Sequence alignment for CL0004

PF00054

LAMA1_HUMAN/2920-3051--------------------------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------------------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------------------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------------------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------------------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------------------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------------------------------------------------------------------------
AGRIN_CHICK/1416-1546--------------------------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------------------------------------------------------------------------
AGRIN_CHICK/1925-2056--------------------------------------------------------------------------------
CSPG4_RAT/55-182--------------------------------------------------------------------------------
AGRIN_RAT/1291-1422--------------------------------------------------------------------------------
AGRIN_RAT/1559-1694--------------------------------------------------------------------------------
SHBG_RAT/76-206--------------------------------------------------------------------------------
CRB_DROME/1048-1183--------------------------------------------------------------------------------
AGRIN_RAT/1811-1942--------------------------------------------------------------------------------
SLIT_DROME/1204-1335--------------------------------------------------------------------------------
PROS_HUMAN/329-459--------------------------------------------------------------------------------
CRB_DROME/1281-1443--------------------------------------------------------------------------------
SHBG_HUMAN/75-205--------------------------------------------------------------------------------
FAT_DROME/4156-4306--------------------------------------------------------------------------------

PF02210

EYS_HUMAN/3007-3141--------------------------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------------------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------------------------------------------------------------------------
Q7PSM9_ANOGA/919-1050--------------------------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------------------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------------------------------------------------------------------------
CNTP1_MOUSE/390-516--------------------------------------------------------------------------------
Q18291_CAEEL/303-430--------------------------------------------------------------------------------
Q18291_CAEEL/495-627--------------------------------------------------------------------------------
Q18291_CAEEL/722-843--------------------------------------------------------------------------------
Q18291_CAEEL/906-1035--------------------------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------------------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------------------------------------------------------------------------
LAMA5_MOUSE/3157-3274--------------------------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------------------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------------------------------------------------------------------------
NRX3A_MOUSE/475-619--------------------------------------------------------------------------------
NRX3A_HUMAN/287-413--------------------------------------------------------------------------------
CNTP4_MOUSE/400-526--------------------------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------------------------------------------------------------------------
CRUM1_MOUSE/513-650--------------------------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------------------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------------------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------------------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------------------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------------------------------------------------------------------------
Q9VJ82_DROME/55-178--------------------------------------------------------------------------------
Q9VJ82_DROME/238-367--------------------------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------------------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------------------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------------------------------------------------------------------------
CSPG4_HUMAN/55-178--------------------------------------------------------------------------------
CSPG4_HUMAN/230-363--------------------------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------------------------------------------------------------------------
LAMA3_HUMAN/2797-2904--------------------------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------------------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------------------------------------------------------------------------
Q8IQH0_DROME/220-342--------------------------------------------------------------------------------
Q8IQH0_DROME/403-516--------------------------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------------------------------------------------------------------------
EYS_DROME/1723-1856--------------------------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------------------------------------------------------------------------
CNTP5_HUMAN/819-938--------------------------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------------------------------------------------------------------------
NRX3B_HUMAN/117-236--------------------------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------------------------------------------------------------------------
STAN_DROME/1584-1736--------------------------------------------------------------------------------
STAN_DROME/1826-1946--------------------------------------------------------------------------------
NRX3A_HUMAN/55-184--------------------------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------------------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------------------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------------------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------------------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------------------------------------------------------------------------
Q7PT06_ANOGA/364-479--------------------------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------------------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------------------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------------------------------------------------------------------------
Q7Q1N4_ANOGA/1163-1293--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/611-730--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------------------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------------------------------------------------------------------------
CRUM2_MOUSE/469-592--------------------------------------------------------------------------------
CRUM2_MOUSE/901-1019--------------------------------------------------------------------------------
EGFLA_MOUSE/641-767--------------------------------------------------------------------------------
EGFLA_HUMAN/868-996--------------------------------------------------------------------------------
Q19617_CAEEL/154-276--------------------------------------------------------------------------------
Q19617_CAEEL/725-839--------------------------------------------------------------------------------
NRX2A_RAT/949-1077--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------------------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------------------------------------------------------------------------
O45000_CAEEL/275-401--------------------------------------------------------------------------------
O45000_CAEEL/738-847--------------------------------------------------------------------------------
Q22574_CAEEL/136-267--------------------------------------------------------------------------------
Q22574_CAEEL/415-539--------------------------------------------------------------------------------
NRX1A_MOUSE/753-884--------------------------------------------------------------------------------
CADN_DROME/2407-2568--------------------------------------------------------------------------------
CADN_DROME/2661-2796--------------------------------------------------------------------------------
O61230_LYTVA/2142-2298--------------------------------------------------------------------------------
O61230_LYTVA/2393-2517--------------------------------------------------------------------------------
O75852_HUMAN/32-150--------------------------------------------------------------------------------
FAT2_RAT/3802-3923--------------------------------------------------------------------------------
CELR3_RAT/1534-1693--------------------------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------------------------------------------------------------------------
CRB_DROME/1585-1722--------------------------------------------------------------------------------
FAT_DROME/4432-4545--------------------------------------------------------------------------------
P70570_RAT/1017-1137--------------------------------------------------------------------------------
P70570_RAT/1408-1528--------------------------------------------------------------------------------
CNTP1_HUMAN/203-332--------------------------------------------------------------------------------
CNTP1_HUMAN/813-939--------------------------------------------------------------------------------
CRUM1_HUMAN/514-651--------------------------------------------------------------------------------
CRUM1_HUMAN/743-860--------------------------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------------------------------------------------------------------------
P91806_STRPU/27-156--------------------------------------------------------------------------------
P91806_STRPU/212-343--------------------------------------------------------------------------------
CNTP1_RAT/1089-1219--------------------------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------------------------------------------------------------------------
PROS_RABIT/485-617--------------------------------------------------------------------------------
LAMA_DROME/2704-2846--------------------------------------------------------------------------------
LAMA_DROME/2905-3031--------------------------------------------------------------------------------
LAMA_DROME/3083-3205--------------------------------------------------------------------------------
LAMA_DROME/3379-3514--------------------------------------------------------------------------------
LAMA_DROME/3563-3691--------------------------------------------------------------------------------
Q19350_CAEEL/582-695--------------------------------------------------------------------------------
Q19350_CAEEL/789-914--------------------------------------------------------------------------------
EPI1_CAEEL/3101-3218--------------------------------------------------------------------------------
Q21442_CAEEL/537-680--------------------------------------------------------------------------------
Q21442_CAEEL/1363-1488--------------------------------------------------------------------------------
CADE_DROME/1153-1296--------------------------------------------------------------------------------
NRX1A_BOVIN/58-192--------------------------------------------------------------------------------
GAS6_MOUSE/322-450--------------------------------------------------------------------------------
GAS6_MOUSE/510-647--------------------------------------------------------------------------------
LAMA3_MOUSE/2796-2903--------------------------------------------------------------------------------
LAMA3_MOUSE/3016-3136--------------------------------------------------------------------------------
LAMA3_MOUSE/3186-3311--------------------------------------------------------------------------------
NRX2A_RAT/57-187--------------------------------------------------------------------------------
NRX2B_RAT/119-268--------------------------------------------------------------------------------
COBA2_MOUSE/90-213--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------------------------------------------------------------------------
Q7T024_DANRE/32-164--------------------------------------------------------------------------------
Q7T3H4_DANRE/314-442--------------------------------------------------------------------------------
Q7T3H4_DANRE/493-622--------------------------------------------------------------------------------
Q7TSG9_MOUSE/211-328--------------------------------------------------------------------------------
Q7TSG9_MOUSE/448-573--------------------------------------------------------------------------------
Q7TSP8_MOUSE/32-159--------------------------------------------------------------------------------
Q7ZYG1_XENLA/102-225--------------------------------------------------------------------------------
Q867A1_CANFA/1017-1137--------------------------------------------------------------------------------
Q867A1_CANFA/1188-1294--------------------------------------------------------------------------------
Q867A1_CANFA/1408-1528--------------------------------------------------------------------------------
Q867A1_CANFA/1578-1703--------------------------------------------------------------------------------
Q86SD6_CIOIN/125-252--------------------------------------------------------------------------------
Q86SD6_CIOIN/321-465--------------------------------------------------------------------------------
Q86YZ7_HUMAN/748-867--------------------------------------------------------------------------------
Q8AW17_DANRE/66-189--------------------------------------------------------------------------------
Q8C6X0_MOUSE/104-227--------------------------------------------------------------------------------
Q8HYS4_PIG/109-232--------------------------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------------------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------------------------------------------------------------------------
Q8IRV8_DROME/3806-3938--------------------------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------------------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------------------------------------------------------------------------
Q8MY74_9BILA/15-170--------------------------------------------------------------------------------
Q8MY74_9BILA/264-390--------------------------------------------------------------------------------
Q8MY75_9BILA/1323-1478--------------------------------------------------------------------------------
Q8MY76_9BIVA/532-689--------------------------------------------------------------------------------
Q8MY77_BRABE/58-197--------------------------------------------------------------------------------
Q8MY77_BRABE/253-387--------------------------------------------------------------------------------
Q8MY78_ASTPE/2250-2404--------------------------------------------------------------------------------
Q8MY78_ASTPE/2490-2615--------------------------------------------------------------------------------
Q8SZX4_DROME/104-233--------------------------------------------------------------------------------
Q8SZX4_DROME/327-452--------------------------------------------------------------------------------
Q8UUM5_ORYLA/94-217--------------------------------------------------------------------------------
Q8WX98_HUMAN/215-344--------------------------------------------------------------------------------
CNTP5_HUMAN/209-338--------------------------------------------------------------------------------
CNTP5_HUMAN/395-521--------------------------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------------------------------------------------------------------------
Q90WZ3_XENLA/1189-1317--------------------------------------------------------------------------------
Q90Z43_CHICK/454-582--------------------------------------------------------------------------------
Q90Z45_CHICK/604-732--------------------------------------------------------------------------------
Q91VV0_MOUSE/1107-1232--------------------------------------------------------------------------------
NRX4_DROME/824-943--------------------------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------------------------------------------------------------------------
Q96MJ5_HUMAN/398-522--------------------------------------------------------------------------------
Q54A24_HUMAN/398-524--------------------------------------------------------------------------------
NRX1A_CHICK/364-508--------------------------------------------------------------------------------
NRX1A_CHICK/789-917--------------------------------------------------------------------------------
Q9DE36_DANRE/1171-1299--------------------------------------------------------------------------------
Q9DE37_DANRE/1179-1304--------------------------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------------------------------------------------------------------------
Q9I907_PAGMA/107-230--------------------------------------------------------------------------------
Q9IBG4_XENLA/581-714--------------------------------------------------------------------------------
Q9NGV2_DROME/429-557--------------------------------------------------------------------------------
Q9NGV2_DROME/650-776--------------------------------------------------------------------------------
Q9NGV2_DROME/1210-1340--------------------------------------------------------------------------------
Q9NGV4_DROME/611-727--------------------------------------------------------------------------------
Q9NSD0_HUMAN/488-621--------------------------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------------------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------------------------------------------------------------------------
NRX2A_HUMAN/521-666--------------------------------------------------------------------------------
NRX2A_HUMAN/760-890--------------------------------------------------------------------------------
CELR2_RAT/869-995--------------------------------------------------------------------------------
CNTP2_HUMAN/216-345--------------------------------------------------------------------------------
CNTP2_HUMAN/401-529--------------------------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------------------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------------------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------------------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------------------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------------------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------------------------------------------------------------------------
CADN2_DROME/1209-1370--------------------------------------------------------------------------------
FAT2_DROME/3969-4096--------------------------------------------------------------------------------
Q9VZ96_DROME/275-414--------------------------------------------------------------------------------
Q9VZ96_DROME/514-640--------------------------------------------------------------------------------
Q9VZ96_DROME/698-817--------------------------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------------------------------------------------------------------------
Q9XYX0_DROME/1108-1236--------------------------------------------------------------------------------
Q9XZC9_DROME/3030-3161--------------------------------------------------------------------------------
Q9XZC9_DROME/3211-3342--------------------------------------------------------------------------------
Q9ZBW1_STRCO/478-605--------------------------------------------------------------------------------

PF00457

XYN3_ASPKW/27-209--------------------------------------------------------------------------------
XYNC_STRLI/59-238--------------------------------------------------------------------------------
XYNA_BACCI/27-212--------------------------------------------------------------------------------
XYN1_COCCA/38-218--------------------------------------------------------------------------------
XYNA_CLOSA/68-254--------------------------------------------------------------------------------
XYNA_SCHCO/8-196--------------------------------------------------------------------------------
XYN1_HYPJE/50-227--------------------------------------------------------------------------------
XYNA_BACPU/36-221--------------------------------------------------------------------------------
XYN2_HYPJE/40-221--------------------------------------------------------------------------------
XYNA2_CLOSR/40-227--------------------------------------------------------------------------------
XYNB_STRLI/51-230--------------------------------------------------------------------------------
XYNA_RUMFL/36-235--------------------------------------------------------------------------------

PF01670

GUNA_ASPKW/82-239--------------------------------------------------------------------------------
GUN_ASPAC/84-237--------------------------------------------------------------------------------
P96492_THENE/99-273--------------------------------------------------------------------------------
O53438_MYCTU/1-151--------------------------------------------------------------------------------
O00095_HYPJE/81-234--------------------------------------------------------------------------------
O08428_THENE/81-254--------------------------------------------------------------------------------
GUNS_PECCC/107-264--------------------------------------------------------------------------------
Q60032_THEMT/81-254--------------------------------------------------------------------------------
O08468_STRHA/108-258--------------------------------------------------------------------------------
Q54331_STRLI/111-261--------------------------------------------------------------------------------
O13454_ASPOZ/82-239--------------------------------------------------------------------------------
O33897_RHOMR/106-260--------------------------------------------------------------------------------

PF00354

CRP_HUMAN/25-220--------------------------------------------------------------------------------
SAMP_HUMAN/26-219--------------------------------------------------------------------------------
CRP1_LIMPO/33-237--------------------------------------------------------------------------------
SAMP_MOUSE/27-220--------------------------------------------------------------------------------
SAMP_RAT/27-220--------------------------------------------------------------------------------
CRP_XENLA/23-219--------------------------------------------------------------------------------
FP_CRIMI/26-219--------------------------------------------------------------------------------
CRP_MOUSE/26-221--------------------------------------------------------------------------------
CRP_RABIT/26-221--------------------------------------------------------------------------------

PF13385

C6IP17_9BACE/143-331--------------------------------------------------------------------------------
B5HK67_STRPR/813-980--------------------------------------------------------------------------------
B5HK67_STRPR/1039-1213--------------------------------------------------------------------------------
B5HSG2_9ACTO/784-950--------------------------------------------------------------------------------
B5HSG2_9ACTO/1024-1214--------------------------------------------------------------------------------
A2TQ55_9FLAO/511-667--------------------------------------------------------------------------------
A4HQF1_LEIBR/417-575--------------------------------------------------------------------------------
A4HMI3_LEIBR/692-852--------------------------------------------------------------------------------
C1E3W3_MICSR/499-682--------------------------------------------------------------------------------
C1E3W3_MICSR/738-918--------------------------------------------------------------------------------
C1E3W3_MICSR/990-1183--------------------------------------------------------------------------------
C1E3W3_MICSR/1513-1710--------------------------------------------------------------------------------
C1E3W3_MICSR/1777-1953--------------------------------------------------------------------------------
C1E3W3_MICSR/2021-2219--------------------------------------------------------------------------------
C1E3W3_MICSR/3428-3615--------------------------------------------------------------------------------
C1E3W3_MICSR/3717-3923--------------------------------------------------------------------------------
C1E3W3_MICSR/4016-4222--------------------------------------------------------------------------------
A9AX01_HERA2/1704-1859--------------------------------------------------------------------------------
A9AX01_HERA2/2658-2820--------------------------------------------------------------------------------
A9AX01_HERA2/2979-3139--------------------------------------------------------------------------------
A9AX01_HERA2/3459-3613--------------------------------------------------------------------------------
A9AX01_HERA2/3682-3839--------------------------------------------------------------------------------
A0L6L9_MAGSM/6878-7036--------------------------------------------------------------------------------
A0L6L9_MAGSM/7692-7855--------------------------------------------------------------------------------
A0L6L9_MAGSM/10293-10458--------------------------------------------------------------------------------
A0L6L9_MAGSM/10517-10674--------------------------------------------------------------------------------
A0L6L9_MAGSM/11010-11176--------------------------------------------------------------------------------
C1MTE9_MICPC/801-984--------------------------------------------------------------------------------
C1MTE9_MICPC/2180-2367--------------------------------------------------------------------------------
C1MTE9_MICPC/2462-2670--------------------------------------------------------------------------------
C1MTE9_MICPC/3450-3730--------------------------------------------------------------------------------
A3XS24_9VIBR/1516-1662--------------------------------------------------------------------------------
A3XS24_9VIBR/1814-1973--------------------------------------------------------------------------------
D1YWM2_METPS/379-538--------------------------------------------------------------------------------
D1YWM2_METPS/634-793--------------------------------------------------------------------------------
B9XBQ7_9BACT/87-254--------------------------------------------------------------------------------
B9XBQ7_9BACT/333-511--------------------------------------------------------------------------------
B9XBQ7_9BACT/584-754--------------------------------------------------------------------------------
B9XBQ7_9BACT/907-1066--------------------------------------------------------------------------------
Q12UM1_METBU/206-367--------------------------------------------------------------------------------
Q12UM1_METBU/416-574--------------------------------------------------------------------------------
Q12UM1_METBU/630-797--------------------------------------------------------------------------------
Q12UM1_METBU/1025-1180--------------------------------------------------------------------------------
Q1Q6Y8_9BACT/1609-1779--------------------------------------------------------------------------------
A6FYU1_9DELT/4-164--------------------------------------------------------------------------------
A6FYU1_9DELT/221-380--------------------------------------------------------------------------------
A6FYU1_9DELT/656-816--------------------------------------------------------------------------------
A7BSN2_9GAMM/44-211--------------------------------------------------------------------------------
A7BSN2_9GAMM/271-432--------------------------------------------------------------------------------
A7BSN2_9GAMM/495-650--------------------------------------------------------------------------------
B5JIQ7_9BACT/93-256--------------------------------------------------------------------------------
B5JIQ7_9BACT/1081-1243--------------------------------------------------------------------------------
A0ZJ64_NODSP/167-349--------------------------------------------------------------------------------
A0ZJ64_NODSP/406-564--------------------------------------------------------------------------------
Q112U0_TRIEI/317-477--------------------------------------------------------------------------------
A9V7L7_MONBE/271-438--------------------------------------------------------------------------------
A9V7L7_MONBE/494-654--------------------------------------------------------------------------------
A9V7L7_MONBE/712-870--------------------------------------------------------------------------------
B5H1J2_STRCL/805-972--------------------------------------------------------------------------------
B5H1J2_STRCL/1027-1193--------------------------------------------------------------------------------
B5H1J2_STRCL/1247-1444--------------------------------------------------------------------------------
B4CUW8_9BACT/507-671--------------------------------------------------------------------------------
B4CUW8_9BACT/717-881--------------------------------------------------------------------------------
B4CUW8_9BACT/925-1088--------------------------------------------------------------------------------
C0A826_9BACT/82-235--------------------------------------------------------------------------------
B4CU79_9BACT/530-695--------------------------------------------------------------------------------
B4CU79_9BACT/743-907--------------------------------------------------------------------------------
B4CU79_9BACT/950-1117--------------------------------------------------------------------------------
A5G5W5_GEOUR/2827-2981--------------------------------------------------------------------------------
A5G5W5_GEOUR/3120-3280--------------------------------------------------------------------------------
B1C4U2_9FIRM/67-237--------------------------------------------------------------------------------
B1C4U2_9FIRM/289-449--------------------------------------------------------------------------------
B1C4U2_9FIRM/783-955--------------------------------------------------------------------------------
B8FIJ2_DESAA/1831-1990--------------------------------------------------------------------------------
B8FIJ2_DESAA/2134-2295--------------------------------------------------------------------------------
B8FIJ2_DESAA/3096-3258--------------------------------------------------------------------------------
A4CID0_ROBBH/179-344--------------------------------------------------------------------------------
A4CID0_ROBBH/610-790--------------------------------------------------------------------------------
E8W159_STRFA/1054-1222--------------------------------------------------------------------------------
E8W159_STRFA/1335-1504--------------------------------------------------------------------------------
Q2CEY6_9RHOB/408-563--------------------------------------------------------------------------------
Q2CEY6_9RHOB/1555-1715--------------------------------------------------------------------------------
A3TZ88_9RHOB/431-586--------------------------------------------------------------------------------
A3TZ88_9RHOB/1595-1756--------------------------------------------------------------------------------
A3TZ88_9RHOB/2040-2208--------------------------------------------------------------------------------
B9XIT2_9BACT/377-534--------------------------------------------------------------------------------
B9XIT2_9BACT/676-834--------------------------------------------------------------------------------
B9XIT2_9BACT/980-1139--------------------------------------------------------------------------------
B1WQC8_CYAA5/524-689--------------------------------------------------------------------------------
B1WQC8_CYAA5/1267-1430--------------------------------------------------------------------------------
B1WQC8_CYAA5/1487-1639--------------------------------------------------------------------------------
A9V0U4_MONBE/359-524--------------------------------------------------------------------------------
A9V0U4_MONBE/585-745--------------------------------------------------------------------------------
A9V0U4_MONBE/804-963--------------------------------------------------------------------------------
A9VEK3_MONBE/38-204--------------------------------------------------------------------------------
B3PKP2_CELJU/660-825--------------------------------------------------------------------------------
B3PKP2_CELJU/969-1129--------------------------------------------------------------------------------
A1ZIY6_9BACT/389-541--------------------------------------------------------------------------------
A1ZIY6_9BACT/741-910--------------------------------------------------------------------------------
A1ZIY6_9BACT/1920-2067--------------------------------------------------------------------------------
B6ES74_ALISL/190-345--------------------------------------------------------------------------------
B6ES74_ALISL/500-655--------------------------------------------------------------------------------
B9XR24_9BACT/99-270--------------------------------------------------------------------------------
B9XR24_9BACT/347-521--------------------------------------------------------------------------------
B4DB48_9BACT/865-1021--------------------------------------------------------------------------------
C7DG96_9EURY/379-534--------------------------------------------------------------------------------
C7DG96_9EURY/587-759--------------------------------------------------------------------------------
D2BE74_STRRD/717-881--------------------------------------------------------------------------------
D2BE74_STRRD/929-1096--------------------------------------------------------------------------------
Q0HV90_SHESR/643-815--------------------------------------------------------------------------------
Q0HV90_SHESR/959-1113--------------------------------------------------------------------------------
A7BQ37_9GAMM/824-993--------------------------------------------------------------------------------
A7BQ37_9GAMM/1055-1222--------------------------------------------------------------------------------
D2PTT7_KRIFD/1087-1258--------------------------------------------------------------------------------
D2PTT7_KRIFD/1411-1585--------------------------------------------------------------------------------
C3YCM4_BRAFL/394-559--------------------------------------------------------------------------------
C7DG99_9EURY/172-333--------------------------------------------------------------------------------
C7DG99_9EURY/507-676--------------------------------------------------------------------------------
C7DG99_9EURY/724-893--------------------------------------------------------------------------------
A9VE19_MONBE/314-480--------------------------------------------------------------------------------
A9VE19_MONBE/539-692--------------------------------------------------------------------------------
D2PTR0_KRIFD/509-676--------------------------------------------------------------------------------
D2PTR0_KRIFD/724-887--------------------------------------------------------------------------------
C9Z507_STRSW/85-252--------------------------------------------------------------------------------
C9Z507_STRSW/880-1051--------------------------------------------------------------------------------
B9XSE8_9BACT/106-287--------------------------------------------------------------------------------
B9XSE8_9BACT/544-758--------------------------------------------------------------------------------
Q8AAU9_BACTN/556-751--------------------------------------------------------------------------------
B4DBW7_9BACT/343-518--------------------------------------------------------------------------------
B4DBW7_9BACT/723-901--------------------------------------------------------------------------------
A1ZNX8_9BACT/30-185--------------------------------------------------------------------------------
A1ZNX8_9BACT/1936-2081--------------------------------------------------------------------------------
Q3A7I8_PELCD/248-409--------------------------------------------------------------------------------
Q3A7I8_PELCD/466-622--------------------------------------------------------------------------------
C6WQK6_ACTMD/751-914--------------------------------------------------------------------------------
C6WQK6_ACTMD/960-1138--------------------------------------------------------------------------------
A1ZVW7_9BACT/1977-2130--------------------------------------------------------------------------------
C0BUU7_9BIFI/1272-1447--------------------------------------------------------------------------------
Q21FF7_SACD2/693-861--------------------------------------------------------------------------------
Q21FF7_SACD2/1008-1165--------------------------------------------------------------------------------
D4J0Z2_BUTFI/85-242--------------------------------------------------------------------------------
D4J0Z2_BUTFI/302-464--------------------------------------------------------------------------------
F1TD97_9CLOT/74-242--------------------------------------------------------------------------------
F1TD97_9CLOT/798-960--------------------------------------------------------------------------------
A8T2S4_9VIBR/246-407--------------------------------------------------------------------------------
B0SG40_LEPBA/1149-1299--------------------------------------------------------------------------------
B0SG40_LEPBA/1360-1526--------------------------------------------------------------------------------
B9XQM3_9BACT/1183-1350--------------------------------------------------------------------------------
B9XQM3_9BACT/1611-1774--------------------------------------------------------------------------------
B9XKM7_9BACT/82-250--------------------------------------------------------------------------------
B9XKM7_9BACT/504-693--------------------------------------------------------------------------------
C2GWB7_BIFLN/98-274--------------------------------------------------------------------------------
C2GWB7_BIFLN/783-943--------------------------------------------------------------------------------
A9VAU4_MONBE/230-399--------------------------------------------------------------------------------
A9VAU4_MONBE/459-623--------------------------------------------------------------------------------
B5I5M1_9ACTO/756-922--------------------------------------------------------------------------------
B5I5M1_9ACTO/980-1161--------------------------------------------------------------------------------
B0SER7_LEPBA/623-775--------------------------------------------------------------------------------
B0SER7_LEPBA/822-978--------------------------------------------------------------------------------
Q7UF08_RHOBA/1547-1724--------------------------------------------------------------------------------
A1ZI15_9BACT/2043-2196--------------------------------------------------------------------------------
B9XRA5_9BACT/68-245--------------------------------------------------------------------------------
B9XRA5_9BACT/395-559--------------------------------------------------------------------------------
Q025I9_SOLUE/268-426--------------------------------------------------------------------------------
Q025I9_SOLUE/611-778--------------------------------------------------------------------------------
D4J0Z1_BUTFI/161-331--------------------------------------------------------------------------------
D4J0Z1_BUTFI/1079-1248--------------------------------------------------------------------------------
C5A5H2_THEGJ/288-448--------------------------------------------------------------------------------
D0LH97_HALO1/139-304--------------------------------------------------------------------------------
D0LH97_HALO1/418-584--------------------------------------------------------------------------------
B5S513_RALSL/599-761--------------------------------------------------------------------------------
B6FL10_9CLOT/94-268--------------------------------------------------------------------------------
B6FL10_9CLOT/1094-1263--------------------------------------------------------------------------------
B9XNF4_9BACT/100-267--------------------------------------------------------------------------------
B9XNF4_9BACT/337-542--------------------------------------------------------------------------------
B9XNF4_9BACT/1418-1587--------------------------------------------------------------------------------
B1Z442_BURA4/571-733--------------------------------------------------------------------------------
C4RHZ8_9ACTO/993-1154--------------------------------------------------------------------------------
Q3ZYD7_DEHSC/121-281--------------------------------------------------------------------------------
D1JG45_9ARCH/87-239--------------------------------------------------------------------------------
B7B809_9PORP/808-979--------------------------------------------------------------------------------
D2S7A7_GEOOG/124-331--------------------------------------------------------------------------------
D2S7A7_GEOOG/404-567--------------------------------------------------------------------------------
B4DBW6_9BACT/675-838--------------------------------------------------------------------------------
B4DBW6_9BACT/1004-1165--------------------------------------------------------------------------------
C7Q3C0_CATAD/677-839--------------------------------------------------------------------------------
D7B4B0_NOCDD/985-1152--------------------------------------------------------------------------------
E8WC63_STRFA/486-660--------------------------------------------------------------------------------
E8WC63_STRFA/714-888--------------------------------------------------------------------------------
D1W043_9BACT/612-763--------------------------------------------------------------------------------
D1W043_9BACT/1088-1239--------------------------------------------------------------------------------
A9ECQ9_9FLAO/180-355--------------------------------------------------------------------------------
E6U4D5_ETHHY/571-732--------------------------------------------------------------------------------
E6U4D5_ETHHY/791-955--------------------------------------------------------------------------------
D3EBL1_GEOS4/639-797--------------------------------------------------------------------------------
A3KK79_STRAM/307-464--------------------------------------------------------------------------------
A3KK79_STRAM/529-696--------------------------------------------------------------------------------
D1JA15_9ARCH/516-672--------------------------------------------------------------------------------
C7BV05_9CAUD/528-695--------------------------------------------------------------------------------
C7BV05_9CAUD/979-1149--------------------------------------------------------------------------------
Q8CJN7_STRCO/818-1003--------------------------------------------------------------------------------
Q8CJN7_STRCO/1057-1254--------------------------------------------------------------------------------
D2MHJ3_9BACT/38-196--------------------------------------------------------------------------------
A6DI80_9BACT/69-224--------------------------------------------------------------------------------
A6DI80_9BACT/409-566--------------------------------------------------------------------------------
B9JMF4_AGRRK/589-752--------------------------------------------------------------------------------
C6D6G1_PAESJ/689-843--------------------------------------------------------------------------------
B3G4E3_ADIVA/133-304--------------------------------------------------------------------------------
A6DIA2_9BACT/77-247--------------------------------------------------------------------------------
A6DIA2_9BACT/485-652--------------------------------------------------------------------------------
C6IZP4_9BACL/694-846--------------------------------------------------------------------------------
D2MH98_9BACT/68-223--------------------------------------------------------------------------------
Q2S986_HAHCH/529-688--------------------------------------------------------------------------------
A5IKD5_THEP1/72-243--------------------------------------------------------------------------------
A5IKD8_THEP1/84-252--------------------------------------------------------------------------------
A5IKD9_THEP1/70-241--------------------------------------------------------------------------------
B8E3D5_DICTD/75-246--------------------------------------------------------------------------------
Q9RGC0_9PSED/58-241--------------------------------------------------------------------------------
D3Q5W9_STANL/397-559--------------------------------------------------------------------------------
B8E3D6_DICTD/88-243--------------------------------------------------------------------------------
B4WFU8_9SYNE/1165-1322--------------------------------------------------------------------------------
D2S068_HALTV/1213-1371--------------------------------------------------------------------------------
C7R5J8_JONDD/642-797--------------------------------------------------------------------------------
B9XF62_9BACT/754-913--------------------------------------------------------------------------------
B9XF62_9BACT/1163-1328--------------------------------------------------------------------------------
C0BFQ3_9BACT/663-844--------------------------------------------------------------------------------
C0BFQ3_9BACT/1593-1762--------------------------------------------------------------------------------
Q82GV4_STRAW/288-440--------------------------------------------------------------------------------
Q82GV4_STRAW/507-677--------------------------------------------------------------------------------
B9XQP8_9BACT/1436-1601--------------------------------------------------------------------------------
D2RI28_ARCPA/200-357--------------------------------------------------------------------------------
Q82NZ6_STRAW/688-850--------------------------------------------------------------------------------
B0RBH3_CLAMS/131-296--------------------------------------------------------------------------------
B4CYT0_9BACT/1004-1165--------------------------------------------------------------------------------
A5IKD7_THEP1/80-241--------------------------------------------------------------------------------
A7RFD3_NEMVE/587-745--------------------------------------------------------------------------------
A7RFD3_NEMVE/814-978--------------------------------------------------------------------------------
B4D2H5_9BACT/770-926--------------------------------------------------------------------------------
A7BLG4_9GAMM/11-182--------------------------------------------------------------------------------
D1YWT9_METPS/74-233--------------------------------------------------------------------------------
B4D5C1_9BACT/847-1006--------------------------------------------------------------------------------
A7NM90_ROSCS/2533-2667--------------------------------------------------------------------------------
C3YC48_BRAFL/3070-3244--------------------------------------------------------------------------------
B9XCZ6_9BACT/452-613--------------------------------------------------------------------------------
B1VPR2_STRGG/841-1008--------------------------------------------------------------------------------
A6FZW9_9DELT/150-306--------------------------------------------------------------------------------
Q9KBP7_BACHD/618-775--------------------------------------------------------------------------------
A6DIA3_9BACT/77-235--------------------------------------------------------------------------------
A6DIA3_9BACT/430-581--------------------------------------------------------------------------------
A5GAT0_GEOUR/77-245--------------------------------------------------------------------------------
C7NU53_HALUD/819-971--------------------------------------------------------------------------------
C7R5J7_JONDD/543-698--------------------------------------------------------------------------------
A5FKP6_FLAJ1/643-806--------------------------------------------------------------------------------
C5C072_BEUC1/597-756--------------------------------------------------------------------------------
B1VKK7_STRGG/739-905--------------------------------------------------------------------------------
Q9F0I5_PAEMA/447-622--------------------------------------------------------------------------------
D0LXW7_HALO1/117-278--------------------------------------------------------------------------------
A9WA06_CHLAA/1556-1710--------------------------------------------------------------------------------
A9WA06_CHLAA/2510-2646--------------------------------------------------------------------------------
B4WNI1_9SYNE/1038-1201--------------------------------------------------------------------------------
B4WNI1_9SYNE/1270-1438--------------------------------------------------------------------------------
Q1Z1R8_PHOPR/409-572--------------------------------------------------------------------------------
D2QKT6_SPILD/62-225--------------------------------------------------------------------------------
B9XJN0_9BACT/964-1136--------------------------------------------------------------------------------
D3F0R0_CONWI/81-255--------------------------------------------------------------------------------
Q1IAN3_PSEE4/1352-1533--------------------------------------------------------------------------------
D2KW09_9BACL/548-698--------------------------------------------------------------------------------
Q64ZH3_BACFR/87-258--------------------------------------------------------------------------------
B9XRK5_9BACT/771-923--------------------------------------------------------------------------------
D2RHY5_ARCPA/85-250--------------------------------------------------------------------------------
Q09BW4_STIAD/232-387--------------------------------------------------------------------------------
A9UYJ6_MONBE/339-527--------------------------------------------------------------------------------
A9UYJ6_MONBE/605-770--------------------------------------------------------------------------------
C5BR34_TERTT/279-438--------------------------------------------------------------------------------
A7BSA6_9GAMM/93-264--------------------------------------------------------------------------------
C9P2T6_VIBME/335-497--------------------------------------------------------------------------------
B9XPI1_9BACT/67-230--------------------------------------------------------------------------------
B9XNV5_9BACT/85-245--------------------------------------------------------------------------------
B0BI81_9BACT/117-283--------------------------------------------------------------------------------
B9L5Y9_NAUPA/341-510--------------------------------------------------------------------------------
B9L5Y9_NAUPA/584-760--------------------------------------------------------------------------------
D2MKT6_9BACT/66-219--------------------------------------------------------------------------------
B5JIL5_9BACT/1259-1418--------------------------------------------------------------------------------
B8GR77_THISH/225-391--------------------------------------------------------------------------------
B9XJI0_9BACT/873-1042--------------------------------------------------------------------------------
B9XJI0_9BACT/1110-1278--------------------------------------------------------------------------------
B9XB13_9BACT/1144-1312--------------------------------------------------------------------------------
D2QKF2_SPILD/352-526--------------------------------------------------------------------------------
Q26HK5_FLABB/23-183--------------------------------------------------------------------------------
A6CAJ5_9PLAN/479-645--------------------------------------------------------------------------------
B5M9N9_STRLS/927-1086--------------------------------------------------------------------------------
D2RF32_ARCPA/203-366--------------------------------------------------------------------------------
A6DLA7_9BACT/349-518--------------------------------------------------------------------------------
E6U4E1_ETHHY/86-250--------------------------------------------------------------------------------
E6U4E1_ETHHY/784-946--------------------------------------------------------------------------------
C9Q244_9VIBR/239-399--------------------------------------------------------------------------------
A3KHU1_STRAM/255-431--------------------------------------------------------------------------------
B4WP60_9SYNE/551-730--------------------------------------------------------------------------------
A6DSI2_9BACT/432-601--------------------------------------------------------------------------------
B2J7Y5_NOSP7/1077-1239--------------------------------------------------------------------------------
C7MFU6_BRAFD/81-246--------------------------------------------------------------------------------
E6W633_DESIS/612-776--------------------------------------------------------------------------------
D2QME8_SPILD/62-232--------------------------------------------------------------------------------
A6C871_9PLAN/174-361--------------------------------------------------------------------------------
B5JKS9_9BACT/735-891--------------------------------------------------------------------------------
D1N8J1_9BACT/65-221--------------------------------------------------------------------------------
B1BNK4_CLOPF/78-238--------------------------------------------------------------------------------
A3ZT42_9PLAN/352-527--------------------------------------------------------------------------------
A6C3W6_9PLAN/343-518--------------------------------------------------------------------------------
C9YSY4_STRSW/83-255--------------------------------------------------------------------------------
A7VXP7_9CLOT/1543-1697--------------------------------------------------------------------------------
A7C3F7_9GAMM/76-243--------------------------------------------------------------------------------
B1C336_9FIRM/592-740--------------------------------------------------------------------------------
Q11V34_CYTH3/470-632--------------------------------------------------------------------------------
A3ZSH6_9PLAN/365-543--------------------------------------------------------------------------------
A8ABA7_IGNH4/303-476--------------------------------------------------------------------------------
C6WL54_ACTMD/900-1058--------------------------------------------------------------------------------
C9ZAH4_STRSW/168-331--------------------------------------------------------------------------------
C0BH93_9BACT/71-260--------------------------------------------------------------------------------
C0BH93_9BACT/774-924--------------------------------------------------------------------------------
D3FFH5_CONWI/94-255--------------------------------------------------------------------------------
C4REW1_9ACTO/454-621--------------------------------------------------------------------------------
Q5E1F1_VIBF1/333-497--------------------------------------------------------------------------------
B8FFM0_DESAA/606-772--------------------------------------------------------------------------------
C2GWB5_BIFLN/83-253--------------------------------------------------------------------------------
C6W5Q6_DYAFD/67-233--------------------------------------------------------------------------------
Q4BVA3_CROWT/438-594--------------------------------------------------------------------------------
C6WP14_ACTMD/1437-1597--------------------------------------------------------------------------------
A9DV23_9FLAO/71-238--------------------------------------------------------------------------------
B1BZX6_9FIRM/439-587--------------------------------------------------------------------------------
D3F200_CONWI/284-437--------------------------------------------------------------------------------
A9AVE2_HERA2/51-206--------------------------------------------------------------------------------
B4WP62_9SYNE/1025-1201--------------------------------------------------------------------------------
B9XFJ5_9BACT/1123-1293--------------------------------------------------------------------------------
A5US22_ROSS1/40-194--------------------------------------------------------------------------------
B8FF04_DESAA/2226-2395--------------------------------------------------------------------------------
D1N5I7_9BACT/61-228--------------------------------------------------------------------------------
C7QBN6_CATAD/347-521--------------------------------------------------------------------------------
A9ERE1_SORC5/151-299--------------------------------------------------------------------------------
A6DR58_9BACT/44-196--------------------------------------------------------------------------------
C3U0P6_9BACT/412-578--------------------------------------------------------------------------------
B5LWG3_9PHYC/41-196--------------------------------------------------------------------------------
C6W2U2_DYAFD/85-270--------------------------------------------------------------------------------
B9XRA3_9BACT/915-1084--------------------------------------------------------------------------------
B4CYP7_9BACT/402-560--------------------------------------------------------------------------------
D3EAV8_GEOS4/59-242--------------------------------------------------------------------------------
C9Z2C7_STRSW/788-953--------------------------------------------------------------------------------
A7S999_NEMVE/80-241--------------------------------------------------------------------------------
B0R0F2_DANRE/84-248--------------------------------------------------------------------------------
D2R2C9_PIRSD/92-280--------------------------------------------------------------------------------
D1N440_9BACT/265-425--------------------------------------------------------------------------------
B7BC96_9PORP/290-465--------------------------------------------------------------------------------
Q11RF9_CYTH3/63-223--------------------------------------------------------------------------------
D2HFC1_AILME/255-434--------------------------------------------------------------------------------
D2MK76_9BACT/72-236--------------------------------------------------------------------------------
D2QYB6_PIRSD/350-513--------------------------------------------------------------------------------
C0A3B4_9BACT/75-255--------------------------------------------------------------------------------
A0KCD8_BURCH/575-734--------------------------------------------------------------------------------
C0JKE8_9CNID/98-257--------------------------------------------------------------------------------
C6WK26_ACTMD/256-414--------------------------------------------------------------------------------
Q11TR6_CYTH3/67-238--------------------------------------------------------------------------------
C9KS24_9BACE/174-343--------------------------------------------------------------------------------
C6WE64_ACTMD/93-256--------------------------------------------------------------------------------
A3XHG5_LEEBM/75-230--------------------------------------------------------------------------------
A2SGZ6_METPP/1212-1389--------------------------------------------------------------------------------
Q1CYH0_MYXXD/203-378--------------------------------------------------------------------------------
B9XP36_9BACT/812-969--------------------------------------------------------------------------------
C4RFN0_9ACTO/720-882--------------------------------------------------------------------------------
A1ZNA6_9BACT/47-195--------------------------------------------------------------------------------
Q2SFE6_HAHCH/1420-1563--------------------------------------------------------------------------------
A9AVC5_HERA2/48-212--------------------------------------------------------------------------------
Q4DW65_TRYCC/416-574--------------------------------------------------------------------------------
B4WFW4_9SYNE/1032-1209--------------------------------------------------------------------------------
A6DFJ8_9BACT/285-467--------------------------------------------------------------------------------
B3T5F8_9ZZZZ/26-177--------------------------------------------------------------------------------
B5D1X2_9BACE/452-632--------------------------------------------------------------------------------
D3IBS1_9BACT/838-1024--------------------------------------------------------------------------------
C0BIM3_9BACT/486-670--------------------------------------------------------------------------------
B4D4I9_9BACT/398-546--------------------------------------------------------------------------------
Q6XR78_9BACT/330-512--------------------------------------------------------------------------------
B9XLW9_9BACT/1683-1852--------------------------------------------------------------------------------
A6C7N1_9PLAN/469-632--------------------------------------------------------------------------------
D2S0M1_HALTV/102-283--------------------------------------------------------------------------------
C0W8I7_9ACTO/94-265--------------------------------------------------------------------------------
D9TDD0_MICAI/800-962--------------------------------------------------------------------------------
C6X6D4_FLAB3/83-273--------------------------------------------------------------------------------
C6VYS1_DYAFD/497-672--------------------------------------------------------------------------------
C7PAG2_CHIPD/920-1086--------------------------------------------------------------------------------
D2EXW4_9BACE/79-271--------------------------------------------------------------------------------
B4D5Z2_9BACT/348-512--------------------------------------------------------------------------------
A4FPB7_SACEN/624-786--------------------------------------------------------------------------------
C6WMV3_ACTMD/573-733--------------------------------------------------------------------------------
Q7UJX1_RHOBA/50-209--------------------------------------------------------------------------------
A4A0C0_9PLAN/363-531--------------------------------------------------------------------------------
Q7URW0_RHOBA/367-559--------------------------------------------------------------------------------
A6DHV3_9BACT/341-513--------------------------------------------------------------------------------
B4D4T4_9BACT/390-545--------------------------------------------------------------------------------
B6G8E7_9ACTN/62-218--------------------------------------------------------------------------------
B9PQF9_TOXGO/122-271--------------------------------------------------------------------------------
A7S3Q5_NEMVE/162-320--------------------------------------------------------------------------------
D5SYY5_PLAL2/128-328--------------------------------------------------------------------------------
A9F726_SORC5/116-294--------------------------------------------------------------------------------
C4RIT9_9ACTO/392-554--------------------------------------------------------------------------------
A7RK85_NEMVE/106-274--------------------------------------------------------------------------------
C7PKJ2_CHIPD/84-251--------------------------------------------------------------------------------
B0N4L9_9FIRM/1244-1393--------------------------------------------------------------------------------
A0LSM6_ACIC1/412-612--------------------------------------------------------------------------------
A7SIB1_NEMVE/85-243--------------------------------------------------------------------------------
A7RIY7_NEMVE/105-286--------------------------------------------------------------------------------
C3ZG11_BRAFL/63-224--------------------------------------------------------------------------------
Q7UQA7_RHOBA/106-269--------------------------------------------------------------------------------
B1C0I8_9FIRM/105-267--------------------------------------------------------------------------------
D2H2H5_AILME/16-191--------------------------------------------------------------------------------
B9XQ67_9BACT/487-653--------------------------------------------------------------------------------
Q15ZH4_PSEA6/374-555--------------------------------------------------------------------------------
C3ZHW9_BRAFL/119-292--------------------------------------------------------------------------------
B3PEP0_CELJU/1203-1381--------------------------------------------------------------------------------
B9XJH3_9BACT/840-1011--------------------------------------------------------------------------------
A6C6P7_9PLAN/374-539--------------------------------------------------------------------------------
A9DIG8_9FLAO/489-650--------------------------------------------------------------------------------
B4DAY9_9BACT/342-525--------------------------------------------------------------------------------
B9XJI2_9BACT/384-535--------------------------------------------------------------------------------
C9RK22_FIBSS/405-579--------------------------------------------------------------------------------
Q11QZ4_CYTH3/221-389--------------------------------------------------------------------------------
A3ZZC4_9PLAN/344-513--------------------------------------------------------------------------------
A9E0U6_9FLAO/61-258--------------------------------------------------------------------------------
C9RJ78_FIBSS/288-457--------------------------------------------------------------------------------
B5HCG7_STRPR/177-340--------------------------------------------------------------------------------
D1JWC6_9BACE/31-177--------------------------------------------------------------------------------
C0A1S0_9BACT/90-270--------------------------------------------------------------------------------
A9V190_MONBE/84-262--------------------------------------------------------------------------------
A6CGM5_9PLAN/366-543--------------------------------------------------------------------------------
A4BJB6_9GAMM/70-236--------------------------------------------------------------------------------
C6IPE3_9BACE/171-339--------------------------------------------------------------------------------
A6DI92_9BACT/1411-1561--------------------------------------------------------------------------------
D3PDE8_DEFDS/259-420--------------------------------------------------------------------------------
D3SUF1_NATMM/123-286--------------------------------------------------------------------------------
C4RNA3_9ACTO/674-835--------------------------------------------------------------------------------
D3I9E5_9BACT/845-1031--------------------------------------------------------------------------------
B4D1M2_9BACT/359-532--------------------------------------------------------------------------------
B9IR57_BACCQ/491-650--------------------------------------------------------------------------------
A3J537_9FLAO/808-958--------------------------------------------------------------------------------
B0UY77_DANRE/29-207--------------------------------------------------------------------------------
A4A1Z8_9PLAN/377-557--------------------------------------------------------------------------------
USH2A_HUMAN/125-286--------------------------------------------------------------------------------
A5FGK8_FLAJ1/706-890--------------------------------------------------------------------------------
C6W6A2_DYAFD/472-647--------------------------------------------------------------------------------
Q1K202_DESAC/525-690--------------------------------------------------------------------------------
B9XQ69_9BACT/485-655--------------------------------------------------------------------------------
D2EF52_9EURY/165-326--------------------------------------------------------------------------------
Q7UP09_RHOBA/485-653--------------------------------------------------------------------------------
C6R6E9_9CORY/73-236--------------------------------------------------------------------------------
A4A2E4_9PLAN/388-559--------------------------------------------------------------------------------
Q4UGJ1_THEAN/119-276--------------------------------------------------------------------------------
B0MAH3_9FIRM/35-193--------------------------------------------------------------------------------
C6WMC2_ACTMD/300-447--------------------------------------------------------------------------------
B4CV03_9BACT/469-631--------------------------------------------------------------------------------
Q0B064_SYNWW/503-682--------------------------------------------------------------------------------
A5KTF5_9BACT/68-255--------------------------------------------------------------------------------
A6DRN0_9BACT/341-515--------------------------------------------------------------------------------
D3IBS0_9BACT/839-1031--------------------------------------------------------------------------------
C3ZH57_BRAFL/80-242--------------------------------------------------------------------------------
A6DHH9_9BACT/316-501--------------------------------------------------------------------------------
Q12MW7_SHEDO/68-230--------------------------------------------------------------------------------
A4BNW4_9GAMM/66-228--------------------------------------------------------------------------------
B4CZ59_9BACT/352-532--------------------------------------------------------------------------------
D2QJX5_SPILD/490-660--------------------------------------------------------------------------------
D2W1V6_NAEGR/220-370--------------------------------------------------------------------------------
D5SPJ9_PLAL2/481-659--------------------------------------------------------------------------------
Q2YZY0_9BACT/84-253--------------------------------------------------------------------------------
A6DFA0_9BACT/339-519--------------------------------------------------------------------------------
B3G4J2_ADIVA/101-294--------------------------------------------------------------------------------
P74816_9SPHN/410-566--------------------------------------------------------------------------------
P73139_SYNY3/1325-1483--------------------------------------------------------------------------------
C5CLG3_VARPS/557-715--------------------------------------------------------------------------------
B5JG14_9BACT/671-837--------------------------------------------------------------------------------
A6CCU9_9PLAN/72-239--------------------------------------------------------------------------------
B4D1A4_9BACT/330-492--------------------------------------------------------------------------------
B9XKL0_9BACT/361-511--------------------------------------------------------------------------------
B1Y080_LEPCP/297-473--------------------------------------------------------------------------------
B8HTY6_CYAP4/32-183--------------------------------------------------------------------------------
C2FVB4_9SPHI/26-172--------------------------------------------------------------------------------
B8G7X6_CHLAD/437-609--------------------------------------------------------------------------------
A3RGV3_9BACT/116-269--------------------------------------------------------------------------------
A8LVR9_SALAI/775-953--------------------------------------------------------------------------------
A5ZI49_9BACE/23-170--------------------------------------------------------------------------------
Q12HW8_SHEDO/63-226--------------------------------------------------------------------------------
A6DRM9_9BACT/467-652--------------------------------------------------------------------------------
A0YFY2_9GAMM/808-969--------------------------------------------------------------------------------
Q38AC5_TRYB2/2147-2303--------------------------------------------------------------------------------
Q7USY0_RHOBA/369-551--------------------------------------------------------------------------------
C3QV99_9BACE/144-325--------------------------------------------------------------------------------
C7M4C3_CAPOD/79-272--------------------------------------------------------------------------------
D0TFR6_9BACE/405-563--------------------------------------------------------------------------------
Q6XLX7_9PHYC/44-198--------------------------------------------------------------------------------
C5CYC7_VARPS/579-746--------------------------------------------------------------------------------
C0A972_9BACT/830-997--------------------------------------------------------------------------------
Q7UV67_RHOBA/396-564--------------------------------------------------------------------------------
C3RMD7_9FIRM/955-1121--------------------------------------------------------------------------------
Q26C91_FLABB/1086-1241--------------------------------------------------------------------------------
B4CZ32_9BACT/535-700--------------------------------------------------------------------------------
Q45134_BUTFI/150-322--------------------------------------------------------------------------------
Q3MCP3_ANAVT/8-178--------------------------------------------------------------------------------
A3ZS75_9PLAN/65-259--------------------------------------------------------------------------------
B4XES9_9SPHN/409-566--------------------------------------------------------------------------------
B3VZZ6_ADIVA/394-546--------------------------------------------------------------------------------
A6C7K1_9PLAN/97-288--------------------------------------------------------------------------------
C9PW73_9BACT/834-1027--------------------------------------------------------------------------------
A5FGU3_FLAJ1/56-211--------------------------------------------------------------------------------
A7S6Y5_NEMVE/109-273--------------------------------------------------------------------------------
E6W606_DESIS/775-953--------------------------------------------------------------------------------
B2RXV6_MOUSE/81-241--------------------------------------------------------------------------------
B3T3H2_9ARCH/1617-1797--------------------------------------------------------------------------------
Q6XLW1_9PHYC/45-203--------------------------------------------------------------------------------
A5FGS6_FLAJ1/56-211--------------------------------------------------------------------------------
D3Q9V4_STANL/94-285--------------------------------------------------------------------------------
D2AYT0_STRRD/828-984--------------------------------------------------------------------------------
A6EL39_9BACT/290-454--------------------------------------------------------------------------------
B9YA97_9FIRM/49-212--------------------------------------------------------------------------------
B8A482_DANRE/166-339--------------------------------------------------------------------------------
A0ZJ67_NODSP/529-687--------------------------------------------------------------------------------
D4J196_BUTFI/151-322--------------------------------------------------------------------------------
B3JMU7_9BACE/180-344--------------------------------------------------------------------------------
A6C9P5_9PLAN/475-641--------------------------------------------------------------------------------
Q7UQ49_RHOBA/293-490--------------------------------------------------------------------------------
D5VLA5_CAUST/65-237--------------------------------------------------------------------------------
C2XL88_BACCE/73-229--------------------------------------------------------------------------------
A9DQH5_9FLAO/230-392--------------------------------------------------------------------------------
A9DQH5_9FLAO/602-753--------------------------------------------------------------------------------
A7SXU0_NEMVE/114-291--------------------------------------------------------------------------------
Q01ZJ6_SOLUE/443-593--------------------------------------------------------------------------------
C0A1S3_9BACT/78-256--------------------------------------------------------------------------------
A6FCT1_9GAMM/23-189--------------------------------------------------------------------------------
A7SJ06_NEMVE/66-224--------------------------------------------------------------------------------
D2GX75_AILME/1323-1494--------------------------------------------------------------------------------
C3ZJX0_BRAFL/84-248--------------------------------------------------------------------------------
A6CD74_9PLAN/486-648--------------------------------------------------------------------------------
C0A499_9BACT/97-283--------------------------------------------------------------------------------
Q2SIZ0_HAHCH/345-511--------------------------------------------------------------------------------
D1N3B4_9BACT/65-217--------------------------------------------------------------------------------
Q01T04_SOLUE/424-579--------------------------------------------------------------------------------
C0A317_9BACT/126-292--------------------------------------------------------------------------------
B4WXA4_9GAMM/345-509--------------------------------------------------------------------------------
GPR98_DANRE/1316-1486--------------------------------------------------------------------------------
E8W633_STRFA/670-816--------------------------------------------------------------------------------
C3YFX1_BRAFL/267-425--------------------------------------------------------------------------------
C6IM39_9BACE/139-323--------------------------------------------------------------------------------
A4APH5_MARSH/489-660--------------------------------------------------------------------------------
A6EPE7_9BACT/500-657--------------------------------------------------------------------------------
B4CWX4_9BACT/68-259--------------------------------------------------------------------------------
A7VVZ5_9CLOT/995-1159--------------------------------------------------------------------------------
A7VVZ5_9CLOT/1308-1481--------------------------------------------------------------------------------
B9YCR3_9FIRM/64-228--------------------------------------------------------------------------------
C9KZQ2_9BACE/79-273--------------------------------------------------------------------------------
D1PTP1_9BACT/697-879--------------------------------------------------------------------------------
C7DHZ7_9EURY/94-255--------------------------------------------------------------------------------
C0A8Y2_9BACT/77-267--------------------------------------------------------------------------------
A1U1N6_MARAV/355-517--------------------------------------------------------------------------------
C6XUD8_PEDHD/197-348--------------------------------------------------------------------------------
A7RGD7_NEMVE/761-933--------------------------------------------------------------------------------
A6Q5C1_NITSB/362-532--------------------------------------------------------------------------------
Q7UKX0_RHOBA/495-667--------------------------------------------------------------------------------
B7B810_9PORP/638-779--------------------------------------------------------------------------------
Q01PZ1_SOLUE/555-711--------------------------------------------------------------------------------
B5LWA1_9PHYC/45-202--------------------------------------------------------------------------------
C3QXW5_9BACE/273-454--------------------------------------------------------------------------------
Q5JHY9_PYRKO/74-253--------------------------------------------------------------------------------
C0A4Z6_9BACT/100-268--------------------------------------------------------------------------------
B5IHJ2_ACIB4/43-199--------------------------------------------------------------------------------
A6DKU6_9BACT/825-976--------------------------------------------------------------------------------
B6FIV8_9CLOT/1043-1193--------------------------------------------------------------------------------
D7VM99_9SPHI/304-488--------------------------------------------------------------------------------
C3YWE2_BRAFL/417-589--------------------------------------------------------------------------------
D7VUJ6_9FLAO/262-424--------------------------------------------------------------------------------
C0A7F3_9BACT/79-271--------------------------------------------------------------------------------
B4D0H4_9BACT/1120-1270--------------------------------------------------------------------------------
C3Y2Z1_BRAFL/3071-3239--------------------------------------------------------------------------------
C2GWB4_BIFLN/81-263--------------------------------------------------------------------------------
B4D888_9BACT/359-541--------------------------------------------------------------------------------
B0R074_DANRE/18-178--------------------------------------------------------------------------------
D4IIU0_9BACT/46-178--------------------------------------------------------------------------------
A8UHT7_9FLAO/98-284--------------------------------------------------------------------------------
B5LWL3_9PHYC/44-199--------------------------------------------------------------------------------
A3ZWC6_9PLAN/537-693--------------------------------------------------------------------------------
A7IAB4_METB6/233-438--------------------------------------------------------------------------------
D1N5L3_9BACT/230-408--------------------------------------------------------------------------------
A5KN61_9FIRM/1060-1206--------------------------------------------------------------------------------
A9AUS6_HERA2/49-202--------------------------------------------------------------------------------
D0N4V0_PHYIT/2337-2507--------------------------------------------------------------------------------
C9MKL6_9BACT/841-1027--------------------------------------------------------------------------------
A3TFX4_9MICO/758-970--------------------------------------------------------------------------------
D3DDC6_9ACTO/90-268--------------------------------------------------------------------------------
Q5JEI1_PYRKO/99-250--------------------------------------------------------------------------------
A3ZYK0_9PLAN/467-615--------------------------------------------------------------------------------
C3Y7N4_BRAFL/3440-3610--------------------------------------------------------------------------------
D2TF05_9VIRU/307-479--------------------------------------------------------------------------------
B9PZH9_TOXGO/1852-2023--------------------------------------------------------------------------------
C1F1C3_ACIC5/46-208--------------------------------------------------------------------------------
C0A1T8_9BACT/656-822--------------------------------------------------------------------------------
A3ZU30_9PLAN/287-484--------------------------------------------------------------------------------
D0N7N6_PHYIT/1213-1402--------------------------------------------------------------------------------
Q8WQJ3_PLACH/580-738--------------------------------------------------------------------------------
Q4E2C9_TRYCC/555-723--------------------------------------------------------------------------------
D2QXJ3_PIRSD/85-316--------------------------------------------------------------------------------
A9DMK5_9FLAO/29-232--------------------------------------------------------------------------------
Q21ES8_SACD2/351-516--------------------------------------------------------------------------------
Q4D387_TRYCC/548-719--------------------------------------------------------------------------------
Q4CQL8_TRYCC/615-790--------------------------------------------------------------------------------
C3YWD8_BRAFL/455-631--------------------------------------------------------------------------------
B5H0C0_STRCL/85-303--------------------------------------------------------------------------------
B9XAN0_9BACT/110-286--------------------------------------------------------------------------------
A8Q9Z5_BRUMA/390-566--------------------------------------------------------------------------------
B1B9W0_CLOBO/683-838--------------------------------------------------------------------------------
Q4D098_TRYCC/522-696--------------------------------------------------------------------------------
A6FB32_9GAMM/1398-1590--------------------------------------------------------------------------------
A9AYC9_HERA2/456-625--------------------------------------------------------------------------------
D2EFG8_9EURY/185-373--------------------------------------------------------------------------------
A6DI79_9BACT/1365-1546--------------------------------------------------------------------------------
C8WJM2_EGGLE/556-718--------------------------------------------------------------------------------
Q4DBZ5_TRYCC/539-719--------------------------------------------------------------------------------
A9UPD6_MONBE/718-872--------------------------------------------------------------------------------
A9UPD6_MONBE/1387-1542--------------------------------------------------------------------------------
Q2C5E7_9GAMM/152-323--------------------------------------------------------------------------------
A7RRU1_NEMVE/95-274--------------------------------------------------------------------------------
A0C6A9_PARTE/79-241--------------------------------------------------------------------------------
C3YGA0_BRAFL/404-581--------------------------------------------------------------------------------
A6EFL8_9SPHI/293-470--------------------------------------------------------------------------------
B0WJ14_CULQU/137-331--------------------------------------------------------------------------------
D5SNY5_PLAL2/116-346--------------------------------------------------------------------------------
B4D162_9BACT/108-252--------------------------------------------------------------------------------
D2R2W9_PIRSD/463-630--------------------------------------------------------------------------------
C0AE30_9BACT/190-358--------------------------------------------------------------------------------
B0NQM9_BACSE/382-538--------------------------------------------------------------------------------
A4RUX3_OSTLU/731-887--------------------------------------------------------------------------------
A9EDQ9_9FLAO/61-262--------------------------------------------------------------------------------
C0ABJ4_9BACT/83-250--------------------------------------------------------------------------------
D2QL68_SPILD/913-1094--------------------------------------------------------------------------------
C7MF92_BRAFD/90-266--------------------------------------------------------------------------------
B3RTE4_TRIAD/414-588--------------------------------------------------------------------------------
B5CQN3_9FIRM/909-1067--------------------------------------------------------------------------------
C7ZM01_NECH7/520-681--------------------------------------------------------------------------------
B3PEH3_CELJU/344-520--------------------------------------------------------------------------------
Q4DVE1_TRYCC/538-719--------------------------------------------------------------------------------
Q4DLB4_TRYCC/560-739--------------------------------------------------------------------------------
Q4DVH9_TRYCC/519-679--------------------------------------------------------------------------------
C0BL63_9BACT/447-606--------------------------------------------------------------------------------
B1ZCU2_METPB/69-254--------------------------------------------------------------------------------
D5SQB3_PLAL2/440-615--------------------------------------------------------------------------------
C9NVL0_9VIBR/95-264--------------------------------------------------------------------------------
Q4E203_TRYCC/561-721--------------------------------------------------------------------------------
A3W6E6_9RHOB/69-255--------------------------------------------------------------------------------
DMFAB_PARAH/67-255--------------------------------------------------------------------------------
Q4DJE0_TRYCC/550-716--------------------------------------------------------------------------------
A4FIN4_SACEN/539-763--------------------------------------------------------------------------------
C3Y2A5_BRAFL/571-723--------------------------------------------------------------------------------
A7VPI1_9CLOT/1224-1393--------------------------------------------------------------------------------
A6DGW8_9BACT/349-518--------------------------------------------------------------------------------
A0KYW6_SHESA/24-174--------------------------------------------------------------------------------
Q08661_TRYCR/494-651--------------------------------------------------------------------------------
Q4CY76_TRYCC/493-650--------------------------------------------------------------------------------
C6U3J5_BURPE/1480-1642--------------------------------------------------------------------------------
Q2SI43_HAHCH/53-227--------------------------------------------------------------------------------
A7RQU2_NEMVE/41-196--------------------------------------------------------------------------------
Q2L0W1_BORA1/464-645--------------------------------------------------------------------------------
B3CGY7_9BACE/24-188--------------------------------------------------------------------------------
A9Q1X4_9CAUD/299-463--------------------------------------------------------------------------------
C0ABW4_9BACT/85-258--------------------------------------------------------------------------------
Q4DEI6_TRYCC/609-779--------------------------------------------------------------------------------
Q4DNF9_TRYCC/541-717--------------------------------------------------------------------------------
D1N4K6_9BACT/1052-1203--------------------------------------------------------------------------------
Q6BFJ4_PARTE/388-553--------------------------------------------------------------------------------
Q15XP5_PSEA6/493-668--------------------------------------------------------------------------------
Q4CU10_TRYCC/552-720--------------------------------------------------------------------------------
Q4CUZ0_TRYCC/507-692--------------------------------------------------------------------------------
C5LM29_PERM5/44-218--------------------------------------------------------------------------------
Q0RMC8_FRAAA/853-1004--------------------------------------------------------------------------------
Q4DTW4_TRYCC/609-788--------------------------------------------------------------------------------
Q23KI9_TETTS/1203-1377--------------------------------------------------------------------------------
B9SN03_RICCO/1026-1206--------------------------------------------------------------------------------
D2R1X6_PIRSD/363-520--------------------------------------------------------------------------------
B5LLK9_9CAUD/132-281--------------------------------------------------------------------------------
Q4DD62_TRYCC/547-708--------------------------------------------------------------------------------
O44049_TRYRA/484-641--------------------------------------------------------------------------------
B9F362_ORYSJ/1014-1191--------------------------------------------------------------------------------
Q4D536_TRYCC/278-465--------------------------------------------------------------------------------
Q4E4X9_TRYCC/543-716--------------------------------------------------------------------------------
A7APG6_BABBO/745-897--------------------------------------------------------------------------------
A7VQJ9_9CLOT/102-271--------------------------------------------------------------------------------
Q4D2I1_TRYCC/522-683--------------------------------------------------------------------------------
C0ABJ7_9BACT/98-281--------------------------------------------------------------------------------
D0A6G4_TRYB9/717-876--------------------------------------------------------------------------------
A0NBK0_ANOGA/346-540--------------------------------------------------------------------------------
Q4DV17_TRYCC/531-688--------------------------------------------------------------------------------
B9XC50_9BACT/960-1141--------------------------------------------------------------------------------
B3RQA7_TRIAD/110-267--------------------------------------------------------------------------------
Q4D649_TRYCC/526-707--------------------------------------------------------------------------------
Q4CKC3_TRYCC/64-221--------------------------------------------------------------------------------
Q4CPY4_TRYCC/199-357--------------------------------------------------------------------------------
C6IED0_9BACE/312-465--------------------------------------------------------------------------------
A9VCG0_MONBE/430-595--------------------------------------------------------------------------------
Q4DK85_TRYCC/570-733--------------------------------------------------------------------------------
B9XDF8_9BACT/185-352--------------------------------------------------------------------------------
A4EZV1_9RHOB/47-196--------------------------------------------------------------------------------
Q05507_TRYCR/462-651--------------------------------------------------------------------------------
A7BI41_TRYCR/325-488--------------------------------------------------------------------------------
D1NA67_9BACT/69-235--------------------------------------------------------------------------------
Q4CKI9_TRYCC/77-248--------------------------------------------------------------------------------
Q2C775_9GAMM/106-244--------------------------------------------------------------------------------
D3DDM5_9ACTO/444-597--------------------------------------------------------------------------------
Q4E3D9_TRYCC/549-716--------------------------------------------------------------------------------
Q4CSU2_TRYCC/510-674--------------------------------------------------------------------------------
Q4CSV1_TRYCC/493-669--------------------------------------------------------------------------------
B8GUW9_THISH/64-240--------------------------------------------------------------------------------
Q4CQZ7_TRYCC/482-640--------------------------------------------------------------------------------
D3KAW2_TRYCR/526-689--------------------------------------------------------------------------------
Q3RBP3_XYLFA/278-449--------------------------------------------------------------------------------
C9KMK0_9FIRM/607-788--------------------------------------------------------------------------------
D4P7M4_9CAUD/491-643--------------------------------------------------------------------------------
Q4CTD0_TRYCC/191-357--------------------------------------------------------------------------------
A7VVZ7_9CLOT/1480-1643--------------------------------------------------------------------------------
A9G504_SORC5/137-321--------------------------------------------------------------------------------
D3D854_9ACTO/447-600--------------------------------------------------------------------------------
A0DCM8_PARTE/76-229--------------------------------------------------------------------------------
A5JZZ5_PLAVS/96-250--------------------------------------------------------------------------------
B2ZWD4_9TRYP/512-674--------------------------------------------------------------------------------
B3HNQ1_ECOLX/523-683--------------------------------------------------------------------------------

PF02973

P77848_9CLOT/93-287--------------------------------------------------------------------------------
NANL_MACDE/81-275--------------------------------------------------------------------------------
NANA_STRR6/118-309--------------------------------------------------------------------------------
NANB_STRPN/42-228--------------------------------------------------------------------------------
NANH_CLOSE/191-366--------------------------------------------------------------------------------
Q59310_CLOPF/48-236--------------------------------------------------------------------------------

PF07953

Q57236_CLOBO/878-1072--------------------------------------------------------------------------------
Q9LBS8_CLOBO/847-1023--------------------------------------------------------------------------------
O87710_9CLOT/811-986--------------------------------------------------------------------------------
P71117_CLOBO/847-1023--------------------------------------------------------------------------------
Q8GR96_CLOBO/872-1066--------------------------------------------------------------------------------
BXE_CLOBO/859-1054--------------------------------------------------------------------------------
O69276_CLOBO/816-992--------------------------------------------------------------------------------
BXEN_CLOBU/812-988--------------------------------------------------------------------------------
Q3ZUA3_9CLOT/40-243--------------------------------------------------------------------------------
O06018_CLOBO/848-1024--------------------------------------------------------------------------------
Q841S3_CLOBO/880-1071--------------------------------------------------------------------------------
Q7B8V4_CLOBO/885-1079--------------------------------------------------------------------------------
BXG_CLOBO/877-1074--------------------------------------------------------------------------------

PF06439

A3HZT9_9BACT/35-266--------------------------------------------------------------------------------
A6LBG6_PARD8/26-215--------------------------------------------------------------------------------
B0T1W6_CAUSK/37-271--------------------------------------------------------------------------------
A4SXW4_POLSQ/31-195--------------------------------------------------------------------------------
A6DIW7_9BACT/14-204--------------------------------------------------------------------------------
A7LWH3_BACOV/242-448--------------------------------------------------------------------------------
A6LFX0_PARD8/51-268--------------------------------------------------------------------------------
Q1IP75_KORVE/134-305--------------------------------------------------------------------------------
Q01PY8_SOLUE/18-214--------------------------------------------------------------------------------
Q021Z2_SOLUE/148-318--------------------------------------------------------------------------------
A6C286_9PLAN/26-230--------------------------------------------------------------------------------
A6L9A1_PARD8/27-220--------------------------------------------------------------------------------
Q7UXM1_RHOBA/116-314--------------------------------------------------------------------------------
Q7UGT3_RHOBA/50-260--------------------------------------------------------------------------------
A6DGN3_9BACT/486-705--------------------------------------------------------------------------------
Q026J2_SOLUE/86-285--------------------------------------------------------------------------------
A7AJH3_9PORP/62-268--------------------------------------------------------------------------------
A4AVD2_MARSH/28-192--------------------------------------------------------------------------------
A6CF10_9PLAN/1565-1736--------------------------------------------------------------------------------
A4Z0W7_BRASO/36-203--------------------------------------------------------------------------------
Q7URI3_RHOBA/55-252--------------------------------------------------------------------------------
Q022Y3_SOLUE/158-351--------------------------------------------------------------------------------
A3ZYX9_9PLAN/31-241--------------------------------------------------------------------------------
Q7UYC2_RHOBA/27-225--------------------------------------------------------------------------------
Q08RB4_STIAD/354-520--------------------------------------------------------------------------------
B1KP96_SHEWM/43-237--------------------------------------------------------------------------------
Q7ULY5_RHOBA/53-228--------------------------------------------------------------------------------
Q9XAM0_STRCO/521-727--------------------------------------------------------------------------------
A6LD72_PARD8/35-236--------------------------------------------------------------------------------
A5V6S7_SPHWW/38-269--------------------------------------------------------------------------------
A3ZPX1_9PLAN/148-325--------------------------------------------------------------------------------
A6E8U4_9SPHI/241-449--------------------------------------------------------------------------------
Q7UFF8_RHOBA/54-264--------------------------------------------------------------------------------
A4SYN3_POLSQ/50-213--------------------------------------------------------------------------------
Q01QD3_SOLUE/67-266--------------------------------------------------------------------------------
Q21G79_SACD2/27-266--------------------------------------------------------------------------------
Q15XP9_PSEA6/43-289--------------------------------------------------------------------------------
A7NM29_ROSCS/68-253--------------------------------------------------------------------------------
Q02AV5_SOLUE/47-254--------------------------------------------------------------------------------
Q024T5_SOLUE/20-224--------------------------------------------------------------------------------
A6CH23_9PLAN/11-222--------------------------------------------------------------------------------
Q5LID8_BACFN/75-244--------------------------------------------------------------------------------
A4AN55_MARSH/13-232--------------------------------------------------------------------------------
Q7UP53_RHOBA/254-436--------------------------------------------------------------------------------
A3HYW7_9BACT/39-258--------------------------------------------------------------------------------
Q020M5_SOLUE/283-466--------------------------------------------------------------------------------
A7LZB4_BACOV/60-285--------------------------------------------------------------------------------
A6L8C0_PARD8/23-196--------------------------------------------------------------------------------
A4XES2_NOVAD/37-271--------------------------------------------------------------------------------
Q024G0_SOLUE/10-210--------------------------------------------------------------------------------
Q7UP53_RHOBA/88-251--------------------------------------------------------------------------------
Q7UJ71_RHOBA/62-282--------------------------------------------------------------------------------
A6C9B4_9PLAN/53-240--------------------------------------------------------------------------------
A0ACR9_STRAM/807-998--------------------------------------------------------------------------------
A6DSM6_9BACT/29-216--------------------------------------------------------------------------------
Q9XBE0_AMYOR/795-985--------------------------------------------------------------------------------
A6LB52_PARD8/744-943--------------------------------------------------------------------------------
A0M051_GRAFK/45-249--------------------------------------------------------------------------------
A6DM12_9BACT/183-370--------------------------------------------------------------------------------
A4ASP9_MARSH/24-229--------------------------------------------------------------------------------
A4ATY8_MARSH/64-260--------------------------------------------------------------------------------
A4ASM0_MARSH/38-261--------------------------------------------------------------------------------
Q15XH8_PSEA6/28-257--------------------------------------------------------------------------------
A6BZI2_9PLAN/34-270--------------------------------------------------------------------------------
A6DJ51_9BACT/30-221--------------------------------------------------------------------------------
A3ZYG0_9PLAN/42-220--------------------------------------------------------------------------------
A6LFJ8_PARD8/58-253--------------------------------------------------------------------------------
B4SNA4_STRM5/52-245--------------------------------------------------------------------------------
Q021Q3_SOLUE/25-318--------------------------------------------------------------------------------
A6DFB8_9BACT/988-1186--------------------------------------------------------------------------------
A6CBU4_9PLAN/476-662--------------------------------------------------------------------------------
Q7UTD6_RHOBA/106-307--------------------------------------------------------------------------------
A4CGG3_ROBBH/26-212--------------------------------------------------------------------------------
A4AUV7_MARSH/139-306--------------------------------------------------------------------------------
B0T1X3_CAUSK/51-253--------------------------------------------------------------------------------
A6C9Y7_9PLAN/38-232--------------------------------------------------------------------------------
A3I2W3_9BACT/58-253--------------------------------------------------------------------------------
A6DGC3_9BACT/39-228--------------------------------------------------------------------------------
A6BYQ3_9PLAN/523-721--------------------------------------------------------------------------------
Q9A9B2_CAUCR/42-285--------------------------------------------------------------------------------
Q01U12_SOLUE/21-204--------------------------------------------------------------------------------
Q7UTD6_RHOBA/325-510--------------------------------------------------------------------------------
A4ARZ0_MARSH/21-221--------------------------------------------------------------------------------
Q01PI7_SOLUE/133-305--------------------------------------------------------------------------------
Q09C00_STIAD/650-816--------------------------------------------------------------------------------
A3ZT25_9PLAN/28-228--------------------------------------------------------------------------------
A4A1V7_9PLAN/150-329--------------------------------------------------------------------------------
A0YAF8_9GAMM/30-260--------------------------------------------------------------------------------
A6DSF7_9BACT/22-217--------------------------------------------------------------------------------
A4BYH9_9FLAO/26-192--------------------------------------------------------------------------------
A0ACX0_STRAM/280-457--------------------------------------------------------------------------------
Q01NY0_SOLUE/48-250--------------------------------------------------------------------------------
A6CCA5_9PLAN/71-236--------------------------------------------------------------------------------
A3I170_9BACT/40-240--------------------------------------------------------------------------------
A7AAJ2_9PORP/957-1147--------------------------------------------------------------------------------
A5IIW8_THEP1/74-230--------------------------------------------------------------------------------
A7LWH3_BACOV/23-209--------------------------------------------------------------------------------
Q01WT7_SOLUE/22-227--------------------------------------------------------------------------------
A6DM09_9BACT/22-216--------------------------------------------------------------------------------
A2TQP1_9FLAO/40-242--------------------------------------------------------------------------------
Q02B64_SOLUE/22-209--------------------------------------------------------------------------------
A6DTC7_9BACT/37-227--------------------------------------------------------------------------------
A6CA29_9PLAN/352-540--------------------------------------------------------------------------------
A6C8Y3_9PLAN/63-235--------------------------------------------------------------------------------
A3XPN2_LEEBM/32-218--------------------------------------------------------------------------------
A4A0Q4_9PLAN/26-218--------------------------------------------------------------------------------
A6E8U4_9SPHI/25-211--------------------------------------------------------------------------------
Q01UN1_SOLUE/9-241--------------------------------------------------------------------------------
A3ZQS2_9PLAN/31-212--------------------------------------------------------------------------------
A6DG40_9BACT/159-340--------------------------------------------------------------------------------
A6DLT3_9BACT/234-440--------------------------------------------------------------------------------
A6EKV1_9SPHI/655-832--------------------------------------------------------------------------------
A3ZY13_9PLAN/44-228--------------------------------------------------------------------------------
A6DLT3_9BACT/28-216--------------------------------------------------------------------------------
Q1AST8_RUBXD/20-211--------------------------------------------------------------------------------
A4FDZ7_SACEN/121-335--------------------------------------------------------------------------------
A7ABK7_9PORP/62-257--------------------------------------------------------------------------------
A6BYS0_9PLAN/54-263--------------------------------------------------------------------------------
Q01XX3_SOLUE/25-191--------------------------------------------------------------------------------
Q2Y669_NITMU/16-255--------------------------------------------------------------------------------
A3ZWI0_9PLAN/615-790--------------------------------------------------------------------------------
A3ZR79_9PLAN/39-201--------------------------------------------------------------------------------
A6CAH6_9PLAN/67-283--------------------------------------------------------------------------------
Q01TF2_SOLUE/30-207--------------------------------------------------------------------------------
Q2RZK0_SALRD/15-220--------------------------------------------------------------------------------
A6CGD1_9PLAN/671-851--------------------------------------------------------------------------------
A6C1K2_9PLAN/155-332--------------------------------------------------------------------------------
Q7UTX3_RHOBA/29-219--------------------------------------------------------------------------------
Q7UYB9_RHOBA/49-246--------------------------------------------------------------------------------
A3ZS39_9PLAN/38-281--------------------------------------------------------------------------------
Q026J8_SOLUE/86-284--------------------------------------------------------------------------------
A6EFU0_9SPHI/28-228--------------------------------------------------------------------------------
A7AG24_9PORP/243-456--------------------------------------------------------------------------------
A3ZX11_9PLAN/36-237--------------------------------------------------------------------------------
A6C3G1_9PLAN/151-333--------------------------------------------------------------------------------
Q7UWR3_RHOBA/519-700--------------------------------------------------------------------------------
Q7UZ09_RHOBA/53-231--------------------------------------------------------------------------------
A3ZQR2_9PLAN/150-327--------------------------------------------------------------------------------
A6C1I1_9PLAN/43-215--------------------------------------------------------------------------------
A6C5D8_9PLAN/56-241--------------------------------------------------------------------------------
A6DGI4_9BACT/22-219--------------------------------------------------------------------------------
Q7UKZ1_RHOBA/77-278--------------------------------------------------------------------------------
Q7ULK4_RHOBA/125-306--------------------------------------------------------------------------------
Q2Y774_NITMU/671-893--------------------------------------------------------------------------------
F2G5M5_ALTMD/88-279--------------------------------------------------------------------------------
A6C6K0_9PLAN/64-244--------------------------------------------------------------------------------
A6LCM7_PARD8/20-194--------------------------------------------------------------------------------
Q027F9_SOLUE/8-228--------------------------------------------------------------------------------
A6DM04_9BACT/25-206--------------------------------------------------------------------------------
Q024Y0_SOLUE/27-212--------------------------------------------------------------------------------
A6CCA5_9PLAN/239-425--------------------------------------------------------------------------------
A3ZTD9_9PLAN/1170-1342--------------------------------------------------------------------------------
A3I2B6_9BACT/23-203--------------------------------------------------------------------------------
A4A0D3_9PLAN/28-213--------------------------------------------------------------------------------
Q7ULY5_RHOBA/234-440--------------------------------------------------------------------------------
A2U0D4_9FLAO/30-260--------------------------------------------------------------------------------
A3ZSI6_9PLAN/804-979--------------------------------------------------------------------------------
A4ASP0_MARSH/33-262--------------------------------------------------------------------------------
A6DNR0_9BACT/77-264--------------------------------------------------------------------------------
Q7UTX3_RHOBA/225-416--------------------------------------------------------------------------------
A4A202_9PLAN/27-207--------------------------------------------------------------------------------
Q7UYD6_RHOBA/61-249--------------------------------------------------------------------------------
A6DQD4_9BACT/44-244--------------------------------------------------------------------------------
Q7UYI5_RHOBA/85-260--------------------------------------------------------------------------------
A4APB3_MARSH/31-262--------------------------------------------------------------------------------
A4CHF9_ROBBH/43-248--------------------------------------------------------------------------------
A6LD40_PARD8/42-255--------------------------------------------------------------------------------
Q2GAA2_NOVAD/60-315--------------------------------------------------------------------------------
A3ZWI1_9PLAN/266-442--------------------------------------------------------------------------------
A3XQG8_LEEBM/44-246--------------------------------------------------------------------------------
Q7UPZ9_RHOBA/40-226--------------------------------------------------------------------------------
Q7URK6_RHOBA/266-443--------------------------------------------------------------------------------
Q1VRW8_9FLAO/69-265--------------------------------------------------------------------------------
A6LER8_PARD8/252-428--------------------------------------------------------------------------------
Q7US53_RHOBA/171-350--------------------------------------------------------------------------------
Q026X4_SOLUE/31-258--------------------------------------------------------------------------------
A3HX26_9BACT/40-244--------------------------------------------------------------------------------
A2TQP0_9FLAO/54-250--------------------------------------------------------------------------------
A3HS07_9BACT/30-219--------------------------------------------------------------------------------
A3ZR79_9PLAN/204-387--------------------------------------------------------------------------------
A3I0Y0_9BACT/33-262--------------------------------------------------------------------------------
A3ZT60_9PLAN/22-206--------------------------------------------------------------------------------
Q01RN4_SOLUE/31-268--------------------------------------------------------------------------------
A6C7J3_9PLAN/515-746--------------------------------------------------------------------------------
A3I2F1_9BACT/51-252--------------------------------------------------------------------------------
A4CGG3_ROBBH/243-451--------------------------------------------------------------------------------
Q7UXU2_RHOBA/55-243--------------------------------------------------------------------------------
Q7UGD2_RHOBA/163-356--------------------------------------------------------------------------------
Q7UYA4_RHOBA/58-260--------------------------------------------------------------------------------

PF00337

Q7QF77_ANOGA/4-145--------------------------------------------------------------------------------
Q7QF77_ANOGA/165-293--------------------------------------------------------------------------------
Q7PPI9_ANOGA/742-883--------------------------------------------------------------------------------
Q7QHP5_ANOGA/12-144--------------------------------------------------------------------------------
Q18813_CAEEL/34-172--------------------------------------------------------------------------------
Q18813_CAEEL/180-310--------------------------------------------------------------------------------
LEG8_HUMAN/18-151--------------------------------------------------------------------------------
LEG8_HUMAN/186-316--------------------------------------------------------------------------------
Q9VPI7_DROME/41-166--------------------------------------------------------------------------------
Q9XVD0_CAEEL/131-257--------------------------------------------------------------------------------
B3GTH_ARATH/184-393--------------------------------------------------------------------------------
B3GTK_ARATH/190-404--------------------------------------------------------------------------------
Q9VPI7_DROME/226-369--------------------------------------------------------------------------------
LEG7_MOUSE/5-135--------------------------------------------------------------------------------
LEG3_MOUSE/131-261--------------------------------------------------------------------------------
LEG4_CHICK/4-134--------------------------------------------------------------------------------
LEG2_CONMY/3-135--------------------------------------------------------------------------------
YPX5_CAEEL/766-887--------------------------------------------------------------------------------
C5HZ14_HUMAN/5-137--------------------------------------------------------------------------------
Q7Q8Z7_ANOGA/12-142--------------------------------------------------------------------------------
Q7Q2T6_ANOGA/13-143--------------------------------------------------------------------------------
Q7PWU9_ANOGA/113-239--------------------------------------------------------------------------------
Q7PWU9_ANOGA/285-422--------------------------------------------------------------------------------
Q95SA3_DROME/4-138--------------------------------------------------------------------------------
O01410_9BILA/10-141--------------------------------------------------------------------------------
Q18625_CAEEL/13-145--------------------------------------------------------------------------------
LEG9_HUMAN/16-147--------------------------------------------------------------------------------
Q6TGN3_DANRE/15-146--------------------------------------------------------------------------------
Q6DDQ2_XENLA/12-143--------------------------------------------------------------------------------
Q6PGR5_XENLA/38-162--------------------------------------------------------------------------------
LEG4_PIG/18-149--------------------------------------------------------------------------------
Q8C3K0_MOUSE/26-160--------------------------------------------------------------------------------
Q86GY9_RHIAP/185-315--------------------------------------------------------------------------------
LEG9_HUMAN/226-355--------------------------------------------------------------------------------
Q6TGN3_DANRE/193-320--------------------------------------------------------------------------------
Q6TGN4_DANRE/93-224--------------------------------------------------------------------------------
Q7SYP0_XENLA/74-204--------------------------------------------------------------------------------
LEG4_PIG/193-323--------------------------------------------------------------------------------
Q6PGR5_XENLA/224-353--------------------------------------------------------------------------------
LEC7_CAEEL/10-137--------------------------------------------------------------------------------
Q94215_CAEEL/11-140--------------------------------------------------------------------------------
Q95SA3_DROME/163-289--------------------------------------------------------------------------------
Q9VPU6_DROME/164-300--------------------------------------------------------------------------------
Q9VPU6_DROME/3-145--------------------------------------------------------------------------------
Q7ZZ26_DANRE/9-141--------------------------------------------------------------------------------
O01410_9BILA/149-277--------------------------------------------------------------------------------
O01329_CAEEL/100-226--------------------------------------------------------------------------------
O62353_CAEEL/138-266--------------------------------------------------------------------------------
Q18625_CAEEL/153-281--------------------------------------------------------------------------------
Q21057_CAEEL/18-144--------------------------------------------------------------------------------
Q9NG17_HAECO/18-142--------------------------------------------------------------------------------
Q9U9P5_HAECO/15-145--------------------------------------------------------------------------------
Q24953_GEOCY/3-139--------------------------------------------------------------------------------
O02442_GLORO/12-141--------------------------------------------------------------------------------
TECPR_DROME/815-954--------------------------------------------------------------------------------
Q6PIT8_HUMAN/1-128--------------------------------------------------------------------------------
LEG6_CHICK/3-133--------------------------------------------------------------------------------
LEG1_BUFAR/3-133--------------------------------------------------------------------------------
LEG_ELEEL/3-128--------------------------------------------------------------------------------
Q7ZTB7_XENLA/5-134--------------------------------------------------------------------------------
LEG1_CONMY/2-135--------------------------------------------------------------------------------
AJL1_ANGJA/2-133--------------------------------------------------------------------------------
Q76CY7_CONMY/2-129--------------------------------------------------------------------------------
ATLE_AGRAE/11-140--------------------------------------------------------------------------------
CGL1_COPCI/8-136--------------------------------------------------------------------------------
Q9U2I7_CAEEL/14-147--------------------------------------------------------------------------------
GRIFN_RAT/4-132--------------------------------------------------------------------------------
GRIFN_DANRE/4-133--------------------------------------------------------------------------------
Q86G98_CRAGI/29-160--------------------------------------------------------------------------------
Q6AV44_ORYSJ/145-340--------------------------------------------------------------------------------
Q84T07_ORYSJ/162-372--------------------------------------------------------------------------------
B3GTI_ARATH/190-391--------------------------------------------------------------------------------
B3GTF_ARATH/170-363--------------------------------------------------------------------------------
B3GTG_ARATH/165-343--------------------------------------------------------------------------------
Q83467_ADEP4/393-522--------------------------------------------------------------------------------
Q83467_ADEP4/547-682--------------------------------------------------------------------------------
Q9VPI6_DROME/339-481--------------------------------------------------------------------------------
C5HZ19_HUMAN/5-137--------------------------------------------------------------------------------
Q9MZA4_SHEEP/5-136--------------------------------------------------------------------------------
Q8SXU5_DROME/5-142--------------------------------------------------------------------------------

PF00139

LRK19_ARATH/23-259--------------------------------------------------------------------------------
LRK22_ARATH/26-272--------------------------------------------------------------------------------
LRK72_ARATH/22-260--------------------------------------------------------------------------------
LEC_BOWMI/2-231--------------------------------------------------------------------------------
LEC1_PSOTE/2-233--------------------------------------------------------------------------------
Q6ZLL7_ORYSJ/19-272--------------------------------------------------------------------------------
LRK61_ARATH/32-279--------------------------------------------------------------------------------
LRK71_ARATH/19-256--------------------------------------------------------------------------------
Q41263_GRISI/6-243--------------------------------------------------------------------------------
ARC1_PHAVU/23-243--------------------------------------------------------------------------------
LECR_PEA/32-257--------------------------------------------------------------------------------
O65756_CICAR/28-251--------------------------------------------------------------------------------
LEC1_CYTSE/3-236--------------------------------------------------------------------------------
LEC_PHALU/22-242--------------------------------------------------------------------------------
LRKS6_ARATH/24-257--------------------------------------------------------------------------------
LEC_SOYBN/34-261--------------------------------------------------------------------------------
LEC_LATSP/4-234--------------------------------------------------------------------------------
Q8H4J1_ORYSJ/34-272--------------------------------------------------------------------------------
Q6K3K2_ORYSJ/106-354--------------------------------------------------------------------------------
LRK52_ARATH/27-248--------------------------------------------------------------------------------
LEC4_GRISI/2-235--------------------------------------------------------------------------------
LRK32_ARATH/25-262--------------------------------------------------------------------------------
Q8LN32_ORYSJ/28-268--------------------------------------------------------------------------------
Q84ZH5_ORYSJ/46-284--------------------------------------------------------------------------------
Q43376_ARAHY/2-236--------------------------------------------------------------------------------
LRKS1_ARATH/28-273--------------------------------------------------------------------------------
Q8LA09_ARATH/26-252--------------------------------------------------------------------------------
Q8SA62_9FABA/4-229--------------------------------------------------------------------------------
Q9LNN3_ARATH/22-277--------------------------------------------------------------------------------
Q6ZIQ9_ORYSJ/34-300--------------------------------------------------------------------------------
Q8H4J3_ORYSJ/27-267--------------------------------------------------------------------------------
LECG_ARAHY/25-249--------------------------------------------------------------------------------
LRK82_ARATH/28-260--------------------------------------------------------------------------------
Q7XUN5_ORYSJ/26-265--------------------------------------------------------------------------------
Q9FQ12_CITPA/23-251--------------------------------------------------------------------------------
Q6UY60_MEDTR/19-259--------------------------------------------------------------------------------
Q5DMV1_CUCME/20-261--------------------------------------------------------------------------------
Q7XUC7_ORYSJ/27-259--------------------------------------------------------------------------------
Y1396_METJA/1450-1677--------------------------------------------------------------------------------
LRKS5_ARATH/23-257--------------------------------------------------------------------------------
LRKS4_ARATH/22-259--------------------------------------------------------------------------------
Q8LIP0_ORYSJ/35-279--------------------------------------------------------------------------------
Q6YT52_ORYSJ/18-256--------------------------------------------------------------------------------
LRK91_ARATH/18-251--------------------------------------------------------------------------------
Q8H4I0_ORYSJ/22-261--------------------------------------------------------------------------------
Q6ZFB3_ORYSJ/34-270--------------------------------------------------------------------------------
Q7UVU2_RHOBA/628-843--------------------------------------------------------------------------------

PF03388

YQF8_SCHPO/24-250--------------------------------------------------------------------------------
YOC5_SCHPO/23-229--------------------------------------------------------------------------------
EMP47_YEAST/36-253--------------------------------------------------------------------------------
LMAN1_HUMAN/44-269--------------------------------------------------------------------------------
Q9V3A8_DROME/33-259--------------------------------------------------------------------------------
Q9VCC2_DROME/33-258--------------------------------------------------------------------------------
LMAN2_CANFA/52-278--------------------------------------------------------------------------------
Q22170_CAEEL/43-272--------------------------------------------------------------------------------

PF03935

Q6BW61_DEBHA/174-674FPLHIDEKEPDDYLHNPDPLKDAAYDKNRFFYDLKNMDRRSMGGLLGVVFLIVAAVVVFILLPILTYS...GITEPYTP.
Q0UQN1_PHANO/94-573WPLIGDKDESDDEMHMP....REDDDIKYKAKLSDHFNRDSIASTIGLAIMIVGLLFIFIALPVMSFT...GAIEYNSSW
A5DEX4_PICGU/157-655FPLHIDEKEPDDYLHNPDPIADASYDKNRFMYDLKNMDRRSMGGLFGIIFLVIAVICVFILFPVLTYS...GVADHYTP.
A1C6M7_ASPCL/154-653LLLFPEDVEKDDHLHNPDP........SDREGQCDLWNRRGIINVAGLILLTLGFLILFIGYPMITAMK.GTVKSGPTCD
A6ZUF5_YEAS7/249-763FPLTLDEKEDDDYIHNPNVEEEAKLDRRRFVDDFKHMDRRSFLGLLGILFLFMAGIFIFIVLPAITFS...GVVYHHEH.
Q752M9_ASHGO/153-654FPLLIDEKEDDDYLHNPDPEEESRLDKQRFLLDLKHMDKRSAGGFVGILLLFIGGLMLFIVLPVLTYT...GAVEHHHA.
Q5KJ60_CRYNJ/92-619QGPIDDDDDMDDHLHTF.....TAAEKKDLSTPFNISSWRGWANALTLAVLAGGGVMLFAGYPIISFYY.GDDSSSGSNT
Q4P2E5_USTMA/148-679GIASSFQDEDDDWLHDP.......KAKSTVGTAESLTSMRGLLNVGTLLLIGLCLLMLFLGYPVLIEI...RKKYADGT.
A5DZI8_LODEL/240-745FPLSIDEKEPDDYLHNPDPVKDAEYEKNRFVYDMKNLDRRSLGGLIGLIVMALGALCVFVVLPALTYS...GATEHYKP.
Q4PGA6_USTMA/384-919WGDYDAESEPDDYLHEPDAEKYRNASSAK.....EMLSPRGLLNIGTLTVIGLGLILLFGGYPVISWL....SRSKASTK
Q4P8J4_USTMA/197-732WDTMDGKQEPDDDLHDP.....QVLPDIKHGWFGGAVGSRGVLNVGVLALLSMALVLLFGGYPIISYF....GRRHESTK
YEPB_SCHPO/124-627LSWVYRSKEEDDDFHDP......KSSVVSLMGEEDYLGWSRFCDLFFLFVLSLGIGLLFIVFPALTFT...GNITPSKEK
YEOB_SCHPO/134-636FSLSREDKEIDDFLHYPLPAKDAK.......KLSYFVGGEGLMQLLFLLFLAAGTGMLFIGLPILTYT...GHNSLAS..
A7TTP7_VANPO/229-744FPLLFDEKEDDDFLHNPDPEEEARLYKKRFVYDLQHMSRRSIGGWLGILLLLCGGAVVFIVIPALTYT...GFVDRGDRP
A5DZ87_LODEL/332-841FPLDINDKEADDHLHNPDPIQDAKYEKNRFWYDLKNGDSRSRLGIAGFVFLLAAAIAVFVVLPSLTYT...GVTDHKAVP
SKN1_CANAX/238-737FPLSIDEKEPDDYLHNPDPVQDAEYDKNRFLYDLKTMDKKSMNGLIAFIVMFLIAIAIFIILPVFTYT...GYNPKAKNF
Q6FUB1_CANGA/183-684FPLLMEEKEDDDYLHNPDPEEEARLDRKRFSNDFKYMDKRSAGGLAGVLFLFIGLGCLFILLPALTYT...GVTEHAKP.
A7E6J8_SCLS1/168-668LLLFPEDVEKDDYLHNPDP.......SDKDLDKCDIWNRRGLTNVGGLIFIVLGVLALFVAYPVVTFVKDKIDPTHGAC.
Q5AEC0_CANAL/212-718FPLNIDEKEPDDYLHNPDPVHDVIYEKNRFWNDLKTADRKSFGGILGFLFLIAAAVAVFVVVPALTYS...GVTTHSPP.
A3LPW0_PICST/189-695FPLHIDEKEADDYLHNPDPVVDAEYDKNRFIYDLKNMDKRSLGGLIGLIVLFIAGLCVFVVLPALTFS...NVTHHSSI.
A7EWT0_SCLS1/211-717FILYDDEIEDDDDLHMP....HDNDDRDFKPTWYEWLERRSLINAIGGVFMVIGLLCVFILLPVLTFATRVWSTGREGSG
Q5KHK4_CRYNJ/69-588WGPMTTGPEEDDWMHNPDPIKNRNYDRGT......IFTPRGLINVGCLVMLILCLVTLFAGYPIITHF....TDTEIKTN
Q6UEI2_PNECA/190-675IMWNPNIVEPDDYLHNP........ATKERKKDYHIFTKRGILNMGSLVILTFGIISFFMGYPILLYT...KKIYEDIH.
Q0UKL9_PHANO/161-653LLLFPEDVEKDDYLHNPDP.......NEKEQRDCDIFTRRGMVNVGGLAFLALGLLALFVGYPVLTFVDKMTKPEKGPCT
A3LPU3_PICST/148-653FPLYIDEKEPDDYLHNPDPVKDAEYDKNRFVYDLKTLDKRALGGLLGVIFLLVAAICVFVVLPVLTFS...RAGVHYTP.
Q6FQ11_CANGA/223-736FPLSMDEKEDDDFLHNPDPEEEARLDKHRFSEDLKHMNKKSFGGILGVLFLFLGAIALFIILPVLTYS...GAVDHHDNN

PF00722

XTH8_ARATH/38-224--------------------------------------------------------------------------------
XTH1_ARATH/36-215--------------------------------------------------------------------------------
Q6BHG8_DEBHA/45-215--------------------------------------------------------------------------------
Q6BH77_DEBHA/56-228--------------------------------------------------------------------------------
Q6BH39_DEBHA/52-224--------------------------------------------------------------------------------
Q6BRL2_DEBHA/100-275--------------------------------------------------------------------------------
Q7CTY9_AGRT5/57-234--------------------------------------------------------------------------------
Q7CSS8_AGRT5/263-456--------------------------------------------------------------------------------
GUB_CLOTM/56-241--------------------------------------------------------------------------------
O73951_9EURY/82-290--------------------------------------------------------------------------------
Q7S0F8_NEUCR/55-225--------------------------------------------------------------------------------
Q42446_MAIZE/24-205--------------------------------------------------------------------------------
EXOK_RHIME/58-245--------------------------------------------------------------------------------
EXSH_RHIME/263-455--------------------------------------------------------------------------------
BRU1_SOYBN/32-213--------------------------------------------------------------------------------
Q6FNU8_CANGA/147-325--------------------------------------------------------------------------------
Q43527_SOLLC/23-204--------------------------------------------------------------------------------
Q60D19_SOLDE/23-202--------------------------------------------------------------------------------
Q6QUX9_VERDA/49-221--------------------------------------------------------------------------------
Q07524_TROMA/43-227--------------------------------------------------------------------------------
XYND_RUMFL/594-785--------------------------------------------------------------------------------
XTH10_ARATH/37-218--------------------------------------------------------------------------------
P93669_HORVU/29-213--------------------------------------------------------------------------------
CRH2_YEAST/96-273--------------------------------------------------------------------------------
CRR1_ASHGO/155-333--------------------------------------------------------------------------------
XTH13_ARATH/26-207--------------------------------------------------------------------------------
Q7XTP9_ORYSJ/31-215--------------------------------------------------------------------------------
Q6ES26_ORYSJ/32-215--------------------------------------------------------------------------------
XTH31_ARATH/39-223--------------------------------------------------------------------------------
O23950_GOSHI/20-202--------------------------------------------------------------------------------
O68641_CELCE/88-288--------------------------------------------------------------------------------
Q5AXN2_EMENI/49-224--------------------------------------------------------------------------------
GUB_BREBE/61-248--------------------------------------------------------------------------------
Q6FWX2_CANGA/97-274--------------------------------------------------------------------------------
Q5JZX2_MAIZE/28-208--------------------------------------------------------------------------------
Q60039_THENE/252-458--------------------------------------------------------------------------------
XTH33_ARATH/43-226--------------------------------------------------------------------------------
Q58WP7_9BACT/251-458--------------------------------------------------------------------------------
Q58WW0_9BACT/53-239--------------------------------------------------------------------------------
GUB_BACSU/54-238--------------------------------------------------------------------------------
Q6ZAN9_ORYSJ/28-212--------------------------------------------------------------------------------
Q588C0_CRYJA/24-205--------------------------------------------------------------------------------
Q7XNY6_ORYSJ/36-222--------------------------------------------------------------------------------
Q9ZRV1_FAGSY/28-209--------------------------------------------------------------------------------
Q6Z2L4_ORYSJ/35-220--------------------------------------------------------------------------------
Q6RHY1_SOLLC/27-212--------------------------------------------------------------------------------
P93672_HORVU/23-204--------------------------------------------------------------------------------
Q6CIZ6_KLULA/49-219--------------------------------------------------------------------------------
Q84T83_ORYSJ/36-221--------------------------------------------------------------------------------
Q8H7Q1_ORYSJ/3-189--------------------------------------------------------------------------------
Q8GVQ2_ORYSJ/40-224--------------------------------------------------------------------------------
Q6C4P9_YARLI/48-219--------------------------------------------------------------------------------
CRH1_YEAST/65-235--------------------------------------------------------------------------------
Q8W3L8_9ROSI/37-221--------------------------------------------------------------------------------
XTH17_ARATH/29-211--------------------------------------------------------------------------------
Q6L873_9ACTO/73-282--------------------------------------------------------------------------------
Q6RHX9_SOLLC/39-224--------------------------------------------------------------------------------
Q6ZAN8_ORYSJ/30-214--------------------------------------------------------------------------------
XTH2_ARATH/32-212--------------------------------------------------------------------------------
CGKA_ALTCA/60-268--------------------------------------------------------------------------------
Q6EJD2_BETVU/24-205--------------------------------------------------------------------------------
Q5AK54_CANAL/69-239--------------------------------------------------------------------------------
Q45648_BACSP/60-250--------------------------------------------------------------------------------
Q58WV0_9BACT/241-448--------------------------------------------------------------------------------
P93671_HORVU/23-204--------------------------------------------------------------------------------
Q5MD55_BRACM/19-198--------------------------------------------------------------------------------
O07856_STREI/49-233--------------------------------------------------------------------------------
Q8GVR3_ORYSJ/46-232--------------------------------------------------------------------------------
XTH28_ARATH/31-216--------------------------------------------------------------------------------
Q7SGL2_NEUCR/50-224--------------------------------------------------------------------------------
Q5KNP5_CRYNJ/97-278--------------------------------------------------------------------------------
Q6YUP5_ORYSJ/36-221--------------------------------------------------------------------------------
Q9FZ05_SOLLC/27-209--------------------------------------------------------------------------------
Q949H9_FESPR/27-211--------------------------------------------------------------------------------
Q825L5_STRAW/78-287--------------------------------------------------------------------------------
Q5AJC0_CANAL/100-275--------------------------------------------------------------------------------
GUB_ORPSP/57-239--------------------------------------------------------------------------------
Q5G5A1_MAGGR/95-271--------------------------------------------------------------------------------
Q7S222_NEUCR/48-222--------------------------------------------------------------------------------
Q6Z998_ORYSJ/39-226--------------------------------------------------------------------------------
Q7N1F8_PHOLL/52-255--------------------------------------------------------------------------------
Q97FD3_CLOAB/57-242--------------------------------------------------------------------------------
CRR1_YEAST/147-325--------------------------------------------------------------------------------
Q8KKH3_BACCI/63-258--------------------------------------------------------------------------------
Q7XBU8_ORYSJ/32-215--------------------------------------------------------------------------------
XTH32_ARATH/43-227--------------------------------------------------------------------------------
XTH26_ARATH/29-208--------------------------------------------------------------------------------
Q82M60_STRAW/400-624--------------------------------------------------------------------------------
Q8GRB4_9PSED/352-562--------------------------------------------------------------------------------
GUB_PAEMA/49-233--------------------------------------------------------------------------------
Q9AT33_DAUCA/30-215--------------------------------------------------------------------------------
Q56X65_ARATH/24-208--------------------------------------------------------------------------------
Q6K9X1_ORYSJ/50-242--------------------------------------------------------------------------------
Q64NE2_BACFR/102-301--------------------------------------------------------------------------------
XTH21_ARATH/28-209--------------------------------------------------------------------------------
Q7S7D0_NEUCR/61-233--------------------------------------------------------------------------------
XTH25_ARATH/30-211--------------------------------------------------------------------------------
Q6FSM3_CANGA/48-218--------------------------------------------------------------------------------
Q6ES25_ORYSJ/25-208--------------------------------------------------------------------------------
O65102_ACTDE/25-206--------------------------------------------------------------------------------
Q9APD8_BACCI/57-251--------------------------------------------------------------------------------
Q5Z746_ORYSJ/26-208--------------------------------------------------------------------------------
Q5AFA2_CANAL/50-220--------------------------------------------------------------------------------
Q5B4L5_EMENI/96-273--------------------------------------------------------------------------------
Q9ZG90_9SPHI/90-285--------------------------------------------------------------------------------
Q98I38_RHILO/263-455--------------------------------------------------------------------------------
P93670_HORVU/26-209--------------------------------------------------------------------------------
Q5Z6H1_ORYSJ/36-217--------------------------------------------------------------------------------
XTH24_ARATH/24-205--------------------------------------------------------------------------------
Q98C78_RHILO/80-268--------------------------------------------------------------------------------
Q7SBQ2_NEUCR/99-274--------------------------------------------------------------------------------
Q8XNF8_CLOPE/412-635--------------------------------------------------------------------------------
XTH1_SOLLC/33-214--------------------------------------------------------------------------------
Q7XTP8_ORYSJ/24-207--------------------------------------------------------------------------------
Q6CL87_KLULA/145-322--------------------------------------------------------------------------------
Q89UP7_BRAJA/123-310--------------------------------------------------------------------------------
XTH3_ARATH/35-213--------------------------------------------------------------------------------
Q51333_CELCE/99-299--------------------------------------------------------------------------------
Q5BEU7_EMENI/49-223--------------------------------------------------------------------------------
Q84V49_CUCSA/37-218--------------------------------------------------------------------------------

PF10287

YJR1_YEAST/104-340--------------------------------------------------------------------------------
C4R9F6_PICPG/188-424--------------------------------------------------------------------------------
A7TGR9_VANPO/101-337--------------------------------------------------------------------------------
B6JWV1_SCHJY/232-465--------------------------------------------------------------------------------
C5GJ05_AJEDR/166-390--------------------------------------------------------------------------------
Q5AJA4_CANAL/225-457--------------------------------------------------------------------------------
C5DIE9_LACTC/220-453--------------------------------------------------------------------------------
Q6FJ92_CANGA/108-344--------------------------------------------------------------------------------
Q6CGN1_YARLI/219-452--------------------------------------------------------------------------------
Q56VT8_PHYPR/317-554--------------------------------------------------------------------------------
YH6B_SCHPO/263-496--------------------------------------------------------------------------------
A5DNR6_PICGU/95-331--------------------------------------------------------------------------------
A5DXV9_LODEL/226-458--------------------------------------------------------------------------------
C5DXY8_ZYGRC/255-485--------------------------------------------------------------------------------
A3LP10_PICST/206-436--------------------------------------------------------------------------------
C5FXD0_ARTOC/195-428--------------------------------------------------------------------------------
A6ZLA4_YEAS7/220-445--------------------------------------------------------------------------------
Q7SG43_NEUCR/137-367--------------------------------------------------------------------------------
Q7SG41_NEUCR/175-395--------------------------------------------------------------------------------
A6RN52_BOTFB/258-482--------------------------------------------------------------------------------
C5M5H0_CANTT/100-335--------------------------------------------------------------------------------
Q6BRM6_DEBHA/196-424--------------------------------------------------------------------------------
A5DUY9_LODEL/99-334--------------------------------------------------------------------------------
Q08WX8_STIAD/98-327--------------------------------------------------------------------------------
Q75A62_ASHGO/258-491--------------------------------------------------------------------------------
Q6FJK5_CANGA/211-436--------------------------------------------------------------------------------
Q6CVS7_KLULA/215-448--------------------------------------------------------------------------------
A7TQU3_VANPO/142-372--------------------------------------------------------------------------------
Q757Z0_ASHGO/143-379--------------------------------------------------------------------------------
Q6CXP7_KLULA/105-343--------------------------------------------------------------------------------
C4Y1A3_CLAL4/228-458--------------------------------------------------------------------------------
Q7SG42_NEUCR/162-391--------------------------------------------------------------------------------
C4R2B9_PICPG/118-354--------------------------------------------------------------------------------
C5M9J2_CANTT/223-454--------------------------------------------------------------------------------
C4XY08_CLAL4/109-343--------------------------------------------------------------------------------
C5DKG4_LACTC/101-337--------------------------------------------------------------------------------
A5DBA4_PICGU/199-429--------------------------------------------------------------------------------
Q0UV14_PHANO/95-329--------------------------------------------------------------------------------
A7TFI3_VANPO/108-344--------------------------------------------------------------------------------

PF00840

CELB_ASPOR/19-414QVGT.TADAHPRLTTYKCTSQNG..CTRQNTSVVLDAATHFIHKKGTQT...SCT-------------------------
GUX1_HYPJE/19-447SACTLQSETHPPLTWQKCSSGGT..CTQQTGSVVIDANWRWTHATNSST...NCY-------------------------
CBHB_ASPAC/24-461QVGTYTAETHPSLTWQTCSGSGS..CTTTSGSVVIDANWRWVHEVGGYT...NCY-------------------------
GUX1_PHACH/20-445QVGTNTARSHPALTSQKCTKSGG..CSNLNTKIVLDANWRWLHSTSGYT...NCY-------------------------
Q01763_PHACH/21-439QAGTITAETHPTLTIQQCTQSGG..CAPLTTKVVLDVNWRWIHSTTGYT...NCY-------------------------
GUX1_PENJA/27-459QVGTLTAETHPALTWSKCT.AGX..CSQVSGSVVIDANWPXVHSTSGST...NCY-------------------------
GUXC_FUSOX/19-451QVCSLNTETKPALTWSKCTSSG...CSDVKGSVVIDANWRWTHQTSGST...NCY-------------------------
GUX2_AGABI/20-450QVGTNMAENHPSLTWQRCTSSG...CQNVNGKVTLDANWRWTHRINDFT...NCY-------------------------
GUNC_FUSOX/20-417TPDK.AKEQHPKLETYRCTKASG..CKKQTNYIVADAGIHGIRQKNGAG...CGD-------------------------
GUN1_TRILO/24-394QPGTSTPEVHPKLTTYKCTTSGG..CVAQDTSVVLDWNYRWMHDANYNS...CTV-------------------------
GUX1_COCCA/20-452QVGTSTAENHPKLTWQTCTGTGGTNCSNKSGSVVLDSNWRWAHNVGGYT...NCY-------------------------
GUN1_HUMGT/22-419KPGE.TKEVHPQLTTFRCTKKGG..CKPATNYIVLDSLSHPIHRAEGLGWGNCGD-------------------------
GUX1_HUMGT/20-452QACSLTTERHPSLSWNKCTAGGQ..CQTVQASITLDSNWRWTHQVSGST...NCY-------------------------
O93780_HUMGT/24-449QAGTITAENHPRMTWKRCSGPGN..CQTVQGEVVIDANWRWL..HNNGQ...NCY-------------------------
GUX1B_NEUCR/19-443QAGTLTAKRHPSLTWQKCTRGG...CPTLNTTMVLDANWRWTHATSGST...KCY-------------------------
O00082_CLAPU/21-452QACSSKPETHPPLSWSRCSRSG...CRSVQGAVTVDANWLWT.TVDGSQ...NCY-------------------------
Q01762_PHACH/21-446QVGTYIPENHPLLATQSCTASGG..CTTSSSKIVLDANRRWIHSTLGTT...SCL-------------------------
GUX1_CRYPA/20-452GVGTQQTETHPQMTWQSCTSPSS..CTTNQGEVVIDSNWRWVHDKDGYV...NCY-------------------------

PF00054

LAMA1_HUMAN/2920-3051--------------------------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------------------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------------------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------------------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------------------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------------------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------------------------------------------------------------------------
AGRIN_CHICK/1416-1546--------------------------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------------------------------------------------------------------------
AGRIN_CHICK/1925-2056--------------------------------------------------------------------------------
CSPG4_RAT/55-182--------------------------------------------------------------------------------
AGRIN_RAT/1291-1422--------------------------------------------------------------------------------
AGRIN_RAT/1559-1694--------------------------------------------------------------------------------
SHBG_RAT/76-206--------------------------------------------------------------------------------
CRB_DROME/1048-1183--------------------------------------------------------------------------------
AGRIN_RAT/1811-1942--------------------------------------------------------------------------------
SLIT_DROME/1204-1335--------------------------------------------------------------------------------
PROS_HUMAN/329-459--------------------------------------------------------------------------------
CRB_DROME/1281-1443--------------------------------------------------------------------------------
SHBG_HUMAN/75-205--------------------------------------------------------------------------------
FAT_DROME/4156-4306--------------------------------------------------------------------------------

PF02210

EYS_HUMAN/3007-3141--------------------------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------------------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------------------------------------------------------------------------
Q7PSM9_ANOGA/919-1050--------------------------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------------------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------------------------------------------------------------------------
CNTP1_MOUSE/390-516--------------------------------------------------------------------------------
Q18291_CAEEL/303-430--------------------------------------------------------------------------------
Q18291_CAEEL/495-627--------------------------------------------------------------------------------
Q18291_CAEEL/722-843--------------------------------------------------------------------------------
Q18291_CAEEL/906-1035--------------------------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------------------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------------------------------------------------------------------------
LAMA5_MOUSE/3157-3274--------------------------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------------------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------------------------------------------------------------------------
NRX3A_MOUSE/475-619--------------------------------------------------------------------------------
NRX3A_HUMAN/287-413--------------------------------------------------------------------------------
CNTP4_MOUSE/400-526--------------------------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------------------------------------------------------------------------
CRUM1_MOUSE/513-650--------------------------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------------------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------------------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------------------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------------------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------------------------------------------------------------------------
Q9VJ82_DROME/55-178--------------------------------------------------------------------------------
Q9VJ82_DROME/238-367--------------------------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------------------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------------------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------------------------------------------------------------------------
CSPG4_HUMAN/55-178--------------------------------------------------------------------------------
CSPG4_HUMAN/230-363--------------------------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------------------------------------------------------------------------
LAMA3_HUMAN/2797-2904--------------------------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------------------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------------------------------------------------------------------------
Q8IQH0_DROME/220-342--------------------------------------------------------------------------------
Q8IQH0_DROME/403-516--------------------------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------------------------------------------------------------------------
EYS_DROME/1723-1856--------------------------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------------------------------------------------------------------------
CNTP5_HUMAN/819-938--------------------------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------------------------------------------------------------------------
NRX3B_HUMAN/117-236--------------------------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------------------------------------------------------------------------
STAN_DROME/1584-1736--------------------------------------------------------------------------------
STAN_DROME/1826-1946--------------------------------------------------------------------------------
NRX3A_HUMAN/55-184--------------------------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------------------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------------------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------------------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------------------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------------------------------------------------------------------------
Q7PT06_ANOGA/364-479--------------------------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------------------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------------------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------------------------------------------------------------------------
Q7Q1N4_ANOGA/1163-1293--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/611-730--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------------------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------------------------------------------------------------------------
CRUM2_MOUSE/469-592--------------------------------------------------------------------------------
CRUM2_MOUSE/901-1019--------------------------------------------------------------------------------
EGFLA_MOUSE/641-767--------------------------------------------------------------------------------
EGFLA_HUMAN/868-996--------------------------------------------------------------------------------
Q19617_CAEEL/154-276--------------------------------------------------------------------------------
Q19617_CAEEL/725-839--------------------------------------------------------------------------------
NRX2A_RAT/949-1077--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------------------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------------------------------------------------------------------------
O45000_CAEEL/275-401--------------------------------------------------------------------------------
O45000_CAEEL/738-847--------------------------------------------------------------------------------
Q22574_CAEEL/136-267--------------------------------------------------------------------------------
Q22574_CAEEL/415-539--------------------------------------------------------------------------------
NRX1A_MOUSE/753-884--------------------------------------------------------------------------------
CADN_DROME/2407-2568--------------------------------------------------------------------------------
CADN_DROME/2661-2796--------------------------------------------------------------------------------
O61230_LYTVA/2142-2298--------------------------------------------------------------------------------
O61230_LYTVA/2393-2517--------------------------------------------------------------------------------
O75852_HUMAN/32-150--------------------------------------------------------------------------------
FAT2_RAT/3802-3923--------------------------------------------------------------------------------
CELR3_RAT/1534-1693--------------------------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------------------------------------------------------------------------
CRB_DROME/1585-1722--------------------------------------------------------------------------------
FAT_DROME/4432-4545--------------------------------------------------------------------------------
P70570_RAT/1017-1137--------------------------------------------------------------------------------
P70570_RAT/1408-1528--------------------------------------------------------------------------------
CNTP1_HUMAN/203-332--------------------------------------------------------------------------------
CNTP1_HUMAN/813-939--------------------------------------------------------------------------------
CRUM1_HUMAN/514-651--------------------------------------------------------------------------------
CRUM1_HUMAN/743-860--------------------------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------------------------------------------------------------------------
P91806_STRPU/27-156--------------------------------------------------------------------------------
P91806_STRPU/212-343--------------------------------------------------------------------------------
CNTP1_RAT/1089-1219--------------------------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------------------------------------------------------------------------
PROS_RABIT/485-617--------------------------------------------------------------------------------
LAMA_DROME/2704-2846--------------------------------------------------------------------------------
LAMA_DROME/2905-3031--------------------------------------------------------------------------------
LAMA_DROME/3083-3205--------------------------------------------------------------------------------
LAMA_DROME/3379-3514--------------------------------------------------------------------------------
LAMA_DROME/3563-3691--------------------------------------------------------------------------------
Q19350_CAEEL/582-695--------------------------------------------------------------------------------
Q19350_CAEEL/789-914--------------------------------------------------------------------------------
EPI1_CAEEL/3101-3218--------------------------------------------------------------------------------
Q21442_CAEEL/537-680--------------------------------------------------------------------------------
Q21442_CAEEL/1363-1488--------------------------------------------------------------------------------
CADE_DROME/1153-1296--------------------------------------------------------------------------------
NRX1A_BOVIN/58-192--------------------------------------------------------------------------------
GAS6_MOUSE/322-450--------------------------------------------------------------------------------
GAS6_MOUSE/510-647--------------------------------------------------------------------------------
LAMA3_MOUSE/2796-2903--------------------------------------------------------------------------------
LAMA3_MOUSE/3016-3136--------------------------------------------------------------------------------
LAMA3_MOUSE/3186-3311--------------------------------------------------------------------------------
NRX2A_RAT/57-187--------------------------------------------------------------------------------
NRX2B_RAT/119-268--------------------------------------------------------------------------------
COBA2_MOUSE/90-213--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------------------------------------------------------------------------
Q7T024_DANRE/32-164--------------------------------------------------------------------------------
Q7T3H4_DANRE/314-442--------------------------------------------------------------------------------
Q7T3H4_DANRE/493-622--------------------------------------------------------------------------------
Q7TSG9_MOUSE/211-328--------------------------------------------------------------------------------
Q7TSG9_MOUSE/448-573--------------------------------------------------------------------------------
Q7TSP8_MOUSE/32-159--------------------------------------------------------------------------------
Q7ZYG1_XENLA/102-225--------------------------------------------------------------------------------
Q867A1_CANFA/1017-1137--------------------------------------------------------------------------------
Q867A1_CANFA/1188-1294--------------------------------------------------------------------------------
Q867A1_CANFA/1408-1528--------------------------------------------------------------------------------
Q867A1_CANFA/1578-1703--------------------------------------------------------------------------------
Q86SD6_CIOIN/125-252--------------------------------------------------------------------------------
Q86SD6_CIOIN/321-465--------------------------------------------------------------------------------
Q86YZ7_HUMAN/748-867--------------------------------------------------------------------------------
Q8AW17_DANRE/66-189--------------------------------------------------------------------------------
Q8C6X0_MOUSE/104-227--------------------------------------------------------------------------------
Q8HYS4_PIG/109-232--------------------------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------------------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------------------------------------------------------------------------
Q8IRV8_DROME/3806-3938--------------------------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------------------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------------------------------------------------------------------------
Q8MY74_9BILA/15-170--------------------------------------------------------------------------------
Q8MY74_9BILA/264-390--------------------------------------------------------------------------------
Q8MY75_9BILA/1323-1478--------------------------------------------------------------------------------
Q8MY76_9BIVA/532-689--------------------------------------------------------------------------------
Q8MY77_BRABE/58-197--------------------------------------------------------------------------------
Q8MY77_BRABE/253-387--------------------------------------------------------------------------------
Q8MY78_ASTPE/2250-2404--------------------------------------------------------------------------------
Q8MY78_ASTPE/2490-2615--------------------------------------------------------------------------------
Q8SZX4_DROME/104-233--------------------------------------------------------------------------------
Q8SZX4_DROME/327-452--------------------------------------------------------------------------------
Q8UUM5_ORYLA/94-217--------------------------------------------------------------------------------
Q8WX98_HUMAN/215-344--------------------------------------------------------------------------------
CNTP5_HUMAN/209-338--------------------------------------------------------------------------------
CNTP5_HUMAN/395-521--------------------------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------------------------------------------------------------------------
Q90WZ3_XENLA/1189-1317--------------------------------------------------------------------------------
Q90Z43_CHICK/454-582--------------------------------------------------------------------------------
Q90Z45_CHICK/604-732--------------------------------------------------------------------------------
Q91VV0_MOUSE/1107-1232--------------------------------------------------------------------------------
NRX4_DROME/824-943--------------------------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------------------------------------------------------------------------
Q96MJ5_HUMAN/398-522--------------------------------------------------------------------------------
Q54A24_HUMAN/398-524--------------------------------------------------------------------------------
NRX1A_CHICK/364-508--------------------------------------------------------------------------------
NRX1A_CHICK/789-917--------------------------------------------------------------------------------
Q9DE36_DANRE/1171-1299--------------------------------------------------------------------------------
Q9DE37_DANRE/1179-1304--------------------------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------------------------------------------------------------------------
Q9I907_PAGMA/107-230--------------------------------------------------------------------------------
Q9IBG4_XENLA/581-714--------------------------------------------------------------------------------
Q9NGV2_DROME/429-557--------------------------------------------------------------------------------
Q9NGV2_DROME/650-776--------------------------------------------------------------------------------
Q9NGV2_DROME/1210-1340--------------------------------------------------------------------------------
Q9NGV4_DROME/611-727--------------------------------------------------------------------------------
Q9NSD0_HUMAN/488-621--------------------------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------------------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------------------------------------------------------------------------
NRX2A_HUMAN/521-666--------------------------------------------------------------------------------
NRX2A_HUMAN/760-890--------------------------------------------------------------------------------
CELR2_RAT/869-995--------------------------------------------------------------------------------
CNTP2_HUMAN/216-345--------------------------------------------------------------------------------
CNTP2_HUMAN/401-529--------------------------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------------------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------------------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------------------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------------------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------------------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------------------------------------------------------------------------
CADN2_DROME/1209-1370--------------------------------------------------------------------------------
FAT2_DROME/3969-4096--------------------------------------------------------------------------------
Q9VZ96_DROME/275-414--------------------------------------------------------------------------------
Q9VZ96_DROME/514-640--------------------------------------------------------------------------------
Q9VZ96_DROME/698-817--------------------------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------------------------------------------------------------------------
Q9XYX0_DROME/1108-1236--------------------------------------------------------------------------------
Q9XZC9_DROME/3030-3161--------------------------------------------------------------------------------
Q9XZC9_DROME/3211-3342--------------------------------------------------------------------------------
Q9ZBW1_STRCO/478-605--------------------------------------------------------------------------------

PF00457

XYN3_ASPKW/27-209------------------------------------------------------------------------------RS
XYNC_STRLI/59-238------------------------------------------------------------------------------GT
XYNA_BACCI/27-212------------------------------------------------------------------------------SA
XYN1_COCCA/38-218------------------------------------------------------------------------------GT
XYNA_CLOSA/68-254------------------------------------------------------------------------------GV
XYNA_SCHCO/8-196------------------------------------------------------------------------------GT
XYN1_HYPJE/50-227------------------------------------------------------------------------------RR
XYNA_BACPU/36-221------------------------------------------------------------------------------GN
XYN2_HYPJE/40-221------------------------------------------------------------------------------GY
XYNA2_CLOSR/40-227------------------------------------------------------------------------------GT
XYNB_STRLI/51-230------------------------------------------------------------------------------GT
XYNA_RUMFL/36-235------------------------------------------------------------------------------GN

PF01670

GUNA_ASPKW/82-239--------------------------------------------------------------------------------
GUN_ASPAC/84-237--------------------------------------------------------------------------------
P96492_THENE/99-273--------------------------------------------------------------------------------
O53438_MYCTU/1-151--------------------------------------------------------------------------------
O00095_HYPJE/81-234--------------------------------------------------------------------------------
O08428_THENE/81-254--------------------------------------------------------------------------------
GUNS_PECCC/107-264--------------------------------------------------------------------------------
Q60032_THEMT/81-254--------------------------------------------------------------------------------
O08468_STRHA/108-258--------------------------------------------------------------------------------
Q54331_STRLI/111-261--------------------------------------------------------------------------------
O13454_ASPOZ/82-239--------------------------------------------------------------------------------
O33897_RHOMR/106-260--------------------------------------------------------------------------------

PF00354

CRP_HUMAN/25-220------------------------------------------------------------------------------K-
SAMP_HUMAN/26-219------------------------------------------------------------------------------K-
CRP1_LIMPO/33-237------------------------------------------------------------------------------.-
SAMP_MOUSE/27-220------------------------------------------------------------------------------K-
SAMP_RAT/27-220------------------------------------------------------------------------------K-
CRP_XENLA/23-219------------------------------------------------------------------------------N-
FP_CRIMI/26-219------------------------------------------------------------------------------K-
CRP_MOUSE/26-221------------------------------------------------------------------------------K-
CRP_RABIT/26-221------------------------------------------------------------------------------K-

PF13385

C6IP17_9BACE/143-331------------------------------------------------------------------------------N.
B5HK67_STRPR/813-980------------------------------------------------------------------------------A.
B5HK67_STRPR/1039-1213------------------------------------------------------------------------------G.
B5HSG2_9ACTO/784-950------------------------------------------------------------------------------G.
B5HSG2_9ACTO/1024-1214------------------------------------------------------------------------------Q.
A2TQ55_9FLAO/511-667------------------------------------------------------------------------------I.
A4HQF1_LEIBR/417-575------------------------------------------------------------------------------R.
A4HMI3_LEIBR/692-852------------------------------------------------------------------------------H.
C1E3W3_MICSR/499-682------------------------------------------------------------------------------N.
C1E3W3_MICSR/738-918------------------------------------------------------------------------------W.
C1E3W3_MICSR/990-1183------------------------------------------------------------------------------A.
C1E3W3_MICSR/1513-1710------------------------------------------------------------------------------R.
C1E3W3_MICSR/1777-1953------------------------------------------------------------------------------A.
C1E3W3_MICSR/2021-2219------------------------------------------------------------------------------D.
C1E3W3_MICSR/3428-3615------------------------------------------------------------------------------K.
C1E3W3_MICSR/3717-3923------------------------------------------------------------------------------S.
C1E3W3_MICSR/4016-4222------------------------------------------------------------------------------A.
A9AX01_HERA2/1704-1859------------------------------------------------------------------------------N.
A9AX01_HERA2/2658-2820------------------------------------------------------------------------------R.
A9AX01_HERA2/2979-3139------------------------------------------------------------------------------Q.
A9AX01_HERA2/3459-3613------------------------------------------------------------------------------R.
A9AX01_HERA2/3682-3839------------------------------------------------------------------------------E.
A0L6L9_MAGSM/6878-7036------------------------------------------------------------------------------N.
A0L6L9_MAGSM/7692-7855------------------------------------------------------------------------------S.
A0L6L9_MAGSM/10293-10458------------------------------------------------------------------------------A.
A0L6L9_MAGSM/10517-10674------------------------------------------------------------------------------S.
A0L6L9_MAGSM/11010-11176------------------------------------------------------------------------------Q.
C1MTE9_MICPC/801-984------------------------------------------------------------------------------P.
C1MTE9_MICPC/2180-2367------------------------------------------------------------------------------A.
C1MTE9_MICPC/2462-2670------------------------------------------------------------------------------A.
C1MTE9_MICPC/3450-3730------------------------------------------------------------------------------A.
A3XS24_9VIBR/1516-1662------------------------------------------------------------------------------R.
A3XS24_9VIBR/1814-1973------------------------------------------------------------------------------E.
D1YWM2_METPS/379-538------------------------------------------------------------------------------G.
D1YWM2_METPS/634-793------------------------------------------------------------------------------G.
B9XBQ7_9BACT/87-254------------------------------------------------------------------------------K.
B9XBQ7_9BACT/333-511------------------------------------------------------------------------------I.
B9XBQ7_9BACT/584-754------------------------------------------------------------------------------N.
B9XBQ7_9BACT/907-1066------------------------------------------------------------------------------S.
Q12UM1_METBU/206-367------------------------------------------------------------------------------S.
Q12UM1_METBU/416-574------------------------------------------------------------------------------S.
Q12UM1_METBU/630-797------------------------------------------------------------------------------T.
Q12UM1_METBU/1025-1180------------------------------------------------------------------------------S.
Q1Q6Y8_9BACT/1609-1779------------------------------------------------------------------------------G.
A6FYU1_9DELT/4-164------------------------------------------------------------------------------T.
A6FYU1_9DELT/221-380------------------------------------------------------------------------------E.
A6FYU1_9DELT/656-816------------------------------------------------------------------------------A.
A7BSN2_9GAMM/44-211------------------------------------------------------------------------------N.
A7BSN2_9GAMM/271-432------------------------------------------------------------------------------S.
A7BSN2_9GAMM/495-650------------------------------------------------------------------------------N.
B5JIQ7_9BACT/93-256------------------------------------------------------------------------------R.
B5JIQ7_9BACT/1081-1243------------------------------------------------------------------------------S.
A0ZJ64_NODSP/167-349------------------------------------------------------------------------------Q.
A0ZJ64_NODSP/406-564------------------------------------------------------------------------------K.
Q112U0_TRIEI/317-477------------------------------------------------------------------------------H.
A9V7L7_MONBE/271-438------------------------------------------------------------------------------T.
A9V7L7_MONBE/494-654------------------------------------------------------------------------------Y.
A9V7L7_MONBE/712-870------------------------------------------------------------------------------H.
B5H1J2_STRCL/805-972------------------------------------------------------------------------------T.
B5H1J2_STRCL/1027-1193------------------------------------------------------------------------------N.
B5H1J2_STRCL/1247-1444------------------------------------------------------------------------------R.
B4CUW8_9BACT/507-671------------------------------------------------------------------------------G.
B4CUW8_9BACT/717-881------------------------------------------------------------------------------G.
B4CUW8_9BACT/925-1088------------------------------------------------------------------------------H.
C0A826_9BACT/82-235------------------------------------------------------------------------------L.
B4CU79_9BACT/530-695------------------------------------------------------------------------------G.
B4CU79_9BACT/743-907------------------------------------------------------------------------------W.
B4CU79_9BACT/950-1117------------------------------------------------------------------------------S.
A5G5W5_GEOUR/2827-2981------------------------------------------------------------------------------G.
A5G5W5_GEOUR/3120-3280------------------------------------------------------------------------------A.
B1C4U2_9FIRM/67-237------------------------------------------------------------------------------K.
B1C4U2_9FIRM/289-449------------------------------------------------------------------------------N.
B1C4U2_9FIRM/783-955------------------------------------------------------------------------------K.
B8FIJ2_DESAA/1831-1990------------------------------------------------------------------------------N.
B8FIJ2_DESAA/2134-2295------------------------------------------------------------------------------N.
B8FIJ2_DESAA/3096-3258------------------------------------------------------------------------------K.
A4CID0_ROBBH/179-344------------------------------------------------------------------------------S.
A4CID0_ROBBH/610-790------------------------------------------------------------------------------T.
E8W159_STRFA/1054-1222------------------------------------------------------------------------------T.
E8W159_STRFA/1335-1504------------------------------------------------------------------------------T.
Q2CEY6_9RHOB/408-563------------------------------------------------------------------------------Q.
Q2CEY6_9RHOB/1555-1715------------------------------------------------------------------------------G.
A3TZ88_9RHOB/431-586------------------------------------------------------------------------------G.
A3TZ88_9RHOB/1595-1756------------------------------------------------------------------------------D.
A3TZ88_9RHOB/2040-2208------------------------------------------------------------------------------T.
B9XIT2_9BACT/377-534------------------------------------------------------------------------------D.
B9XIT2_9BACT/676-834------------------------------------------------------------------------------G.
B9XIT2_9BACT/980-1139------------------------------------------------------------------------------G.
B1WQC8_CYAA5/524-689------------------------------------------------------------------------------R.
B1WQC8_CYAA5/1267-1430------------------------------------------------------------------------------T.
B1WQC8_CYAA5/1487-1639------------------------------------------------------------------------------H.
A9V0U4_MONBE/359-524------------------------------------------------------------------------------S.
A9V0U4_MONBE/585-745------------------------------------------------------------------------------S.
A9V0U4_MONBE/804-963------------------------------------------------------------------------------G.
A9VEK3_MONBE/38-204------------------------------------------------------------------------------T.
B3PKP2_CELJU/660-825------------------------------------------------------------------------------Q.
B3PKP2_CELJU/969-1129------------------------------------------------------------------------------S.
A1ZIY6_9BACT/389-541------------------------------------------------------------------------------H.
A1ZIY6_9BACT/741-910------------------------------------------------------------------------------Q.
A1ZIY6_9BACT/1920-2067------------------------------------------------------------------------------T.
B6ES74_ALISL/190-345------------------------------------------------------------------------------S.
B6ES74_ALISL/500-655------------------------------------------------------------------------------S.
B9XR24_9BACT/99-270------------------------------------------------------------------------------I.
B9XR24_9BACT/347-521------------------------------------------------------------------------------L.
B4DB48_9BACT/865-1021------------------------------------------------------------------------------N.
C7DG96_9EURY/379-534------------------------------------------------------------------------------E.
C7DG96_9EURY/587-759------------------------------------------------------------------------------N.
D2BE74_STRRD/717-881------------------------------------------------------------------------------L.
D2BE74_STRRD/929-1096------------------------------------------------------------------------------G.
Q0HV90_SHESR/643-815------------------------------------------------------------------------------Q.
Q0HV90_SHESR/959-1113------------------------------------------------------------------------------K.
A7BQ37_9GAMM/824-993------------------------------------------------------------------------------Q.
A7BQ37_9GAMM/1055-1222------------------------------------------------------------------------------Q.
D2PTT7_KRIFD/1087-1258------------------------------------------------------------------------------K.
D2PTT7_KRIFD/1411-1585------------------------------------------------------------------------------S.
C3YCM4_BRAFL/394-559------------------------------------------------------------------------------N.
C7DG99_9EURY/172-333------------------------------------------------------------------------------E.
C7DG99_9EURY/507-676------------------------------------------------------------------------------N.
C7DG99_9EURY/724-893------------------------------------------------------------------------------V.
A9VE19_MONBE/314-480------------------------------------------------------------------------------M.
A9VE19_MONBE/539-692------------------------------------------------------------------------------G.
D2PTR0_KRIFD/509-676------------------------------------------------------------------------------D.
D2PTR0_KRIFD/724-887------------------------------------------------------------------------------G.
C9Z507_STRSW/85-252------------------------------------------------------------------------------Q.
C9Z507_STRSW/880-1051------------------------------------------------------------------------------G.
B9XSE8_9BACT/106-287------------------------------------------------------------------------------D.
B9XSE8_9BACT/544-758------------------------------------------------------------------------------G.
Q8AAU9_BACTN/556-751------------------------------------------------------------------------------T.
B4DBW7_9BACT/343-518------------------------------------------------------------------------------T.
B4DBW7_9BACT/723-901------------------------------------------------------------------------------L.
A1ZNX8_9BACT/30-185------------------------------------------------------------------------------A.
A1ZNX8_9BACT/1936-2081------------------------------------------------------------------------------T.
Q3A7I8_PELCD/248-409------------------------------------------------------------------------------D.
Q3A7I8_PELCD/466-622------------------------------------------------------------------------------R.
C6WQK6_ACTMD/751-914------------------------------------------------------------------------------N.
C6WQK6_ACTMD/960-1138------------------------------------------------------------------------------A.
A1ZVW7_9BACT/1977-2130------------------------------------------------------------------------------T.
C0BUU7_9BIFI/1272-1447------------------------------------------------------------------------------T.
Q21FF7_SACD2/693-861------------------------------------------------------------------------------Q.
Q21FF7_SACD2/1008-1165------------------------------------------------------------------------------Q.
D4J0Z2_BUTFI/85-242------------------------------------------------------------------------------K.
D4J0Z2_BUTFI/302-464------------------------------------------------------------------------------K.
F1TD97_9CLOT/74-242------------------------------------------------------------------------------G.
F1TD97_9CLOT/798-960------------------------------------------------------------------------------S.
A8T2S4_9VIBR/246-407------------------------------------------------------------------------------E.
B0SG40_LEPBA/1149-1299------------------------------------------------------------------------------A.
B0SG40_LEPBA/1360-1526------------------------------------------------------------------------------E.
B9XQM3_9BACT/1183-1350------------------------------------------------------------------------------N.
B9XQM3_9BACT/1611-1774------------------------------------------------------------------------------G.
B9XKM7_9BACT/82-250------------------------------------------------------------------------------N.
B9XKM7_9BACT/504-693------------------------------------------------------------------------------N.
C2GWB7_BIFLN/98-274------------------------------------------------------------------------------T.
C2GWB7_BIFLN/783-943------------------------------------------------------------------------------G.
A9VAU4_MONBE/230-399------------------------------------------------------------------------------T.
A9VAU4_MONBE/459-623------------------------------------------------------------------------------D.
B5I5M1_9ACTO/756-922------------------------------------------------------------------------------K.
B5I5M1_9ACTO/980-1161------------------------------------------------------------------------------G.
B0SER7_LEPBA/623-775------------------------------------------------------------------------------G.
B0SER7_LEPBA/822-978------------------------------------------------------------------------------T.
Q7UF08_RHOBA/1547-1724------------------------------------------------------------------------------S.
A1ZI15_9BACT/2043-2196------------------------------------------------------------------------------T.
B9XRA5_9BACT/68-245------------------------------------------------------------------------------N.
B9XRA5_9BACT/395-559------------------------------------------------------------------------------N.
Q025I9_SOLUE/268-426------------------------------------------------------------------------------G.
Q025I9_SOLUE/611-778------------------------------------------------------------------------------G.
D4J0Z1_BUTFI/161-331------------------------------------------------------------------------------S.
D4J0Z1_BUTFI/1079-1248------------------------------------------------------------------------------G.
C5A5H2_THEGJ/288-448------------------------------------------------------------------------------K.
D0LH97_HALO1/139-304------------------------------------------------------------------------------N.
D0LH97_HALO1/418-584------------------------------------------------------------------------------A.
B5S513_RALSL/599-761------------------------------------------------------------------------------N.
B6FL10_9CLOT/94-268------------------------------------------------------------------------------E.
B6FL10_9CLOT/1094-1263------------------------------------------------------------------------------G.
B9XNF4_9BACT/100-267------------------------------------------------------------------------------T.
B9XNF4_9BACT/337-542------------------------------------------------------------------------------R.
B9XNF4_9BACT/1418-1587------------------------------------------------------------------------------N.
B1Z442_BURA4/571-733------------------------------------------------------------------------------N.
C4RHZ8_9ACTO/993-1154------------------------------------------------------------------------------S.
Q3ZYD7_DEHSC/121-281------------------------------------------------------------------------------Y.
D1JG45_9ARCH/87-239------------------------------------------------------------------------------K.
B7B809_9PORP/808-979------------------------------------------------------------------------------K.
D2S7A7_GEOOG/124-331------------------------------------------------------------------------------R.
D2S7A7_GEOOG/404-567------------------------------------------------------------------------------T.
B4DBW6_9BACT/675-838------------------------------------------------------------------------------W.
B4DBW6_9BACT/1004-1165------------------------------------------------------------------------------Q.
C7Q3C0_CATAD/677-839------------------------------------------------------------------------------G.
D7B4B0_NOCDD/985-1152------------------------------------------------------------------------------G.
E8WC63_STRFA/486-660------------------------------------------------------------------------------G.
E8WC63_STRFA/714-888------------------------------------------------------------------------------G.
D1W043_9BACT/612-763------------------------------------------------------------------------------K.
D1W043_9BACT/1088-1239------------------------------------------------------------------------------L.
A9ECQ9_9FLAO/180-355------------------------------------------------------------------------------G.
E6U4D5_ETHHY/571-732------------------------------------------------------------------------------K.
E6U4D5_ETHHY/791-955------------------------------------------------------------------------------T.
D3EBL1_GEOS4/639-797------------------------------------------------------------------------------G.
A3KK79_STRAM/307-464------------------------------------------------------------------------------T.
A3KK79_STRAM/529-696------------------------------------------------------------------------------ND
D1JA15_9ARCH/516-672------------------------------------------------------------------------------K.
C7BV05_9CAUD/528-695------------------------------------------------------------------------------G.
C7BV05_9CAUD/979-1149------------------------------------------------------------------------------N.
Q8CJN7_STRCO/818-1003------------------------------------------------------------------------------N.
Q8CJN7_STRCO/1057-1254------------------------------------------------------------------------------N.
D2MHJ3_9BACT/38-196------------------------------------------------------------------------------G.
A6DI80_9BACT/69-224------------------------------------------------------------------------------A.
A6DI80_9BACT/409-566------------------------------------------------------------------------------L.
B9JMF4_AGRRK/589-752------------------------------------------------------------------------------T.
C6D6G1_PAESJ/689-843------------------------------------------------------------------------------Q.
B3G4E3_ADIVA/133-304------------------------------------------------------------------------------K.
A6DIA2_9BACT/77-247------------------------------------------------------------------------------Q.
A6DIA2_9BACT/485-652------------------------------------------------------------------------------L.
C6IZP4_9BACL/694-846------------------------------------------------------------------------------L.
D2MH98_9BACT/68-223------------------------------------------------------------------------------T.
Q2S986_HAHCH/529-688------------------------------------------------------------------------------T.
A5IKD5_THEP1/72-243------------------------------------------------------------------------------Q.
A5IKD8_THEP1/84-252------------------------------------------------------------------------------Q.
A5IKD9_THEP1/70-241------------------------------------------------------------------------------Q.
B8E3D5_DICTD/75-246------------------------------------------------------------------------------K.
Q9RGC0_9PSED/58-241------------------------------------------------------------------------------N.
D3Q5W9_STANL/397-559------------------------------------------------------------------------------G.
B8E3D6_DICTD/88-243------------------------------------------------------------------------------K.
B4WFU8_9SYNE/1165-1322------------------------------------------------------------------------------Q.
D2S068_HALTV/1213-1371------------------------------------------------------------------------------Q.
C7R5J8_JONDD/642-797------------------------------------------------------------------------------Q.
B9XF62_9BACT/754-913------------------------------------------------------------------------------Q.
B9XF62_9BACT/1163-1328------------------------------------------------------------------------------LP
C0BFQ3_9BACT/663-844------------------------------------------------------------------------------D.
C0BFQ3_9BACT/1593-1762------------------------------------------------------------------------------S.
Q82GV4_STRAW/288-440------------------------------------------------------------------------------T.
Q82GV4_STRAW/507-677------------------------------------------------------------------------------G.
B9XQP8_9BACT/1436-1601------------------------------------------------------------------------------A.
D2RI28_ARCPA/200-357------------------------------------------------------------------------------Y.
Q82NZ6_STRAW/688-850------------------------------------------------------------------------------G.
B0RBH3_CLAMS/131-296------------------------------------------------------------------------------S.
B4CYT0_9BACT/1004-1165------------------------------------------------------------------------------N.
A5IKD7_THEP1/80-241------------------------------------------------------------------------------E.
A7RFD3_NEMVE/587-745------------------------------------------------------------------------------A.
A7RFD3_NEMVE/814-978------------------------------------------------------------------------------T.
B4D2H5_9BACT/770-926------------------------------------------------------------------------------K.
A7BLG4_9GAMM/11-182------------------------------------------------------------------------------N.
D1YWT9_METPS/74-233------------------------------------------------------------------------------G.
B4D5C1_9BACT/847-1006------------------------------------------------------------------------------N.
A7NM90_ROSCS/2533-2667------------------------------------------------------------------------------Q.
C3YC48_BRAFL/3070-3244------------------------------------------------------------------------------K.
B9XCZ6_9BACT/452-613------------------------------------------------------------------------------R.
B1VPR2_STRGG/841-1008------------------------------------------------------------------------------D.
A6FZW9_9DELT/150-306------------------------------------------------------------------------------D.
Q9KBP7_BACHD/618-775------------------------------------------------------------------------------E.
A6DIA3_9BACT/77-235------------------------------------------------------------------------------S.
A6DIA3_9BACT/430-581------------------------------------------------------------------------------K.
A5GAT0_GEOUR/77-245------------------------------------------------------------------------------H.
C7NU53_HALUD/819-971------------------------------------------------------------------------------T.
C7R5J7_JONDD/543-698------------------------------------------------------------------------------R.
A5FKP6_FLAJ1/643-806------------------------------------------------------------------------------S.
C5C072_BEUC1/597-756------------------------------------------------------------------------------G.
B1VKK7_STRGG/739-905------------------------------------------------------------------------------A.
Q9F0I5_PAEMA/447-622------------------------------------------------------------------------------G.
D0LXW7_HALO1/117-278------------------------------------------------------------------------------N.
A9WA06_CHLAA/1556-1710------------------------------------------------------------------------------R.
A9WA06_CHLAA/2510-2646------------------------------------------------------------------------------Q.
B4WNI1_9SYNE/1038-1201------------------------------------------------------------------------------S.
B4WNI1_9SYNE/1270-1438------------------------------------------------------------------------------S.
Q1Z1R8_PHOPR/409-572------------------------------------------------------------------------------N.
D2QKT6_SPILD/62-225------------------------------------------------------------------------------N.
B9XJN0_9BACT/964-1136------------------------------------------------------------------------------Q.
D3F0R0_CONWI/81-255------------------------------------------------------------------------------G.
Q1IAN3_PSEE4/1352-1533------------------------------------------------------------------------------L.
D2KW09_9BACL/548-698------------------------------------------------------------------------------N.
Q64ZH3_BACFR/87-258------------------------------------------------------------------------------Q.
B9XRK5_9BACT/771-923------------------------------------------------------------------------------Q.
D2RHY5_ARCPA/85-250------------------------------------------------------------------------------Y.
Q09BW4_STIAD/232-387------------------------------------------------------------------------------Q.
A9UYJ6_MONBE/339-527------------------------------------------------------------------------------H.
A9UYJ6_MONBE/605-770------------------------------------------------------------------------------L.
C5BR34_TERTT/279-438------------------------------------------------------------------------------T.
A7BSA6_9GAMM/93-264------------------------------------------------------------------------------T.
C9P2T6_VIBME/335-497------------------------------------------------------------------------------Y.
B9XPI1_9BACT/67-230------------------------------------------------------------------------------D.
B9XNV5_9BACT/85-245------------------------------------------------------------------------------S.
B0BI81_9BACT/117-283------------------------------------------------------------------------------Q.
B9L5Y9_NAUPA/341-510------------------------------------------------------------------------------K.
B9L5Y9_NAUPA/584-760------------------------------------------------------------------------------G.
D2MKT6_9BACT/66-219------------------------------------------------------------------------------G.
B5JIL5_9BACT/1259-1418------------------------------------------------------------------------------A.
B8GR77_THISH/225-391------------------------------------------------------------------------------T.
B9XJI0_9BACT/873-1042------------------------------------------------------------------------------H.
B9XJI0_9BACT/1110-1278------------------------------------------------------------------------------K.
B9XB13_9BACT/1144-1312------------------------------------------------------------------------------Q.
D2QKF2_SPILD/352-526------------------------------------------------------------------------------S.
Q26HK5_FLABB/23-183------------------------------------------------------------------------------N.
A6CAJ5_9PLAN/479-645------------------------------------------------------------------------------N.
B5M9N9_STRLS/927-1086------------------------------------------------------------------------------G.
D2RF32_ARCPA/203-366------------------------------------------------------------------------------Y.
A6DLA7_9BACT/349-518------------------------------------------------------------------------------N.
E6U4E1_ETHHY/86-250------------------------------------------------------------------------------H.
E6U4E1_ETHHY/784-946------------------------------------------------------------------------------R.
C9Q244_9VIBR/239-399------------------------------------------------------------------------------Y.
A3KHU1_STRAM/255-431------------------------------------------------------------------------------G.
B4WP60_9SYNE/551-730------------------------------------------------------------------------------S.
A6DSI2_9BACT/432-601------------------------------------------------------------------------------N.
B2J7Y5_NOSP7/1077-1239------------------------------------------------------------------------------Y.
C7MFU6_BRAFD/81-246------------------------------------------------------------------------------S.
E6W633_DESIS/612-776------------------------------------------------------------------------------Q.
D2QME8_SPILD/62-232------------------------------------------------------------------------------S.
A6C871_9PLAN/174-361------------------------------------------------------------------------------Q.
B5JKS9_9BACT/735-891------------------------------------------------------------------------------K.
D1N8J1_9BACT/65-221------------------------------------------------------------------------------G.
B1BNK4_CLOPF/78-238------------------------------------------------------------------------------K.
A3ZT42_9PLAN/352-527------------------------------------------------------------------------------L.
A6C3W6_9PLAN/343-518------------------------------------------------------------------------------K.
C9YSY4_STRSW/83-255------------------------------------------------------------------------------G.
A7VXP7_9CLOT/1543-1697------------------------------------------------------------------------------K.
A7C3F7_9GAMM/76-243------------------------------------------------------------------------------S.
B1C336_9FIRM/592-740------------------------------------------------------------------------------K.
Q11V34_CYTH3/470-632------------------------------------------------------------------------------H.
A3ZSH6_9PLAN/365-543------------------------------------------------------------------------------S.
A8ABA7_IGNH4/303-476------------------------------------------------------------------------------E.
C6WL54_ACTMD/900-1058------------------------------------------------------------------------------T.
C9ZAH4_STRSW/168-331------------------------------------------------------------------------------T.
C0BH93_9BACT/71-260------------------------------------------------------------------------------K.
C0BH93_9BACT/774-924------------------------------------------------------------------------------H.
D3FFH5_CONWI/94-255------------------------------------------------------------------------------D.
C4REW1_9ACTO/454-621------------------------------------------------------------------------------G.
Q5E1F1_VIBF1/333-497------------------------------------------------------------------------------Y.
B8FFM0_DESAA/606-772------------------------------------------------------------------------------Y.
C2GWB5_BIFLN/83-253------------------------------------------------------------------------------D.
C6W5Q6_DYAFD/67-233------------------------------------------------------------------------------A.
Q4BVA3_CROWT/438-594------------------------------------------------------------------------------Q.
C6WP14_ACTMD/1437-1597------------------------------------------------------------------------------T.
A9DV23_9FLAO/71-238------------------------------------------------------------------------------L.
B1BZX6_9FIRM/439-587------------------------------------------------------------------------------S.
D3F200_CONWI/284-437------------------------------------------------------------------------------D.
A9AVE2_HERA2/51-206------------------------------------------------------------------------------S.
B4WP62_9SYNE/1025-1201------------------------------------------------------------------------------A.
B9XFJ5_9BACT/1123-1293------------------------------------------------------------------------------H.
A5US22_ROSS1/40-194------------------------------------------------------------------------------N.
B8FF04_DESAA/2226-2395------------------------------------------------------------------------------G.
D1N5I7_9BACT/61-228------------------------------------------------------------------------------K.
C7QBN6_CATAD/347-521------------------------------------------------------------------------------G.
A9ERE1_SORC5/151-299------------------------------------------------------------------------------Q.
A6DR58_9BACT/44-196------------------------------------------------------------------------------K.
C3U0P6_9BACT/412-578------------------------------------------------------------------------------Q.
B5LWG3_9PHYC/41-196------------------------------------------------------------------------------P.
C6W2U2_DYAFD/85-270------------------------------------------------------------------------------Q.
B9XRA3_9BACT/915-1084------------------------------------------------------------------------------A.
B4CYP7_9BACT/402-560------------------------------------------------------------------------------L.
D3EAV8_GEOS4/59-242------------------------------------------------------------------------------N.
C9Z2C7_STRSW/788-953------------------------------------------------------------------------------R.
A7S999_NEMVE/80-241------------------------------------------------------------------------------N.
B0R0F2_DANRE/84-248------------------------------------------------------------------------------R.
D2R2C9_PIRSD/92-280------------------------------------------------------------------------------T.
D1N440_9BACT/265-425------------------------------------------------------------------------------G.
B7BC96_9PORP/290-465------------------------------------------------------------------------------K.
Q11RF9_CYTH3/63-223------------------------------------------------------------------------------N.
D2HFC1_AILME/255-434------------------------------------------------------------------------------L.
D2MK76_9BACT/72-236------------------------------------------------------------------------------K.
D2QYB6_PIRSD/350-513------------------------------------------------------------------------------G.
C0A3B4_9BACT/75-255------------------------------------------------------------------------------R.
A0KCD8_BURCH/575-734------------------------------------------------------------------------------K.
C0JKE8_9CNID/98-257------------------------------------------------------------------------------Q.
C6WK26_ACTMD/256-414------------------------------------------------------------------------------T.
Q11TR6_CYTH3/67-238------------------------------------------------------------------------------K.
C9KS24_9BACE/174-343------------------------------------------------------------------------------K.
C6WE64_ACTMD/93-256------------------------------------------------------------------------------A.
A3XHG5_LEEBM/75-230------------------------------------------------------------------------------E.
A2SGZ6_METPP/1212-1389------------------------------------------------------------------------------S.
Q1CYH0_MYXXD/203-378------------------------------------------------------------------------------E.
B9XP36_9BACT/812-969------------------------------------------------------------------------------R.
C4RFN0_9ACTO/720-882------------------------------------------------------------------------------T.
A1ZNA6_9BACT/47-195------------------------------------------------------------------------------E.
Q2SFE6_HAHCH/1420-1563------------------------------------------------------------------------------H.
A9AVC5_HERA2/48-212------------------------------------------------------------------------------G.
Q4DW65_TRYCC/416-574------------------------------------------------------------------------------K.
B4WFW4_9SYNE/1032-1209------------------------------------------------------------------------------D.
A6DFJ8_9BACT/285-467------------------------------------------------------------------------------N.
B3T5F8_9ZZZZ/26-177------------------------------------------------------------------------------Y.
B5D1X2_9BACE/452-632------------------------------------------------------------------------------Q.
D3IBS1_9BACT/838-1024------------------------------------------------------------------------------R.
C0BIM3_9BACT/486-670------------------------------------------------------------------------------E.
B4D4I9_9BACT/398-546------------------------------------------------------------------------------K.
Q6XR78_9BACT/330-512------------------------------------------------------------------------------N.
B9XLW9_9BACT/1683-1852------------------------------------------------------------------------------E.
A6C7N1_9PLAN/469-632------------------------------------------------------------------------------S.
D2S0M1_HALTV/102-283------------------------------------------------------------------------------N.
C0W8I7_9ACTO/94-265------------------------------------------------------------------------------R.
D9TDD0_MICAI/800-962------------------------------------------------------------------------------T.
C6X6D4_FLAB3/83-273------------------------------------------------------------------------------K.
C6VYS1_DYAFD/497-672------------------------------------------------------------------------------N.
C7PAG2_CHIPD/920-1086------------------------------------------------------------------------------H.
D2EXW4_9BACE/79-271------------------------------------------------------------------------------G.
B4D5Z2_9BACT/348-512------------------------------------------------------------------------------K.
A4FPB7_SACEN/624-786------------------------------------------------------------------------------K.
C6WMV3_ACTMD/573-733------------------------------------------------------------------------------K.
Q7UJX1_RHOBA/50-209------------------------------------------------------------------------------E.
A4A0C0_9PLAN/363-531------------------------------------------------------------------------------N.
Q7URW0_RHOBA/367-559------------------------------------------------------------------------------A.
A6DHV3_9BACT/341-513------------------------------------------------------------------------------V.
B4D4T4_9BACT/390-545------------------------------------------------------------------------------R.
B6G8E7_9ACTN/62-218------------------------------------------------------------------------------D.
B9PQF9_TOXGO/122-271------------------------------------------------------------------------------S.
A7S3Q5_NEMVE/162-320------------------------------------------------------------------------------G.
D5SYY5_PLAL2/128-328------------------------------------------------------------------------------E.
A9F726_SORC5/116-294------------------------------------------------------------------------------G.
C4RIT9_9ACTO/392-554------------------------------------------------------------------------------A.
A7RK85_NEMVE/106-274------------------------------------------------------------------------------G.
C7PKJ2_CHIPD/84-251------------------------------------------------------------------------------K.
B0N4L9_9FIRM/1244-1393------------------------------------------------------------------------------N.
A0LSM6_ACIC1/412-612------------------------------------------------------------------------------D.
A7SIB1_NEMVE/85-243------------------------------------------------------------------------------G.
A7RIY7_NEMVE/105-286------------------------------------------------------------------------------G.
C3ZG11_BRAFL/63-224------------------------------------------------------------------------------G.
Q7UQA7_RHOBA/106-269------------------------------------------------------------------------------S.
B1C0I8_9FIRM/105-267------------------------------------------------------------------------------N.
D2H2H5_AILME/16-191------------------------------------------------------------------------------R.
B9XQ67_9BACT/487-653------------------------------------------------------------------------------A.
Q15ZH4_PSEA6/374-555------------------------------------------------------------------------------C.
C3ZHW9_BRAFL/119-292------------------------------------------------------------------------------N.
B3PEP0_CELJU/1203-1381------------------------------------------------------------------------------T.
B9XJH3_9BACT/840-1011------------------------------------------------------------------------------G.
A6C6P7_9PLAN/374-539------------------------------------------------------------------------------R.
A9DIG8_9FLAO/489-650------------------------------------------------------------------------------C.
B4DAY9_9BACT/342-525------------------------------------------------------------------------------H.
B9XJI2_9BACT/384-535------------------------------------------------------------------------------S.
C9RK22_FIBSS/405-579------------------------------------------------------------------------------G.
Q11QZ4_CYTH3/221-389------------------------------------------------------------------------------N.
A3ZZC4_9PLAN/344-513------------------------------------------------------------------------------Q.
A9E0U6_9FLAO/61-258------------------------------------------------------------------------------A.
C9RJ78_FIBSS/288-457------------------------------------------------------------------------------K.
B5HCG7_STRPR/177-340------------------------------------------------------------------------------T.
D1JWC6_9BACE/31-177------------------------------------------------------------------------------L.
C0A1S0_9BACT/90-270------------------------------------------------------------------------------L.
A9V190_MONBE/84-262------------------------------------------------------------------------------N.
A6CGM5_9PLAN/366-543------------------------------------------------------------------------------K.
A4BJB6_9GAMM/70-236------------------------------------------------------------------------------R.
C6IPE3_9BACE/171-339------------------------------------------------------------------------------K.
A6DI92_9BACT/1411-1561------------------------------------------------------------------------------K.
D3PDE8_DEFDS/259-420------------------------------------------------------------------------------I.
D3SUF1_NATMM/123-286------------------------------------------------------------------------------H.
C4RNA3_9ACTO/674-835------------------------------------------------------------------------------Q.
D3I9E5_9BACT/845-1031------------------------------------------------------------------------------R.
B4D1M2_9BACT/359-532------------------------------------------------------------------------------K.
B9IR57_BACCQ/491-650------------------------------------------------------------------------------K.
A3J537_9FLAO/808-958------------------------------------------------------------------------------K.
B0UY77_DANRE/29-207------------------------------------------------------------------------------T.
A4A1Z8_9PLAN/377-557------------------------------------------------------------------------------K.
USH2A_HUMAN/125-286------------------------------------------------------------------------------A.
A5FGK8_FLAJ1/706-890------------------------------------------------------------------------------N.
C6W6A2_DYAFD/472-647------------------------------------------------------------------------------K.
Q1K202_DESAC/525-690------------------------------------------------------------------------------R.
B9XQ69_9BACT/485-655------------------------------------------------------------------------------Q.
D2EF52_9EURY/165-326------------------------------------------------------------------------------A.
Q7UP09_RHOBA/485-653------------------------------------------------------------------------------K.
C6R6E9_9CORY/73-236------------------------------------------------------------------------------R.
A4A2E4_9PLAN/388-559------------------------------------------------------------------------------K.
Q4UGJ1_THEAN/119-276------------------------------------------------------------------------------S.
B0MAH3_9FIRM/35-193------------------------------------------------------------------------------K.
C6WMC2_ACTMD/300-447------------------------------------------------------------------------------K.
B4CV03_9BACT/469-631------------------------------------------------------------------------------Q.
Q0B064_SYNWW/503-682------------------------------------------------------------------------------S.
A5KTF5_9BACT/68-255------------------------------------------------------------------------------L.
A6DRN0_9BACT/341-515------------------------------------------------------------------------------K.
D3IBS0_9BACT/839-1031------------------------------------------------------------------------------H.
C3ZH57_BRAFL/80-242------------------------------------------------------------------------------G.
A6DHH9_9BACT/316-501------------------------------------------------------------------------------P.
Q12MW7_SHEDO/68-230------------------------------------------------------------------------------L.
A4BNW4_9GAMM/66-228------------------------------------------------------------------------------V.
B4CZ59_9BACT/352-532------------------------------------------------------------------------------K.
D2QJX5_SPILD/490-660------------------------------------------------------------------------------N.
D2W1V6_NAEGR/220-370------------------------------------------------------------------------------K.
D5SPJ9_PLAL2/481-659------------------------------------------------------------------------------G.
Q2YZY0_9BACT/84-253------------------------------------------------------------------------------G.
A6DFA0_9BACT/339-519------------------------------------------------------------------------------G.
B3G4J2_ADIVA/101-294------------------------------------------------------------------------------K.
P74816_9SPHN/410-566------------------------------------------------------------------------------M.
P73139_SYNY3/1325-1483------------------------------------------------------------------------------N.
C5CLG3_VARPS/557-715------------------------------------------------------------------------------T.
B5JG14_9BACT/671-837------------------------------------------------------------------------------P.
A6CCU9_9PLAN/72-239------------------------------------------------------------------------------S.
B4D1A4_9BACT/330-492------------------------------------------------------------------------------Q.
B9XKL0_9BACT/361-511------------------------------------------------------------------------------L.
B1Y080_LEPCP/297-473------------------------------------------------------------------------------V.
B8HTY6_CYAP4/32-183------------------------------------------------------------------------------N.
C2FVB4_9SPHI/26-172------------------------------------------------------------------------------M.
B8G7X6_CHLAD/437-609------------------------------------------------------------------------------Q.
A3RGV3_9BACT/116-269------------------------------------------------------------------------------N.
A8LVR9_SALAI/775-953------------------------------------------------------------------------------G.
A5ZI49_9BACE/23-170------------------------------------------------------------------------------K.
Q12HW8_SHEDO/63-226------------------------------------------------------------------------------Q.
A6DRM9_9BACT/467-652------------------------------------------------------------------------------K.
A0YFY2_9GAMM/808-969------------------------------------------------------------------------------N.
Q38AC5_TRYB2/2147-2303------------------------------------------------------------------------------D.
Q7USY0_RHOBA/369-551------------------------------------------------------------------------------K.
C3QV99_9BACE/144-325------------------------------------------------------------------------------G.
C7M4C3_CAPOD/79-272------------------------------------------------------------------------------K.
D0TFR6_9BACE/405-563------------------------------------------------------------------------------G.
Q6XLX7_9PHYC/44-198------------------------------------------------------------------------------T.
C5CYC7_VARPS/579-746------------------------------------------------------------------------------I.
C0A972_9BACT/830-997------------------------------------------------------------------------------T.
Q7UV67_RHOBA/396-564------------------------------------------------------------------------------K.
C3RMD7_9FIRM/955-1121------------------------------------------------------------------------------Q.
Q26C91_FLABB/1086-1241------------------------------------------------------------------------------L.
B4CZ32_9BACT/535-700------------------------------------------------------------------------------G.
Q45134_BUTFI/150-322------------------------------------------------------------------------------N.
Q3MCP3_ANAVT/8-178------------------------------------------------------------------------------Q.
A3ZS75_9PLAN/65-259------------------------------------------------------------------------------A.
B4XES9_9SPHN/409-566------------------------------------------------------------------------------S.
B3VZZ6_ADIVA/394-546------------------------------------------------------------------------------S.
A6C7K1_9PLAN/97-288------------------------------------------------------------------------------T.
C9PW73_9BACT/834-1027------------------------------------------------------------------------------R.
A5FGU3_FLAJ1/56-211------------------------------------------------------------------------------K.
A7S6Y5_NEMVE/109-273------------------------------------------------------------------------------G.
E6W606_DESIS/775-953------------------------------------------------------------------------------A.
B2RXV6_MOUSE/81-241------------------------------------------------------------------------------V.
B3T3H2_9ARCH/1617-1797------------------------------------------------------------------------------S.
Q6XLW1_9PHYC/45-203------------------------------------------------------------------------------V.
A5FGS6_FLAJ1/56-211------------------------------------------------------------------------------G.
D3Q9V4_STANL/94-285------------------------------------------------------------------------------G.
D2AYT0_STRRD/828-984------------------------------------------------------------------------------G.
A6EL39_9BACT/290-454------------------------------------------------------------------------------D.
B9YA97_9FIRM/49-212------------------------------------------------------------------------------Q.
B8A482_DANRE/166-339------------------------------------------------------------------------------D.
A0ZJ67_NODSP/529-687------------------------------------------------------------------------------R.
D4J196_BUTFI/151-322------------------------------------------------------------------------------N.
B3JMU7_9BACE/180-344------------------------------------------------------------------------------G.
A6C9P5_9PLAN/475-641------------------------------------------------------------------------------E.
Q7UQ49_RHOBA/293-490------------------------------------------------------------------------------G.
D5VLA5_CAUST/65-237------------------------------------------------------------------------------K.
C2XL88_BACCE/73-229------------------------------------------------------------------------------Y.
A9DQH5_9FLAO/230-392------------------------------------------------------------------------------T.
A9DQH5_9FLAO/602-753------------------------------------------------------------------------------N.
A7SXU0_NEMVE/114-291------------------------------------------------------------------------------G.
Q01ZJ6_SOLUE/443-593------------------------------------------------------------------------------Q.
C0A1S3_9BACT/78-256------------------------------------------------------------------------------A.
A6FCT1_9GAMM/23-189------------------------------------------------------------------------------S.
A7SJ06_NEMVE/66-224------------------------------------------------------------------------------G.
D2GX75_AILME/1323-1494------------------------------------------------------------------------------T.
C3ZJX0_BRAFL/84-248------------------------------------------------------------------------------G.
A6CD74_9PLAN/486-648------------------------------------------------------------------------------Q.
C0A499_9BACT/97-283------------------------------------------------------------------------------L.
Q2SIZ0_HAHCH/345-511------------------------------------------------------------------------------G.
D1N3B4_9BACT/65-217------------------------------------------------------------------------------S.
Q01T04_SOLUE/424-579------------------------------------------------------------------------------K.
C0A317_9BACT/126-292------------------------------------------------------------------------------S.
B4WXA4_9GAMM/345-509------------------------------------------------------------------------------G.
GPR98_DANRE/1316-1486------------------------------------------------------------------------------T.
E8W633_STRFA/670-816------------------------------------------------------------------------------G.
C3YFX1_BRAFL/267-425------------------------------------------------------------------------------G.
C6IM39_9BACE/139-323------------------------------------------------------------------------------G.
A4APH5_MARSH/489-660------------------------------------------------------------------------------K.
A6EPE7_9BACT/500-657------------------------------------------------------------------------------A.
B4CWX4_9BACT/68-259------------------------------------------------------------------------------N.
A7VVZ5_9CLOT/995-1159------------------------------------------------------------------------------N.
A7VVZ5_9CLOT/1308-1481------------------------------------------------------------------------------K.
B9YCR3_9FIRM/64-228------------------------------------------------------------------------------D.
C9KZQ2_9BACE/79-273------------------------------------------------------------------------------K.
D1PTP1_9BACT/697-879------------------------------------------------------------------------------K.
C7DHZ7_9EURY/94-255------------------------------------------------------------------------------S.
C0A8Y2_9BACT/77-267------------------------------------------------------------------------------K.
A1U1N6_MARAV/355-517------------------------------------------------------------------------------K.
C6XUD8_PEDHD/197-348------------------------------------------------------------------------------N.
A7RGD7_NEMVE/761-933------------------------------------------------------------------------------K.
A6Q5C1_NITSB/362-532------------------------------------------------------------------------------I.
Q7UKX0_RHOBA/495-667------------------------------------------------------------------------------R.
B7B810_9PORP/638-779------------------------------------------------------------------------------G.
Q01PZ1_SOLUE/555-711------------------------------------------------------------------------------Q.
B5LWA1_9PHYC/45-202------------------------------------------------------------------------------A.
C3QXW5_9BACE/273-454------------------------------------------------------------------------------D.
Q5JHY9_PYRKO/74-253------------------------------------------------------------------------------R.
C0A4Z6_9BACT/100-268------------------------------------------------------------------------------A.
B5IHJ2_ACIB4/43-199------------------------------------------------------------------------------D.
A6DKU6_9BACT/825-976------------------------------------------------------------------------------K.
B6FIV8_9CLOT/1043-1193------------------------------------------------------------------------------T.
D7VM99_9SPHI/304-488------------------------------------------------------------------------------S.
C3YWE2_BRAFL/417-589------------------------------------------------------------------------------K.
D7VUJ6_9FLAO/262-424------------------------------------------------------------------------------L.
C0A7F3_9BACT/79-271------------------------------------------------------------------------------G.
B4D0H4_9BACT/1120-1270------------------------------------------------------------------------------R.
C3Y2Z1_BRAFL/3071-3239------------------------------------------------------------------------------D.
C2GWB4_BIFLN/81-263------------------------------------------------------------------------------G.
B4D888_9BACT/359-541------------------------------------------------------------------------------K.
B0R074_DANRE/18-178------------------------------------------------------------------------------A.
D4IIU0_9BACT/46-178------------------------------------------------------------------------------N.
A8UHT7_9FLAO/98-284------------------------------------------------------------------------------L.
B5LWL3_9PHYC/44-199------------------------------------------------------------------------------T.
A3ZWC6_9PLAN/537-693------------------------------------------------------------------------------R.
A7IAB4_METB6/233-438------------------------------------------------------------------------------NM
D1N5L3_9BACT/230-408------------------------------------------------------------------------------K.
A5KN61_9FIRM/1060-1206------------------------------------------------------------------------------K.
A9AUS6_HERA2/49-202------------------------------------------------------------------------------Q.
D0N4V0_PHYIT/2337-2507------------------------------------------------------------------------------Q.
C9MKL6_9BACT/841-1027------------------------------------------------------------------------------R.
A3TFX4_9MICO/758-970------------------------------------------------------------------------------G.
D3DDC6_9ACTO/90-268------------------------------------------------------------------------------S.
Q5JEI1_PYRKO/99-250------------------------------------------------------------------------------N.
A3ZYK0_9PLAN/467-615------------------------------------------------------------------------------Q.
C3Y7N4_BRAFL/3440-3610------------------------------------------------------------------------------T.
D2TF05_9VIRU/307-479------------------------------------------------------------------------------G.
B9PZH9_TOXGO/1852-2023------------------------------------------------------------------------------S.
C1F1C3_ACIC5/46-208------------------------------------------------------------------------------F.
C0A1T8_9BACT/656-822------------------------------------------------------------------------------G.
A3ZU30_9PLAN/287-484------------------------------------------------------------------------------H.
D0N7N6_PHYIT/1213-1402------------------------------------------------------------------------------Q.
Q8WQJ3_PLACH/580-738------------------------------------------------------------------------------T.
Q4E2C9_TRYCC/555-723------------------------------------------------------------------------------D.
D2QXJ3_PIRSD/85-316------------------------------------------------------------------------------G.
A9DMK5_9FLAO/29-232------------------------------------------------------------------------------D.
Q21ES8_SACD2/351-516------------------------------------------------------------------------------G.
Q4D387_TRYCC/548-719------------------------------------------------------------------------------Y.
Q4CQL8_TRYCC/615-790------------------------------------------------------------------------------V.
C3YWD8_BRAFL/455-631------------------------------------------------------------------------------K.
B5H0C0_STRCL/85-303------------------------------------------------------------------------------G.
B9XAN0_9BACT/110-286------------------------------------------------------------------------------T.
A8Q9Z5_BRUMA/390-566------------------------------------------------------------------------------A.
B1B9W0_CLOBO/683-838------------------------------------------------------------------------------T.
Q4D098_TRYCC/522-696------------------------------------------------------------------------------N.
A6FB32_9GAMM/1398-1590------------------------------------------------------------------------------S.
A9AYC9_HERA2/456-625------------------------------------------------------------------------------Q.
D2EFG8_9EURY/185-373------------------------------------------------------------------------------N.
A6DI79_9BACT/1365-1546------------------------------------------------------------------------------G.
C8WJM2_EGGLE/556-718------------------------------------------------------------------------------V.
Q4DBZ5_TRYCC/539-719------------------------------------------------------------------------------A.
A9UPD6_MONBE/718-872------------------------------------------------------------------------------H.
A9UPD6_MONBE/1387-1542------------------------------------------------------------------------------K.
Q2C5E7_9GAMM/152-323------------------------------------------------------------------------------A.
A7RRU1_NEMVE/95-274------------------------------------------------------------------------------P.
A0C6A9_PARTE/79-241------------------------------------------------------------------------------N.
C3YGA0_BRAFL/404-581------------------------------------------------------------------------------V.
A6EFL8_9SPHI/293-470------------------------------------------------------------------------------K.
B0WJ14_CULQU/137-331------------------------------------------------------------------------------P.
D5SNY5_PLAL2/116-346------------------------------------------------------------------------------Y.
B4D162_9BACT/108-252------------------------------------------------------------------------------Q.
D2R2W9_PIRSD/463-630------------------------------------------------------------------------------G.
C0AE30_9BACT/190-358------------------------------------------------------------------------------T.
B0NQM9_BACSE/382-538------------------------------------------------------------------------------T.
A4RUX3_OSTLU/731-887------------------------------------------------------------------------------C.
A9EDQ9_9FLAO/61-262------------------------------------------------------------------------------T.
C0ABJ4_9BACT/83-250------------------------------------------------------------------------------G.
D2QL68_SPILD/913-1094------------------------------------------------------------------------------K.
C7MF92_BRAFD/90-266------------------------------------------------------------------------------D.
B3RTE4_TRIAD/414-588------------------------------------------------------------------------------N.
B5CQN3_9FIRM/909-1067------------------------------------------------------------------------------D.
C7ZM01_NECH7/520-681------------------------------------------------------------------------------H.
B3PEH3_CELJU/344-520------------------------------------------------------------------------------I.
Q4DVE1_TRYCC/538-719------------------------------------------------------------------------------A.
Q4DLB4_TRYCC/560-739------------------------------------------------------------------------------E.
Q4DVH9_TRYCC/519-679------------------------------------------------------------------------------A.
C0BL63_9BACT/447-606------------------------------------------------------------------------------K.
B1ZCU2_METPB/69-254------------------------------------------------------------------------------K.
D5SQB3_PLAL2/440-615------------------------------------------------------------------------------N.
C9NVL0_9VIBR/95-264------------------------------------------------------------------------------S.
Q4E203_TRYCC/561-721------------------------------------------------------------------------------W.
A3W6E6_9RHOB/69-255------------------------------------------------------------------------------K.
DMFAB_PARAH/67-255------------------------------------------------------------------------------P.
Q4DJE0_TRYCC/550-716------------------------------------------------------------------------------V.
A4FIN4_SACEN/539-763------------------------------------------------------------------------------H.
C3Y2A5_BRAFL/571-723------------------------------------------------------------------------------S.
A7VPI1_9CLOT/1224-1393------------------------------------------------------------------------------V.
A6DGW8_9BACT/349-518------------------------------------------------------------------------------T.
A0KYW6_SHESA/24-174------------------------------------------------------------------------------Q.
Q08661_TRYCR/494-651------------------------------------------------------------------------------G.
Q4CY76_TRYCC/493-650------------------------------------------------------------------------------G.
C6U3J5_BURPE/1480-1642------------------------------------------------------------------------------A.
Q2SI43_HAHCH/53-227------------------------------------------------------------------------------E.
A7RQU2_NEMVE/41-196------------------------------------------------------------------------------G.
Q2L0W1_BORA1/464-645------------------------------------------------------------------------------K.
B3CGY7_9BACE/24-188------------------------------------------------------------------------------K.
A9Q1X4_9CAUD/299-463------------------------------------------------------------------------------D.
C0ABW4_9BACT/85-258------------------------------------------------------------------------------S.
Q4DEI6_TRYCC/609-779------------------------------------------------------------------------------A.
Q4DNF9_TRYCC/541-717------------------------------------------------------------------------------N.
D1N4K6_9BACT/1052-1203------------------------------------------------------------------------------L.
Q6BFJ4_PARTE/388-553------------------------------------------------------------------------------C.
Q15XP5_PSEA6/493-668------------------------------------------------------------------------------R.
Q4CU10_TRYCC/552-720------------------------------------------------------------------------------D.
Q4CUZ0_TRYCC/507-692------------------------------------------------------------------------------N.
C5LM29_PERM5/44-218------------------------------------------------------------------------------T.
Q0RMC8_FRAAA/853-1004------------------------------------------------------------------------------R.
Q4DTW4_TRYCC/609-788------------------------------------------------------------------------------A.
Q23KI9_TETTS/1203-1377------------------------------------------------------------------------------N.
B9SN03_RICCO/1026-1206------------------------------------------------------------------------------P.
D2R1X6_PIRSD/363-520------------------------------------------------------------------------------G.
B5LLK9_9CAUD/132-281------------------------------------------------------------------------------S.
Q4DD62_TRYCC/547-708------------------------------------------------------------------------------A.
O44049_TRYRA/484-641------------------------------------------------------------------------------G.
B9F362_ORYSJ/1014-1191------------------------------------------------------------------------------E.
Q4D536_TRYCC/278-465------------------------------------------------------------------------------K.
Q4E4X9_TRYCC/543-716------------------------------------------------------------------------------V.
A7APG6_BABBO/745-897------------------------------------------------------------------------------S.
A7VQJ9_9CLOT/102-271------------------------------------------------------------------------------Y.
Q4D2I1_TRYCC/522-683------------------------------------------------------------------------------G.
C0ABJ7_9BACT/98-281------------------------------------------------------------------------------G.
D0A6G4_TRYB9/717-876------------------------------------------------------------------------------R.
A0NBK0_ANOGA/346-540------------------------------------------------------------------------------E.
Q4DV17_TRYCC/531-688------------------------------------------------------------------------------G.
B9XC50_9BACT/960-1141------------------------------------------------------------------------------D.
B3RQA7_TRIAD/110-267------------------------------------------------------------------------------Q.
Q4D649_TRYCC/526-707------------------------------------------------------------------------------G.
Q4CKC3_TRYCC/64-221------------------------------------------------------------------------------S.
Q4CPY4_TRYCC/199-357------------------------------------------------------------------------------L.
C6IED0_9BACE/312-465------------------------------------------------------------------------------K.
A9VCG0_MONBE/430-595------------------------------------------------------------------------------P.
Q4DK85_TRYCC/570-733------------------------------------------------------------------------------G.
B9XDF8_9BACT/185-352------------------------------------------------------------------------------Y.
A4EZV1_9RHOB/47-196------------------------------------------------------------------------------G.
Q05507_TRYCR/462-651------------------------------------------------------------------------------G.
A7BI41_TRYCR/325-488------------------------------------------------------------------------------T.
D1NA67_9BACT/69-235------------------------------------------------------------------------------S.
Q4CKI9_TRYCC/77-248------------------------------------------------------------------------------D.
Q2C775_9GAMM/106-244------------------------------------------------------------------------------N.
D3DDM5_9ACTO/444-597------------------------------------------------------------------------------L.
Q4E3D9_TRYCC/549-716------------------------------------------------------------------------------D.
Q4CSU2_TRYCC/510-674------------------------------------------------------------------------------V.
Q4CSV1_TRYCC/493-669------------------------------------------------------------------------------S.
B8GUW9_THISH/64-240------------------------------------------------------------------------------R.
Q4CQZ7_TRYCC/482-640------------------------------------------------------------------------------G.
D3KAW2_TRYCR/526-689------------------------------------------------------------------------------I.
Q3RBP3_XYLFA/278-449------------------------------------------------------------------------------I.
C9KMK0_9FIRM/607-788------------------------------------------------------------------------------RM
D4P7M4_9CAUD/491-643------------------------------------------------------------------------------Q.
Q4CTD0_TRYCC/191-357------------------------------------------------------------------------------T.
A7VVZ7_9CLOT/1480-1643------------------------------------------------------------------------------Q.
A9G504_SORC5/137-321------------------------------------------------------------------------------I.
D3D854_9ACTO/447-600------------------------------------------------------------------------------K.
A0DCM8_PARTE/76-229------------------------------------------------------------------------------T.
A5JZZ5_PLAVS/96-250------------------------------------------------------------------------------N.
B2ZWD4_9TRYP/512-674------------------------------------------------------------------------------A.
B3HNQ1_ECOLX/523-683------------------------------------------------------------------------------G.

PF02973

P77848_9CLOT/93-287------------------------------------------------------------------------------IP
NANL_MACDE/81-275------------------------------------------------------------------------------IP
NANA_STRR6/118-309------------------------------------------------------------------------------VE
NANB_STRPN/42-228------------------------------------------------------------------------------IF
NANH_CLOSE/191-366------------------------------------------------------------------------------..
Q59310_CLOPF/48-236------------------------------------------------------------------------------LS

PF07953

Q57236_CLOBO/878-1072------------------------------------------------------------------------------N-
Q9LBS8_CLOBO/847-1023------------------------------------------------------------------------------S-
O87710_9CLOT/811-986------------------------------------------------------------------------------K-
P71117_CLOBO/847-1023------------------------------------------------------------------------------N-
Q8GR96_CLOBO/872-1066------------------------------------------------------------------------------D-
BXE_CLOBO/859-1054------------------------------------------------------------------------------N-
O69276_CLOBO/816-992------------------------------------------------------------------------------N-
BXEN_CLOBU/812-988------------------------------------------------------------------------------N-
Q3ZUA3_9CLOT/40-243------------------------------------------------------------------------------N-
O06018_CLOBO/848-1024------------------------------------------------------------------------------R-
Q841S3_CLOBO/880-1071------------------------------------------------------------------------------K-
Q7B8V4_CLOBO/885-1079------------------------------------------------------------------------------S-
BXG_CLOBO/877-1074------------------------------------------------------------------------------G-

PF06439

A3HZT9_9BACT/35-266------------------------------------------------------------------------------DW
A6LBG6_PARD8/26-215------------------------------------------------------------------------------KT
B0T1W6_CAUSK/37-271------------------------------------------------------------------------------PW
A4SXW4_POLSQ/31-195------------------------------------------------------------------------------GF
A6DIW7_9BACT/14-204------------------------------------------------------------------------------SF
A7LWH3_BACOV/242-448------------------------------------------------------------------------------GW
A6LFX0_PARD8/51-268------------------------------------------------------------------------------EW
Q1IP75_KORVE/134-305------------------------------------------------------------------------------KP
Q01PY8_SOLUE/18-214------------------------------------------------------------------------------AE
Q021Z2_SOLUE/148-318------------------------------------------------------------------------------KP
A6C286_9PLAN/26-230------------------------------------------------------------------------------GF
A6L9A1_PARD8/27-220------------------------------------------------------------------------------KW
Q7UXM1_RHOBA/116-314------------------------------------------------------------------------------GA
Q7UGT3_RHOBA/50-260------------------------------------------------------------------------------GL
A6DGN3_9BACT/486-705------------------------------------------------------------------------------RV
Q026J2_SOLUE/86-285------------------------------------------------------------------------------DA
A7AJH3_9PORP/62-268------------------------------------------------------------------------------GW
A4AVD2_MARSH/28-192------------------------------------------------------------------------------KP
A6CF10_9PLAN/1565-1736------------------------------------------------------------------------------NL
A4Z0W7_BRASO/36-203------------------------------------------------------------------------------GW
Q7URI3_RHOBA/55-252------------------------------------------------------------------------------KW
Q022Y3_SOLUE/158-351------------------------------------------------------------------------------KA
A3ZYX9_9PLAN/31-241------------------------------------------------------------------------------LP
Q7UYC2_RHOBA/27-225------------------------------------------------------------------------------SF
Q08RB4_STIAD/354-520------------------------------------------------------------------------------PF
B1KP96_SHEWM/43-237------------------------------------------------------------------------------GW
Q7ULY5_RHOBA/53-228------------------------------------------------------------------------------EM
Q9XAM0_STRCO/521-727------------------------------------------------------------------------------GY
A6LD72_PARD8/35-236------------------------------------------------------------------------------GW
A5V6S7_SPHWW/38-269------------------------------------------------------------------------------AW
A3ZPX1_9PLAN/148-325------------------------------------------------------------------------------DA
A6E8U4_9SPHI/241-449------------------------------------------------------------------------------GY
Q7UFF8_RHOBA/54-264------------------------------------------------------------------------------VS
A4SYN3_POLSQ/50-213------------------------------------------------------------------------------TP
Q01QD3_SOLUE/67-266------------------------------------------------------------------------------DA
Q21G79_SACD2/27-266------------------------------------------------------------------------------GW
Q15XP9_PSEA6/43-289------------------------------------------------------------------------------QW
A7NM29_ROSCS/68-253------------------------------------------------------------------------------LA
Q02AV5_SOLUE/47-254------------------------------------------------------------------------------GF
Q024T5_SOLUE/20-224------------------------------------------------------------------------------DG
A6CH23_9PLAN/11-222------------------------------------------------------------------------------DA
Q5LID8_BACFN/75-244------------------------------------------------------------------------------EP
A4AN55_MARSH/13-232------------------------------------------------------------------------------GF
Q7UP53_RHOBA/254-436------------------------------------------------------------------------------GL
A3HYW7_9BACT/39-258------------------------------------------------------------------------------GF
Q020M5_SOLUE/283-466------------------------------------------------------------------------------GW
A7LZB4_BACOV/60-285------------------------------------------------------------------------------GY
A6L8C0_PARD8/23-196------------------------------------------------------------------------------GS
A4XES2_NOVAD/37-271------------------------------------------------------------------------------PW
Q024G0_SOLUE/10-210------------------------------------------------------------------------------EW
Q7UP53_RHOBA/88-251------------------------------------------------------------------------------GW
Q7UJ71_RHOBA/62-282------------------------------------------------------------------------------RS
A6C9B4_9PLAN/53-240------------------------------------------------------------------------------DA
A0ACR9_STRAM/807-998------------------------------------------------------------------------------AR
A6DSM6_9BACT/29-216------------------------------------------------------------------------------GP
Q9XBE0_AMYOR/795-985------------------------------------------------------------------------------NR
A6LB52_PARD8/744-943------------------------------------------------------------------------------GF
A0M051_GRAFK/45-249------------------------------------------------------------------------------EW
A6DM12_9BACT/183-370------------------------------------------------------------------------------GW
A4ASP9_MARSH/24-229------------------------------------------------------------------------------GF
A4ATY8_MARSH/64-260------------------------------------------------------------------------------DA
A4ASM0_MARSH/38-261------------------------------------------------------------------------------DW
Q15XH8_PSEA6/28-257------------------------------------------------------------------------------GW
A6BZI2_9PLAN/34-270------------------------------------------------------------------------------GV
A6DJ51_9BACT/30-221------------------------------------------------------------------------------GW
A3ZYG0_9PLAN/42-220------------------------------------------------------------------------------AW
A6LFJ8_PARD8/58-253------------------------------------------------------------------------------DA
B4SNA4_STRM5/52-245------------------------------------------------------------------------------DA
Q021Q3_SOLUE/25-318------------------------------------------------------------------------------GS
A6DFB8_9BACT/988-1186------------------------------------------------------------------------------GA
A6CBU4_9PLAN/476-662------------------------------------------------------------------------------DY
Q7UTD6_RHOBA/106-307------------------------------------------------------------------------------GW
A4CGG3_ROBBH/26-212------------------------------------------------------------------------------PW
A4AUV7_MARSH/139-306------------------------------------------------------------------------------ES
B0T1X3_CAUSK/51-253------------------------------------------------------------------------------DA
A6C9Y7_9PLAN/38-232------------------------------------------------------------------------------GY
A3I2W3_9BACT/58-253------------------------------------------------------------------------------DA
A6DGC3_9BACT/39-228------------------------------------------------------------------------------GF
A6BYQ3_9PLAN/523-721------------------------------------------------------------------------------GF
Q9A9B2_CAUCR/42-285------------------------------------------------------------------------------PS
Q01U12_SOLUE/21-204------------------------------------------------------------------------------S.
Q7UTD6_RHOBA/325-510------------------------------------------------------------------------------NF
A4ARZ0_MARSH/21-221------------------------------------------------------------------------------KS
Q01PI7_SOLUE/133-305------------------------------------------------------------------------------AP
Q09C00_STIAD/650-816------------------------------------------------------------------------------SF
A3ZT25_9PLAN/28-228------------------------------------------------------------------------------GF
A4A1V7_9PLAN/150-329------------------------------------------------------------------------------GA
A0YAF8_9GAMM/30-260------------------------------------------------------------------------------KW
A6DSF7_9BACT/22-217------------------------------------------------------------------------------NW
A4BYH9_9FLAO/26-192------------------------------------------------------------------------------TD
A0ACX0_STRAM/280-457------------------------------------------------------------------------------GY
Q01NY0_SOLUE/48-250------------------------------------------------------------------------------GF
A6CCA5_9PLAN/71-236------------------------------------------------------------------------------GW
A3I170_9BACT/40-240------------------------------------------------------------------------------ET
A7AAJ2_9PORP/957-1147------------------------------------------------------------------------------GF
A5IIW8_THEP1/74-230------------------------------------------------------------------------------PW
A7LWH3_BACOV/23-209------------------------------------------------------------------------------NW
Q01WT7_SOLUE/22-227------------------------------------------------------------------------------GY
A6DM09_9BACT/22-216------------------------------------------------------------------------------EW
A2TQP1_9FLAO/40-242------------------------------------------------------------------------------TE
Q02B64_SOLUE/22-209------------------------------------------------------------------------------GF
A6DTC7_9BACT/37-227------------------------------------------------------------------------------ES
A6CA29_9PLAN/352-540------------------------------------------------------------------------------GW
A6C8Y3_9PLAN/63-235------------------------------------------------------------------------------KD
A3XPN2_LEEBM/32-218------------------------------------------------------------------------------PW
A4A0Q4_9PLAN/26-218------------------------------------------------------------------------------GW
A6E8U4_9SPHI/25-211------------------------------------------------------------------------------QW
Q01UN1_SOLUE/9-241------------------------------------------------------------------------------GW
A3ZQS2_9PLAN/31-212------------------------------------------------------------------------------TA
A6DG40_9BACT/159-340------------------------------------------------------------------------------GA
A6DLT3_9BACT/234-440------------------------------------------------------------------------------GF
A6EKV1_9SPHI/655-832------------------------------------------------------------------------------TF
A3ZY13_9PLAN/44-228------------------------------------------------------------------------------TH
A6DLT3_9BACT/28-216------------------------------------------------------------------------------TF
Q1AST8_RUBXD/20-211------------------------------------------------------------------------------GA
A4FDZ7_SACEN/121-335------------------------------------------------------------------------------PY
A7ABK7_9PORP/62-257------------------------------------------------------------------------------DA
A6BYS0_9PLAN/54-263------------------------------------------------------------------------------GW
Q01XX3_SOLUE/25-191------------------------------------------------------------------------------GW
Q2Y669_NITMU/16-255------------------------------------------------------------------------------GF
A3ZWI0_9PLAN/615-790------------------------------------------------------------------------------DW
A3ZR79_9PLAN/39-201------------------------------------------------------------------------------GW
A6CAH6_9PLAN/67-283------------------------------------------------------------------------------GY
Q01TF2_SOLUE/30-207------------------------------------------------------------------------------QW
Q2RZK0_SALRD/15-220------------------------------------------------------------------------------GW
A6CGD1_9PLAN/671-851------------------------------------------------------------------------------GF
A6C1K2_9PLAN/155-332------------------------------------------------------------------------------GA
Q7UTX3_RHOBA/29-219------------------------------------------------------------------------------GF
Q7UYB9_RHOBA/49-246------------------------------------------------------------------------------GY
A3ZS39_9PLAN/38-281------------------------------------------------------------------------------ET
Q026J8_SOLUE/86-284------------------------------------------------------------------------------DA
A6EFU0_9SPHI/28-228------------------------------------------------------------------------------GF
A7AG24_9PORP/243-456------------------------------------------------------------------------------GW
A3ZX11_9PLAN/36-237------------------------------------------------------------------------------GF
A6C3G1_9PLAN/151-333------------------------------------------------------------------------------GA
Q7UWR3_RHOBA/519-700------------------------------------------------------------------------------GW
Q7UZ09_RHOBA/53-231------------------------------------------------------------------------------DF
A3ZQR2_9PLAN/150-327------------------------------------------------------------------------------GA
A6C1I1_9PLAN/43-215------------------------------------------------------------------------------GW
A6C5D8_9PLAN/56-241------------------------------------------------------------------------------GP
A6DGI4_9BACT/22-219------------------------------------------------------------------------------PA
Q7UKZ1_RHOBA/77-278------------------------------------------------------------------------------KT
Q7ULK4_RHOBA/125-306------------------------------------------------------------------------------KA
Q2Y774_NITMU/671-893------------------------------------------------------------------------------GF
F2G5M5_ALTMD/88-279------------------------------------------------------------------------------DA
A6C6K0_9PLAN/64-244------------------------------------------------------------------------------KW
A6LCM7_PARD8/20-194------------------------------------------------------------------------------TK
Q027F9_SOLUE/8-228------------------------------------------------------------------------------GY
A6DM04_9BACT/25-206------------------------------------------------------------------------------EA
Q024Y0_SOLUE/27-212------------------------------------------------------------------------------PW
A6CCA5_9PLAN/239-425------------------------------------------------------------------------------RM
A3ZTD9_9PLAN/1170-1342------------------------------------------------------------------------------NA
A3I2B6_9BACT/23-203------------------------------------------------------------------------------EW
A4A0D3_9PLAN/28-213------------------------------------------------------------------------------GF
Q7ULY5_RHOBA/234-440------------------------------------------------------------------------------EW
A2U0D4_9FLAO/30-260------------------------------------------------------------------------------EW
A3ZSI6_9PLAN/804-979------------------------------------------------------------------------------QW
A4ASP0_MARSH/33-262------------------------------------------------------------------------------EW
A6DNR0_9BACT/77-264------------------------------------------------------------------------------DA
Q7UTX3_RHOBA/225-416------------------------------------------------------------------------------QW
A4A202_9PLAN/27-207------------------------------------------------------------------------------GW
Q7UYD6_RHOBA/61-249------------------------------------------------------------------------------GF
A6DQD4_9BACT/44-244------------------------------------------------------------------------------KW
Q7UYI5_RHOBA/85-260------------------------------------------------------------------------------KW
A4APB3_MARSH/31-262------------------------------------------------------------------------------VW
A4CHF9_ROBBH/43-248------------------------------------------------------------------------------DW
A6LD40_PARD8/42-255------------------------------------------------------------------------------GY
Q2GAA2_NOVAD/60-315------------------------------------------------------------------------------AP
A3ZWI1_9PLAN/266-442------------------------------------------------------------------------------GF
A3XQG8_LEEBM/44-246------------------------------------------------------------------------------EW
Q7UPZ9_RHOBA/40-226------------------------------------------------------------------------------GF
Q7URK6_RHOBA/266-443------------------------------------------------------------------------------DA
Q1VRW8_9FLAO/69-265------------------------------------------------------------------------------DA
A6LER8_PARD8/252-428------------------------------------------------------------------------------KE
Q7US53_RHOBA/171-350------------------------------------------------------------------------------HP
Q026X4_SOLUE/31-258------------------------------------------------------------------------------DW
A3HX26_9BACT/40-244------------------------------------------------------------------------------EF
A2TQP0_9FLAO/54-250------------------------------------------------------------------------------DA
A3HS07_9BACT/30-219------------------------------------------------------------------------------GW
A3ZR79_9PLAN/204-387------------------------------------------------------------------------------GM
A3I0Y0_9BACT/33-262------------------------------------------------------------------------------EW
A3ZT60_9PLAN/22-206------------------------------------------------------------------------------DA
Q01RN4_SOLUE/31-268------------------------------------------------------------------------------DW
A6C7J3_9PLAN/515-746------------------------------------------------------------------------------GW
A3I2F1_9BACT/51-252------------------------------------------------------------------------------GW
A4CGG3_ROBBH/243-451------------------------------------------------------------------------------GW
Q7UXU2_RHOBA/55-243------------------------------------------------------------------------------DA
Q7UGD2_RHOBA/163-356------------------------------------------------------------------------------DA
Q7UYA4_RHOBA/58-260------------------------------------------------------------------------------DA

PF00337

Q7QF77_ANOGA/4-145--------------------------------------------------------------------------------
Q7QF77_ANOGA/165-293--------------------------------------------------------------------------------
Q7PPI9_ANOGA/742-883--------------------------------------------------------------------------------
Q7QHP5_ANOGA/12-144--------------------------------------------------------------------------------
Q18813_CAEEL/34-172--------------------------------------------------------------------------------
Q18813_CAEEL/180-310--------------------------------------------------------------------------------
LEG8_HUMAN/18-151--------------------------------------------------------------------------------
LEG8_HUMAN/186-316--------------------------------------------------------------------------------
Q9VPI7_DROME/41-166--------------------------------------------------------------------------------
Q9XVD0_CAEEL/131-257--------------------------------------------------------------------------------
B3GTH_ARATH/184-393--------------------------------------------------------------------------------
B3GTK_ARATH/190-404--------------------------------------------------------------------------------
Q9VPI7_DROME/226-369--------------------------------------------------------------------------------
LEG7_MOUSE/5-135--------------------------------------------------------------------------------
LEG3_MOUSE/131-261--------------------------------------------------------------------------------
LEG4_CHICK/4-134--------------------------------------------------------------------------------
LEG2_CONMY/3-135--------------------------------------------------------------------------------
YPX5_CAEEL/766-887--------------------------------------------------------------------------------
C5HZ14_HUMAN/5-137--------------------------------------------------------------------------------
Q7Q8Z7_ANOGA/12-142--------------------------------------------------------------------------------
Q7Q2T6_ANOGA/13-143--------------------------------------------------------------------------------
Q7PWU9_ANOGA/113-239--------------------------------------------------------------------------------
Q7PWU9_ANOGA/285-422--------------------------------------------------------------------------------
Q95SA3_DROME/4-138--------------------------------------------------------------------------------
O01410_9BILA/10-141--------------------------------------------------------------------------------
Q18625_CAEEL/13-145--------------------------------------------------------------------------------
LEG9_HUMAN/16-147--------------------------------------------------------------------------------
Q6TGN3_DANRE/15-146--------------------------------------------------------------------------------
Q6DDQ2_XENLA/12-143--------------------------------------------------------------------------------
Q6PGR5_XENLA/38-162--------------------------------------------------------------------------------
LEG4_PIG/18-149--------------------------------------------------------------------------------
Q8C3K0_MOUSE/26-160--------------------------------------------------------------------------------
Q86GY9_RHIAP/185-315--------------------------------------------------------------------------------
LEG9_HUMAN/226-355--------------------------------------------------------------------------------
Q6TGN3_DANRE/193-320--------------------------------------------------------------------------------
Q6TGN4_DANRE/93-224--------------------------------------------------------------------------------
Q7SYP0_XENLA/74-204--------------------------------------------------------------------------------
LEG4_PIG/193-323--------------------------------------------------------------------------------
Q6PGR5_XENLA/224-353--------------------------------------------------------------------------------
LEC7_CAEEL/10-137--------------------------------------------------------------------------------
Q94215_CAEEL/11-140--------------------------------------------------------------------------------
Q95SA3_DROME/163-289--------------------------------------------------------------------------------
Q9VPU6_DROME/164-300--------------------------------------------------------------------------------
Q9VPU6_DROME/3-145--------------------------------------------------------------------------------
Q7ZZ26_DANRE/9-141--------------------------------------------------------------------------------
O01410_9BILA/149-277--------------------------------------------------------------------------------
O01329_CAEEL/100-226--------------------------------------------------------------------------------
O62353_CAEEL/138-266--------------------------------------------------------------------------------
Q18625_CAEEL/153-281--------------------------------------------------------------------------------
Q21057_CAEEL/18-144--------------------------------------------------------------------------------
Q9NG17_HAECO/18-142--------------------------------------------------------------------------------
Q9U9P5_HAECO/15-145--------------------------------------------------------------------------------
Q24953_GEOCY/3-139--------------------------------------------------------------------------------
O02442_GLORO/12-141--------------------------------------------------------------------------------
TECPR_DROME/815-954--------------------------------------------------------------------------------
Q6PIT8_HUMAN/1-128--------------------------------------------------------------------------------
LEG6_CHICK/3-133--------------------------------------------------------------------------------
LEG1_BUFAR/3-133--------------------------------------------------------------------------------
LEG_ELEEL/3-128--------------------------------------------------------------------------------
Q7ZTB7_XENLA/5-134--------------------------------------------------------------------------------
LEG1_CONMY/2-135--------------------------------------------------------------------------------
AJL1_ANGJA/2-133--------------------------------------------------------------------------------
Q76CY7_CONMY/2-129--------------------------------------------------------------------------------
ATLE_AGRAE/11-140--------------------------------------------------------------------------------
CGL1_COPCI/8-136--------------------------------------------------------------------------------
Q9U2I7_CAEEL/14-147--------------------------------------------------------------------------------
GRIFN_RAT/4-132--------------------------------------------------------------------------------
GRIFN_DANRE/4-133--------------------------------------------------------------------------------
Q86G98_CRAGI/29-160--------------------------------------------------------------------------------
Q6AV44_ORYSJ/145-340--------------------------------------------------------------------------------
Q84T07_ORYSJ/162-372--------------------------------------------------------------------------------
B3GTI_ARATH/190-391--------------------------------------------------------------------------------
B3GTF_ARATH/170-363--------------------------------------------------------------------------------
B3GTG_ARATH/165-343--------------------------------------------------------------------------------
Q83467_ADEP4/393-522--------------------------------------------------------------------------------
Q83467_ADEP4/547-682--------------------------------------------------------------------------------
Q9VPI6_DROME/339-481--------------------------------------------------------------------------------
C5HZ19_HUMAN/5-137--------------------------------------------------------------------------------
Q9MZA4_SHEEP/5-136--------------------------------------------------------------------------------
Q8SXU5_DROME/5-142--------------------------------------------------------------------------------

PF00139

LRK19_ARATH/23-259------------------------------------------------------------------------------QE
LRK22_ARATH/26-272------------------------------------------------------------------------------DR
LRK72_ARATH/22-260------------------------------------------------------------------------------TG
LEC_BOWMI/2-231------------------------------------------------------------------------------NS
LEC1_PSOTE/2-233------------------------------------------------------------------------------KT
Q6ZLL7_ORYSJ/19-272------------------------------------------------------------------------------TF
LRK61_ARATH/32-279------------------------------------------------------------------------------TT
LRK71_ARATH/19-256------------------------------------------------------------------------------SA
Q41263_GRISI/6-243------------------------------------------------------------------------------DT
ARC1_PHAVU/23-243------------------------------------------------------------------------------ND
LECR_PEA/32-257------------------------------------------------------------------------------QA
O65756_CICAR/28-251------------------------------------------------------------------------------KS
LEC1_CYTSE/3-236------------------------------------------------------------------------------DH
LEC_PHALU/22-242------------------------------------------------------------------------------AE
LRKS6_ARATH/24-257------------------------------------------------------------------------------LS
LEC_SOYBN/34-261------------------------------------------------------------------------------ET
LEC_LATSP/4-234------------------------------------------------------------------------------ET
Q8H4J1_ORYSJ/34-272------------------------------------------------------------------------------DD
Q6K3K2_ORYSJ/106-354------------------------------------------------------------------------------AA
LRK52_ARATH/27-248------------------------------------------------------------------------------TG
LEC4_GRISI/2-235------------------------------------------------------------------------------NT
LRK32_ARATH/25-262------------------------------------------------------------------------------QQ
Q8LN32_ORYSJ/28-268------------------------------------------------------------------------------AD
Q84ZH5_ORYSJ/46-284------------------------------------------------------------------------------SD
Q43376_ARAHY/2-236------------------------------------------------------------------------------DS
LRKS1_ARATH/28-273------------------------------------------------------------------------------SA
Q8LA09_ARATH/26-252------------------------------------------------------------------------------VN
Q8SA62_9FABA/4-229------------------------------------------------------------------------------NY
Q9LNN3_ARATH/22-277------------------------------------------------------------------------------SA
Q6ZIQ9_ORYSJ/34-300------------------------------------------------------------------------------EF
Q8H4J3_ORYSJ/27-267------------------------------------------------------------------------------EE
LECG_ARAHY/25-249------------------------------------------------------------------------------ET
LRK82_ARATH/28-260------------------------------------------------------------------------------VR
Q7XUN5_ORYSJ/26-265------------------------------------------------------------------------------AA
Q9FQ12_CITPA/23-251------------------------------------------------------------------------------TP
Q6UY60_MEDTR/19-259------------------------------------------------------------------------------ED
Q5DMV1_CUCME/20-261------------------------------------------------------------------------------AD
Q7XUC7_ORYSJ/27-259------------------------------------------------------------------------------SC
Y1396_METJA/1450-1677------------------------------------------------------------------------------RG
LRKS5_ARATH/23-257------------------------------------------------------------------------------KC
LRKS4_ARATH/22-259------------------------------------------------------------------------------LI
Q8LIP0_ORYSJ/35-279------------------------------------------------------------------------------SD
Q6YT52_ORYSJ/18-256------------------------------------------------------------------------------AV
LRK91_ARATH/18-251------------------------------------------------------------------------------CS
Q8H4I0_ORYSJ/22-261------------------------------------------------------------------------------SE
Q6ZFB3_ORYSJ/34-270------------------------------------------------------------------------------TT
Q7UVU2_RHOBA/628-843------------------------------------------------------------------------------EV

PF03388

YQF8_SCHPO/24-250------------------------------------------------------------------------------TS
YOC5_SCHPO/23-229------------------------------------------------------------------------------SQ
EMP47_YEAST/36-253------------------------------------------------------------------------------DA
LMAN1_HUMAN/44-269------------------------------------------------------------------------------RR
Q9V3A8_DROME/33-259------------------------------------------------------------------------------RR
Q9VCC2_DROME/33-258------------------------------------------------------------------------------DY
LMAN2_CANFA/52-278------------------------------------------------------------------------------EH
Q22170_CAEEL/43-272------------------------------------------------------------------------------GY

PF03935

Q6BW61_DEBHA/174-674.............ESYEILTSYRYPLLSAIR.TGLVDPDTPEDALTKKTS.K.DATWKLVFSDEFNAAGRTFYEGDDQFF
Q0UQN1_PHANO/94-573GKPFWA.ANIYKAEAWAHVNDVKYPFIQNIR.TGLIDPDTPKSAMKRKGE.Y.GDEYELVFSDEFNVENRTFYEGDDPYF
A5DEX4_PICGU/157-655.............ESYEILTHYKYPILSAIR.TSLVDPDTPDEYLTRKVT.T.G.TWKLVFSDEFNKDGRTFYDGDDQFF
A1C6M7_ASPCL/154-653P............RDTLCLDVGDRPLLSNIR.RGLIDPDTPKSARSKKSA.D.GKEWKLVFSDEFNTDGRTFYDGDDPFY
A6ZUF5_YEAS7/249-763VHAANSAGSSSSNTTSKSLTEYQYPQLAAIR.TTLVDPDTPDSAKTRVAK.D.GSKWQLVFSDEFNAEGRTFYDGDDQFW
Q752M9_ASHGO/153-654.............KLTEVLSPYQYPQLSAIR.TSLVDPDTPKDARKRKSL.K.GETWPLVFSDEFNAVGRTFFEGDDQFW
Q5KJ60_CRYNJ/92-619SG..........YNLGGINASGQYPSITGLP..SLIDSDTPEYLYTRTGF.D.GKEWTLVFSDEFEKDGRTFFEGDDPFW
Q4P2E5_USTMA/148-679.............ASASLSTTTTFTTFPVNMKRGLVDQETPQSAYKRTSPVD.NSAWHLVFSDEFNTPGRTFWPGDDPFW
A5DZI8_LODEL/240-745.............ESYEVLTRYSYPMLSAIR.QSLIDPDTPLDAMLKKSK.L.GDTWPLVFSDEFNVEGRTFYDGDDQFF
Q4PGA6_USTMA/384-919GG..........FNLGGANATGQVADLKIGR..GLIDPDTPESVKTRTTLNGSGKKMNLVFSDEFNRDGRSFYPGDDPFW
Q4P8J4_USTMA/197-732GG..........YNLGGVNASGQIASIPGLR.SSLIDPDTPQDARTRLSP.DGTKTMKLVFSDEFNTPGRSFYPGDDPFW
YEPB_SCHPO/124-627FD..........AIMANQITDHLFAHMRVPR.TNLIDKDTPSTAYHRTGY.N.GRKYNLVFSDEFNKEGRSFYSGNDQFW
YEOB_SCHPO/134-636.............TRVTGITNHQFRILRLLRYGSLIDPDTPESAYTFDSQ.D.LGTLDLVFSDEFNYPGRAFYDGDDQFW
A7TTP7_VANPO/229-744RQGGSSSGGGSQNGDNEYLTAYTYPQLAAIR.TTLVDPDTPSAAKTRKAK.D.GSSWNLVFSDEFNAEGRTFYDGDDQFW
A5DZ87_LODEL/332-841.............LTYLILTQYKYPTLSAIR.QSLIDPDTPLDARTIEAR.D.GSDWSLVFSDEFNVVGRTFYEGDDQFF
SKN1_CANAX/238-737.............ENYEVLTRYSYPRLSAIR.TSLIDPDTPEDALFWKSK.N.GEEWPLVFSDEFNAEGRTFYEGDDQFF
Q6FUB1_CANGA/183-684.............VVQEILSAYQYPQLSAIR.TKLVDPDTPQSALSRQAR.D.GSYWKLVFSDEFNAEGRTFYDGEDQFW
A7E6J8_SCLS1/168-668.............AAAIDCLSIKIPLLKNVR.TGLIDPDTPDSVKSKTAQ.D.GTKLKLVFSDEFNTDGRTFYDGDDPFF
Q5AEC0_CANAL/212-718.............QEYEILSHYSYPLLSAIR.TSLIDPDTPQDALKMKAK.D.GSNWSLVFSDEFNIMGRTFYEGDDQFW
A3LPW0_PICST/189-695.............QSYEILTDYTYPLLSAIR.TSLVDPDTPSSAFNHTAQ.N.GDVWTLVFSDEFNAEGRTFYEGDDQFF
A7EWT0_SCLS1/211-717SGYV......DYGPAWAHVNNNTYPLLKNVR.TTLIDPDTPQTARTRESTFN.GETLNLVFSDEFNNNNRTFYPGDDPFW
Q5KHK4_CRYNJ/69-588GA..........YNIGGINSTGQVPLISNIP..TVIDSDTPVDKYTRTGF.D.GKTYSLVFSDEFEKEGRTFFPGDDPFW
Q6UEI2_PNECA/190-675.............RCPDCTKTLPIDLLNATR..GLIDPDTPEEFYELKNK.D.GKIYKLVFSDEFNKNGRTFYPGDDQFW
Q0UKL9_PHANO/161-653G............NPLCIQGKQNEPILSTYE.RG..S.STPT...............QLGFSDEFNVDGPLFYDGDDPYF
A3LPU3_PICST/148-653.............EEYEILTHYQYPLLSAIR.TNLVDPDTPSDALTIKAQ.D.GSNWSLVFSDEFNAEGRTFYDGDDQFF
Q6FQ11_CANGA/223-736IHPANS..TNFTNHNAVPLSLYQYPQLSAIR.TSLVDPDTPQSALTRKAK.D.GSDWRLVFSDEFNAAGRTFYDGDDQFW

PF00722

XTH8_ARATH/38-224------------------------------------------------------------------------------FE
XTH1_ARATH/36-215------------------------------------------------------------------------------FD
Q6BHG8_DEBHA/45-215------------------------------------------------------------------------------KS
Q6BH77_DEBHA/56-228------------------------------------------------------------------------------GQ
Q6BH39_DEBHA/52-224------------------------------------------------------------------------------NS
Q6BRL2_DEBHA/100-275------------------------------------------------------------------------------NS
Q7CTY9_AGRT5/57-234------------------------------------------------------------------------------NG
Q7CSS8_AGRT5/263-456------------------------------------------------------------------------------IN
GUB_CLOTM/56-241------------------------------------------------------------------------------NG
O73951_9EURY/82-290------------------------------------------------------------------------------GE
Q7S0F8_NEUCR/55-225------------------------------------------------------------------------------AV
Q42446_MAIZE/24-205------------------------------------------------------------------------------FY
EXOK_RHIME/58-245------------------------------------------------------------------------------NG
EXSH_RHIME/263-455------------------------------------------------------------------------------IN
BRU1_SOYBN/32-213------------------------------------------------------------------------------FY
Q6FNU8_CANGA/147-325------------------------------------------------------------------------------ML
Q43527_SOLLC/23-204------------------------------------------------------------------------------FY
Q60D19_SOLDE/23-202------------------------------------------------------------------------------FT
Q6QUX9_VERDA/49-221------------------------------------------------------------------------------NG
Q07524_TROMA/43-227------------------------------------------------------------------------------FD
XYND_RUMFL/594-785------------------------------------------------------------------------------NG
XTH10_ARATH/37-218------------------------------------------------------------------------------FN
P93669_HORVU/29-213------------------------------------------------------------------------------FD
CRH2_YEAST/96-273------------------------------------------------------------------------------NV
CRR1_ASHGO/155-333------------------------------------------------------------------------------ML
XTH13_ARATH/26-207------------------------------------------------------------------------------FY
Q7XTP9_ORYSJ/31-215------------------------------------------------------------------------------MT
Q6ES26_ORYSJ/32-215------------------------------------------------------------------------------FY
XTH31_ARATH/39-223------------------------------------------------------------------------------FD
O23950_GOSHI/20-202------------------------------------------------------------------------------FL
O68641_CELCE/88-288------------------------------------------------------------------------------AE
Q5AXN2_EMENI/49-224------------------------------------------------------------------------------TL
GUB_BREBE/61-248------------------------------------------------------------------------------NG
Q6FWX2_CANGA/97-274------------------------------------------------------------------------------NA
Q5JZX2_MAIZE/28-208------------------------------------------------------------------------------LY
Q60039_THENE/252-458------------------------------------------------------------------------------AE
XTH33_ARATH/43-226------------------------------------------------------------------------------IE
Q58WP7_9BACT/251-458------------------------------------------------------------------------------NE
Q58WW0_9BACT/53-239------------------------------------------------------------------------------NG
GUB_BACSU/54-238------------------------------------------------------------------------------NG
Q6ZAN9_ORYSJ/28-212------------------------------------------------------------------------------LT
Q588C0_CRYJA/24-205------------------------------------------------------------------------------FF
Q7XNY6_ORYSJ/36-222------------------------------------------------------------------------------FR
Q9ZRV1_FAGSY/28-209------------------------------------------------------------------------------LH
Q6Z2L4_ORYSJ/35-220------------------------------------------------------------------------------FE
Q6RHY1_SOLLC/27-212------------------------------------------------------------------------------FN
P93672_HORVU/23-204------------------------------------------------------------------------------FF
Q6CIZ6_KLULA/49-219------------------------------------------------------------------------------ES
Q84T83_ORYSJ/36-221------------------------------------------------------------------------------FD
Q8H7Q1_ORYSJ/3-189------------------------------------------------------------------------------FG
Q8GVQ2_ORYSJ/40-224------------------------------------------------------------------------------FG
Q6C4P9_YARLI/48-219------------------------------------------------------------------------------PS
CRH1_YEAST/65-235------------------------------------------------------------------------------SS
Q8W3L8_9ROSI/37-221------------------------------------------------------------------------------FN
XTH17_ARATH/29-211------------------------------------------------------------------------------FH
Q6L873_9ACTO/73-282------------------------------------------------------------------------------HE
Q6RHX9_SOLLC/39-224------------------------------------------------------------------------------FN
Q6ZAN8_ORYSJ/30-214------------------------------------------------------------------------------MT
XTH2_ARATH/32-212------------------------------------------------------------------------------FD
CGKA_ALTCA/60-268------------------------------------------------------------------------------QT
Q6EJD2_BETVU/24-205------------------------------------------------------------------------------FN
Q5AK54_CANAL/69-239------------------------------------------------------------------------------GT
Q45648_BACSP/60-250------------------------------------------------------------------------------NG
Q58WV0_9BACT/241-448------------------------------------------------------------------------------NE
P93671_HORVU/23-204------------------------------------------------------------------------------FD
Q5MD55_BRACM/19-198------------------------------------------------------------------------------FE
O07856_STREI/49-233------------------------------------------------------------------------------NG
Q8GVR3_ORYSJ/46-232------------------------------------------------------------------------------FS
XTH28_ARATH/31-216------------------------------------------------------------------------------FD
Q7SGL2_NEUCR/50-224------------------------------------------------------------------------------TP
Q5KNP5_CRYNJ/97-278------------------------------------------------------------------------------NA
Q6YUP5_ORYSJ/36-221------------------------------------------------------------------------------FD
Q9FZ05_SOLLC/27-209------------------------------------------------------------------------------FD
Q949H9_FESPR/27-211------------------------------------------------------------------------------FN
Q825L5_STRAW/78-287------------------------------------------------------------------------------HE
Q5AJC0_CANAL/100-275------------------------------------------------------------------------------NS
GUB_ORPSP/57-239------------------------------------------------------------------------------NG
Q5G5A1_MAGGR/95-271------------------------------------------------------------------------------DA
Q7S222_NEUCR/48-222------------------------------------------------------------------------------GA
Q6Z998_ORYSJ/39-226------------------------------------------------------------------------------MY
Q7N1F8_PHOLL/52-255------------------------------------------------------------------------------LG
Q97FD3_CLOAB/57-242------------------------------------------------------------------------------NG
CRR1_YEAST/147-325------------------------------------------------------------------------------ML
Q8KKH3_BACCI/63-258------------------------------------------------------------------------------NE
Q7XBU8_ORYSJ/32-215------------------------------------------------------------------------------FD
XTH32_ARATH/43-227------------------------------------------------------------------------------FY
XTH26_ARATH/29-208------------------------------------------------------------------------------FS
Q82M60_STRAW/400-624------------------------------------------------------------------------------GE
Q8GRB4_9PSED/352-562------------------------------------------------------------------------------NE
GUB_PAEMA/49-233------------------------------------------------------------------------------NG
Q9AT33_DAUCA/30-215------------------------------------------------------------------------------FE
Q56X65_ARATH/24-208------------------------------------------------------------------------------WG
Q6K9X1_ORYSJ/50-242------------------------------------------------------------------------------FG
Q64NE2_BACFR/102-301------------------------------------------------------------------------------VA
XTH21_ARATH/28-209------------------------------------------------------------------------------FN
Q7S7D0_NEUCR/61-233------------------------------------------------------------------------------DQ
XTH25_ARATH/30-211------------------------------------------------------------------------------FD
Q6FSM3_CANGA/48-218------------------------------------------------------------------------------ES
Q6ES25_ORYSJ/25-208------------------------------------------------------------------------------FR
O65102_ACTDE/25-206------------------------------------------------------------------------------FG
Q9APD8_BACCI/57-251------------------------------------------------------------------------------NG
Q5Z746_ORYSJ/26-208------------------------------------------------------------------------------FQ
Q5AFA2_CANAL/50-220------------------------------------------------------------------------------LG
Q5B4L5_EMENI/96-273------------------------------------------------------------------------------NA
Q9ZG90_9SPHI/90-285------------------------------------------------------------------------------TS
Q98I38_RHILO/263-455------------------------------------------------------------------------------VD
P93670_HORVU/26-209------------------------------------------------------------------------------FY
Q5Z6H1_ORYSJ/36-217------------------------------------------------------------------------------FH
XTH24_ARATH/24-205------------------------------------------------------------------------------FN
Q98C78_RHILO/80-268------------------------------------------------------------------------------NG
Q7SBQ2_NEUCR/99-274------------------------------------------------------------------------------DP
Q8XNF8_CLOPE/412-635------------------------------------------------------------------------------GM
XTH1_SOLLC/33-214------------------------------------------------------------------------------FW
Q7XTP8_ORYSJ/24-207------------------------------------------------------------------------------ID
Q6CL87_KLULA/145-322------------------------------------------------------------------------------ML
Q89UP7_BRAJA/123-310------------------------------------------------------------------------------YT
XTH3_ARATH/35-213------------------------------------------------------------------------------FG
Q51333_CELCE/99-299------------------------------------------------------------------------------AE
Q5BEU7_EMENI/49-223------------------------------------------------------------------------------GE
Q84V49_CUCSA/37-218------------------------------------------------------------------------------FY

PF10287

YJR1_YEAST/104-340------------------------------------------------------------------------------SS
C4R9F6_PICPG/188-424------------------------------------------------------------------------------TG
A7TGR9_VANPO/101-337------------------------------------------------------------------------------SA
B6JWV1_SCHJY/232-465------------------------------------------------------------------------------SG
C5GJ05_AJEDR/166-390------------------------------------------------------------------------------AG
Q5AJA4_CANAL/225-457------------------------------------------------------------------------------DG
C5DIE9_LACTC/220-453------------------------------------------------------------------------------GS
Q6FJ92_CANGA/108-344------------------------------------------------------------------------------SQ
Q6CGN1_YARLI/219-452------------------------------------------------------------------------------NS
Q56VT8_PHYPR/317-554------------------------------------------------------------------------------NG
YH6B_SCHPO/263-496------------------------------------------------------------------------------SS
A5DNR6_PICGU/95-331------------------------------------------------------------------------------GD
A5DXV9_LODEL/226-458------------------------------------------------------------------------------SG
C5DXY8_ZYGRC/255-485------------------------------------------------------------------------------SG
A3LP10_PICST/206-436------------------------------------------------------------------------------SG
C5FXD0_ARTOC/195-428------------------------------------------------------------------------------PG
A6ZLA4_YEAS7/220-445------------------------------------------------------------------------------NG
Q7SG43_NEUCR/137-367------------------------------------------------------------------------------DG
Q7SG41_NEUCR/175-395------------------------------------------------------------------------------AS
A6RN52_BOTFB/258-482------------------------------------------------------------------------------SG
C5M5H0_CANTT/100-335------------------------------------------------------------------------------SG
Q6BRM6_DEBHA/196-424------------------------------------------------------------------------------AG
A5DUY9_LODEL/99-334------------------------------------------------------------------------------SG
Q08WX8_STIAD/98-327------------------------------------------------------------------------------AA
Q75A62_ASHGO/258-491------------------------------------------------------------------------------VS
Q6FJK5_CANGA/211-436------------------------------------------------------------------------------GG
Q6CVS7_KLULA/215-448------------------------------------------------------------------------------SS
A7TQU3_VANPO/142-372------------------------------------------------------------------------------SS
Q757Z0_ASHGO/143-379------------------------------------------------------------------------------SG
Q6CXP7_KLULA/105-343------------------------------------------------------------------------------ST
C4Y1A3_CLAL4/228-458------------------------------------------------------------------------------PG
Q7SG42_NEUCR/162-391------------------------------------------------------------------------------GG
C4R2B9_PICPG/118-354------------------------------------------------------------------------------DA
C5M9J2_CANTT/223-454------------------------------------------------------------------------------DG
C4XY08_CLAL4/109-343------------------------------------------------------------------------------KG
C5DKG4_LACTC/101-337------------------------------------------------------------------------------SA
A5DBA4_PICGU/199-429------------------------------------------------------------------------------AG
Q0UV14_PHANO/95-329------------------------------------------------------------------------------AA
A7TFI3_VANPO/108-344------------------------------------------------------------------------------SV

PF00840

CELB_ASPOR/19-414------------------------------------------------------------------------------NS
GUX1_HYPJE/19-447------------------------------------------------------------------------------DG
CBHB_ASPAC/24-461------------------------------------------------------------------------------SG
GUX1_PHACH/20-445------------------------------------------------------------------------------TG
Q01763_PHACH/21-439------------------------------------------------------------------------------SG
GUX1_PENJA/27-459------------------------------------------------------------------------------TG
GUXC_FUSOX/19-451------------------------------------------------------------------------------TG
GUX2_AGABI/20-450------------------------------------------------------------------------------TG
GUNC_FUSOX/20-417------------------------------------------------------------------------------WG
GUN1_TRILO/24-394------------------------------------------------------------------------------NG
GUX1_COCCA/20-452------------------------------------------------------------------------------TG
GUN1_HUMGT/22-419------------------------------------------------------------------------------WG
GUX1_HUMGT/20-452------------------------------------------------------------------------------TG
O93780_HUMGT/24-449------------------------------------------------------------------------------EG
GUX1B_NEUCR/19-443------------------------------------------------------------------------------TG
O00082_CLAPU/21-452------------------------------------------------------------------------------TG
Q01762_PHACH/21-446------------------------------------------------------------------------------TA
GUX1_CRYPA/20-452------------------------------------------------------------------------------TG

PF00054

LAMA1_HUMAN/2920-3051----------F------------RT---S-SQ----------NG---V---LLGIST.A--------------KV-----
LAMA1_HUMAN/2514-2658----------F------------AT---T-NS----------SG---I---ILAALG.G--------------DV-----
LAMA1_HUMAN/2743-2872----------I------------RT---F-AS----------SG---L---IY..YM.A--------------HQ-----
LAMA2_HUMAN/2793-2921----------V------------RT---E-AE----------SG---L---LF..YM.A--------------RI-----
LAMA2_HUMAN/2554-2695----------F------------ST---K-NE----------SG---I---ILLGSG.G--------------TP-----
LAMA2_HUMAN/2174-2314----------V------------KT---A-VA----------DN---L---LF..YL.G--------------SA-----
LAMA2_HUMAN/2368-2507----------F------------RT---F-SS----------SA---L---LM..YL.A--------------TR-----
AGRIN_CHICK/1416-1546----------F------------RA---T-EL----------SG---L---LL..YN.G--------------QN-----
AGRIN_CHICK/1682-1817----------F------------LA---K-SP----------SG---M---IF..YN.G--------------QK-----
AGRIN_CHICK/1925-2056----------I------------KT---E-AT----------QG---L---IL..WS.G--------------KG-----
CSPG4_RAT/55-182----------F------------ST---S-QP----------EA---L---LL..LA.A--------------GQ-----
AGRIN_RAT/1291-1422----------F------------RA---L-ET----------EG---L---LL..YN.G--------------NA-----
AGRIN_RAT/1559-1694----------F------------LA---R-GP----------SG---L---LL..YN.G--------------QK-----
SHBG_RAT/76-206----------F------------RT---W-DP----------EG---V---IF..YG.D--------------TN-----
CRB_DROME/1048-1183----------F------------RT---T-LP----------NG---V---LAFGTT.G--------------EK-----
AGRIN_RAT/1811-1942----------L------------RT---E-AT----------QG---L---VL..WI.G--------------KA-----
SLIT_DROME/1204-1335----------F------------SS---A-EQ----------NG---I---LM..YD.G--------------QD-----
PROS_HUMAN/329-459----------F------------RT---Y-DS----------EG---V---IL..YA.E--------------SI-----
CRB_DROME/1281-1443----------I------------RT---R-EP----------TG---Q---VF..YL.G--------------TD-----
SHBG_HUMAN/75-205----------V------------RT---W-DP----------EG---V---IF..YG.D--------------TN-----
FAT_DROME/4156-4306----------F------------AT---T-KP----------NS---L---LL..YNYG--------------MQ-----

PF02210

EYS_HUMAN/3007-3141----------F------------ST...T.KT----------EG---L---IV--WM-G--------------IA-----
Q7PH68_ANOGA/3924-4055----------F------------SA...Y.EP----------NG---L---LI--WY-G--------------QR-----
Q7PSM9_ANOGA/688-822----------F------------RT...N.EP----------NG---L---II--LN-T--------------MT-----
Q7PSM9_ANOGA/919-1050----------F------------KT...S.RP----------AG---L---LL--LT-S--------------AE-----
Q7PSM9_ANOGA/1115-1244----------F------------KT...L.EP----------NG---L---LF--YN-G--------------GK-----
CELR1_MOUSE/1734-1864----------F------------RT...R.KE----------DG---V---LM--EA-T--------------AG-----
CNTP1_MOUSE/390-516----------F------------RT...W.DL----------TG---L---LL--FS-H--------------LG-----
Q18291_CAEEL/303-430----------F------------KT...V.HG----------TS---M---LF--YA-G--------------DE-----
Q18291_CAEEL/495-627----------F------------RT...T.SS----------DG---L---IL--YH-G--------------VM-----
Q18291_CAEEL/722-843----------F------------RT...T.SS----------RG---V---LF--DT-G--------------AN-----
Q18291_CAEEL/906-1035----------F------------QT...L.MR----------SA---L---LF--FT-L--------------PK-----
Q18291_CAEEL/1129-1266----------F------------RT...T.QP----------NG---V---LI--SI-E--------------CA-----
LAMA5_MOUSE/2974-3103----------L------------RL...V.SY----------NG---I---IF--FL-K--------------QE-----
LAMA5_MOUSE/3157-3274----------F------------RG...T.QD----------NN---L---LY--YR-T--------------SP-----
LAMA5_MOUSE/3367-3497----------V------------RP..HA.AS----------QG---L---LL--ST-A--------------PM-----
LAMA5_MOUSE/3547-3670----------M------------RP...L.AA----------AG---L---IF--HL-G--------------QA-----
NRX3A_MOUSE/475-619----------F------------RT...T.EP----------NG---L---IL--FT-H--------------GK-----
NRX3A_HUMAN/287-413----------F------------KT...W.QR----------NG---L---IL--HT-G--------------KS-----
CNTP4_MOUSE/400-526----------F------------RT...W.NK----------AG---L---LL--FS-E--------------LQ-----
CNTP4_MOUSE/1048-1178----------F------------RT...T.RA----------PS---L---LL--HM-S--------------SF-----
CRUM1_MOUSE/513-650----------F------------HT...V.QP----------NA---L---LL--IR-G--------------NK-----
PGBM_HUMAN/4234-4364----------V------------RT...S.TA----------SG---L---LL--WQ-G--------------VE-----
LAMA5_HUMAN/2970-3099----------L------------RL...V.SY----------SG---V---LF--FL-K--------------QQ-----
LAMA5_HUMAN/3370-3499----------V------------LP...R.SS----------RG---L---LL--FT-A--------------RL-----
LAMA5_HUMAN/3549-3673----------V------------RP...L.AV----------TG---L---IF--HL-G--------------QA-----
FAT1_HUMAN/3859-3985----------L------------RT...Y.ST----------HA---V---VM--YA-R--------------G.-----
Q9VJ82_DROME/55-178----------F------------RT...R.QE----------NA---F---LF--LA-A--------------GR-----
Q9VJ82_DROME/238-367----------F------------RT...M.AS----------AG---V---IF--FN-G--------------G.-----
LAMA4_HUMAN/1079-1210----------V------------RT...P.AD----------NG---L---IL--LM-V--------------NG-----
LAMA4_HUMAN/1499-1626----------L------------RT...R.SS----------HG---M---IF--YV-S--------------DQ-----
CADH4_CAEEL/3750-3871----------L------------KT...T.TH----------NG---I---IM--WS-R--------------GK-----
CSPG4_HUMAN/55-178----------F------------ST...S.QP----------EA---L---LL--LA-A--------------GP-----
CSPG4_HUMAN/230-363----------L------------TT...Q.SR----------QA---P---LA--FQ-A--------------GG-----
FAT2_HUMAN/3800-3921----------L------------KT...L.QP----------QA---I---LL--FT-N--------------ET-----
LAMA3_HUMAN/2797-2904----------F------------QT...F.QP----------SG---I---LL--DH-Q--------------TW-----
LAMA3_HUMAN/3186-3311----------I------------RP...R.SL----------TG---I---LI--HI-G--------------SQ-----
CTP5B_MOUSE/1031-1159----------F------------MT...A.QA----------PT---L---LL--YL-N--------------FS-----
Q8IQH0_DROME/220-342----------F------------KT...A.FA----------NG---V---MM--YS-R--------------GT-----
Q8IQH0_DROME/403-516----------F------------RT...Y.EE----------TG---V---ML--HH-D--------------FY-----
Q8IQH0_DROME/1032-1156----------F------------TT...T.IP----------KG---F---LL--GF-S--------------SN-----
EYS_DROME/1723-1856----------L------------RP...L.SE----------RG---L---LL--YF-G--------------TL-----
FAT3_HUMAN/3865-3994----------L------------RT...L.QS----------NG---I---IM--YT-R--------------A.-----
CNTP5_HUMAN/819-938----------F------------KT...T.AL----------SG---V---FL--EN-L--------------GI-----
CNTP3_HUMAN/1046-1176----------F------------RT...T.RT----------PS---L---LL--YV-S--------------SF-----
NRX3B_HUMAN/117-236----------F------------ST...T.VK----------DG---I---LV--RI-D--------------SA-----
CELR3_HUMAN/1793-1924----------F------------RT...R.AT----------QG---V---LM--QV-Q--------------AG-----
STAN_DROME/1584-1736----------F------------AT...V.QE----------NG---L---LL--YN-G--------------RY-----
STAN_DROME/1826-1946----------L------------RT...R.QK----------EA---F---LL--QI-Q--------------IG-----
NRX3A_HUMAN/55-184----------F------------KT...N.VS----------TG---L---LL--YL-D--------------DG-----
NRX3A_HUMAN/899-1027----------F------------KT...T.SP----------DG---F---IL--FN-S--------------GD-----
Q7PQ15_ANOGA/414-542----------F------------RP...E.SF----------DG---I---LL--LT-G--------------ER-----
Q7PQ15_ANOGA/635-761----------I------------KP...L.LE----------DG---L---LL--YS-G--------------HH-----
Q7PQ15_ANOGA/1195-1324----------F------------KT...H.SA----------NG---L---IL--WT-G--------------R.-----
Q7PT06_ANOGA/181-303----------F------------KT...A.HP----------NG---V---LL--YS-R--------------GT-----
Q7PT06_ANOGA/364-479----------F------------RT...Y.EE----------KG---L---ML--HH-D--------------FL-----
Q7PT06_ANOGA/786-905----------F------------KT...T.IE----------NA---V---LL--HA-R--------------GP-----
Q7PT06_ANOGA/994-1118----------F------------TT...T.NP----------KG---F---LI--GL-F--------------SN-----
Q7PT75_ANOGA/1039-1184----------L------------LP...R.QK----------DG---L---VF--YM-G--------------P.-----
Q7Q1N4_ANOGA/1163-1293----------F------------RT...R.ET----------YG---E---LF--RI-S--------------DQ-----
Q7Q3I9_ANOGA/259-395----------I------------IPT.TT.AQ----------IS---L---LA--FI-G--------------QP-----
Q7Q3I9_ANOGA/602-734----------V------------RP...L.SE----------KG---L---IL--FV-R--------------TF-----
Q7Q3I9_ANOGA/875-1043----------I------------ST.....LE----------DG---V---LV--WT-T--------------DE-----
Q7Q5D1_ANOGA/428-553----------F------------KT...N.YD----------DS---A---LF--YA-S--------------GE-----
Q7Q5D1_ANOGA/611-730----------F------------KS...S.KA----------TA---V---LA--YS-E--------------VK-----
Q7Q5D1_ANOGA/1025-1153----------F------------RT...T.GE----------KA---I---LL--FQ-P--------------PI-----
Q7Q5D1_ANOGA/1257-1408----------L------------RT...Y.DR----------HA---F---VL--YA-N--------------DH-----
Q7Q4H3_ANOGA/211-342----------F------------RT...I.EP----------FG---T---LL--SN-I--------------PR-----
CRUM2_MOUSE/469-592----------F------------RT...T.LL----------AG---T---LA--TL-K--------------DT-----
CRUM2_MOUSE/901-1019----------F------------RT...R.DS----------EA---G---LL--RA-V--------------SA-----
EGFLA_MOUSE/641-767----------F------------RP...D.SG----------DG---V---LL--YS-Y--------------DT-----
EGFLA_HUMAN/868-996----------F------------KT...T.AK----------DG---L---LL--WR-G--------------DS-----
Q19617_CAEEL/154-276----------F------------RT...Y.RS----------GV---F---FF--SM-A--------------DQ-----
Q19617_CAEEL/725-839----------V------------KF...S.HS----------QM---S---IL--SW-H--------------ST-----
NRX2A_RAT/949-1077----------F------------KT...T.AP----------DG---L---LL--FN-S--------------GN-----
Q7PPF9_ANOGA/3556-3683----------I------------RP...R.AQ----------SG---L---LM--SV-H--------------GR-----
Q7Q1M9_ANOGA/1015-1178----------I------------IT...T.KP----------DG---L---IF--YN-G--------------PI-----
O45000_CAEEL/275-401----------F------------RFSDSD.AK----------EG---I---LV--YG-E--------------TS-----
O45000_CAEEL/738-847----------F------------RT...T.ET----------PA---S---LV--TV-Q--------------GN-----
Q22574_CAEEL/136-267----------F------------KLD.E..HK----------DG---I---IF--FA-G--------------EL-----
Q22574_CAEEL/415-539----------F------------KT...E.KP----------SG---V---LF--FW-K--------------ED-----
NRX1A_MOUSE/753-884----------F------------RS...Q.RA----------YG---I---LM--AT-T--------------SR-----
CADN_DROME/2407-2568----------F------------IT...R.KP----------DG---L---II--YN-G--------------PI-----
CADN_DROME/2661-2796----------F------------RT...R.EE----------YG---E---LF--RV-S--------------DQ-----
O61230_LYTVA/2142-2298----------F------------IT...E.VS----------SG---T---LL--YN-G--------------PI-----
O61230_LYTVA/2393-2517----------V------------RT...R.QE----------NG---L---IW--SI-S--------------SA-----
O75852_HUMAN/32-150----------F------------KT...L.TP----------WG---V---FL--EN-M--------------GK-----
FAT2_RAT/3802-3923----------L------------KT...L.QP----------WA---L---LM--FT-N--------------ET-----
CELR3_RAT/1534-1693----------F------------AT...V.QP----------SG---L---LF--YN-G--------------RL-----
SLIT2_HUMAN/1188-1316----------I------------AT...D.ED----------SG---I---LL--YK-G--------------D.-----
CRB_DROME/1585-1722----------F------------RT.....RA----------GG---T---LL--YI-D--------------NV-----
FAT_DROME/4432-4545----------F------------RT...Y.KD----------QG---Q---IL--YA-A--------------TN-----
P70570_RAT/1017-1137----------I------------QT...T.VD----------RG---L---LF--FA-E--------------NQ-----
P70570_RAT/1408-1528----------I------------QT...T.SP----------KG---L---VF--YA-G--------------TK-----
CNTP1_HUMAN/203-332----------F------------KT...E.EK----------DG---L---LL--HA-E--------------GA-----
CNTP1_HUMAN/813-939----------F------------RT...S.AP----------SG---V---FL--EN-M--------------GG-----
CRUM1_HUMAN/514-651----------F------------QT...V.QP----------MA---L---LL--FR-S--------------NR-----
CRUM1_HUMAN/743-860----------V------------RT...L.QP----------SG---L---LL--AL-E--------------NS-----
CRUM1_HUMAN/980-1105----------F------------RT...R.DA----------NV---I---IL--HA-E--------------KE-----
P91806_STRPU/27-156----------L------------KT...L.SP----------NG---L---LL--FA-G--------------NE-----
P91806_STRPU/212-343----------F------------RT...E.QP----------NG---L---ML--YT-A--------------DD-----
CNTP1_RAT/1089-1219----------F------------ST...S.SA----------PA---V---LL--YV-S--------------SF-----
LAMA4_MOUSE/1258-1374----------F------------RT...L.QP----------NG---L---LF--YY-T--------------SG-----
PROS_RABIT/485-617----------I------------RP...S.TG----------TG---V---ML--TL-V--------------SG-----
LAMA_DROME/2704-2846----------F------------RT...T.EP----------SG---F---LL--YL-G--------------ND-----
LAMA_DROME/2905-3031----------F------------KAD.KD.TS----------NG---L---LF--FY-G--------------RD-----
LAMA_DROME/3083-3205----------F------------KT...T.QP----------NG---V---LF--YA-A--------------NH-----
LAMA_DROME/3379-3514----------F------------RT...E.RP----------NG---L---LI--YA-G--------------SK-----
LAMA_DROME/3563-3691----------F------------RP...R.DP----------NG---L---LF--SV-H--------------GK-----
Q19350_CAEEL/582-695----------F------------RT...T.VE----------NT---H---LA--SS-E--------------NI-----
Q19350_CAEEL/789-914----------M------------HS...G.KP----------DA---V---LF--YI-G--------------EK-----
EPI1_CAEEL/3101-3218----------F------------KTR.SI.RQ----------PS---S---LF--TV-N--------------DD-----
Q21442_CAEEL/537-680----------F------------RT...E.QE----------HG---I---PL--FF-G--------------NE-----
Q21442_CAEEL/1363-1488----------M------------RP...R.MK----------NG---I---LF--SV-G--------------V.-----
CADE_DROME/1153-1296----------I------------TP...Q.ID----------QG---L---IM--YL-G--------------PL-----
NRX1A_BOVIN/58-192----------L------------KT...R.SA----------RG---L---VL--YF-D--------------DE-----
GAS6_MOUSE/322-450----------F------------RT...F.DP----------EG---V---LF--FA-G--------------GR-----
GAS6_MOUSE/510-647----------I------------RP...A.TD----------TG---V---LL--AL-V--------------GD-----
LAMA3_MOUSE/2796-2903----------F------------QT...F.QP----------SG---T---LL--NH-Q--------------TR-----
LAMA3_MOUSE/3016-3136----------I------------QT...T.SS----------RG---L---VF--HT-G--------------TR-----
LAMA3_MOUSE/3186-3311----------I------------RP...R.SL----------TG---V---LI--HI-A--------------SQ-----
NRX2A_RAT/57-187----------L------------RT...N.AT----------RA---L---LL--YL-D--------------DG-----
NRX2B_RAT/119-268----------F------------ST...H.QR----------SA---V---LV--RV-D--------------SA-----
COBA2_MOUSE/90-213----------V------------RT...RPGL----------QA---P---LL--TL-Y--------------SA-----
Q7PPF9_ANOGA/2700-2843----------F------------RT...D.KP----------EG---F---VL--YL-G--------------NE-----
Q7PPF9_ANOGA/2902-3028----------F------------KAP.PE.TR----------DG---L---LF--YA-G--------------KN-----
Q7PPF9_ANOGA/3080-3203----------F------------RT...T.QS----------DG---V---LF--YT-T--------------TY-----
Q7PPU8_ANOGA/1604-1755----------F------------AT...V.RD----------SG---L---LL--YN-G--------------RY-----
Q7PPU8_ANOGA/1846-1967----------L------------RT...R.KR----------DS---F---VM--EI-Q--------------VG-----
Q7T024_DANRE/32-164----------F------------RTR.QT.SQ----------TA---T---LM--QV-N--------------AG-----
Q7T3H4_DANRE/314-442----------L------------RT...F.DP----------EG---V---IF--FA-G--------------GH-----
Q7T3H4_DANRE/493-622----------L------------RA...A.SS----------MG---V---LF--AL-V--------------RQ-----
Q7TSG9_MOUSE/211-328----------V------------RT...R.QP----------LG---L---LL--AL-E--------------NS-----
Q7TSG9_MOUSE/448-573----------F------------RT...H.DT----------NV---M---IL--HA-E--------------KE-----
Q7TSP8_MOUSE/32-159----------I------------SL...R.QP----------LT---V---LI--GL-Q--------------SF-----
Q7ZYG1_XENLA/102-225----------V------------KPK.K..ES----------QA---F---LL--SI-Y--------------NE-----
Q867A1_CANFA/1017-1137----------I------------QT...T.VD----------RG---L---LF--FA-E--------------NQ-----
Q867A1_CANFA/1188-1294----------F------------QT...F.QP----------SG---I---LF--NL-Q--------------SP-----
Q867A1_CANFA/1408-1528----------V------------QT...A.SS----------RG---L---VF--YT-G--------------TK-----
Q867A1_CANFA/1578-1703----------I------------RP...R.SL----------TG---I---LM--HV-G--------------SQ-----
Q86SD6_CIOIN/125-252----------I------------RR...RSDA----------DG---L---LL--YN-G--------------GQ-----
Q86SD6_CIOIN/321-465----------M------------RA...T.SP----------DG---L---VL--FH-G--------------ED-----
Q86YZ7_HUMAN/748-867----------F------------KT...T.AS----------SG---V---FL--EN-L--------------GI-----
Q8AW17_DANRE/66-189----------V------------KAK.A..GL----------QA---F---LL--SI-Y--------------NE-----
Q8C6X0_MOUSE/104-227----------I------------KPK.K..GT----------QA---F---LL--SL-Y--------------NE-----
Q8HYS4_PIG/109-232----------V------------KAK.K..GS----------QA---F---LV--SI-Y--------------NE-----
Q8IP51_DROME/2616-2755----------F------------RT...L.DE----------NA---L---LF--LA-V--------------DD-----
Q8IP51_DROME/2804-2944----------F------------RT...L.QP----------DC---L---LL--LA-A--------------YP-----
Q8IRV8_DROME/3806-3938----------V------------RPA.S..LE----------DS---V---IL--YT-A--------------ES-----
Q8MPN3_DROME/3548-3676----------F------------RP...E.NG----------DG---L---LL--FN-G--------------QT-----
Q8MPN3_DROME/4059-4188----------F------------TT...N.KP----------NG---L---LF--WW-G--------------QE-----
Q8MY74_9BILA/15-170----------F------------IT...E.EP----------NG---I---LM--YN-G--------------PM-----
Q8MY74_9BILA/264-390----------I------------RT...R.DQ----------EG---L---VW--HI-S--------------DE-----
Q8MY75_9BILA/1323-1478----------F------------LT...K.SR----------DG---I---IL--YN-G--------------PI-----
Q8MY76_9BIVA/532-689----------F------------IT...T.KA----------NG---L---IL--YS-G--------------PV-----
Q8MY77_BRABE/58-197----------F------------KA...C.NQ----------RG---L---LI--YQ-A--------------GQ-----
Q8MY77_BRABE/253-387----------F------------RT...K.AQ----------NG---L---LF--YF-G--------------G.-----
Q8MY78_ASTPE/2250-2404----------F------------IT...T.AA----------EG---V---LL--YN-G--------------PM-----
Q8MY78_ASTPE/2490-2615----------F------------RT...R.ED----------EG---L---LW--TI-T--------------NL-----
Q8SZX4_DROME/104-233----------F------------KT...V.EP----------NG---L---LV--FN-G--------------GR-----
Q8SZX4_DROME/327-452----------F------------IT...T.RP----------DA---V---LL--RV-E--------------SA-----
Q8UUM5_ORYLA/94-217----------V------------KAQ.A..GL----------QA---F---LL--SI-Y--------------SE-----
Q8WX98_HUMAN/215-344----------F------------KT...M.QS----------DG---I---LL--HR-E--------------GP-----
CNTP5_HUMAN/209-338----------F------------KS...M.QG----------DG---V---LF--HG-E--------------GQ-----
CNTP5_HUMAN/395-521----------F------------RT...W.NK----------DG---L---LL--ST-E--------------LS-----
CNTP5_HUMAN/1044-1173----------F------------VT...T.QA----------PS---L---LL--FI-N--------------SS-----
Q90WZ3_XENLA/1189-1317----------V------------AT...D.ED----------SG---I---LL--YK-G--------------DK-----
Q90Z43_CHICK/454-582----------V------------AT...D.KD----------NG---I---LL--YK-G--------------DN-----
Q90Z45_CHICK/604-732----------V------------ST...A.ED----------NG---I---LL--YN-G--------------D.-----
Q91VV0_MOUSE/1107-1232----------V------------RP...R.SS----------SG---T---LV--HG-H--------------SV-----
NRX4_DROME/824-943----------F------------RT...T.QE----------NS---V---IF--HA-T--------------GP-----
HMR1_CAEEL/2312-2461----------F------------MT...T.QS----------DA---L---LF--YN-G--------------PL-----
Q96MJ5_HUMAN/398-522----------F------------RT...W.NR----------AG---H---LL--FG-E--------------LR-----
Q54A24_HUMAN/398-524----------F------------RT...W.NK----------AG---L---LL--FS-E--------------LQ-----
NRX1A_CHICK/364-508----------F------------RT...T.EP----------NG---L---IL--FS-H--------------GK-----
NRX1A_CHICK/789-917----------F------------KT...T.SL----------DG---L---IL--YN-S--------------GD-----
Q9DE36_DANRE/1171-1299----------I------------AT...D.ED----------NG---V---LL--YK-G--------------DN-----
Q9DE37_DANRE/1179-1304----------V------------AT...D.KD----------NG---I---LL--YK-E--------------DH-----
CELR2_HUMAN/1395-1554----------F------------AT...K.ER----------DG---L---LL--YN-G--------------RF-----
Q9I907_PAGMA/107-230----------I------------KPK.A..GL----------QS---F---LL--SV-Y--------------NQ-----
Q9IBG4_XENLA/581-714----------F------------RT...T.LP----------DM---V---LM--YR-G--------------DE-----
Q9NGV2_DROME/429-557----------F------------RP...E.SF----------DG---I---IL--LS-G--------------ER-----
Q9NGV2_DROME/650-776----------L------------KP...E.QA----------DG---L---IL--YS-G--------------PE-----
Q9NGV2_DROME/1210-1340----------I------------KT...H.SE----------NG---V---IL--WT-G--------------RQ-----
Q9NGV4_DROME/611-727----------A------------RM...T.QQ----------RR---M---LL--QA-H--------------SS-----
Q9NSD0_HUMAN/488-621----------I------------RP...S.TG----------TG---V---ML--AL-V--------------SG-----
CELR1_HUMAN/1470-1629----------F------------AT...Q.ER----------NG---L---LL--YN-G--------------RF-----
CELR1_HUMAN/1719-1849----------F------------RT...R.KE----------DS---V---LM--EA-T--------------SG-----
NRX2A_HUMAN/521-666----------F------------RT...T.EP----------NG---L---LL--FS-Q--------------GR-----
NRX2A_HUMAN/760-890----------F------------MS...Q.RA----------YG---L---MM--AT-T--------------SR-----
CELR2_RAT/869-995----------F------------RT...R.QA----------DG---V---LL--QA-V--------------TR-----
CNTP2_HUMAN/216-345----------F------------KT...S.ES----------EG---V---IL--HG-E--------------GQ-----
CNTP2_HUMAN/401-529----------F------------RT...W.NP----------NG---L---LV--FS-H--------------FA-----
CNTP2_HUMAN/1055-1187----------F------------ST...T.KA----------PC---I---LL--YI-S--------------SF-----
NRX1A_HUMAN/1156-1275----------F------------ST...V.QK----------EA---V---LV--RV-D--------------SS-----
Q9VCZ9_DROME/132-266----------F------------KT...E.QP----------NG---L---VL--YT-D--------------DG-----
Q9VCZ9_DROME/386-520----------F------------RT...R.QP----------NG---L---LF--YT-G--------------HG-----
Q9VCZ9_DROME/582-719----------F------------RT...K.EP----------NG---I---IV--LA-T--------------GS-----
Q9VCZ9_DROME/814-942----------F------------KT...S.RP----------AG---L---LL--LT-S--------------AE-----
CADN2_DROME/1209-1370----------F------------IT...R.VA----------DG---L---IL--YN-G--------------PI-----
FAT2_DROME/3969-4096----------I------------RT...V.QQ----------TG---T---LL--YA-S--------------GK-----
Q9VZ96_DROME/275-414----------F------------RT...R.LP----------HG---L---LV--YH-N--------------VK-----
Q9VZ96_DROME/514-640----------F------------RT...N.FD----------DS---A---LF--YA-S--------------GE-----
Q9VZ96_DROME/698-817----------F------------RS...S.RP----------GA---V---LA--YS-D--------------VT-----
Q9VZ96_DROME/1351-1503----------L------------RT...Y.DT----------NA---L---VL--YA-N--------------DH-----
Q9XYX0_DROME/1108-1236----------F------------RT...T.GE----------KA---I---LL--FQ-P--------------PI-----
Q9XZC9_DROME/3030-3161----------F------------RS...F.YP----------NG---M---L.--YL-S--------------PG-----
Q9XZC9_DROME/3211-3342----------F------------RT...S.EL----------SG---I---LL--SV-S--------------DP-----
Q9ZBW1_STRCO/478-605----------F------------RYS.AA.DG----------EQ---P---LL--WM-G--------------GI-----

PF00457

XYN3_ASPKW/27-209AGIN------YVQNYNGNLGDFTYDES.A-GTFSMYWEDGVSSD---F---V------V--------------GL-----
XYNC_STRLI/59-238.DGM------YYSFWTDGGGSVSMTLNGG-GSYSTQWT..NCGN---F---V------A--------------GK-----
XYNA_BACCI/27-212ASTD------YWQNWTDGGGIVNAVNGSG-GNYSVNWS..NTGN---F---V------V--------------GK-----
XYN1_COCCA/38-218HNGC------FWSWWSDGGARATYTNGAG-GSYSVSWG..SGGN---L---V------G--------------GK-----
XYNA_CLOSA/68-254NGGY------DYELWKDYGNTSMTLKN.G-GAFSCQWS..NIGN---A---L------F--------------RK-----
XYNA_SCHCO/8-196DGGY------YYSWWTDGAGDATYQNNGG-GSYTLTWS.GNNGN---L---V------G--------------GK-----
XYN1_HYPJE/50-227ASIN------YDQNYQ.TGGQVSYSPS.N-TGFSVNWN..TQDD---F---V------V--------------GV-----
XYNA_BACPU/36-221HSGY------DYELWKDYGNTSMTLNN.G-GAFSAGWN..NIGN---A---L------F--------------RK-----
XYN2_HYPJE/40-221NNGY------FYSYWNDGHGGVTYTNGPG-GQFSVNWS..NSGN---F---V------G--------------GK-----
XYNA2_CLOSR/40-227HGGY------DYELWKDYGNTIMELND.G-GTFSCQWS..NIGN---A---L------F--------------RK-----
XYNB_STRLI/51-230NNGY------YYSFWTDSQGTVSMNMGSG-GQYSTSWR..NTGN---F---V------A--------------GK-----
XYNA_RUMFL/36-235VGGY------DYEMWNQNGQGQASMNPGA-GSFTCSWS..NIEN---F---L------A--------------RM-----

PF01670

GUNA_ASPKW/82-239---------------------------LT-FD.KKLVS--DVSS---I---P------T--------------SV-----
GUN_ASPAC/84-237---------------------------LT-FN.KKLVS--QISQ---I---P------T--------------TA-----
P96492_THENE/99-273---------------------------GT-EILPVKVK--DLPD---F---Y------V--------------TL-----
O53438_MYCTU/1-151---------------------------MG-TNLPTEVG--QILS---A---P------T--------------SI-----
O00095_HYPJE/81-234---------------------------IA-IPQKRTVN--SISS---M---P------T--------------TA-----
O08428_THENE/81-254---------------------------EG-TKLPLVVS--SVES---F---T------V--------------EL-----
GUNS_PECCC/107-264---------------------------EN-SGLPIQLS--SNKS---I---T------S--------------NV-----
Q60032_THEMT/81-254---------------------------EG-SKLPVPVS--SMKS---F---S------V--------------EV-----
O08468_STRHA/108-258---------------------------PG-TNLPAQVS--GIAS---A---P------S--------------SI-----
Q54331_STRLI/111-261---------------------------PG-TDLPVRLD--TVSA---A---P------S--------------SI-----
O13454_ASPOZ/82-239---------------------------VT-FD.KKLVS--DVQS---I---P------T--------------DV-----
O33897_RHOMR/106-260---------------------------PA-RAIRDCAA--RAGA---V---R------R--------------AH-----

PF00354

CRP_HUMAN/25-220---A------F---------V--FPKESD-TS---------------Y---V------S----------L---KAPLTKP
SAMP_HUMAN/26-219---V------F---------V--FPRESV-TD---------------H---V------N----------L---ITPLEKP
CRP1_LIMPO/33-237---K------V---------K--FPPSSS-PS---------------F---P------R----------L---VMVGTLP
SAMP_MOUSE/27-220---V------F---------V--FPRESE-TD---------------H---V------K----------L---IPHLEKP
SAMP_RAT/27-220---V------F---------V--FPRESE-TD---------------Y---V------K----------L---IPWLEKP
CRP_XENLA/23-219---V------F---------L--FPKPSV-TT---------------Y---A------I----------L---KPEVEKP
FP_CRIMI/26-219---V------F---------V--FPRESE-SD---------------Y---V------K----------L---IPRLEKP
CRP_MOUSE/26-221---A------F---------V--FPKESD-TS---------------Y---V------S----------L---EAESKKP
CRP_RABIT/26-221---A------F---------V--FPKESD-NS---------------Y---V------S----------L---NAQLKKP

PF13385

C6IP17_9BACE/143-331---S......Y--------.I..D....F-GR......--.SEE...Y...V------K..........F...G......
B5HK67_STRPR/813-980---A......A--------.R..F....D-GT......--.SAA...Y...A------D..........V...NE.....
B5HK67_STRPR/1039-1213---H......L--------.V..L....D-GD......--..GD...Y...A------S..........T...AT.....
B5HSG2_9ACTO/784-950---A......A--------.K..L....N-GA......--..SA...Y...L------A..........T...SG.....
B5HSG2_9ACTO/1024-1214---T......L--------.T..L....N-GT......--..SA...F...A------S..........A...AG.....
A2TQ55_9FLAO/511-667---A......F--------.A..Q....N-DF......--..TI...P...V------T..........D...DN.....
A4HQF1_LEIBR/417-575---A......A--------.F..H....F-TK......--..SV...S...V------S..........A...GR.....
A4HMI3_LEIBR/692-852---P......L--------.L..F....F-PG......--..DG...Y...V------S..........W...RL.....
C1E3W3_MICSR/499-682---A......V--------.R..F....D-GV......--..NA...G...V------I..........S..QGE.....
C1E3W3_MICSR/738-918---S......L--------.K..F....D-RN......--..EH...S...I------A..........T...TS.....
C1E3W3_MICSR/990-1183---S......I--------.S..F....D-GL......--..TA...Y...G------H..........V...PY.....
C1E3W3_MICSR/1513-1710---S......M--------.Y..F....D-GK......--..SV...Y..GV------D..........F...HP.....
C1E3W3_MICSR/1777-1953---A......A--------.L..F....S-GSI.....--MYTG...P...Y------T..........D...AL.....
C1E3W3_MICSR/2021-2219---A......L--------.Y..F....D-GV......--..ET...L...V------S..........V...PF.....
C1E3W3_MICSR/3428-3615---A......V--------.M..S....F-NG......--..YD...T...L------L..........A...TP.....
C1E3W3_MICSR/3717-3923---A......I--------.Y..F....N-GK......--..DT...Q...V------K..........F...NF.....
C1E3W3_MICSR/4016-4222---S......L--------.Y..F....N-GED.....--.SMG...V...V------E..........Y...HP.....
A9AX01_HERA2/1704-1859---A......A--------.S..F....D-GL......--..ND...Y...L------Q..........A....S.....
A9AX01_HERA2/2658-2820---A......A--------.Y..F....N-GS......--..GD...W...L------S..........C...TY.....
A9AX01_HERA2/2979-3139---N......M--------.T.......F-GG......--..SG...A...I------E..........VQ.SPT.....
A9AX01_HERA2/3459-3613---A......L--------.N..F....D-GN......--..ND...N...L------T..........I...AN.....
A9AX01_HERA2/3682-3839---A......L--------.S..F....D-GV......--..ND...G...L------S..........A...TI.....
A0L6L9_MAGSM/6878-7036---S......L--------.V..F....D-GT......--..DD...A...A------Y..........S...TV.....
A0L6L9_MAGSM/7692-7855---Q......V--------.L..S....F-DG......--..VD...D...V------A..........S...AA.....
A0L6L9_MAGSM/10293-10458---.......M--------.Q..F....S-TG......--.EAD...T...L------T..........V...TG.....
A0L6L9_MAGSM/10517-10674---T......V--------.A..L....N-GT......--..NQ...Y...Y------Q..........S...NV.....
A0L6L9_MAGSM/11010-11176---G......V--------.M..Q....F-DG......--..DD...Q...I------V..........A...EG.....
C1MTE9_MICPC/801-984---M......V--------.Y..F....D-GD......--..TQ...Y...L------V..........T...ARD....
C1MTE9_MICPC/2180-2367---S......L--------.Y..F....N-GV......--..DT...L...L------Y..........T...PRSA..T
C1MTE9_MICPC/2462-2670---S......M--------.Y..F....N-GL......--..DT...K...L------T..........V...NA.....
C1MTE9_MICPC/3450-3730---A......L--------.Y..F....N-GW......--..DT...D...V------Y..........G...PYD....
A3XS24_9VIBR/1516-1662---S......L--------.Q..L....T-DN......--..NG...Y...A------I..........T...NH.....
A3XS24_9VIBR/1814-1973---T......V--------.V..E....F-GAL.....--SASK...G...Y------A..........I...TS.....
D1YWM2_METPS/379-538---S......R--------.S..F....N-GA......--..TS...Y...I------Q..........C...HDS....
D1YWM2_METPS/634-793---A......Q--------.R..Y....F-NG......--..ST...Y...I------D..........S...NM.....
B9XBQ7_9BACT/87-254---A......A--------.G..Y....N-GA......--..ST...G...T------T..........V...PYS....
B9XBQ7_9BACT/333-511---D......Q--------.Q..S....D-DGG.....--.SPT...T...V------D..........Y...NP.....
B9XBQ7_9BACT/584-754---N......V--------.ARNF....D-GI......--..SS...Y...V------E..........L...SN.....
B9XBQ7_9BACT/907-1066---S......V--------.A..F....D-GS......--..SQ...Y...V------L..........I...GN.....
Q12UM1_METBU/206-367---G......I--------.R..F....H-DD......--..SD...V...V------R..........V...ENS....
Q12UM1_METBU/416-574---A......L--------.E..F....D-GS......--..ND...H...V------S..........V...DS.....
Q12UM1_METBU/630-797---A......L--------.S..L....D-DR......--..TE...Y...V------V..........V...ND.....
Q12UM1_METBU/1025-1180---G......L--------.D..F....D-GT......--..ND...H...V------F..........V...PN.....
Q1Q6Y8_9BACT/1609-1779---A......L--------.S..F....N-GT......--..SN...Y...V------S..........I...PP.....
A6FYU1_9DELT/4-164---S......L--------.Y..F....N-GS......--..GT...H...I------A..........L...GN.....
A6FYU1_9DELT/221-380---A......L--------.S..C....D-GS......--..ND...Y...V------D..........I...GS.....
A6FYU1_9DELT/656-816---A......L--------.R..F....D-GV......--..DD...Y...V------Q..........I...GN.....
A7BSN2_9GAMM/44-211---N......L--------.S..F....D-GM......--..DD...Y...V------D..........L...QTD....
A7BSN2_9GAMM/271-432---A......L--------.E..L....D-GS......--..GD...Y...I------T..........L...PD.....
A7BSN2_9GAMM/495-650---A......M--------.S..F....D-GV......--..DD...Y...V------A..........F...DD.....
B5JIQ7_9BACT/93-256---A......L--------.R..F....D-GT......--..GG...R...V------E..........L...DS.....
B5JIQ7_9BACT/1081-1243---A......L--------.K..F....D-GK......--..GG...Q...V------S..........L...GN.....
A0ZJ64_NODSP/167-349---A......C--------.L..N....F-NL......--.SNS...V...V------T..........L...ST.....
A0ZJ64_NODSP/406-564---R......V--------.M..Q....F-DG......--.FND...Y...V------E..........V...PY.....
Q112U0_TRIEI/317-477---C......L--------.S..F....D-GV......--..DD...Y...L------E..........L...PT.....
A9V7L7_MONBE/271-438---P......F--------.L..K....L-NG......--.NGE...H...V------R..........V...EP.....
A9V7L7_MONBE/494-654---A......M--------.Q..F....D-GT......--..DD...Y...V------T..........M...PA.....
A9V7L7_MONBE/712-870---A......L--------.N..F....V-GN......--..NS...Y...V------Q..........L...PP.....
B5H1J2_STRCL/805-972---A......L--------.S..L....D-GV......--..DD...H...A------F..........T...EL.....
B5H1J2_STRCL/1027-1193---A......L--------.R..L....D-GK......--..DD...Y...A------V..........T...TA.....
B5H1J2_STRCL/1247-1444---A......L--------.K..L....N-GS......--..DA...Y...A------M..........T...ST.....
B4CUW8_9BACT/507-671---A......L--------.T..F....D-GV......--..DD...Y...V------N..........V...GT.....
B4CUW8_9BACT/717-881---A......L--------.S..I....P-AA......--..AN...Y...A------D..........A...GT.....
B4CUW8_9BACT/925-1088---S......L--------.L..L....N-GS......--..GQ...R...A------N..........S...AA.....
C0A826_9BACT/82-235---P......V--------.L..R....P-SA......--..GK...P...V------Q..........L...TG.....
B4CU79_9BACT/530-695---S......L--------.N..F....D-GV......--..AS...Y...V------A..........V...PS.....
B4CU79_9BACT/743-907---S......L--------.N..L....D-GS......--..TG...F...A------T..........T...PS.....
B4CU79_9BACT/950-1117---E......S--------.M..T....L-DGID...S--GLDD...H...A------E..........V...SA.....
A5G5W5_GEOUR/2827-2981---A......M--------.AGSF....D-GA......--..ND...Y...I------K..........V...NN.....
A5G5W5_GEOUR/3120-3280---A......A--------.I..F....D-GS......--..ND...Y...V------S..........I...SD.....
B1C4U2_9FIRM/67-237---A......V--------.H..I....T-NSNGSTSA--KAEQ...Y...I------D..........F..GKN.....
B1C4U2_9FIRM/289-449---G......S--------.S..S....K-KA......--..SS...Y...I------N..........L...GD.....
B1C4U2_9FIRM/783-955---A......I--------.H..I....Q-NENGSTMQ--TAKQ...Y...I------N..........F...GQP...D
B8FIJ2_DESAA/1831-1990---.......G--------.L..D....T-GG......--..GG...Y...I------L..........A...PY.....
B8FIJ2_DESAA/2134-2295---S......M--------.Y..L....D-GS......--..GD...Y...L------T..........V..LSD.....
B8FIJ2_DESAA/3096-3258---G......L--------.Y..V....D-GS......--..YD...Y...L------Q..........I...PS.....
A4CID0_ROBBH/179-344---.......A--------.Y..S....G-AE......--..DS...Y...L------T..........F...PM.....
A4CID0_ROBBH/610-790---D......A--------.Y..A....G-AA......--..DS...Y...L------T..........V...PA.....
E8W159_STRFA/1054-1222---A......A--------.S..F....D-GR......--..DS...V...V------E..........L...PD.....
E8W159_STRFA/1335-1504---A......A--------.T..F....D-GS......--.ADS...Y...V------Q..........L...PN.....
Q2CEY6_9RHOB/408-563---A......L--------.L..T....R-SG......--..HS...A...A------V..........V...PA.....
Q2CEY6_9RHOB/1555-1715---A......A--------.L..A....T-TG......--..FE...E...I------V..........V...DD.....
A3TZ88_9RHOB/431-586---S......A--------.N..F....L-NG......--..GA...T...V------Q..........V...AN.....
A3TZ88_9RHOB/1595-1756---T......A--------.L..G....H-TG......--..FE...R...I------R..........V...EN.....
A3TZ88_9RHOB/2040-2208---G......A--------.I..D....L-RG......--..AE...Y...L------E..........I...AG.....
B9XIT2_9BACT/377-534---H......V--------.L..N....L-NG......--.TNQ...Y...V------W..........L...PP.....
B9XIT2_9BACT/676-834---Q......V--------.L..N....L-SG......--..AN........------Q..........F...AT.....
B9XIT2_9BACT/980-1139---S......V--------.L..N....L-TG......--.GNQ...Y...M------N..........L...PA.....
B1WQC8_CYAA5/524-689---G......V--------.S..F....D-GK......--..QD...Y...I------A..........I...PS.....
B1WQC8_CYAA5/1267-1430---.......C--------.I..A....L-EQ......--..SD...S...V------I..........L..LKD.....
B1WQC8_CYAA5/1487-1639---R......V--------.M..Q....F-NG......--.VNT...Y...I------E..........I...SH.....
A9V0U4_MONBE/359-524---P......A--------.L..S....L-RG......--.SDQ...H...L------R..........A...PP.....
A9V0U4_MONBE/585-745---S......L--------.Y..L....D-GD......--..ND...Y...V------L..........A...PP.....
A9V0U4_MONBE/804-963---A......L--------.A..L....V-GN......--..GS...W...V------Q..........L...PA.....
A9VEK3_MONBE/38-204---Y......A--------.L..A....L-DAG.....--.TTS...H...V------T..........L...PC.....
B3PKP2_CELJU/660-825---A......F--------.Q..F....N-GN......--...N...G...V------R..........L...PD.....
B3PKP2_CELJU/969-1129---A......L--------.S.......L-DG......--..TS...G...V------R..........L...PD.....
A1ZIY6_9BACT/389-541---A......L--------.M..F....D-AN......--..TP...A...I------E..........V...DN.....
A1ZIY6_9BACT/741-910---S......L--------.R..F....D-GK......--..TA...Y...A------Q..........S...EG.....
A1ZIY6_9BACT/1920-2067---A......A--------.R..F....T-EA......--..TD...Q...I------Q..........I...PD.....
B6ES74_ALISL/190-345---A......L--------.L..D....V-SD......--..ND...G...Y------A..........I...SG.....
B6ES74_ALISL/500-655---G......L--------.L..D....V-SD......--..ND...G...Y------A..........I...SG.....
B9XR24_9BACT/99-270---D......T--------.N..S....D-DG......--..GV...P...V------I..........I...PY.....
B9XR24_9BACT/347-521---A......E--------.F..F....D-GT......--..SD...Y...V------E..........LLNPPG.....
B4DB48_9BACT/865-1021---A......L--------.Y..L....N-GT......--..DA...Y...L------T..........T...PA.....
C7DG96_9EURY/379-534---V......A--------.T..F....N-GV......--..DS...Q...V------L..........I...PP.....
C7DG96_9EURY/587-759---P......L--------.I..S....I-GE......--..GA...Y...S------TKVASFNPGGAT..........
D2BE74_STRRD/717-881---G......L--------.R..L....D-GA......--..GG...H...A------R..........T...TG.....
D2BE74_STRRD/929-1096---A......L--------.A..L....D-GT......--..GG...Y...A------Q..........A...AA.....
Q0HV90_SHESR/643-815---A......L--------.S.......L-DG......--..AH...G...V------L..........L...PS.....
Q0HV90_SHESR/959-1113---A......A--------.V..F....D-GA......--..SG.......I------V..........L...PN.....
A7BQ37_9GAMM/824-993---A......A--------.L..F....D-GD......--..GD...Y...I------L..........V...AD.....
A7BQ37_9GAMM/1055-1222---A......A--------.H..F....D-GV......--..DN...T...I------E..........I...PDS...S
D2PTT7_KRIFD/1087-1258---A......V--------.E..L....P-GGS.....--.NTN...A...V------D..........L...PD.....
D2PTT7_KRIFD/1411-1585---A......V--------.S..L....P-GGAA....--GTGN...Q...V------R..........L...PD.....
C3YCM4_BRAFL/394-559---G......C--------.A..Q....F-GG......--..AG...R...L------V..........A...NG.....
C7DG99_9EURY/172-333---A......A--------.T..F....N-GI......--..SS...Y...I------N..........V...SN.....
C7DG99_9EURY/507-676---N......V--------.Q.......D-SNV.....--.YDG...F...V------T..........I...NTTN..R
C7DG99_9EURY/724-893---.......V--------.F..N....F-TS......--..ND...T...V------K..........V...PY.....
A9VE19_MONBE/314-480---A......L--------.Y..L....D-GV......--..ND...Y...V------I..........A...PS.....
A9VE19_MONBE/539-692---A......L--------.L..L....P-GN......--..GS...W...V------Q..........L...PA.....
D2PTR0_KRIFD/509-676---A......L--------.W..F....N-GT......--.RTA...A...V------T..........T...SK.....
D2PTR0_KRIFD/724-887---G......I--------.R..F....D-GS......--..GG...T...V------S..........T...TD.....
C9Z507_STRSW/85-252---G......L--------.S..F....N-GS......--..DT...Y...I------K..........V...PN.....
C9Z507_STRSW/880-1051---S......F--------.K..M....S-GGNS...G--SSSP...Y...V------K..........I...PN.....
B9XSE8_9BACT/106-287---T......A--------.A..S....F-GSLS...P--TDSA...M...I------E..........T...DN.....
B9XSE8_9BACT/544-758---S......S--------.V........-DN......--..YL...G...V------S..........I...TN.....
Q8AAU9_BACTN/556-751---N......Y--------.L..M....L-PQ......--..DA........------...........L...S......
B4DBW7_9BACT/343-518---A......L--------.Q..L....N-GV......--..DA...A...A------N..........V...PDS...S
B4DBW7_9BACT/723-901---A......G--------.L..N....V-NG......--..SA...Y...S------DQVGL..EIDHT...TN.....
A1ZNX8_9BACT/30-185---G......V--------.L..H....L-HK......--..NK...Y...A------S..........H...AN.....
A1ZNX8_9BACT/1936-2081---S......V--------.K..L....D-NV......--..AD...Y...L------Q..........V...PD.....
Q3A7I8_PELCD/248-409---G......V--------.V.......L-DG......--..SG...Y...L------M..........V...PD.....
Q3A7I8_PELCD/466-622---S......A--------.T..L....D-EY......--..TD...A...F------T..........L...N......
C6WQK6_ACTMD/751-914---A......L--------.K..L....N-GT......--..NA...S...A------Q..........S...TT.....
C6WQK6_ACTMD/960-1138---ASSQRKWL--------.S..Y....D-NT......--.STG...R...A------T..........G...PR.....
A1ZVW7_9BACT/1977-2130---S......A--------.L..F....D-QV......--..AD...Q...I------T..........I...PD.....
C0BUU7_9BIFI/1272-1447---K......A--------.A..R....L-GS......--..GS...W...L------S..........V...TQ.....
Q21FF7_SACD2/693-861---A......V--------.S.......L-NG......--..SN...G...V------R..........L...PN.....
Q21FF7_SACD2/1008-1165---A......I--------.E..F....L-GD......--.AGP...G...A------K..........L...PD.....
D4J0Z2_BUTFI/85-242---S......L--------....K....L-DG......--..SY...G...L------K..........L...NQ.....
D4J0Z2_BUTFI/302-464---A......L--------.L..T....D-GY......--.......G...L------D..........L...GN.....
F1TD97_9CLOT/74-242---A......V--------.A..L....D-GS......--..SG...Y...I------K..........L...PN.....
F1TD97_9CLOT/798-960---Q......V--------.L..Y....L-DGT.....--.TGT...F...A------A..........F...PQ.....
A8T2S4_9VIBR/246-407---A......V--------.V........-SG......--..EH...V...L------D..........V...TD.....
B0SG40_LEPBA/1149-1299---A......S--------.L..S....I-GN......--..AG...S...A------P..........S...PS.....
B0SG40_LEPBA/1360-1526---A......V--------.R..I....V-AG......--..SG...D...Y------L..........L...GS.....
B9XQM3_9BACT/1183-1350---A......L--------.S..F....N-GT......--..NA...Y...V------Y..........V...PT.....
B9XQM3_9BACT/1611-1774---G......L--------.E..L....D-GT......--...E...C...A------I..........V...TN.....
B9XKM7_9BACT/82-250---S.....IA--------.L..S....V-AQ......--..PS...S...V------T..........A...GY.....
B9XKM7_9BACT/504-693---V......A--------.V..G....I-TG......--..GA...T...V------N..........I...PYA....
C2GWB7_BIFLN/98-274---T......A--------.A..Q....L-GS......--..GF...W...L------N..........V...TK.....
C2GWB7_BIFLN/783-943---K......V--------.L..K....L-DGS.....--.DGT...Y...A------E..........F...PK.....
A9VAU4_MONBE/230-399---G......V--------.S..F....I-EP......--..YD...Q...I------Q..........L...PA.....
A9VAU4_MONBE/459-623---S......Y--------.L..G....F-DG......--..ND...R...V------K..........L...EP.....
B5I5M1_9ACTO/756-922---G......L--------.K..T....N-GT......--..SS...Y...A------A..........T...SG.....
B5I5M1_9ACTO/980-1161---N......V--------.L..E....L-NEA.....--VLGR...A...T------S..........A...VA.....
B0SER7_LEPBA/623-775---A......Y--------.E..F....N-GL......--..SD...S...I------N..........S...SG.....
B0SER7_LEPBA/822-978---A......Y--------.S..F....N-GT......--..NS...Y...F------Q.........KL...NPN....
Q7UF08_RHOBA/1547-1724---S......V--------.Q..F....S-GT......--..GQ...V...M------R..........L..ATS.....
A1ZI15_9BACT/2043-2196---S......A--------.W..F....D-QV......--..AD...Q...V------T..........V...PD.....
B9XRA5_9BACT/68-245---C......F--------.Q..F....N-GS......--..SQ...Y...L------N..........V...TH.....
B9XRA5_9BACT/395-559---G......L--------.S..F....D-GS......--..SQ...Y..GA------E..........T...TGT...P
Q025I9_SOLUE/268-426---A.......--------....G....G-SG......--..SQ...W...V------N..........L...GT.....
Q025I9_SOLUE/611-778---A......G--------.F..A....S-GS......--..AQ...Y...L------D..........F...GS.....
D4J0Z1_BUTFI/161-331---Q......A--------.L..S....L-NG......--.SNQ...Y...L------K..........V...TT.....
D4J0Z1_BUTFI/1079-1248---K......V--------.L..Y....L-SGDDS.VG--GNNS...Y...L------E..........F...PK.....
C5A5H2_THEGJ/288-448---A......F--------.E..F.....-DG......--..GS...Y...V------R..........I...TP.....
D0LH97_HALO1/139-304---G......L--------.H..L....D-AV......--.EGH...H...V------K..........I...AD.....
D0LH97_HALO1/418-584---G......V--------.E..I....S-GG......--..EA...P...N------K..........I...SE.....
B5S513_RALSL/599-761---A......V--------.S.......L-SG......--..GA...Y...V------A..........L...PA.....
B6FL10_9CLOT/94-268---A......L--------.S..L....N-GT......--..GQ...F...L------D..........V...KK.....
B6FL10_9CLOT/1094-1263---Q......V--------.L..Y....L-DGDKT.DG--GHDS...Y...L------E..........F...PE.....
B9XNF4_9BACT/100-267---N.....YM--------.V..L....V-NG......--.IGG...A...L------I..........P...PP.....
B9XNF4_9BACT/337-542---.......L--------.V..L....P-GGAQ....--NTTA...Y...A------D..........F...PN.....
B9XNF4_9BACT/1418-1587---P......A--------PT..F....D-GL......--..ST...D...I------L..........V...PA.....
B1Z442_BURA4/571-733---A......V--------.S..L....D-GS......--..TG...Y...V------A..........L...PN.....
C4RHZ8_9ACTO/993-1154---T.....GL--------.L..V....N-GS......--..PG...S...A------D..........T...AA.....
Q3ZYD7_DEHSC/121-281---A......L--------.S..F....N-GE......--..DN...W...V------T..........V...AQ.....
D1JG45_9ARCH/87-239---A......L--------.N..F....D-GVD.....--FVSA...P...V------N..........I...NP.....
B7B809_9PORP/808-979---S......L--------.S..F....N-GK......--..DA...I...A------V..........V...NSS....
D2S7A7_GEOOG/124-331---R......A--------.V..H....F-PE......--..SA...Y...A------A..........A...DG.....
D2S7A7_GEOOG/404-567---A......V--------.R..L....R-GV......--...N...D...I------S..........T...GA.....
B4DBW6_9BACT/675-838---P......V--------.L..R....F-DG......--.SSS...Y...L------S..........I...PS.....
B4DBW6_9BACT/1004-1165---P......V--------.V..R....F-DG......--.TSS...Y...L------K..........I...PT.....
C7Q3C0_CATAD/677-839---A......V--------.H..L....D-GA......--..SG...Y...V------A..........L...PS.....
D7B4B0_NOCDD/985-1152---V......S--------.L..N....P-AV......--..PE...R...I------T..........T...EG.....
E8WC63_STRFA/486-660---A......A--------.S..F....N-GS......--..TA...F...L------K..........G...RT.....
E8WC63_STRFA/714-888---S......A--------.S..F....N-GS......--..TG...M...L------K..........S...KQ.....
D1W043_9BACT/612-763---D......V--------.Q..R....F-TS......--..SG...G...F------V..........V...PN.....
D1W043_9BACT/1088-1239---N......F--------.S..I....V-GN......--..KS...Y...K------T..........M...TTG....
A9ECQ9_9FLAO/180-355---A......Y--------....A....G-AS......--..DS...Y...L------T..........F...PT.....
E6U4D5_ETHHY/571-732---T......V--------.L..S....L-DG......--..SS...Y...L------N..........Y...DV.....
E6U4D5_ETHHY/791-955---V......A--------.S..F....D-GQ......--..TA...A...Y------R..........Y...PS.....
D3EBL1_GEOS4/639-797---G......M--------.D..F....N-GS......--..DG...Y...I------E..........L...PN.....
A3KK79_STRAM/307-464---V......A--------.L..D....G-RG......--..NS...Y...L------T..........P...DV.....
A3KK79_STRAM/529-696---H......L--------.A..L....D-GA......--..DD...Y...A------A..........T...DG.....
D1JA15_9ARCH/516-672---A......L--------.S..F....D-GK......--..DD...W...V------K..........V...DS.....
C7BV05_9CAUD/528-695---Y......W--------.E..F....D-GV......--..DD...R...I------V..........I...SR.....
C7BV05_9CAUD/979-1149---G......Y--------.M..V....F-GS......--..NE...T...I------R..........F...GS.....
Q8CJN7_STRCO/818-1003---S......L--------.W..L....N-DGSDT..T--QRAG...Y...A------A..........T..SAP.....
Q8CJN7_STRCO/1057-1254---A......L--------.V..L....D-GS......--..AG...Y...A------S..........A...TG.....
D2MHJ3_9BACT/38-196---A......M--------.V..F....D-GA......--..SS...L...I------E..........V...PHN....
A6DI80_9BACT/69-224---A......N--------.M..K....E-GV......--..RG...Y...I------R..........T...QG.....
A6DI80_9BACT/409-566---A......I--------.R..P.....-EKR.....--.KSG...V...I------D..........F...GS.....
B9JMF4_AGRRK/589-752---A......V--------.S..L...IS-SN......--..SA...Y...V------S..........L...PE.....
C6D6G1_PAESJ/689-843---A......A--------.V..F....D-GN......--..SG.......V------R..........L...PN.....
B3G4E3_ADIVA/133-304---A......L--------.S..F....S-ST......--..ST...Y...L------R..........S...YD.....
A6DIA2_9BACT/77-247---A......L--------.D..F....S-NV......--..GS...S...I------MT........QI..........
A6DIA2_9BACT/485-652---S......W--------.D..F....N-NT......--..KS...S...V------K..........V...HN.....
C6IZP4_9BACL/694-846---A......A--------.E..F....D-GT......--..SG.......I------R..........L...DD.....
D2MH98_9BACT/68-223---A......L--------.E..F....D-GV......--..DD...H...V------I..........V...AD.....
Q2S986_HAHCH/529-688---C......A--------.YAEF....N-GS......--..SQ...Y...I------E..........I...AD.....
A5IKD5_THEP1/72-243---.......A--------.L..K....L-PG......--..SR...G...L------L..........L...PE.....
A5IKD8_THEP1/84-252---A......V--------.Y.......L-DG......--..TK...G...I------Q..........L...PD.....
A5IKD9_THEP1/70-241---A......L--------.V..F....D-GK......--..KG.......V------V..........L...GD.....
B8E3D5_DICTD/75-246---A......V--------.Y..L....D-GA......--...S...G...I------Q..........L...PD.....
Q9RGC0_9PSED/58-241---A......L--------.L..F....D-GY......--..ST...W...I------K..........R...SA.....
D3Q5W9_STANL/397-559---H......L--------.K..L....D-GE......--..TG...F...A------H..........T...GD.....
B8E3D6_DICTD/88-243---A......L--------.V..L....D-GN......--..SG.......V------L..........L...YE.....
B4WFU8_9SYNE/1165-1322---N......V--------.I..E....L-DGDG...D--QLSR...T...L------A..........L...NG.....
D2S068_HALTV/1213-1371---A......V--------.A..L....D-GE......--..SQ...H...V------N..........A...GND...A
C7R5J8_JONDD/642-797---A......L--------.T.......L-DG......--..TN...G...V------R..........L...PD.....
B9XF62_9BACT/754-913---P......V--------.V..R....F-GVG.....--.ATN...F...M------Q..........V...AS.....
B9XF62_9BACT/1163-1328---A......V--------.N..F....N-GT......--..NQ...Y...L------A..........V...NP.....
C0BFQ3_9BACT/663-844---G......I--------.V..H....N-PG......--..YS...W...E------L..........L...NG.....
C0BFQ3_9BACT/1593-1762---S......A--------.Y..Q....F-NG......--..ST...V...L------Y..........F...GN.....
Q82GV4_STRAW/288-440---.......A--------.H..L....D-GG......--..DQ...A...F------L..........T...PDA....
Q82GV4_STRAW/507-677---H......L--------.Q..L....D-GE......--..TG...Y...A------A..........T...EQ.....
B9XQP8_9BACT/1436-1601---Q......A--------.V..Q....L-DG......--.STG...Y...V------Q..........I...PV.....
D2RI28_ARCPA/200-357---G......L--------.E..F....D-GE......--..DD...Y...V------E..........I...PN.....
Q82NZ6_STRAW/688-850---A......V--------.S..L....D-GA......--..DG...H...V------A..........L...AD.....
B0RBH3_CLAMS/131-296---S......Y--------.L..L....D-GS......--..SS...Q...V------T..........N...GL.....
B4CYT0_9BACT/1004-1165---A......V--------.S..L....N-GT......--.STS...Y...V------S..........Y...PN.....
A5IKD7_THEP1/80-241---A......A--------.V..F....D-GT......--..SG.......V------V..........L...PD.....
A7RFD3_NEMVE/587-745---K......R--------....F....L-GN......--.PKS...Y...I------I..........F...PRT....
A7RFD3_NEMVE/814-978---S......F--------.V..F....Y-GRG.....--NSYG...Y...I------P..........T...SR.....
B4D2H5_9BACT/770-926---A......I--------.V..L....D-GV......--..HD...Y...L------T..........L...PV.....
A7BLG4_9GAMM/11-182---A......Y--------.Q..F....D-GK......--..DD...Y...I------Q..........V..AHN.....
D1YWT9_METPS/74-233---E......R--------.E..F....D-GY......--..ND...H...I------K..........C...NN.....
B4D5C1_9BACT/847-1006---A......L--------.D..F....N-GT......--..SS...T...A------SA........SL...GG.....
A7NM90_ROSCS/2533-2667---G.......--------.L..N....L-SS......--..SH...T...L------T..........M...TD.....
C3YC48_BRAFL/3070-3244---A......I--------.S..L....D-GQ......--..AQ...Y...L------NAGQF..PGECL...GS.....
B9XCZ6_9BACT/452-613---A......A--------.K..F....D-GL......--..AG...Y...V------G..........L...QTG....
B1VPR2_STRGG/841-1008---K......G--------.L..S....L-AN......--..SA...Y...G------S..........T...PG.....
A6FZW9_9DELT/150-306---A......L--------.H..C....N-ESK.....--.AVH...A...L------D..........S...PS.....
Q9KBP7_BACHD/618-775---A......A--------.V..F....D-GT......--..TG.......I------R..........L...PN.....
A6DIA3_9BACT/77-235---A......H--------.L..P....R-GV......--..RG...T...I------S..........T...KK.....
A6DIA3_9BACT/430-581---A......I--------.K..I....L-NG......--.......P...L------S..........L...GQ.....
A5GAT0_GEOUR/77-245---A......Y--------.F..F....D-GSY.....--NAFD...F...I------T..........V...PD.....
C7NU53_HALUD/819-971---A......L--------.E..F....T-RE......--.NDS...Q....------...........V...RA.....
C7R5J7_JONDD/543-698---.......A--------.I..Q....L-NG......--..SN...G...V------V..........L...PQ.....
A5FKP6_FLAJ1/643-806---A......Y--------.S..F....N-GA......--..GS...Y...I------D..........A...PI.....
C5C072_BEUC1/597-756---S......R--------.F..T....G-ST......--..NS...Y...G------S..........T...TA.....
B1VKK7_STRGG/739-905---S......A--------.L..K....F-NG......--.TTG...Y...A------Q..........S...SG.....
Q9F0I5_PAEMA/447-622---A......L--------.L..F....D-GS......--..SN...Y...I------E..........V...NA.....
D0LXW7_HALO1/117-278---A......A--------.S.......F-SG......--..DA...V...L------A..........I...DD.....
A9WA06_CHLAA/1556-1710---T......G--------.V..R....F-DG......--..ND...Y...L------S..........A...GT.....
A9WA06_CHLAA/2510-2646---.......G--------.I..I....L-NA......--..TQ...T...L------S..........I...TD.....
B4WNI1_9SYNE/1038-1201---A......V--------.V..L....D-GN......--..GD...Y...L------F..........R....D.....
B4WNI1_9SYNE/1270-1438---L......T--------.L..N....D-PTL.....--.IST...D...A------S..........P...TK.....
Q1Z1R8_PHOPR/409-572---Y......G--------.T..F....N-GQ......--..NQ...F...A------E..........I..AHN.....
D2QKT6_SPILD/62-225---S......A--------.Y..F....F-NR......--..NA...Y...I------N..........L...PA.....
B9XJN0_9BACT/964-1136---A......F--------.V..F....N-GT......--..DA...D...V------K..........I...PA.....
D3F0R0_CONWI/81-255---.......Y--------.L..S....S-AN......--..TT...P...L------Q..........V...TS.....
Q1IAN3_PSEE4/1352-1533---R......L--------.L.......A-SN......--..YG...K...V------S..........D...GD.....
D2KW09_9BACL/548-698---G......V--------.S..F....D-GS......--..SG...Y...I------N..........L...GG.....
Q64ZH3_BACFR/87-258---G......A--------.A..R....L-SN......--..KG...H...F------K..........L...PD.....
B9XRK5_9BACT/771-923---A......F--------.S..F....N-GT......--..NA...F...I------Q..........I...PH.....
D2RHY5_ARCPA/85-250---C......L--------.E..F....T-DY......--..TQ...Y...V------Y..........I...NN.....
Q09BW4_STIAD/232-387---A......L--------.R..F....D-GN......--..GD...F...A------E..........T...AG.....
A9UYJ6_MONBE/339-527---L......L--------.P..A....L-SE......--..SG...W...V------L..........H...AI.....
A9UYJ6_MONBE/605-770---S......A--------.M..R...IN-AA......--..AR...A...L------K..........F...PF.....
C5BR34_TERTT/279-438---C......R--------.YGAF....D-GN......--.TDG...Y...V------Q..........I...NDPG..N
A7BSA6_9GAMM/93-264---A......L--------.S..F....D-GI......--..DD...Y...V------S..........I...PDN...A
C9P2T6_VIBME/335-497---G......V--------.F..I....G-NQ......--..NQ...Y...V------E..........I...PH.....
B9XPI1_9BACT/67-230---A......F--------.L..I....D-GE......--..TG...K...I------I..........V...PD.....
B9XNV5_9BACT/85-245---A......A--------.S..F....D-GA......--..SG...I...V------A..........V...PY.....
B0BI81_9BACT/117-283---A......A--------.Q..F....D-GS......--..GE...A...V------E..........V...TD.....
B9L5Y9_NAUPA/341-510---D......G--------.Y.......F-NG......--..SD...Y...V------D..........M...GD.....
B9L5Y9_NAUPA/584-760---D......I--------.N..S....T-ST......--.EDK...A...V------M..........L..ENN.....
D2MKT6_9BACT/66-219---A......L--------.E.......F-EP......--..PE...V...V------A..........V...DA.....
B5JIL5_9BACT/1259-1418---V......V--------.E..L....D-GV......--..ND...H...I------L..........L...SQ.....
B8GR77_THISH/225-391---CR....YG--------.V..F....D-GS......--..SA...Y...V------E..........V...PG.....
B9XJI0_9BACT/873-1042---N......V--------.L..R....F-SSA.....--.NNQ...F...L------S..........V...TSG....
B9XJI0_9BACT/1110-1278---T......V--------.R..F....N-SA......--.ANQ...Y...L------T..........V...SA.....
B9XB13_9BACT/1144-1312---A......F--------.N..F....D-GK......--..TN...M...V------S..........V...GI.....
D2QKF2_SPILD/352-526---A......I--------.L..L....D-GS......--..GD...Y...F------Y..........M..DDN.....
Q26HK5_FLABB/23-183---A......L--------.N..F....D-GV......--..DD...G...V------Q..........T..SFP.....
A6CAJ5_9PLAN/479-645---G......F--------.Q..F....A-P.......--..GS...Y...L------D..........L...GK.....
B5M9N9_STRLS/927-1086---A......V--------.Q..L....D-GS......--..TG...Y...V------D..........A...GAP....
D2RF32_ARCPA/203-366---A......L--------.S..F.....-DD......--..GE...Y...V------E..........V...PN.....
A6DLA7_9BACT/349-518---A......L--------.H..L....S-GAN.....--.HKG...F...L------Y..........V...PD.....
E6U4E1_ETHHY/86-250---N......V--------.I..A....F-DG......--..SS...Y...L------N..........Y...AF.....
E6U4E1_ETHHY/784-946---K......V--------.L..A....L-NGQ.....--YGAE...N...Y------S..........L...SD.....
C9Q244_9VIBR/239-399---G......V--------.F..N....Q-SQ......--..AQ...Y...V------N..........I...PN.....
A3KHU1_STRAM/255-431---A......L--------.L..F....D-GY......--..ST...W...V------T..........R...AAA....
B4WP60_9SYNE/551-730---A......I--------.A..F....D-GK......--..GD...S...V------K..........L...EN.....
A6DSI2_9BACT/432-601---A......L--------.R..L....A-GVN.....--.HKS...F...I------H..........V...SN.....
B2J7Y5_NOSP7/1077-1239---A......L--------.A..F....N-GQ......--..SD...Y...V------K..........L...NN.....
C7MFU6_BRAFD/81-246---G......A--------.L..Q....L-SG......--...G...H...V------E..........L...PG.....
E6W633_DESIS/612-776---A......V--------.Y..L....D-GG......--.......Y...I------T..........L...PHEY..N
D2QME8_SPILD/62-232---A......Y--------.R..F....A-DG......--..NK...I...I------V..........A...NN.....
A6C871_9PLAN/174-361---A......A--------.A..F....Q-PG......--..KG...F...L------R..........VV.DP......
B5JKS9_9BACT/735-891---S......L--------.Y..F....N-GV......--..NN...S...A------S..........L...PA.....
D1N8J1_9BACT/65-221---G......A--------.L..E....V-GS......--..GG...G...V------E..........V...RH.....
B1BNK4_CLOPF/78-238---G......L--------.K..L....T-GQ......--.KGT...F...L------S..........I...PS.....
A3ZT42_9PLAN/352-527---H......F--------.N..P....S-KQ......--..SR...Y...L------K..........L...DEP....
A6C3W6_9PLAN/343-518---S......A--------.T..S....F-SD......--..SN...Y...L------E..........V...PH.....
C9YSY4_STRSW/83-255---R......A--------.L..S....L-PGGAP..T--SDGA...Y...V------R..........L...PR.....
A7VXP7_9CLOT/1543-1697---A......A--------.R..F....T-GDI.....--.KGG...Y...I------E..........F...DS.....
A7C3F7_9GAMM/76-243---A......Y--------.A..L....D-GE......--..KS...Y...I------V..........A...P......
B1C336_9FIRM/592-740---.......A--------.L..D....F-NR......--..KG...Y...V------D..........L...EL.....
Q11V34_CYTH3/470-632---P......A--------.L..Q....F-SG......--..TT...Y...A------Q..........V...PNS...P
A3ZSH6_9PLAN/365-543---S......L--------.Y..L....G-.GP.....--GTGA...Y...A------K..........V...PN.....
A8ABA7_IGNH4/303-476---A......A--------.W..F....D-G.......--..ST...A...L------A..........S...ED.....
C6WL54_ACTMD/900-1058---A......L--------.S..F....T-GS......--..NQ...Y...A------Q..........T...RT.....
C9ZAH4_STRSW/168-331---A......H--------.E..N...VR-GS......--..HQ...Y...V------D..........L...PN.....
C0BH93_9BACT/71-260---Y......F--------.E..F....D-GN......--..ND...F...G------A..........I...QG.....
C0BH93_9BACT/774-924---.......F--------.N..Y....N-GQ......--..YS...Y...S------N..........S....N.....
D3FFH5_CONWI/94-255---H......A--------.I..D....L-DGLLS..K--PLGQ...F...V------H..........V...PDN...G
C4REW1_9ACTO/454-621---S......L--------.A..L....G-GT......--..NG...H...V------A..........L...PD.....
Q5E1F1_VIBF1/333-497---G......D--------.F..K....K-SQ......--..TQ...Y...I------E..........V...PH.....
B8FFM0_DESAA/606-772---S......V--------.S..F....K-GN......--.DGS...Y...A------S..........V...PN.....
C2GWB5_BIFLN/83-253---D......A--------.L..T....L-SGGAK..T--GTGD...W...V------K..........L...PS.....
C6W5Q6_DYAFD/67-233---A......Y--------.Q..F....D-GI......--..DD...V...I------E..........I...SP.....
Q4BVA3_CROWT/438-594---S......V--------.L..N....F-DG......--.QDD...Y...I------E..........I...QE.....
C6WP14_ACTMD/1437-1597---S......V--------.D..F....H-GG......--..QA...Q...V------A..........P...AP.....
A9DV23_9FLAO/71-238---A......Y--------.A..F....D-GV......--..ND...H...I------R..........I...PA.....
B1BZX6_9FIRM/439-587---.......A--------.L..D....F-NG......--..SG...Y...V------D..........L...NI.....
D3F200_CONWI/284-437---R......A--------.V..R....L-DG......--..AG...H...V------S..........F...ADR...P
A9AVE2_HERA2/51-206---C......A--------.C.......F-DG......--..QS...W...V------E..........L...AN.....
B4WP62_9SYNE/1025-1201---A......A--------.G..F....N-GK......--..DA...M...V------R..........L...KN.....
B9XFJ5_9BACT/1123-1293---T......A--------.V..K....F-GPA.....--.INS...Y...V------G..........G...IP.....
A5US22_ROSS1/40-194---.......T--------.L..Y....L-SG......--..SG...Y...L------Q..........V...PNA....
B8FF04_DESAA/2226-2395---A......M--------.A..F....D-GA......--..SS...Y...G------V..........V...SDV...Q
D1N5I7_9BACT/61-228---A......V--------....R....L-EG......--..GA...K...L------A..........Y...PA.....
C7QBN6_CATAD/347-521---S......A--------.A..F....S-GAAK...Q--IKGG...Q...I------Q..........T...KA.....
A9ERE1_SORC5/151-299---A......L--------.S..V....T-M.......--..GS...K...L------Y..........F..RHD.....
A6DR58_9BACT/44-196---G......L--------.E..F....P-AG......--..SQ...A...L------D..........L...GD.....
C3U0P6_9BACT/412-578---A......I--------.Q..F....N-PA......--..TG...G...A------L..........T...QR.....
B5LWG3_9PHYC/41-196---V......A--------.S..F....S-NG......--..DS...L...V------L..........L...SS.....
C6W2U2_DYAFD/85-270---.......A--------.M..K....G-AK......--..DG...Y...V------L..........F...DPT....
B9XRA3_9BACT/915-1084---R......F--------.G..F....L-AT......--.SNS...C...V------TN........II...AD.....
B4CYP7_9BACT/402-560---A......F--------....A....S-SS......--..SS...Y...A------S..........I...PA.....
D3EAV8_GEOS4/59-242---G......L--------.L..F....D-GY......--..ST...Y...I------S..........HR.FKE.....
C9Z2C7_STRSW/788-953---A......L--------.R..F....N-GT......--..TD...H...A------T..........A...AS.....
A7S999_NEMVE/80-241---A......A--------.Y........-TY......--..CG...D...I------L..........F...HG.....
B0R0F2_DANRE/84-248---A......V--------.Y..F....T-GR......--..GD...Q...L------R..........L..KPN.....
D2R2C9_PIRSD/92-280---A......A--------.E..F....S-AS......--..AI...R...V------A..........D...PGDK..S
D1N440_9BACT/265-425---A......W--------.H..F....T-GG......--..ST.......A------A..........W...KP.....
B7BC96_9PORP/290-465---A......L--------.F..I....N-GT......--.KEQ...F...V------N..........I...PH.....
Q11RF9_CYTH3/63-223---D......A--------.Y..D....F-TY......--..GN...S...I------T..........V...SS.....
D2HFC1_AILME/255-434---P......V--------.L..Y....F-SG......--.RRG...R...L------L..........L...RPE...V
D2MK76_9BACT/72-236---A......L--------.E..F....D-GA......--..SN...W...V------E..........V...PH.....
D2QYB6_PIRSD/350-513---A......I--------.L.......L-DG......--..KT...F...L------T..........L...PS.....
C0A3B4_9BACT/75-255---A......A--------.Q..F....T-GE......--..DS...R...L------T..........L...RA.....
A0KCD8_BURCH/575-734---A......I--------.V..F....D-GL......--..KA...G...L------Q..........L...PS.....
C0JKE8_9CNID/98-257---A......A--------.R..L....Y-DH......--..DI...Y...L------R..........G...DT.....
C6WK26_ACTMD/256-414---A......T--------.T..L....P-TA......--..SA...H...C------A..........A...GS.....
Q11TR6_CYTH3/67-238---A......L--------.H..F....N-GS......--..DG...F...I------R..........IPFSAN.....
C9KS24_9BACE/174-343---A......V--------.I..I....K-KG......--..NR...T...V------K..........T...FS.....
C6WE64_ACTMD/93-256---A......L--------.H..Q....R-GC......--..HQ...Y...V------E..........L...PA.....
A3XHG5_LEEBM/75-230---Q......A--------.L..Q....L-TG......--..ET...Y...L------S..........L...PQ.....
A2SGZ6_METPP/1212-1389---A......L--------.R..F....D-GA......--..GS...F...V------A..........L...DA.....
Q1CYH0_MYXXD/203-378---.......V--------.I..L....S-GA......--..GA...Y...V------N..........L...PIT....
B9XP36_9BACT/812-969---.......A--------.L..E....F-DG......--..NN...Y...V------D..........I...AGF....
C4RFN0_9ACTO/720-882---E......V--------.N.......A-SG......--..DG...A...L------T..........V...NS.....
A1ZNA6_9BACT/47-195---C......L--------.Q..F....D-GT......--..GA...H...I------D..........L...GD.....
Q2SFE6_HAHCH/1420-1563---E......F--------.S..F....T-DN......--..NL...Y...A------T..........I...GQ.....
A9AVC5_HERA2/48-212---S......V--------.L..D....F-DG......--..NG...Y...L------E..........L...NP.....
Q4DW65_TRYCC/416-574---K......C--------.Y..Y....F-SK......--..GN...A...L------S..........I...GR.....
B4WFW4_9SYNE/1032-1209---G......V--------.A..F....S-GN......--...G...D...V------R..........V...AD.....
A6DFJ8_9BACT/285-467---A......I--------.N..F....D-GD......--..DD...F...L------S..........T...SF.....
B3T5F8_9ZZZZ/26-177---A......L--------.D..F....D-GV......--..ND...Y...V------N..........M...GD.....
B5D1X2_9BACE/452-632---A......V--------.K..F...SL-SD......--..NS...S...F------I..........V...PK.....
D3IBS1_9BACT/838-1024---G......L--------.V.......I-TD......--..PN...M...F------K..........M...PA.....
C0BIM3_9BACT/486-670---A......L--------.E..F....K-SD......--..YD...R...L------S..........I...NKE....
B4D4I9_9BACT/398-546---P......V--------.V..H....F-SGA.....--.SSQ...Y...L------T..........L...PN.....
Q6XR78_9BACT/330-512---A......V--------.N..F....D-GE......--..NS...W...L------A..........T...AY.....
B9XLW9_9BACT/1683-1852---A......F--------.S..I....V-NG......--..ML...R...V------V..........G...DP.....
A6C7N1_9PLAN/469-632---A......A--------.Y..F....D-GT......--...A...L...L------E..........S..NTP.....
D2S0M1_HALTV/102-283---G......L--------.L..F....D-GY......--..TT...W...A------A..........W...EA.....
C0W8I7_9ACTO/94-265---P......V--------.M..G....F-DG......--..SN...A...I------G..........Y...DY.....
D9TDD0_MICAI/800-962---A......A--------.R..F....D-GT......--.ADA...H...L------T..........T...SK.....
C6X6D4_FLAB3/83-273---.......A--------.V..Q....G-EK......--..FK...Y...I------K..........Y...TS.....
C6VYS1_DYAFD/497-672---A......Y--------....F....V-SD......--..YN...S...I------K..........L...GN.....
C7PAG2_CHIPD/920-1086---A......A--------.V..F....N-GT......--..SA...Y...V------T..........I...GG.....
D2EXW4_9BACE/79-271---M......A--------.Y..Q....G-AE......--..NA...Y...I------L..........AK.TPSI...L
B4D5Z2_9BACT/348-512---G......A--------.L.EF....K-GA......--..GD...G...V------R..........V...EI.....
A4FPB7_SACEN/624-786---G......L--------.E..L....S-GL......--..DD...W...V------E..........AYRDPR.....
C6WMV3_ACTMD/573-733---A......L--------.H..L....S-GL......--..DD...F...V------E..........V..YRDR....
Q7UJX1_RHOBA/50-209---S......W--------.L..L....D-GQ......--...T...A...L------E..........P..HGA.....
A4A0C0_9PLAN/363-531---S......T--------.A..F....E-WKR.....--.PGD...R...V------R..........V..YVP.....
Q7URW0_RHOBA/367-559---AS...RGI--------.N..F....D-RP......--..GS...R...V------R..........T....R.....
A6DHV3_9BACT/341-513---L......S--------.F..K....E-GS......--..DH...Y...F------Q..........V...NSP....
B4D4T4_9BACT/390-545---A......L--------.I..F....D-GK......--..KA...Q...H------D..........T...GLK....
B6G8E7_9ACTN/62-218---S......L--------.V..L....A-DKT.....--.KDF...D...V------K..........V...AQ.....
B9PQF9_TOXGO/122-271---A......A--------.F..V....N-GA......--..SG...T...I------R..........S....S.....
A7S3Q5_NEMVE/162-320---A......Y--------.E..L....A-GT......--.ADS...Y...I------Q..........I...PN.....
D5SYY5_PLAL2/128-328---A......L--------.E..F....G-NK......--..AG...Y...L------T..........L...DD.....
A9F726_SORC5/116-294---G......V--------.L..T....L-DG......--.EDD...Y...V------D..........L...PA.....
C4RIT9_9ACTO/392-554---.......A--------.L.......F-TR......--..TN...V...L------Q..........T...AQ.....
A7RK85_NEMVE/106-274---R......A--------.L..N....L-TR......--..DG...N...V------T..........F...DI.....
C7PKJ2_CHIPD/84-251---V......L--------.S..L....S-GN......--.NNA...F...I------T..........L...PA.....
B0N4L9_9FIRM/1244-1393---N......I--------.A..T....V-NG......--..DG...Y...V------A..........L...PY.....
A0LSM6_ACIC1/412-612---Q......T--------.P..N....L-AA......--.LSA...G...V------T..........S...TN.....
A7SIB1_NEMVE/85-243---A......Y--------.Y..F....S-GT......--.SSS...Y...I------E..........I...PY.....
A7RIY7_NEMVE/105-286---.......R--------.Y..F....D-NG......--..GG...T...I------T..........I...PHS...S
C3ZG11_BRAFL/63-224---S......F--------.L..F....S-GT......--.TSS...Y...M------D..........I...PNN...G
Q7UQA7_RHOBA/106-269---A......T--------.K..I....E-SV......--..HP...A...T------K..........L...AE.....
B1C0I8_9FIRM/105-267---I......A--------.K..F....D-GS......--..SA...Y...L------Y..........P...FN.....
D2H2H5_AILME/16-191---A......L--------.Y..F....S-GR......--..GE...Q...L------R..........L..RAD.....
B9XQ67_9BACT/487-653---K......A--------.Y..T....S-DA......--..KT...T...P------A..........L...DD.....
Q15ZH4_PSEA6/374-555---Q......V--------.M..S....V-PK......--..NS...D...A------N..........I...SA.....
C3ZHW9_BRAFL/119-292---E......V--------.L..K....L-KG......--..PN...S...V------N..............DY.....
B3PEP0_CELJU/1203-1381---A......L--------.N..F....D-GR......--..GA...Y...V------E..........I...PK.....
B9XJH3_9BACT/840-1011---A......L--------.G..F....G-GT......--..NA...F...V------T..........E..ATN.....
A6C6P7_9PLAN/374-539---S......L--------.E..F....K-RT......--..SD...R...V------R..........T...H......
A9DIG8_9FLAO/489-650---A......I--------.A..F....D-.G......--..TE...T...I------E..........IP.ITN.....
B4DAY9_9BACT/342-525---G......A--------.L..Q....L-DG......--..RS...F...A------R..........A...AF.....
B9XJI2_9BACT/384-535---A......F--------.Y..F....D-G.......--..NS...Y...C------S..........N...GA.....
C9RK22_FIBSS/405-579---A......F--------.V..F....N-GK......--..SS...I...I------E..........I...QE.....
Q11QZ4_CYTH3/221-389---A......L--------.R..F....D-GS......--..DD...Y...V------Q..........A...ASY...S
A3ZZC4_9PLAN/344-513---E......L--------.T..V....A-NS......--..ND...S...L------S..........M...SV.....
A9E0U6_9FLAO/61-258---P......T--------.N..A....I-EL......--..NN...S...F------L..........F...TP.....
C9RJ78_FIBSS/288-457---A......V--------.L.......L-EP......--..GQ...F...I------D..........L...DT.....
B5HCG7_STRPR/177-340---A......A--------.E..N....P-RG......--.SYQ...F...V------D..........L...PA.....
D1JWC6_9BACE/31-177---A......L--------.H..L....D-GK......--..DN...N...V------R..........T...GM.....
C0A1S0_9BACT/90-270---L......A--------.L..P....L-NANA....--MLGP...R...L------E..........L...PA.....
A9V190_MONBE/84-262---.......Y--------.A..F....N-AT......--..RR...G...I------AQV......FWT..NAS.....
A6CGM5_9PLAN/366-543---R......A--------.L..E....F-KQ......--.PAD...R...V------R..........V..........
A4BJB6_9GAMM/70-236---A......A--------.S..F....N-GS......--..DQ...F...I------T..........A...DD.....
C6IPE3_9BACE/171-339---A......V--------.V.LK....S-AN......--..KT...S...L------N..........F...K......
A6DI92_9BACT/1411-1561---A......L--------.G..I....Y-GE......--..AG...R...I------T..........F...SG.....
D3PDE8_DEFDS/259-420---Y......R--------.V..A....N-FN......--..GK...Y...I------T..........I...DE.....
D3SUF1_NATMM/123-286---H......I--------.R..L....T-GG......--..FD...R...V------N..........L...PE.....
C4RNA3_9ACTO/674-835---A......V--------.A..L....S-SL......--..DD...F...V------D..........V...FRD...R
D3I9E5_9BACT/845-1031---A......L--------.I.......V-KD......--..PE...M...L------Y..........I...PG.....
B4D1M2_9BACT/359-532---R......A--------.L..Q....F-HS......--.VSD...R...V------R..........V...K......
B9IR57_BACCQ/491-650---N......V--------.M..K....L-NGKA....--NTFG...Y...L------P..........F...SA.....
A3J537_9FLAO/808-958---L......F--------.L..S....F-DG......--.RND...Y...A------T..........D...DN.....
B0UY77_DANRE/29-207---G......I--------.Y..F....S-GQ......--..AE...Q...L------K..........V...NPA...F
A4A1Z8_9PLAN/377-557---Q......S--------.L..E....F-KK......--.FHD...R...V------R..........I...NV.....
USH2A_HUMAN/125-286---S......F--------.I..F....G-NH......--..KS...C...F------S..........S...PP.....
A5FGK8_FLAJ1/706-890---A......I--------.D..F....S-TSA.....--NNKS...M...V------N..........I...PN.....
C6W6A2_DYAFD/472-647---A......R--------.D..I....F-GE......--..N....A...V------S..........F...GDN....
Q1K202_DESAC/525-690---G......I--------.T..F....D-GN......--..GD...Y...L------T..........V...ED.....
B9XQ69_9BACT/485-655---C......A--------.E.......L-SG......--..EN...G...F------T..........F...PD.....
D2EF52_9EURY/165-326---V......A--------.N..F....N-GN......--..NA...Y...I------Y..........A...PV.....
Q7UP09_RHOBA/485-653---A......W--------....Q....L-TG......--..DD...A...V------A..........T...EV.....
C6R6E9_9CORY/73-236---P......V--------.A..Q....F-DG......--.RKD...A...V------G..........FD.IGD.....
A4A2E4_9PLAN/388-559---S......S--------.L..E....F-KR......--.PGD...R...V------R..........I...S......
Q4UGJ1_THEAN/119-276---S......L--------.S..F....T-AE......--..SS...Y...K------I..........R...AT.....
B0MAH3_9FIRM/35-193---A......A--------.K..F....D-GS......--..SA...F...A------Y..........S...FK.....
C6WMC2_ACTMD/300-447---R......F--------.L..N....L-DG......--..TA...A...I------T..........A...PT.....
B4CV03_9BACT/469-631---A......L--------.V..I....D-K.......--..DT...T...L------D..........L...GD.....
Q0B064_SYNWW/503-682---A......L--------.D..F....P-EN......--.SQR...R...I------N..........V...PF.....
A5KTF5_9BACT/68-255---A......T--------.V..F....D-GS......--..AQ...Y...I------E..........V...AD.....
A6DRN0_9BACT/341-515---S......A--------.L..D....F-KS......--.INA...R...I------R..........L...N......
D3IBS0_9BACT/839-1031---G......L--------.I.......I-ED......--..PK...M...L------Q..........I...PA.....
C3ZH57_BRAFL/80-242---A......F--------.L..F....S-GT......--.AHS...Y...I------D..........I...PN.....
A6DHH9_9BACT/316-501---Q......F--------.I..E....G-AY......--..GY...A...L------D..........F...DG.....
Q12MW7_SHEDO/68-230---A......L--------.A........-.Q......--..DV...M...V------V..........G...GL.....
A4BNW4_9GAMM/66-228---A......A--------.L..R....F-GG......--.KAA...Y...L------D..........V...PF.....
B4CZ59_9BACT/352-532---D......A--------.L..E....F-KS......--.PGD...R...V------R..........V...NL.....
D2QJX5_SPILD/490-660---A......F--------.Q.......S-NG......--..DD...I...L------T..........L...GQ.....
D2W1V6_NAEGR/220-370---S......V--------.Y..F....D-GK......--..KN...G...L------A..........S..TVN.....
D5SPJ9_PLAL2/481-659---Q......A--------.I..E....F-SG......--..DD...E...Y------K..........L...KE.....
Q2YZY0_9BACT/84-253---K......V--------.L..S....L-QD......--..G....A...L------R..........L...PG.....
A6DFA0_9BACT/339-519---S......L--------.V..F....D-KGT.....--.KGS...F...V------V..........E...EP.....
B3G4J2_ADIVA/101-294---C......A--------.V..F....D-GQ......--...S...F...I------D..........F...PVN...H
P74816_9SPHN/410-566---F......Q--------.V..K....T-GT......--..GF...E...L------T..........R...DNS....
P73139_SYNY3/1325-1483---P......A--------.V..L....F-QG......--..G....G...V------T..........L...DQ.....
C5CLG3_VARPS/557-715---Q......A--------.A........-........--..AD...Y...A------E..........L...PV.....
B5JG14_9BACT/671-837---S......V--------.D..F....D-AV......--..TE...S...M------S..........F...DG.....
A6CCU9_9PLAN/72-239---A......I--------.V..L....D-GE......--..SN...S...I------M..........I...SEQS..T
B4D1A4_9BACT/330-492---G......L--------.V..V....D-KG......--...S...T...L------D..........L...GD.....
B9XKL0_9BACT/361-511---G......F--------.H..F....D-GS......--..SS...V...V------N..........V...GA.....
B1Y080_LEPCP/297-473---P......A--------.N..T....S-ST......--..SA...G...V------D..........TL.LNV.....
B8HTY6_CYAP4/32-183---I......L--------.V..F....A-ND......--..HQ...G...I------A..........A...GK.....
C2FVB4_9SPHI/26-172---A......L--------.H..M....D-GK......--..DN...D...V------R..........T...GI.....
B8G7X6_CHLAD/437-609---A......W--------.N........-SE......--..RG...S...L------A..........F...PT.....
A3RGV3_9BACT/116-269---A......G--------.D..F....E-SS......--.SSQ...Y...L------S..........H...AD.....
A8LVR9_SALAI/775-953---Q......V--------.A..S....F-DG......--..TG...E...V------A..........T...SG.....
A5ZI49_9BACE/23-170---A......V--------.C..L....D-GK......--..DN...N...L------R..........I...GM.....
Q12HW8_SHEDO/63-226---A......L--------.Y........-........--..YD...I...L------K..........V...DS.....
A6DRM9_9BACT/467-652---G......Y--------.I.......L-DG......--..DS...A...L------D..........F...KG.....
A0YFY2_9GAMM/808-969---A......A--------.N.......F-TG......--..SN...Y...I------E..........V...AN.....
Q38AC5_TRYB2/2147-2303---C......I--------.R..F....L-GG......--.......Y...V------S..........I...TF.....
Q7USY0_RHOBA/369-551---P......A--------.L..Q....F-KR......--.PGD...R...V------R..........V...NV.....
C3QV99_9BACE/144-325---S......Y--------.I..D....F-GR......--.SEE...Y...V------N..........F...GT.....
C7M4C3_CAPOD/79-272---.......A--------.Y..Q....G-AD......--..NS...Y...I------L..........I...TP.....
D0TFR6_9BACE/405-563---Q......V--------.A..S....L-EN......--..QA...R...V------D..........L...PTA...S
Q6XLX7_9PHYC/44-198---A......A--------.Y..F....D-GT......--...T...R...L------E..........I...QNV...P
C5CYC7_VARPS/579-746---G......M--------.S..F....A-NR......--..TA...G...V------P..........L...KN.....
C0A972_9BACT/830-997---A.....RA--------.M..Q....F-DG......--..QT...L...L------K..........A...AE.....
Q7UV67_RHOBA/396-564---S......A--------.L..D....F-KR......--.PSD...R...V------R..........F...H......
C3RMD7_9FIRM/955-1121---.......A--------.L..K....L-NG......--..DG...Y...L------Q..........M...QH.....
Q26C91_FLABB/1086-1241---S......I--------.Y..F....D-GR......--..ND...Y...L------Q..........T...NV.....
B4CZ32_9BACT/535-700---R......L--------.I..L....D-GK......--..GA...Y...F------R..........T...DQ.....
Q45134_BUTFI/150-322---A......A--------.Y..F....N-GE......--..NA...Y...L------E..........V...EK.....
Q3MCP3_ANAVT/8-178---T......V--------.L..K....F-DG......--.IDD...Y...I------D..........F...GK.....
A3ZS75_9PLAN/65-259---A......R--------.I..R....L-GQ......--..FF...M...I------D..........R...PDV....
B4XES9_9SPHN/409-566---A.......--------.F..H....V-ST......--..GT...G...V------E..........L...NRS...Y
B3VZZ6_ADIVA/394-546---C......M--------.V..F....V-SS......--..TQ...F...I------R..........I...PY.....
A6C7K1_9PLAN/97-288---A......I--------.R..L....D-GK......--..GA...Y...I------A..........V...ND.....
C9PW73_9BACT/834-1027---A......I--------.K..V....N-EK......--..GV...G...V------R..........S...NS.....
A5FGU3_FLAJ1/56-211---A......Q--------.R..L....N-NK......--..AL...E...A------V..........I...DN.....
A7S6Y5_NEMVE/109-273---A......V--------.L..F....L-GT......--..DG...S...Y------R..........I..LNR.....
E6W606_DESIS/775-953---G......Q--------.S..L....A-GG......--..YT...F...L------E..........D..SST.....
B2RXV6_MOUSE/81-241---T......F--------.L..Y....Y-GTY.....--.KSS...C...I------S..............NP.....
B3T3H2_9ARCH/1617-1797---N......I--------.I..S....L-SE......--..TE...Y...I------E..........V...DK.....
Q6XLW1_9PHYC/45-203---A......Y--------.F..S....G-DG......--..TS...R...I------D..........M...NTI....
A5FGS6_FLAJ1/56-211---A......L--------.R..L....N-NK......--..AF...Q...A------V..........V...GD.....
D3Q9V4_STANL/94-285---.......A--------.I..F....N-GA......--..NG...Y...F------R..........V...PSH...K
D2AYT0_STRRD/828-984---S......G--------.L..V....L-GG......--..ST...Y...L------T..........T...GN.....
A6EL39_9BACT/290-454---S......Y--------.F..N....F-NG......--..PD...K...I------D..........V...PT.....
B9YA97_9FIRM/49-212---G......Y--------.R..L....D-AQ......--...T...E...H------R..........V...QS.....
B8A482_DANRE/166-339---S......F--------.F..S....F-PGK.....--.SAA...A...I------A..........L...PP.....
A0ZJ67_NODSP/529-687---G......V--------.V..L....D-GV......--..ND...Y...I------E..........I...AD.....
D4J196_BUTFI/151-322---V......A--------.H..F....D-GK......--..DD...Y...L------S..........V...EK.....
B3JMU7_9BACE/180-344---A......K--------.L........-FS......--..QS...Y...I------D..........N...PE.....
A6C9P5_9PLAN/475-641---G......L--------.L..L....D-GN......--..KS...Y...L------K..........A...EP.....
Q7UQ49_RHOBA/293-490---A......V--------.N..F....D-NS......--..DN...A...I------I..........T...FD.....
D5VLA5_CAUST/65-237---G......F--------.R..A....A-.D......--..DG...I...V------S..........W...NA.....
C2XL88_BACCE/73-229---S......L--------.Y..F....N-GL......--..NN...H...V------V..........I...PNH....
A9DQH5_9FLAO/230-392---Q......F--------.L..N....V-GN......--..QP...E...L------D..........I...Q......
A9DQH5_9FLAO/602-753---N......S--------.L..F....F-DG......--.IDD...Y...V------E..........D...RS.....
A7SXU0_NEMVE/114-291---R......R--------.........F-RS......--..SG...S...I------T..........I...PNA...P
Q01ZJ6_SOLUE/443-593---S......A--------.A..F....N-GE......--...T...Q...I------E..........F...PG.....
C0A1S3_9BACT/78-256---A......T--------.T..R....D-SG......--..NK...A...I------N..........T...DT.....
A6FCT1_9GAMM/23-189---G......Y--------.S.......F-DG......--..ND...F...T------T..........M...SN.....
A7SJ06_NEMVE/66-224---A......Y--------.R..F....S-GS......--.KNS...Y...I------E..........I...PG.....
D2GX75_AILME/1323-1494---A......A--------.L..Y....F-SGLE....--GAFG...T...V------NP.......KYH...PS.....
C3ZJX0_BRAFL/84-248---S......Y--------.F..F....Q-GS......--.LNS...Y...I------E..........F...PN.....
A6CD74_9PLAN/486-648---A......L--------.T..F....N-GQ......--..QQ...Y...G------T..........M...QK.....
C0A499_9BACT/97-283---A......L--------.T..R....S-TT......--.NPA...G...V------S..........I...NN.....
Q2SIZ0_HAHCH/345-511---K......A--------.Q.......G-AT......--..SN...S...K------K..........L...HD.....
D1N3B4_9BACT/65-217---G......I--------.L..L....D-GA......--..TN...S...V------F..........C...GP.....
Q01T04_SOLUE/424-579---D......F--------.R.......T-EK......--..DA...K...V------R..........L...EY.....
C0A317_9BACT/126-292---S......A--------.S..A....T-GR......--...D...G...V------A..........T...AA.....
B4WXA4_9GAMM/345-509---K......A--------.Q.......G-ST......--..QT...S...K------K..........L...TD.....
GPR98_DANRE/1316-1486---D......A--------.L..F....F-SGRP....--GAYG...S...I------S........