZH8_POPTR/30-270-----.IS..----FQ----------------------------------------------------------------
B9HCZ3_POPTR/23-280-----.VE..----FL----------------------------------------------------------------
I1JFJ9_SOYBN/45-285-----.VS..----FT----------------------------------------------------------------
I1MX65_SOYBN/42-290-----SLN..----FN----------------------------------------------------------------
M7Y9L8_TRIUA/34-283-----.QS..----FV----------------------------------------------------------------
Q652V6_ORYSJ/38-298-----.DH..----FR----------------------------------------------------------------
Q6ZFB7_ORYSJ/37-281-----.VS..----FN----------------------------------------------------------------
Q6ZIQ8_ORYSJ/39-305-----.TT..----FS----------------------------------------------------------------
Q6ZLL9_ORYSJ/30-291-----..Q..----FI----------------------------------------------------------------
Q7XUN6_ORYSJ/30-280-----.ER..----FV----------------------------------------------------------------
Q84ZI0_ORYSJ/31-304-----.HQ..----FV----------------------------------------------------------------
U5G5V7_POPTR/26-278-----.NH..----FI----------------------------------------------------------------
W5AMW1_WHEAT/26-276-----..Q..----LL----------------------------------------------------------------
W5AND9_WHEAT/35-289-----.NQ..----FV----------------------------------------------------------------
W5GWA8_WHEAT/27-281-----..Q..----FI----------------------------------------------------------------

PF03388

YQF8_SCHPO/24-250------TS------HL----------------------------------------------------------------
YOC5_SCHPO/23-229------SQ------FL----------------------------------------------------------------
EMP47_YEAST/36-253------DA------SK----------------------------------------------------------------
LMAN1_HUMAN/44-269------RR------FE----------------------------------------------------------------
Q9V3A8_DROME/33-259------RR------FE----------------------------------------------------------------
Q9VCC2_DROME/33-258------DY------MK----------------------------------------------------------------
LMAN2_CANFA/52-278------EH------LK----------------------------------------------------------------
Q22170_CAEEL/43-272------GY------YK----------------------------------------------------------------

PF00457

U5MR46_CLOSA/70-253-----NGG------YD----------------------------------------------------------------
XYNB_ASPFU/42-219-----NNG------YY----------------------------------------------------------------
XYN3_MAGO7/54-234-----HNG------FY----------------------------------------------------------------
F8DB45_HALXS/87-262-----HEG------YY----------------------------------------------------------------
F9XDM7_ZYMTI/45-223-----NNG------YY----------------------------------------------------------------
M2QR82_CERS8/44-221-----NNG------FY----------------------------------------------------------------
G7XIG9_ASPKW/42-219-----SNG------YF----------------------------------------------------------------
A9G323_SORC5/221-397-----HCG------YT----------------------------------------------------------------
G2QUC8_THITE/35-208-----.DG------TA----------------------------------------------------------------
E3Q8W7_COLGM/43-217-----...------DY----------------------------------------------------------------
A7EQZ6_SCLS1/49-220-----...------NY----------------------------------------------------------------
K0J5P9_AMPXN/62-246-----HDG------YD----------------------------------------------------------------
G4TKV8_PIRID/43-220-----NNG------YY----------------------------------------------------------------
S8ATR1_PENO1/29-208-----NGI------DY----------------------------------------------------------------
T0MBU2_COLGC/37-214-----HNG------YY----------------------------------------------------------------
Q2UFR7_ASPOR/71-245-----SAG------YY----------------------------------------------------------------
F7PGE0_9EURY/60-235-----HDG------YF----------------------------------------------------------------
M9LS78_PSEA3/38-220-----QSI------NY----------------------------------------------------------------
G1X5P3_ARTOA/57-231-----SNT------NY----------------------------------------------------------------
E6UKJ6_RUMA7/55-250-----..D------YH----------------------------------------------------------------
G2XS85_BOTF4/46-225-----SGG------YY----------------------------------------------------------------
C7Q365_CATAD/61-236-----NNG------YY----------------------------------------------------------------
S7ZJ07_PENO1/39-216-----NNG------FY----------------------------------------------------------------
E3QVD0_COLGM/44-216-----...------DY----------------------------------------------------------------
G2X5X8_VERDV/37-215-----HNG------YF----------------------------------------------------------------
C6WIK2_ACTMD/54-231-----HNG------YY----------------------------------------------------------------
B1ZMX2_OPITP/39-216-----DHG------YF----------------------------------------------------------------
A9EQP3_SORC5/210-404-----.NG------YG----------------------------------------------------------------
F4H710_CELFA/52-228-----HDG------YF----------------------------------------------------------------
S3E0R3_GLAL2/19-199-----AQS------YF----------------------------------------------------------------
R0K9J6_SETT2/42-213-----NNG------FY----------------------------------------------------------------
M7TVV3_BOTF1/41-218-----SGG------YY----------------------------------------------------------------
T0KW32_COLGC/75-251-----AGG------FY----------------------------------------------------------------
G0S9X3_CHATD/56-233-----HGG------YF----------------------------------------------------------------
K5X1T9_AGABU/46-223-----VNG------YF----------------------------------------------------------------
S3DEM3_GLAL2/50-221-----...------DY----------------------------------------------------------------
B8M5E1_TALSN/53-227-----..V------NY----------------------------------------------------------------
V5FWP5_BYSSN/38-215-----NNG------YY----------------------------------------------------------------
D9SP57_CLOC7/41-225-----FEG------YD----------------------------------------------------------------
A8P4P6_COPC7/104-288-----HDG------YF----------------------------------------------------------------
Q0UI10_PHANO/28-204-----NSF------NA----------------------------------------------------------------
Q47QL8_THEFY/52-227-----HDG------YF----------------------------------------------------------------
G2QWT6_THITE/50-225-----.NP------SY----------------------------------------------------------------
R6YEV7_9FIRM/39-222-----QDG------YN----------------------------------------------------------------
Q21G61_SACD2/43-220-----HGG------YY----------------------------------------------------------------
F7W2U2_SORMK/27-207-----.AN------YF----------------------------------------------------------------
R4LPY0_9ACTN/53-232-----SGG------TY----------------------------------------------------------------
XYNB_ASPFN/42-219-----NNG------YY----------------------------------------------------------------
C9RK54_FIBSS/46-247-----.GN------YS----------------------------------------------------------------
XYNC_STRCO/61-238-----.DG------MY----------------------------------------------------------------
S7ZVQ9_PENO1/51-226-----..G------FY----------------------------------------------------------------
G4UC47_NEUT9/40-217-----NNG------FY----------------------------------------------------------------
E3QHP2_COLGM/50-227-----HNG------YF----------------------------------------------------------------
M1W9A1_CLAP2/39-214-----.GG------LY----------------------------------------------------------------
A8NZY3_COPC7/34-216-----QAA------SF----------------------------------------------------------------
G2Q4M3_THIHA/47-221-----...------DY----------------------------------------------------------------
A8NW94_COPC7/49-232-----HDG------YF----------------------------------------------------------------
E3S3R6_PYRTT/42-215-----...------EY----------------------------------------------------------------
G4TKT5_PIRID/54-231-----HNG------YY----------------------------------------------------------------
Q2HCI0_CHAGB/40-217-----HEG------FY----------------------------------------------------------------
I3VTR8_THESW/29-209-----.TT------NY----------------------------------------------------------------
B3PIN1_CELJU/38-224-----NNG------FY----------------------------------------------------------------
K5WVZ1_PHACS/44-221-----NGG------YF----------------------------------------------------------------
G0SAF9_CHATD/37-199-----HNG------YY----------------------------------------------------------------
G4TKT3_PIRID/54-231-----KDG------YY----------------------------------------------------------------
S8AJR6_DACHA/43-221-----HDG------YY----------------------------------------------------------------
M1LSN7_9CLOT/30-211-----ATT------DY----------------------------------------------------------------
F0XC21_GROCL/46-221-----.SP------NY----------------------------------------------------------------
A0A0C4EAA2_MAGP6/41-223-----QGG------YY----------------------------------------------------------------
B2A9I4_PODAN/43-221-----HNG------YY----------------------------------------------------------------
G2X4G1_VERDV/41-216-----HGG------FF----------------------------------------------------------------
B8MND2_TALSN/59-232-----.ST------NY----------------------------------------------------------------
A9GHF8_SORC5/306-501-----.GD------FF----------------------------------------------------------------
E5A0Q4_LEPMJ/78-250-----RQG------GY----------------------------------------------------------------
G4U378_PIRID/48-223-----.GY------YN----------------------------------------------------------------
C9RLL3_FIBSS/44-238-----.NG------VG----------------------------------------------------------------
B2WG17_PYRTR/46-223-----HNG------CF----------------------------------------------------------------
XYNA_BACSU/29-211-----AST------DY----------------------------------------------------------------
XYNA_EMENI/46-223-----SNG------YY----------------------------------------------------------------
XYN3_ASPKW/29-208-----AGI------NY----------------------------------------------------------------
E6UBP6_RUMA7/65-254-----SDG------YD----------------------------------------------------------------
C7YSL3_NECH7/42-220-----HGG------YY----------------------------------------------------------------
N1PCA4_DOTSN/49-227-----NNG------YY----------------------------------------------------------------
G0R947_HYPJQ/52-226-----ASI------NY----------------------------------------------------------------
G2Q913_THIHA/39-217-----HDG------FY----------------------------------------------------------------
B2B3J5_PODAN/53-231-----HSG------YF----------------------------------------------------------------
Q9KEF3_BACHD/29-208-----..N------TY----------------------------------------------------------------
Q2GN95_CHAGB/35-214-----HDG------YF----------------------------------------------------------------
A9EUR0_SORC5/153-329-----HCG------LT----------------------------------------------------------------
S8AS02_DACHA/46-242-----NNG------YF----------------------------------------------------------------
U7Q3B8_SPOS1/53-234-----.AS------YT----------------------------------------------------------------
J3NW75_GAGT3/48-227-----HNG------YY----------------------------------------------------------------
G4TKT1_PIRID/54-222-----KDG------YY----------------------------------------------------------------
A0A0D1E285_USTMA/36-218-----QSI------NY----------------------------------------------------------------
M7SU57_EUTLA/19-190-----..Q------SY----------------------------------------------------------------
B6QV47_PENMQ/55-228-----AGI------NY----------------------------------------------------------------
M3CYK1_SPHMS/48-225-----SNG------FF----------------------------------------------------------------
K1X7K7_MARBU/40-238-----NNG------FY----------------------------------------------------------------
G2NBA0_STREK/53-228-----NNG------YY----------------------------------------------------------------
U7PQP8_SPOS1/44-215-----...------DY----------------------------------------------------------------
G0RUP7_HYPJQ/43-221-----NNG------YF----------------------------------------------------------------
G8LXE2_CLOCD/39-223-----YQG------YD----------------------------------------------------------------
T0L8D6_COLGC/39-215-----HNG------YY----------------------------------------------------------------
G2QV82_THITE/46-224-----..Q------DY----------------------------------------------------------------
Q2H5I3_CHAGB/51-228-----HGG------YY----------------------------------------------------------------
XYN4_MAGO7/51-228-----HDG------FY----------------------------------------------------------------
G8LXE2_CLOCD/424-608-----HGG------YN----------------------------------------------------------------
K1WWU0_MARBU/46-224-----HDG------FF----------------------------------------------------------------
C7PX63_CATAD/51-229-----NSG------YY----------------------------------------------------------------
S8AMN0_PENO1/42-221-----NNG------YY----------------------------------------------------------------
F4FB94_VERMA/40-218-----HNG------FF----------------------------------------------------------------
E3S9S5_PYRTT/49-227-----NNG------FF----------------------------------------------------------------
B8NYB7_ASPFN/69-243-----.AG------FY----------------------------------------------------------------
J3NLQ4_GAGT3/38-211-----...------.P----------------------------------------------------------------
L7VQD8_CLOSH/42-225-----HGG------YD----------------------------------------------------------------
L0EBB6_THECK/28-208-----.AN------TY----------------------------------------------------------------
A8FE31_BACP2/38-219-----HGG------YD----------------------------------------------------------------
G4U379_PIRID/50-216-----...------.N----------------------------------------------------------------
E3Q964_COLGM/44-223-----NNG------YY----------------------------------------------------------------
C5BU21_TERTT/52-237-----HGG------HY----------------------------------------------------------------
B8I7X1_CLOCE/38-221-----IDG------YD----------------------------------------------------------------
A8NKZ6_COPC7/44-228-----HDG------YF----------------------------------------------------------------
Q11SH7_CYTH3/43-226-----HNG------FF----------------------------------------------------------------
B8I371_CLOCE/30-210-----.AT------DY----------------------------------------------------------------
I2FN07_USTH4/36-218-----HSI------DY----------------------------------------------------------------
G4TKT4_PIRID/54-231-----KDG------YY----------------------------------------------------------------
C9Z2V1_STRSW/53-229-----DNG------FY----------------------------------------------------------------
S8AP92_PENO1/40-211-----NNG------FF----------------------------------------------------------------
T0K1I6_COLGC/42-222-----NNG------YF----------------------------------------------------------------
C7ZN05_NECH7/1-172-----...------.Y----------------------------------------------------------------
XYNC_FIBSS/52-240-----...------IG----------------------------------------------------------------
G1X9B1_ARTOA/43-221-----HDG------YY----------------------------------------------------------------
A9GEL6_SORC5/142-318-----HCG------FT----------------------------------------------------------------
K2RN85_MACPH/42-220-----NNG------YY----------------------------------------------------------------
R4LM27_9ACTN/54-231-----HNG------YF----------------------------------------------------------------
D5UGI1_CELFN/51-229-----HSG------WW----------------------------------------------------------------
Q2HI25_CHAGB/36-208-----QGG------YY----------------------------------------------------------------
XYNC_FIBSS/327-512-----..P------YH----------------------------------------------------------------
G4N696_MAGO7/47-225-----...------.R----------------------------------------------------------------
G8SKM4_ACTS5/52-226-----NNG------YY----------------------------------------------------------------
M2TBN8_COCH5/42-219-----...------DY----------------------------------------------------------------
N1PGQ5_DOTSN/47-227-----NNG------WF----------------------------------------------------------------
Q7ZA57_GIBZA/50-227-----HNG------YF----------------------------------------------------------------
B2WK18_PYRTR/41-214-----..Q------DY----------------------------------------------------------------
S8AF15_DACHA/44-214-----NNG------YF----------------------------------------------------------------
C5BMU2_TERTT/37-214-----QNG------YY----------------------------------------------------------------
B6QNP6_PENMQ/54-227-----.AI------NY----------------------------------------------------------------
U7PKR6_SPOS1/52-230-----NNG------FF----------------------------------------------------------------
G3XY88_ASPNA/57-232-----.AG------FY----------------------------------------------------------------
G9NQ12_HYPAI/48-222-----SSI------NY----------------------------------------------------------------
F7W777_SORMK/45-222-----HNG------YY----------------------------------------------------------------
Q0UBJ9_PHANO/41-216-----..N------AP----------------------------------------------------------------
T0JLP7_COLGC/68-241-----.RT------NY----------------------------------------------------------------
D8PN69_SCHCM/41-226-----DGG------YY----------------------------------------------------------------
C7ZC92_NECH7/39-216-----HDG------FY----------------------------------------------------------------
B8E1P4_DICTD/41-222-----FDG------YY----------------------------------------------------------------
D1BXH1_XYLCX/54-230-----SGG------YF----------------------------------------------------------------
F0S4T0_PSESL/87-269-----NNG------YF----------------------------------------------------------------
G9MV13_HYPVG/54-228-----SNT------NY----------------------------------------------------------------
Q2HCI7_CHAGB/53-216-----HSG------YF----------------------------------------------------------------
L0E9J8_THECK/24-202-----...------.N----------------------------------------------------------------
E4N0N4_KITSK/54-229-----DGG------YF----------------------------------------------------------------
J3PC50_GAGT3/50-229-----HNG------YY----------------------------------------------------------------
Q0CMZ1_ASPTN/41-218-----NNG------YY----------------------------------------------------------------
S3D920_GLAL2/48-226-----NNG------YY----------------------------------------------------------------
E6X8Q5_CELAD/57-241-----NGG------YW----------------------------------------------------------------
F9F5R3_FUSOF/43-220-----NNG------FY----------------------------------------------------------------
XYNB_ASPCL/42-219-----KNG------YY----------------------------------------------------------------
G2Q4S6_THIHA/47-224-----HSG------YF----------------------------------------------------------------
Q0UBV5_PHANO/22-194-----..Q------FF----------------------------------------------------------------
G2X8M4_VERDV/40-224-----HDG------YF----------------------------------------------------------------
H1YIW2_9SPHI/65-249-----NNG------FF----------------------------------------------------------------
M7STD0_EUTLA/43-222-----HNG------FF----------------------------------------------------------------
D4LFB0_RUMC1/42-232-----EDG------YA----------------------------------------------------------------

PF01670

GUNA_ASPKW/28-239-----SPP------YS----------------------------------------------------------------
G0RRG8_HYPJQ/29-234-----.NG------YT----------------------------------------------------------------
Q2UFR8_ASPOR/29-239-----.PP------YS----------------------------------------------------------------
Q9RJY3_STRCO/54-261-----QGR------YV----------------------------------------------------------------
Q9S5X8_THEMA/18-255-----.IP------LS----------------------------------------------------------------

PF07675

Q7MUZ4_PORGI/41-208-----MIP------LS----------------------------------------------------------------
HAGA1_PORGI/230-407-----TYV------LN----------------------------------------------------------------
F5HGU5_PORGI/47-200-----.TI------LY----------------------------------------------------------------
Q7MTE2_PORGI/1142-1311-----.TE------TF----------------------------------------------------------------

PF00629

H3CJZ0_TETNG/591-747------CN------FE----------------------------------------------------------------
F6ZQ08_XENTR/641-801------CN------FD----------------------------------------------------------------
MAMC2_HUMAN/509-665------CT------FE----------------------------------------------------------------
F1Q7F6_DANRE/345-500------CD------FE----------------------------------------------------------------
Q28WN9_DROPS/509-694------CD------FE----------------------------------------------------------------
F6TDH8_CIOIN/81-235------CS------FN----------------------------------------------------------------
F1QL06_DANRE/266-425------CA------FE----------------------------------------------------------------
L9KUF8_TUPCH/628-792------CH------FE----------------------------------------------------------------
AEGP_MOUSE/979-1143------CD------FE----------------------------------------------------------------
F1R3K1_DANRE/3-160------CL------LE----------------------------------------------------------------
Q17E33_AEDAE/237-420------CD------FE----------------------------------------------------------------
PTPRU_HUMAN/27-187------CT------FE----------------------------------------------------------------
MEP1B_RAT/266-429------CD------FE----------------------------------------------------------------
MAMC2_HUMAN/170-328------CD------FE----------------------------------------------------------------
AEGP_HUMAN/813-968------CS------FE----------------------------------------------------------------
H3DMT5_TETNG/350-507------CN------FE----------------------------------------------------------------
AEGP_MOUSE/661-814------CN------FE----------------------------------------------------------------
F6RM13_MACMU/211-367------CS------FD----------------------------------------------------------------
AEGP_MOUSE/67-222------CN------FE----------------------------------------------------------------
ZAN_RABIT/152-314------CV------FE----------------------------------------------------------------
PTPRU_DANRE/26-183------CT------FD----------------------------------------------------------------
PTPRU_CHICK/27-186------CT------FE----------------------------------------------------------------
Q5TG12_HUMAN/36-193------CT------FD----------------------------------------------------------------
B4QA49_DROSI/136-311------CD------FE----------------------------------------------------------------
ALK_HUMAN/480-635------CN------FE----------------------------------------------------------------
F1RDD1_DANRE/748-922------CG------FE----------------------------------------------------------------
AEGP_HUMAN/493-643------TD------FE----------------------------------------------------------------
AEGP_HUMAN/656-808------CN------FE----------------------------------------------------------------
MEP1B_HUMAN/265-428------CS------FE----------------------------------------------------------------
H3CE92_TETNG/270-434------CD------FE----------------------------------------------------------------
F5H0T8_HUMAN/373-535------CD------FE----------------------------------------------------------------
MEP1A_RAT/270-433------CA------FE----------------------------------------------------------------
AEGP_RAT/273-426------TD------FE----------------------------------------------------------------
H3CU29_TETNG/52-210------CS------FE----------------------------------------------------------------
H3DPC5_TETNG/223-385------CT------FE----------------------------------------------------------------
D2HWA9_AILME/125-297------CG------FE----------------------------------------------------------------
NRP1_RAT/650-810------CE------FG----------------------------------------------------------------
H3CQ93_TETNG/344-500------CT------FE----------------------------------------------------------------
PTPRM_HUMAN/27-183------CL------FD----------------------------------------------------------------
Q17E33_AEDAE/18-191------CN------FE----------------------------------------------------------------
B8JKC0_DANRE/268-431------CH------FE----------------------------------------------------------------
AEGP_RAT/817-972------CS------FE----------------------------------------------------------------
F6PMK1_XENTR/270-431------CT------FE----------------------------------------------------------------
Q1RLY9_DANRE/637-803------CD------FG----------------------------------------------------------------
H3BWX9_TETNG/646-802------CD------FE----------------------------------------------------------------
MEP1A_HUMAN/269-432------CT------FE----------------------------------------------------------------
AEGP_MOUSE/494-648------TD------FE----------------------------------------------------------------
Q176I3_AEDAE/155-324------CD------FE----------------------------------------------------------------
NRP1_CHICK/641-800------CG------FG----------------------------------------------------------------
Q7PZL9_ANOGA/167-334------CD------FE----------------------------------------------------------------
AEGP_HUMAN/271-424------TD------FE----------------------------------------------------------------
B0S6D0_DANRE/630-787------CD------FE----------------------------------------------------------------
H3CJZ0_TETNG/58-219------CD------FD----------------------------------------------------------------
ENTK_MOUSE/392-548------CT------FD----------------------------------------------------------------
ZAN_PIG/149-311------CD------FE----------------------------------------------------------------
MAMC2_MOUSE/342-497------CD------FE----------------------------------------------------------------
H3BVJ4_TETNG/269-431------CS------FE----------------------------------------------------------------
F5H4B5_HUMAN/41-203------CD------FE----------------------------------------------------------------
B4HP69_DROSE/94-269------CD------FE----------------------------------------------------------------
Q176I4_AEDAE/127-297------CD------FE----------------------------------------------------------------
A2AJX4_MOUSE/1695-1857------CN------FE----------------------------------------------------------------
ENTK_BOVIN/363-519------CN------FE----------------------------------------------------------------
E9PWQ7_MOUSE/217-373------CT------FD----------------------------------------------------------------
Q28DN2_XENTR/27-183------CT------FE----------------------------------------------------------------
NRP2_HUMAN/646-801------CN------FD----------------------------------------------------------------
F6Q2U5_XENTR/171-329------CD------FE----------------------------------------------------------------
Q9VQS2_DROME/132-307------CD------FE----------------------------------------------------------------

PF00354

SAMP_MOUSE/27-220-------------------------------------K----L-------IPHLEKP.-------L---Q----------
CRP1_LIMPO/33-237-------------------------------------R----L-------VMVGTLPD-------L---Q----------
CRP_XENLA/23-219-------------------------------------I----L-------KPEVEKP.-------L---K----------
CRP_RABIT/26-221-------------------------------------S----L-------NAQLKKP.-------L---K----------
CRP_HUMAN/25-220-------------------------------------S----L-------KAPLTKP.-------L---K----------
SAMP_HUMAN/26-219-------------------------------------N----L-------ITPLEKP.-------L---Q----------
Q542I3_MOUSE/26-221-------------------------------------S----L-------EAESKKP.-------L---N----------
FP_CRIMI/26-219-------------------------------------K----L-------IPRLEKP.-------L---E----------

PF13385

A9V7L7_MONBE/717-870-------------------------------------Q....L-----..PP...RRL.......F...G...ES...--
A9V0U4_MONBE/809-963-------------------------------------Q....L-----..PA....RN.......F.......GG...--
A9VE19_MONBE/544-692-------------------------------------Q....L-----..PA....RN.......F.......GG...--
A9V0U4_MONBE/590-745-------------------------------------L....A-----..PP....LT.......F.......NN...--
B9JMF4_AGRRK/595-752-------------------------------------S....L-----..PE...NLV.......L...P...LA...--
C9ZAH4_STRSW/174-331-------------------------------------D....L-----..PN....SV.......L...G..GAS...--
B5HCG7_STRPR/182-340-------------------------------------D....L-----..PA....TV.......L...G..GAS...--
D3EBL1_GEOS4/644-797-------------------------------------E....L-----..PN....RV.......T...D...TE...--
Q82NZ6_STRAW/693-850-------------------------------------A....L-----..AD....DL.......L...A..GAA...--
C7Q3C0_CATAD/682-839-------------------------------------A....L-----..PS....GL.......L...S..GAG...--
C6WP14_ACTMD/1442-1597-------------------------------------A....P-----..AP....FD.......L.......EG...--
A7RQU2_NEMVE/46-196-------------------------------------L....L-----..KG....ISTSCFHEPW...T..CFK...--
B3RTE4_TRIAD/419-588-------------------------------------N....L-----..GS....HPNK..CLVD...PERCNN...--
Q11RF9_CYTH3/68-223-------------------------------------T....V-----..SS....QP.......I...L...DNGFG--
D2AYT0_STRRD/833-984-------------------------------------T....T-----..GN....TT.......L...G..FLR...--
Q01PZ1_SOLUE/560-711-------------------------------------I....M-----.LPSG..HHQ.......F...G...FR...--
D0LXW7_HALO1/121-278-------------------------------------A....I-----..DD...DGS.......F...T..STG...--
A9ERE1_SORC5/156-299-------------------------------------Y....F-----.RHD....AA.......W...T...AS...--
A7RK85_NEMVE/111-274-------------------------------------T....F-----..DI....QH.......FRNRP...TL...--
Q7UP09_RHOBA/489-653-------------------------------------A....T-----..EV....GN.......F...D..RSQ...--
D2QJX5_SPILD/494-660-------------------------------------T....L-----..GQ...AGV.......F...N..RSQ...--
A5G5W5_GEOUR/3125-3280-------------------------------------S....I-----..SD...SAS.......L...D..VTT...--
Q12UM1_METBU/211-367-------------------------------------R....V-----..ENS..ISL.......N...P...KS...--
A5G5W5_GEOUR/2834-2981-------------------------------------K....V-----..NN...SSS.......L...N...PT...--
Q3A7I8_PELCD/252-409-------------------------------------M....V-----..PD....ND......AF...D..LRK...--
Q2S986_HAHCH/536-688-------------------------------------E....I-----..AD...NNL.......L...D..ITD...--
C5BR34_TERTT/286-438-------------------------------------Q....I-----..NDPGNNSI.......L...D...LD...--
Q5E1F1_VIBF1/338-497-------------------------------------E....V-----..PH...NSK.......L..SN...ED...--
D0LH97_HALO1/423-584-------------------------------------K....I-----..SE....AC.......V...A...SS...--
Q2SIZ0_HAHCH/349-511-------------------------------------K....L-----..HD....LI.......K...A...TG...--
Q21ES8_SACD2/355-516-------------------------------------K....L-----..HR....LI.......T...A...TG...--
A1U1N6_MARHV/358-517-------------------------------------K....L-----..HT....QL.......T...T...SG...--
Q7UQA7_RHOBA/111-269-------------------------------------K....L-----..AE....QT.......K...Q...SN...--
Q5JEI1_THEKO/104-250-------------------------------------S.....-----..GS....AT.......L...S...SQ...--
D2RI28_ARCPA/205-357-------------------------------------E....I-----..PN...SES.......L..QE...NE...--
D2QKT6_SPILD/67-225-------------------------------------N....L-----..PA....AP.......F...T...NP...--
A7RFD3_NEMVE/591-745-------------------------------------I....F-----..PRT..PKL.......R...N...VK...--
A5FGU3_FLAJ1/61-211-------------------------------------V....I-----..DN....LP.......Q...A...NT...--
A5FGS6_FLAJ1/61-211-------------------------------------V....V-----..GD....LP.......Q...A...NK...--
A5FKP6_FLAJ1/648-806-------------------------------------D....A-----..PI....AN.......I...P...QGN..--
B1WQC8_CYAA5/1492-1639-------------------------------------E....I-----..SH...HER.......F...N..LSN...--
B2J7Y5_NOSP7/1082-1239-------------------------------------K....L-----..NN...PAA.......L...N..FTG...--
B8GR77_THISH/232-391-------------------------------------E....V-----..PG...HPN.......L...T..GTS...--
A5US22_ROSS1/44-194-------------------------------------Q....V-----..PNA..PAL.......N...P...SG...--
B8FIJ2_DESAA/1835-1990-------------------------------------L....A-----..PY...RPS.......F...D...VQ...--
B8FIJ2_DESAA/2139-2295-------------------------------------T....V-----.LSD....AS.......L...D...VQ...--
B8FIJ2_DESAA/3101-3258-------------------------------------Q....I-----..PS...NSA.......L...D...LY...--
B1WQC8_CYAA5/529-689-------------------------------------A....I-----..PS....VP.......LK.PP...SA...--
A0L6L9_MAGMM/6883-7036-------------------------------------Y....S-----..TV....GG.......M...V...TA...--
A0L6L9_MAGMM/10297-10458-------------------------------------T....V-----..TG....VN.......I...A...NS...--
A0L6L9_MAGMM/11015-11176-------------------------------------V....A-----..EG....VS.......V...A...NR...--
A0L6L9_MAGMM/7697-7855-------------------------------------A....S-----..AA....IS.......L...P..PSS...--
Q11V34_CYTH3/475-632-------------------------------------Q....V-----..PNS.PAFN.......L...G...TG...--
D1YWM2_METPS/639-793-------------------------------------D....S-----..NM....V........T...T...SN...--
A9AX01_HERA2/2983-3139-------------------------------------E....V-----QSPT....AV.......S...A..LTS...--
C5CYC7_VARPS/584-746-------------------------------------P....L-----..KN....DS.......V...ATVLGG...--
A9VEK3_MONBE/43-204-------------------------------------T....L-----..PC....VG.......L...S...SS...--
A9UYJ6_MONBE/611-770-------------------------------------K....F-----..PF...PPR.......L.......PA...--
A4CID0_ROBBH/183-344-------------------------------------T....F-----..PM....DG.......L...K...NQ...--
Q01ZJ6_SOLUE/448-593-------------------------------------E....F-----..PG....F............Q...AE...--
Q112U0_TRIEI/322-477-------------------------------------E....L-----..PT....AT.......I...P..QTG...--
A9AVC5_HERA2/53-212-------------------------------------E....L-----..NP....AS.......I...P..AGN...--
C3YCM4_BRAFL/399-559-------------------------------------V....A-----..NG....FT.......S...HA.WGS...--
A9AX01_HERA2/3464-3613-------------------------------------T....I-----..AN...TTT.......L...D...LS...--
A9AX01_HERA2/1709-1859-------------------------------------Q....A-----...S....LS.......L...A...PT...--
A9AX01_HERA2/3687-3839-------------------------------------S....A-----..TI...TNN.......L...S...LA...--
A9AVE2_HERA2/55-206-------------------------------------E....L-----..AN....PF.......A...S...AS...--
A0ZJ67_NODSP/534-687-------------------------------------E....I-----..AD....PF.......G...K...NK...--
A9WA06_CHLAA/1561-1710-------------------------------------S....A-----..GT...DER.......F...R..MSD...--
D2GX75_AILME/1328-1494-------------------------------------NP.KYH-----..PS....RN.......N...S...IA...--
GPR98_DANRE/1321-1486-------------------------------------S....A-----..ET...TLL.......V...PQ.ILA...--
B3PKP2_CELJU/973-1129-------------------------------------R....L-----..PD....NL.......I...T...GN...--
Q21FF7_SACD2/1013-1165-------------------------------------K....L-----..PD....NL.......I...T...DH...--
Q21FF7_SACD2/697-861-------------------------------------R....L-----..PN....GL.......I...D...NY...--
B8E3D6_DICTD/93-243-------------------------------------L....L-----..YE....GP.......V...E...TY...--
C6D6G1_PAESJ/694-843-------------------------------------R....L-----..PN....KL.......I...D...SN...--
Q9KBP7_BACHD/623-775-------------------------------------R....L-----..PN....GL.......I...S...RN...--
C7R5J8_JONDD/646-797-------------------------------------R....L-----..PD....GL.......I...D...SH...--
C7R5J7_JONDD/547-698-------------------------------------V....L-----..PQ....GL.......I...H...GN...--
D4J0Z2_BUTFI/89-242-------------------------------------K....L-----..NQ....QN.......L.......GE...--
A5GAT0_GEOUR/82-245-------------------------------------T....V-----..PD...SPS.......L...S..FTN...--
C6W5Q6_DYAFD/72-233-------------------------------------E....I-----..SP....KD.......L...Q...IN...--
D5SQB3_PLAL2/445-615-------------------------------------Q....I-----..AA....KN.......L...P...FSK..--
A0C6A9_PARTE/84-241-------------------------------------I....I-----..PH....HD.......Q...Y...HD...--
A4HMI3_LEIBR/697-852-------------------------------------S....W-----..RL...KHM.......F...P..RGS...--
A5JZZ5_PLAVS/101-250-------------------------------------P....H-----..SD....EY.......F...K...TV...--
D2W1V6_NAEGR/225-370-------------------------------------A....S-----.TVN....VN.......L.......TV...--
Q3A7I8_PELCD/471-622-------------------------------------T....L-----..N.....TD.......V...P..MPD...--
B0R0F2_DANRE/89-248-------------------------------------R....L-----.KPN....AE.......V...P...RA...--
B3RQA7_TRIAD/115-267-------------------------------------C....L-----..GN....LS.......L...C...TN...--
D3F200_CONWI/289-437-------------------------------------S....F-----..ADR.PAFD.......L.......TT...--
C6WK26_ACTMD/261-414-------------------------------------A....A-----..GS...GAA.......L...S..FTG...--
A0ZJ64_NODSP/411-564-------------------------------------E....V-----..PY...EPA.......L...N...PS...--
P73139_SYNY3/1330-1483-------------------------------------T....L-----..DQ...PVP.......L...T...NQ...--
D3F0R0_CONWI/85-255-------------------------------------Q....V-----..TS....PL.......L...A...PA...--
C1F1C3_ACIC5/51-208-------------------------------------TEKLET-----.HDT....VQ.......M...A...SS...--
B5HK67_STRPR/818-980-------------------------------------D....V-----..NE....TV.......L...D..SSK...--
D9TDD0_MICAI/805-962-------------------------------------T....T-----..SK....PV.......LT.DT...SA...--
Q82GV4_STRAW/292-440-------------------------------------L....T-----..PDA..PAV.......D...T...HG...--
D2BE74_STRRD/722-881-------------------------------------R....T-----..TG...PVV.......S...T...LS...--
B5I5M1_9ACTN/761-922-------------------------------------A....T-----..SG....SV.......V...D..TAG...--
B1VPR2_STRGG/846-1008-------------------------------------S....T-----..PG....KV.......L...E...TQ...--
B5HSG2_9ACTN/789-950-------------------------------------A....T-----..SG....PV.......L...D..TTK...--
B1VKK7_STRGG/744-905-------------------------------------Q....S-----..SG....PV.......V..DT...TK...--
C6WQK6_ACTMD/756-914-------------------------------------Q....S-----..TT...AIV.......N...T...SK...--
C9Z2C7_STRSW/793-953-------------------------------------T....A-----..AS....AV.......H...T...GQ...--
D2PTR0_KRIFD/729-887-------------------------------------S....T-----..TD....PV.......V..RT...DS...--
D2PTR0_KRIFD/514-676-------------------------------------T....T-----..SK...RSA.......V..DT...GK...--
B5H1J2_STRC2/810-972-------------------------------------F....T-----..EL....SS.......V..AT...EA...--
B5H1J2_STRC2/1032-1193-------------------------------------V....T-----..TA...PHL.......N...N...ER...--
C6WL54_ACTMD/905-1058-------------------------------------Q....T-----..RT...PVV.......D...T...RA...--
E6W606_DESIS/780-953-------------------------------------E....D-----.SST....FN.......I...A...TQ...--
C5C072_BEUC1/602-756-------------------------------------S....T-----..TA....RE.......G...G...PQ...--
A0L6L9_MAGMM/10522-10674-------------------------------------Q....S-----..NV...AAT.......T...A...VD...--
D0LH97_HALO1/144-304-------------------------------------K....I-----..AD...VAQ.......L..YP..GAQ...--
Q12UM1_METBU/421-574-------------------------------------S....V-----..DS....SI.......I...E...NY...--
D3SUF1_NATMM/128-286-------------------------------------N....L-----..PE....TLTDPIIDLM...R...DQ...--
Q12UM1_METBU/635-797-------------------------------------V....V-----..ND...NSS.......L...D..LST...--
B1Y080_LEPCP/302-473-------------------------------------D....T-----LLNV....AS.......V...L...GT...--
Q025I9_SOLUE/271-426-------------------------------------N....L-----..GT...SSA.......L..QP...NS...--
Q025I9_SOLUE/616-778-------------------------------------D....F-----..GS...STG.......L...N...PA...--
C6XUD8_PEDHD/202-348-------------------------------------A....A-----..AA....DT...............NT...--
E6W633_DESIS/617-776-------------------------------------T....L-----..PHEYNPII.......S...P..DAE...--
B8FF04_DESAA/2231-2395-------------------------------------V....V-----..SDV.QSLR.......L...S...GT...--
C7PKJ2_CHIPD/89-251-------------------------------------T....L-----..PA....ET.......L...S..DIE...--
D2PTT7_KRIFD/1092-1258-------------------------------------D....L-----..PD....NL.......L...Q..GAA...--
D2PTT7_KRIFD/1416-1585-------------------------------------R....L-----..PD...NIE.......A...G..MDE...--

PF02973

NANA_STRR6/118-309-------------------------------------D----V-------ETNASNGQ-------R---VDLSSELDK--
Q8CWP8_STRR6/42-227-------------------------------------N----K-------SIDISPLL-------L---DKLSGDSQ.--
Q8XMG4_CLOPE/50-236-------------------------------------N----L-------ESSNASNI-------T---YDLEKYKN.--

PF07953

A7GBG3_CLOBL/878-1072-------------------------------------SINGDVYIYS.TNRNQFGIYSSKPSEVNIAQNNDIIYNGRY--
F4AAX8_CLOBO/847-1023-------------------------------------QYTESVELVYGVNGESLYLKSPNE...TVEFSNNFFTNGLT--
O87710_9CLOT/811-986-------------------------------------EYTNDIGLIYGINNNALYLNQSNQ...SVSFTNDYFENGLT--
B1INP6_CLOBK/847-1023-------------------------------------KYSDSISLVYGVNGDALYLKEPDE...SVSFSNKAFENGLT--
Q8GR96_CLOBO/872-1066-------------------------------------EVYDGVELND...KNQFKLTSSTNSEIRVTQNQNIIFNSMF--
BXE_CLOBO/859-1054-------------------------------------NINGDVYKYP.TNKNQFGIYNDKLSEVNISQNDYIIYDNKY--
O69276_CLOBO/816-992-------------------------------------EYSKDIGLVYGINSDALYLNGSNQ...SISFSNDFFENGLT--
BXEN_CLOBU/812-988-------------------------------------EYPKDIGLVYGINNNAIHLTGANQ...NIKFTNDYFENGLT--
Q3ZUA3_9CLOT/40-243-------------------------------------ITYPDAQLVPGINGKAIHLVNNESSEVIVHKAMDIEYNDMF--
O06018_CLOBO/848-1024-------------------------------------QYSDTIDLSYGVNGDALYLKEPNQ...SVNFSNNIFENGLT--
Q841S3_CLOBO/880-1071-------------------------------------RLEGDVQVNT.IYTNDFKLSSSGD.KIIVNLNNNILYSAIY--
BXA1_CLOBH/885-1079-------------------------------------NIGSKVNFDP.IDKNQIQLFNLESSKIEVILKNAIVYNSMY--
BXG_CLOBO/877-1074-------------------------------------NVGSDVIFND.IGNGQFKLNNSENSNITAHQSKFVVYDSMF--

PF06439

A3HZT9_9BACT/35-266...ETFRVKD.G.........................I----I-------EVNY................DDYNE-----
A6LBG6_PARD8/26-215.ADQVYSVRD.G.........................K----I-------F........................-----
B0T1W6_CAUSK/37-271...QTFVVDR.G.........................V----I-------RVSY................AGYDK-----
A4SXW4_POLSQ/31-195.....WVIGN.G.........................I----V-------E........................-----
A6DIW7_9BACT/14-204....TWKVKD.G.........................L----L-------I........................-----
A7LWH3_BACO1/242-448......KIED.G.........................I----L-------KVM..................KSGG-----
A6LFX0_PARD8/51-268......VVED.G.........................S----I-------TYK..................GSDN-----
Q1IP75_KORVE/134-305...NPWKVID.G.........................A----L-------T........................-----
Q01PY8_SOLUE/18-214....GFKIAN.G.........................L----L-------I.......................T-----
Q021Z2_SOLUE/148-318...MKWTVVD.G.........................V----L-------R........................-----
A6C286_9PLAN/26-230.......IVD.N.........................T----I-------V.....................GTS-----
A6L9A1_PARD8/27-220.........D.G.........................V----L-------G........................-----
Q7UXM1_RHOBA/116-314.........N.G.........................V----L-------IG....................TTD-----
Q7UGT3_RHOBA/50-260.........D.G.........................V----I-------HGE..................TTPE-----
A6DGN3_9BACT/486-705.........D.GRRPAPAVVKPKSFEETKVKTPKNAVI----L-------DQSKWAN.........PNWQTDTPG-----
Q026J2_SOLUE/86-285..EPQWKIVD.G.........................H----A-------E........................-----
A7AJH3_9PORP/62-268......VIED.E.........................A----M-------KVFT................APGKK-----
A4AVD2_MARSH/28-192.........D.N.........................E----I-------V.......................G-----
A6CF10_9PLAN/1565-1736.........N.G.........................E----I-------V.....................GRS-----
A4Z0W7_BRASO/36-203.........D.G.........................A----L-------M.....................ADK-----
Q7URI3_RHOBA/55-252......KIEG.N.........................A----L-------TCI.................SHKDQ-----
Q022Y3_SOLUE/158-351..SLWHLVPT.A.........................A----M-------E........................-----
A3ZYX9_9PLAN/31-241...DTWSFND.G.........................G----I-------Q........................-----
Q7UYC2_RHOBA/27-225.........D.G.........................V----I-------HGE..................TTKE-----
Q08RB4_STIAD/354-520....SWAVSG.NQ.......................LT----V-------A........................-----
B1KP96_SHEWM/43-237......VIDQ.D.........................S----I-------H........................-----
Q7ULY5_RHOBA/53-228.......VVD.G.........................E----I-------H........................-----
Q9XAM0_STRCO/521-727.......NPD.G.........................S----I-------T......................SS-----
A6LD72_PARD8/35-236......EVVN.G.........................T----I-------Q.....................ADG-----
A5V6S7_SPHWW/38-269...GTFVAEG.G.........................I----L-------HVRY................DGYRG-----
A3ZPX1_9PLAN/148-325.......TAD.G.........................L----L-------.........................-----
A6E8U4_9SPHI/241-449......LIKD.G.........................E----L-------SVV..................KSDG-----
Q7UFF8_RHOBA/54-264......NGDD.Q.........................T----L-------TWE.................GTEAL-----
A4SYN3_POLSQ/50-213...ANWLIIN.N.........................E----I-------.........................-----
Q01QD3_SOLUE/67-266.VDPKWKVTD.G.........................Y----F-------E........................-----
Q21G79_SACD2/27-266DPKGVFSVVD.G.........................L----L-------R........................-----
Q15XP9_PSEA6/43-289THQADNLNVN.G.........................D----P-------SDAMGLNADVKSVFSVSQEQQPVLH-----
A7NM29_ROSCS/68-253....LWVVVD.G.........................V----L-------RQDRT..............VPPLRD-----
Q02AV5_SOLUE/47-254.........N.G.........................A----L-------VGE..................ITPG-----
Q024T5_SOLUE/20-224....WTVMAD.G.........................T----V-------VGQRIGELRKMLVPGGPLTTPKDFK-----
A6CH23_9PLAN/11-222KWKVVEDPIDAG.........................T----V-------VMSD................DPAAA-----
Q5LID8_BACFN/75-244.........D.G.........................Q----L-------S........................-----
A4AN55_MARSH/13-232.........N.G.........................T----I-------IGE..................ITPE-----
Q7UP53_RHOBA/254-436.......IDDDG.........................H----L-------V........................-----
A3HYW7_9BACT/39-258.........D.G.........................A----I-------VGL..................ITPE-----
Q020M5_SOLUE/283-466....WSVLPD.G.........................T----L-------LGK.................RTA..-----
A7LZB4_BACO1/60-285......TIED.G.........................C----I-------KFNG................SGGGE-----
A6L8C0_PARD8/23-196.........D.D.........................I----M-------T........................-----
A4XES2_NOVAD/37-271....AIRIEK.G.........................V----L-------HMLGSS...........FTGPDVNG-----
Q024G0_SOLUE/10-210......TVED.G.........................C----L-------K......................TS-----
Q7UP53_RHOBA/88-251.....FRVED.E.........................T----I-------V........................-----
Q7UJ71_RHOBA/62-282.........D.E.........................S----I-------VA...................GRLD-----
A6C9B4_9PLAN/53-240......KIKD.G..........................----.-------.........................-----
A0ACR9_STRAM/807-998.........D.G.........................R----R-------TAWP................LSEER-----
A6DSM6_9BACT/29-216.......FKD.G.........................V----A-------T........................-----
Q9XBE0_AMYOR/795-985.........S.G.........................A----P-------ATW.................PVADG-----
A6LB52_PARD8/744-943NMRRDWKVEN.G.........................L----L-------V........................-----
A0M051_GRAFK/45-249......KAEN.G.........................A----I-------SF...................KPSA-----
A6DM12_9BACT/183-370.........E.G.........................M----L-------I.......................N-----
A4ASP9_MARSH/24-229......YADN.G.........................E----L-------IFD..................FQRD-----
A4ATY8_MARSH/64-260.....WKIVD.N.........................D----I-------M........................-----
A4ASM0_MARSH/38-261......VAKD.G.........................A----L-------TFDT................ELGLE-----
Q15XH8_PSEA6/28-257...DTFRVEN.G.........................L----L-------RVSY................DQYDT-----
A6BZI2_9PLAN/34-270.....FTVKD.G.........................M----L-------H........................-----
A6DJ51_9BACT/30-221......VAED.G.........................C----L-------K........................-----
A3ZYG0_9PLAN/42-220.........E.G.........................E----V-------S........................-----
A6LFJ8_PARD8/58-253.....WAIKD.G.........................T----M-------V........................-----
B4SNA4_STRM5/52-245.....WKIAD.G.........................A----M-------T........................-----
Q021Q3_SOLUE/25-318PSIYEAARFH.GVVLRRETEGLLRRNPRGQQLARLNKL----L-------LEDAYSSELAKSAETGWIVKEGAMA-----
A6DFB8_9BACT/988-1186.........D.G.........................V----I-------YG...................STHG-----
A6CBU4_9PLAN/476-662.........A.G.........................K----L-------V........................-----
Q7UTD6_RHOBA/106-307DAKSHWSVEN.G.........................E----L-------V........................-----
A4CGG3_ROBBH/26-212.......VRD.G.........................A----I-------V.....................GTT-----
A4AUV7_MARSH/139-306.....WMVKD.G.........................I----L-------T........................-----
B0T1X3_CAUSK/51-253.....WTVGD.G.........................V----V-------T........................-----
A6C9Y7_9PLAN/38-232EMKEHWNVVD.G.........................V----I-------V........................-----
A3I2W3_9BACT/58-253.....WTIEN.G.........................E----L-------V........................-----
A6DGC3_9BACT/39-228.......VEN.G.........................A----I-------I.....................GKT-----
A6BYQ3_9PLAN/523-721.........E.G.........................A----L-------TG....................KTD-----
Q9A9B2_CAUCR/42-285AEMFKVVIED.GR.......................PA----L-------Y.....