Sequence alignment for CL0004

PF00139

I1J0Z7_BRADI/24-270--------------------------------------------------------------------------------
M0UWM0_HORVD/54-310--------------------------------------------------------------------------------
K3YQI1_SETIT/31-293--------------------------------------------------------------------------------
D7MX72_ARALL/27-278--------------------------------------------------------------------------------
I1QF95_ORYGL/9-257--------------------------------------------------------------------------------
B9SDJ5_RICCO/21-269--------------------------------------------------------------------------------
M4EIG5_BRARP/19-266--------------------------------------------------------------------------------
I1KL69_SOYBN/32-282--------------------------------------------------------------------------------
I1GT36_BRADI/22-278--------------------------------------------------------------------------------
M4DR71_BRARP/23-281--------------------------------------------------------------------------------
K7UKG6_MAIZE/22-274--------------------------------------------------------------------------------
C5Z960_SORBI/22-274--------------------------------------------------------------------------------
J3MID1_ORYBR/697-950--------------------------------------------------------------------------------
C5YGS5_SORBI/740-993--------------------------------------------------------------------------------
F6HBM8_VITVI/38-285--------------------------------------------------------------------------------
M0ZZ78_SOLTU/22-275--------------------------------------------------------------------------------
J3MID6_ORYBR/47-299--------------------------------------------------------------------------------
I1KL68_SOYBN/57-300--------------------------------------------------------------------------------
B9S3F5_RICCO/21-271--------------------------------------------------------------------------------
B9SXJ7_RICCO/26-271--------------------------------------------------------------------------------
M0VXQ0_HORVD/20-275--------------------------------------------------------------------------------
I1GT33_BRADI/25-286--------------------------------------------------------------------------------
B9SXJ9_RICCO/25-271--------------------------------------------------------------------------------
M7ZXG6_TRIUA/26-279--------------------------------------------------------------------------------
B9SDJ4_RICCO/29-277--------------------------------------------------------------------------------
B9RKX4_RICCO/32-295--------------------------------------------------------------------------------
J3MID3_ORYBR/25-284--------------------------------------------------------------------------------
A9STE4_PHYPA/28-284--------------------------------------------------------------------------------
K7LD59_SOYBN/26-276--------------------------------------------------------------------------------
F6HW43_VITVI/37-287--------------------------------------------------------------------------------
B9SPG3_RICCO/28-274--------------------------------------------------------------------------------
I1I8J5_BRADI/41-316--------------------------------------------------------------------------------
C5WQT3_SORBI/3-256--------------------------------------------------------------------------------
M7Z7K8_TRIUA/24-276--------------------------------------------------------------------------------
M7Z873_TRIUA/26-278--------------------------------------------------------------------------------
I1Q9S6_ORYGL/27-278--------------------------------------------------------------------------------
B9RX67_RICCO/38-289--------------------------------------------------------------------------------
Q7XZX1_ORYSJ/59-312--------------------------------------------------------------------------------
I1H3V1_BRADI/27-275--------------------------------------------------------------------------------
C5YTD3_SORBI/42-297--------------------------------------------------------------------------------
C5WZ65_SORBI/40-297--------------------------------------------------------------------------------
F6HWD4_VITVI/48-292--------------------------------------------------------------------------------
M4C9K1_BRARP/30-282--------------------------------------------------------------------------------
D7L7Q8_ARALL/26-272--------------------------------------------------------------------------------
I1LMH1_SOYBN/27-284--------------------------------------------------------------------------------
I1Q7T2_ORYGL/56-310--------------------------------------------------------------------------------
K7UIK5_MAIZE/47-318--------------------------------------------------------------------------------
B9S3F7_RICCO/27-283--------------------------------------------------------------------------------
Q6Z8M4_ORYSJ/40-308--------------------------------------------------------------------------------
M4F2M7_BRARP/21-273--------------------------------------------------------------------------------
M0Y8Y9_HORVD/24-281--------------------------------------------------------------------------------
B9RX81_RICCO/37-286--------------------------------------------------------------------------------
Q7XUC7_ORYSJ/28-274--------------------------------------------------------------------------------
Q6K8L8_ORYSJ/26-289--------------------------------------------------------------------------------
I1L3I1_SOYBN/35-302--------------------------------------------------------------------------------
M4EJC2_BRARP/29-277--------------------------------------------------------------------------------
F6HWD7_VITVI/37-289--------------------------------------------------------------------------------
F6HW36_VITVI/35-286--------------------------------------------------------------------------------
M1DPR0_SOLTU/22-264--------------------------------------------------------------------------------
K4D2U1_SOLLC/29-283--------------------------------------------------------------------------------
I1H2L8_BRADI/27-276--------------------------------------------------------------------------------
C5XCD6_SORBI/32-291--------------------------------------------------------------------------------
K3Y5L7_SETIT/33-273--------------------------------------------------------------------------------
M1BJQ2_SOLTU/21-281--------------------------------------------------------------------------------
I1LM84_SOYBN/28-267--------------------------------------------------------------------------------
M4CN93_BRARP/29-292--------------------------------------------------------------------------------
Q8H4J3_ORYSJ/28-282--------------------------------------------------------------------------------
B9RX64_RICCO/27-280--------------------------------------------------------------------------------
J3MPZ5_ORYBR/33-302--------------------------------------------------------------------------------
Q84ZH8_ORYSJ/24-276--------------------------------------------------------------------------------
M0YJP2_HORVD/48-317--------------------------------------------------------------------------------
K3Y3M9_SETIT/30-282--------------------------------------------------------------------------------
F6HL81_VITVI/33-286--------------------------------------------------------------------------------
LRK61_ARATH/33-294--------------------------------------------------------------------------------
B9T8H0_RICCO/20-272--------------------------------------------------------------------------------
M1AHJ3_SOLTU/28-281--------------------------------------------------------------------------------
M7YY54_TRIUA/30-272--------------------------------------------------------------------------------
M4CLT1_BRARP/22-275--------------------------------------------------------------------------------
B9SML1_RICCO/44-289--------------------------------------------------------------------------------
M4DP68_BRARP/19-264--------------------------------------------------------------------------------
Q0D8S6_ORYSJ/77-329--------------------------------------------------------------------------------
M8A5Y7_TRIUA/53-300--------------------------------------------------------------------------------
C5Z959_SORBI/30-282--------------------------------------------------------------------------------
LRKS1_ARATH/29-288--------------------------------------------------------------------------------
M4ESL4_BRARP/22-290--------------------------------------------------------------------------------
B9SKY8_RICCO/25-281--------------------------------------------------------------------------------
M4FFA7_BRARP/24-263--------------------------------------------------------------------------------
J3LWI6_ORYBR/44-294--------------------------------------------------------------------------------
K7L999_SOYBN/59-308--------------------------------------------------------------------------------
M7YCL0_TRIUA/32-284--------------------------------------------------------------------------------
D7MR66_ARALL/26-282--------------------------------------------------------------------------------
J3MPZ8_ORYBR/32-293--------------------------------------------------------------------------------
F6GUY7_VITVI/27-280--------------------------------------------------------------------------------
B9HG10_POPTR/32-282--------------------------------------------------------------------------------
B9GZH8_POPTR/30-270--------------------------------------------------------------------------------
B9HCZ3_POPTR/23-280--------------------------------------------------------------------------------
I1JFJ9_SOYBN/45-285--------------------------------------------------------------------------------
I1MX65_SOYBN/42-290--------------------------------------------------------------------------------
M7Y9L8_TRIUA/34-283--------------------------------------------------------------------------------
Q652V6_ORYSJ/38-298--------------------------------------------------------------------------------
Q6ZFB7_ORYSJ/37-281--------------------------------------------------------------------------------
Q6ZIQ8_ORYSJ/39-305--------------------------------------------------------------------------------
Q6ZLL9_ORYSJ/30-291--------------------------------------------------------------------------------
Q7XUN6_ORYSJ/30-280--------------------------------------------------------------------------------
Q84ZI0_ORYSJ/31-304--------------------------------------------------------------------------------
U5G5V7_POPTR/26-278--------------------------------------------------------------------------------
W5AMW1_WHEAT/26-276--------------------------------------------------------------------------------
W5AND9_WHEAT/35-289--------------------------------------------------------------------------------
W5GWA8_WHEAT/27-281--------------------------------------------------------------------------------
W5H3F4_WHEAT/32-280--------------------------------------------------------------------------------

PF03388

YQF8_SCHPO/24-250--------------------------------------------------------------------------------
YOC5_SCHPO/23-229--------------------------------------------------------------------------------
EMP47_YEAST/36-253--------------------------------------------------------------------------------
LMAN1_HUMAN/44-269--------------------------------------------------------------------------------
Q9V3A8_DROME/33-259--------------------------------------------------------------------------------
Q9VCC2_DROME/33-258--------------------------------------------------------------------------------
LMAN2_CANFA/52-278--------------------------------------------------------------------------------
Q22170_CAEEL/43-272--------------------------------------------------------------------------------

PF02210

CNTP4_HUMAN/821-940--------------------------------------------------------------------------------
Q9VZ96_DROME/275-414--------------------------------------------------------------------------------
Q9VZ96_DROME/514-640--------------------------------------------------------------------------------
Q9VZ96_DROME/698-817--------------------------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------------------------------------------------------------------------
EYS_HUMAN/3007-3141--------------------------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------------------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------------------------------------------------------------------------
Q7PSM9_ANOGA/919-1050--------------------------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------------------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------------------------------------------------------------------------
CNTP1_MOUSE/390-516--------------------------------------------------------------------------------
Q18291_CAEEL/303-430--------------------------------------------------------------------------------
Q18291_CAEEL/495-627--------------------------------------------------------------------------------
Q18291_CAEEL/722-843--------------------------------------------------------------------------------
Q18291_CAEEL/906-1035--------------------------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------------------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------------------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------------------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------------------------------------------------------------------------
NRX3A_MOUSE/475-619--------------------------------------------------------------------------------
NRX3A_HUMAN/287-413--------------------------------------------------------------------------------
CNTP4_MOUSE/400-526--------------------------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------------------------------------------------------------------------
CRUM1_MOUSE/513-650--------------------------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------------------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------------------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------------------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------------------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------------------------------------------------------------------------
Q9VJ82_DROME/55-178--------------------------------------------------------------------------------
Q9VJ82_DROME/238-367--------------------------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------------------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------------------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------------------------------------------------------------------------
CSPG4_HUMAN/55-178--------------------------------------------------------------------------------
CSPG4_HUMAN/230-363--------------------------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------------------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------------------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------------------------------------------------------------------------
Q8IQH0_DROME/220-342--------------------------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------------------------------------------------------------------------
EYS_DROME/1723-1856--------------------------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------------------------------------------------------------------------
CNTP5_HUMAN/819-938--------------------------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------------------------------------------------------------------------
NRX3B_HUMAN/117-236--------------------------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------------------------------------------------------------------------
STAN_DROME/1584-1736--------------------------------------------------------------------------------
STAN_DROME/1826-1946--------------------------------------------------------------------------------
NRX3A_HUMAN/55-184--------------------------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------------------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------------------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------------------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------------------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------------------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------------------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------------------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------------------------------------------------------------------------
Q7Q1N4_ANOGA/1163-1293--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------------------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------------------------------------------------------------------------
EGFLA_MOUSE/641-767--------------------------------------------------------------------------------
EGFLA_HUMAN/868-996--------------------------------------------------------------------------------
Q19617_CAEEL/154-276--------------------------------------------------------------------------------
NRX2A_RAT/949-1077--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------------------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------------------------------------------------------------------------
O45000_CAEEL/275-401--------------------------------------------------------------------------------
Q22574_CAEEL/136-267--------------------------------------------------------------------------------
Q22574_CAEEL/415-539--------------------------------------------------------------------------------
NRX1A_MOUSE/753-884--------------------------------------------------------------------------------
CADN_DROME/2407-2568--------------------------------------------------------------------------------
CADN_DROME/2661-2796--------------------------------------------------------------------------------
FAT2_RAT/3802-3923--------------------------------------------------------------------------------
CELR3_RAT/1534-1693--------------------------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------------------------------------------------------------------------
CRB_DROME/1585-1722--------------------------------------------------------------------------------
CNTP1_HUMAN/203-332--------------------------------------------------------------------------------
CNTP1_HUMAN/813-939--------------------------------------------------------------------------------
CRUM1_HUMAN/514-651--------------------------------------------------------------------------------
CRUM1_HUMAN/743-860--------------------------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------------------------------------------------------------------------
CNTP1_RAT/1089-1219--------------------------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------------------------------------------------------------------------
PROS_RABIT/485-617--------------------------------------------------------------------------------
LAMA_DROME/2704-2846--------------------------------------------------------------------------------
LAMA_DROME/2905-3031--------------------------------------------------------------------------------
LAMA_DROME/3083-3205--------------------------------------------------------------------------------
LAMA_DROME/3379-3514--------------------------------------------------------------------------------
LAMA_DROME/3563-3691--------------------------------------------------------------------------------
Q19350_CAEEL/789-914--------------------------------------------------------------------------------
CADE_DROME/1153-1296--------------------------------------------------------------------------------
NRX1A_BOVIN/58-192--------------------------------------------------------------------------------
GAS6_MOUSE/322-450--------------------------------------------------------------------------------
NRX2A_RAT/57-187--------------------------------------------------------------------------------
NRX2B_RAT/119-268--------------------------------------------------------------------------------
COBA2_MOUSE/90-213--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------------------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------------------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------------------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------------------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------------------------------------------------------------------------
CNTP5_HUMAN/209-338--------------------------------------------------------------------------------
CNTP5_HUMAN/395-521--------------------------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------------------------------------------------------------------------
NRX4_DROME/824-943--------------------------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------------------------------------------------------------------------
NRX1A_CHICK/364-508--------------------------------------------------------------------------------
NRX1A_CHICK/789-917--------------------------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------------------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------------------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------------------------------------------------------------------------
NRX2A_HUMAN/521-666--------------------------------------------------------------------------------
NRX2A_HUMAN/760-890--------------------------------------------------------------------------------
CELR2_RAT/869-995--------------------------------------------------------------------------------
CNTP2_HUMAN/216-345--------------------------------------------------------------------------------
CNTP2_HUMAN/401-529--------------------------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------------------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------------------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------------------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------------------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------------------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------------------------------------------------------------------------
B1AM99_HUMAN/398-521--------------------------------------------------------------------------------
B4NSJ9_DROSI/33-158--------------------------------------------------------------------------------
B4Q5I2_DROSI/631-761--------------------------------------------------------------------------------
B4QRF1_DROSI/2162-2287--------------------------------------------------------------------------------
B7ZC61_MOUSE/681-798--------------------------------------------------------------------------------
C1P641_CAEEL/3508-3630--------------------------------------------------------------------------------
C3ZLC2_BRAFL/400-531--------------------------------------------------------------------------------
E9PDN6_HUMAN/215-343--------------------------------------------------------------------------------
F1QGG9_DANRE/493-622--------------------------------------------------------------------------------
F1QQE4_DANRE/1172-1299--------------------------------------------------------------------------------
F1R9W4_DANRE/32-162--------------------------------------------------------------------------------
F1RCV3_DANRE/1181-1305--------------------------------------------------------------------------------
F6X197_CIOIN/154-276--------------------------------------------------------------------------------
F7ER04_CALJA/128-245--------------------------------------------------------------------------------
G3HJH2_CRIGR/1596-1721--------------------------------------------------------------------------------
G3UNZ8_MELGA/755-882--------------------------------------------------------------------------------
G5E9F8_HUMAN/383-515--------------------------------------------------------------------------------
H9H2C7_MELGA/307-434--------------------------------------------------------------------------------
M9NF15_DROME/1112-1240--------------------------------------------------------------------------------
LAMA3_MOUSE/3183-3307--------------------------------------------------------------------------------
Q8MPN3_DROME/3806-3929--------------------------------------------------------------------------------
Q9VCZ9_DROME/1230-1354--------------------------------------------------------------------------------
CADN2_DROME/1039-1199--------------------------------------------------------------------------------
W4YVD3_STRPU/3-125--------------------------------------------------------------------------------

PF00054

AGRIN_CHICK/1416-1546--------------------------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------------------------------------------------------------------------
AGRIN_CHICK/1933-2064--------------------------------------------------------------------------------
LAMA1_HUMAN/2920-3051--------------------------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------------------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------------------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------------------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------------------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------------------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------------------------------------------------------------------------
CSPG4_RAT/55-182--------------------------------------------------------------------------------
AGRIN_RAT/1291-1422--------------------------------------------------------------------------------
AGRIN_RAT/1559-1694--------------------------------------------------------------------------------
SHBG_RAT/76-206--------------------------------------------------------------------------------
CRB_DROME/1048-1183--------------------------------------------------------------------------------
AGRIN_RAT/1811-1942--------------------------------------------------------------------------------
SLIT_DROME/1204-1335--------------------------------------------------------------------------------
PROS_HUMAN/329-459--------------------------------------------------------------------------------
CRB_DROME/1281-1443--------------------------------------------------------------------------------
SHBG_HUMAN/75-205--------------------------------------------------------------------------------
FAT_DROME/4156-4306--------------------------------------------------------------------------------

PF00354

SAMP_MOUSE/27-220--------------------------------------------------------------------------------
CRP1_LIMPO/33-237--------------------------------------------------------------------------------
CRP_XENLA/23-219--------------------------------------------------------------------------------
CRP_RABIT/26-221--------------------------------------------------------------------------------
CRP_HUMAN/25-220--------------------------------------------------------------------------------
SAMP_HUMAN/26-219--------------------------------------------------------------------------------
Q542I3_MOUSE/26-221--------------------------------------------------------------------------------
FP_CRIMI/26-219--------------------------------------------------------------------------------

PF13385

A9V7L7_MONBE/717-870--------------------------------------------------------------------------------
A9V0U4_MONBE/809-963--------------------------------------------------------------------------------
A9VE19_MONBE/544-692--------------------------------------------------------------------------------
A9V0U4_MONBE/590-745--------------------------------------------------------------------------------
B9JMF4_AGRRK/595-752--------------------------------------------------------------------------------
C9ZAH4_STRSW/174-331--------------------------------------------------------------------------------
B5HCG7_STRPR/182-340--------------------------------------------------------------------------------
D3EBL1_GEOS4/644-797--------------------------------------------------------------------------------
Q82NZ6_STRAW/693-850--------------------------------------------------------------------------------
C7Q3C0_CATAD/682-839--------------------------------------------------------------------------------
C6WP14_ACTMD/1442-1597--------------------------------------------------------------------------------
A7RQU2_NEMVE/46-196--------------------------------------------------------------------------------
B3RTE4_TRIAD/419-588--------------------------------------------------------------------------------
Q11RF9_CYTH3/68-223--------------------------------------------------------------------------------
D2AYT0_STRRD/833-984--------------------------------------------------------------------------------
Q01PZ1_SOLUE/560-711--------------------------------------------------------------------------------
D0LXW7_HALO1/121-278--------------------------------------------------------------------------------
A9ERE1_SORC5/156-299--------------------------------------------------------------------------------
A7RK85_NEMVE/111-274--------------------------------------------------------------------------------
Q7UP09_RHOBA/489-653--------------------------------------------------------------------------------
D2QJX5_SPILD/494-660--------------------------------------------------------------------------------
A5G5W5_GEOUR/3125-3280--------------------------------------------------------------------------------
Q12UM1_METBU/211-367--------------------------------------------------------------------------------
A5G5W5_GEOUR/2834-2981--------------------------------------------------------------------------------
Q3A7I8_PELCD/252-409--------------------------------------------------------------------------------
Q2S986_HAHCH/536-688--------------------------------------------------------------------------------
C5BR34_TERTT/286-438--------------------------------------------------------------------------------
Q5E1F1_VIBF1/338-497--------------------------------------------------------------------------------
D0LH97_HALO1/423-584--------------------------------------------------------------------------------
Q2SIZ0_HAHCH/349-511--------------------------------------------------------------------------------
Q21ES8_SACD2/355-516--------------------------------------------------------------------------------
A1U1N6_MARAV/358-517--------------------------------------------------------------------------------
Q7UQA7_RHOBA/111-269--------------------------------------------------------------------------------
Q5JEI1_THEKO/104-250--------------------------------------------------------------------------------
D2RI28_ARCPA/205-357--------------------------------------------------------------------------------
D2QKT6_SPILD/67-225--------------------------------------------------------------------------------
A7RFD3_NEMVE/591-745--------------------------------------------------------------------------------
A5FGU3_FLAJ1/61-211--------------------------------------------------------------------------------
A5FGS6_FLAJ1/61-211--------------------------------------------------------------------------------
A5FKP6_FLAJ1/648-806--------------------------------------------------------------------------------
B1WQC8_CYAA5/1492-1639--------------------------------------------------------------------------------
B2J7Y5_NOSP7/1082-1239--------------------------------------------------------------------------------
B8GR77_THISH/232-391--------------------------------------------------------------------------------
A5US22_ROSS1/44-194--------------------------------------------------------------------------------
B8FIJ2_DESAA/1835-1990--------------------------------------------------------------------------------
B8FIJ2_DESAA/2139-2295--------------------------------------------------------------------------------
B8FIJ2_DESAA/3101-3258--------------------------------------------------------------------------------
B1WQC8_CYAA5/529-689--------------------------------------------------------------------------------
A0L6L9_MAGSM/6883-7036--------------------------------------------------------------------------------
A0L6L9_MAGSM/10297-10458--------------------------------------------------------------------------------
A0L6L9_MAGSM/11015-11176--------------------------------------------------------------------------------
A0L6L9_MAGSM/7697-7855--------------------------------------------------------------------------------
Q11V34_CYTH3/475-632--------------------------------------------------------------------------------
D1YWM2_METPS/639-793--------------------------------------------------------------------------------
A9AX01_HERA2/2983-3139--------------------------------------------------------------------------------
C5CYC7_VARPS/584-746--------------------------------------------------------------------------------
A9VEK3_MONBE/43-204--------------------------------------------------------------------------------
A9UYJ6_MONBE/611-770--------------------------------------------------------------------------------
A4CID0_ROBBH/183-344--------------------------------------------------------------------------------
Q01ZJ6_SOLUE/448-593--------------------------------------------------------------------------------
Q112U0_TRIEI/322-477--------------------------------------------------------------------------------
A9AVC5_HERA2/53-212--------------------------------------------------------------------------------
C3YCM4_BRAFL/399-559--------------------------------------------------------------------------------
A9AX01_HERA2/3464-3613--------------------------------------------------------------------------------
A9AX01_HERA2/1709-1859--------------------------------------------------------------------------------
A9AX01_HERA2/3687-3839--------------------------------------------------------------------------------
A9AVE2_HERA2/55-206--------------------------------------------------------------------------------
A0ZJ67_NODSP/534-687--------------------------------------------------------------------------------
A9WA06_CHLAA/1561-1710--------------------------------------------------------------------------------
D2GX75_AILME/1328-1494--------------------------------------------------------------------------------
GPR98_DANRE/1321-1486--------------------------------------------------------------------------------
B3PKP2_CELJU/973-1129--------------------------------------------------------------------------------
Q21FF7_SACD2/1013-1165--------------------------------------------------------------------------------
Q21FF7_SACD2/697-861--------------------------------------------------------------------------------
B8E3D6_DICTD/93-243--------------------------------------------------------------------------------
C6D6G1_PAESJ/694-843--------------------------------------------------------------------------------
Q9KBP7_BACHD/623-775--------------------------------------------------------------------------------
C7R5J8_JONDD/646-797--------------------------------------------------------------------------------
C7R5J7_JONDD/547-698--------------------------------------------------------------------------------
D4J0Z2_BUTFI/89-242--------------------------------------------------------------------------------
A5GAT0_GEOUR/82-245--------------------------------------------------------------------------------
C6W5Q6_DYAFD/72-233--------------------------------------------------------------------------------
D5SQB3_PLAL2/445-615--------------------------------------------------------------------------------
A0C6A9_PARTE/84-241--------------------------------------------------------------------------------
A4HMI3_LEIBR/697-852--------------------------------------------------------------------------------
A5JZZ5_PLAVS/101-250--------------------------------------------------------------------------------
D2W1V6_NAEGR/225-370--------------------------------------------------------------------------------
Q3A7I8_PELCD/471-622--------------------------------------------------------------------------------
B0R0F2_DANRE/89-248--------------------------------------------------------------------------------
B3RQA7_TRIAD/115-267--------------------------------------------------------------------------------
D3F200_CONWI/289-437--------------------------------------------------------------------------------
C6WK26_ACTMD/261-414--------------------------------------------------------------------------------
A0ZJ64_NODSP/411-564--------------------------------------------------------------------------------
P73139_SYNY3/1330-1483--------------------------------------------------------------------------------
D3F0R0_CONWI/85-255--------------------------------------------------------------------------------
C1F1C3_ACIC5/51-208--------------------------------------------------------------------------------
B5HK67_STRPR/818-980--------------------------------------------------------------------------------
D9TDD0_MICAI/805-962--------------------------------------------------------------------------------
Q82GV4_STRAW/292-440--------------------------------------------------------------------------------
D2BE74_STRRD/722-881--------------------------------------------------------------------------------
B5I5M1_9ACTO/761-922--------------------------------------------------------------------------------
B1VPR2_STRGG/846-1008--------------------------------------------------------------------------------
B5HSG2_9ACTO/789-950--------------------------------------------------------------------------------
B1VKK7_STRGG/744-905--------------------------------------------------------------------------------
C6WQK6_ACTMD/756-914--------------------------------------------------------------------------------
C9Z2C7_STRSW/793-953--------------------------------------------------------------------------------
D2PTR0_KRIFD/729-887--------------------------------------------------------------------------------
D2PTR0_KRIFD/514-676--------------------------------------------------------------------------------
B5H1J2_STRC2/810-972--------------------------------------------------------------------------------
B5H1J2_STRC2/1032-1193--------------------------------------------------------------------------------
C6WL54_ACTMD/905-1058--------------------------------------------------------------------------------
E6W606_DESIS/780-953--------------------------------------------------------------------------------
C5C072_BEUC1/602-756--------------------------------------------------------------------------------
A0L6L9_MAGSM/10522-10674--------------------------------------------------------------------------------
D0LH97_HALO1/144-304--------------------------------------------------------------------------------
Q12UM1_METBU/421-574--------------------------------------------------------------------------------
D3SUF1_NATMM/128-286--------------------------------------------------------------------------------
Q12UM1_METBU/635-797--------------------------------------------------------------------------------
B1Y080_LEPCP/302-473--------------------------------------------------------------------------------
Q025I9_SOLUE/271-426--------------------------------------------------------------------------------
Q025I9_SOLUE/616-778--------------------------------------------------------------------------------
C6XUD8_PEDHD/202-348--------------------------------------------------------------------------------
E6W633_DESIS/617-776--------------------------------------------------------------------------------
B8FF04_DESAA/2231-2395--------------------------------------------------------------------------------
C7PKJ2_CHIPD/89-251--------------------------------------------------------------------------------
D2PTT7_KRIFD/1092-1258--------------------------------------------------------------------------------
D2PTT7_KRIFD/1416-1585--------------------------------------------------------------------------------

PF02973

NANA_STRR6/118-309--------------------------------------------------------------------------------
Q8CWP8_STRR6/42-227--------------------------------------------------------------------------------
Q8XMG4_CLOPE/50-236--------------------------------------------------------------------------------

PF07953

A7GBG3_CLOBL/878-1072--------------------------------------------------------------------------------
F4AAX8_CLOBO/847-1023--------------------------------------------------------------------------------
O87710_9CLOT/811-986--------------------------------------------------------------------------------
B1INP6_CLOBK/847-1023--------------------------------------------------------------------------------
Q8GR96_CLOBO/872-1066--------------------------------------------------------------------------------
BXE_CLOBO/859-1054--------------------------------------------------------------------------------
B1Q6N5_CLOBO/816-992--------------------------------------------------------------------------------
BXEN_CLOBU/812-988--------------------------------------------------------------------------------
Q3ZUA3_9CLOT/40-243--------------------------------------------------------------------------------
O06018_CLOBO/848-1024--------------------------------------------------------------------------------
Q841S3_CLOBO/880-1071--------------------------------------------------------------------------------
BXA1_CLOBH/885-1079--------------------------------------------------------------------------------
BXG_CLOBO/877-1074--------------------------------------------------------------------------------

PF06439

A3HZT9_9BACT/35-266--------------------------------------------------------------------------------
A6LBG6_PARD8/26-215--------------------------------------------------------------------------------
B0T1W6_CAUSK/37-271--------------------------------------------------------------------------------
A4SXW4_POLSQ/31-195--------------------------------------------------------------------------------
A6DIW7_9BACT/14-204--------------------------------------------------------------------------------
A7LWH3_BACO1/242-448--------------------------------------------------------------------------------
A6LFX0_PARD8/51-268--------------------------------------------------------------------------------
Q1IP75_KORVE/134-305--------------------------------------------------------------------------------
Q01PY8_SOLUE/18-214--------------------------------------------------------------------------------
Q021Z2_SOLUE/148-318--------------------------------------------------------------------------------
A6C286_9PLAN/26-230--------------------------------------------------------------------------------
A6L9A1_PARD8/27-220--------------------------------------------------------------------------------
Q7UXM1_RHOBA/116-314--------------------------------------------------------------------------------
Q7UGT3_RHOBA/50-260--------------------------------------------------------------------------------
A6DGN3_9BACT/486-705--------------------------------------------------------------------------------
Q026J2_SOLUE/86-285--------------------------------------------------------------------------------
A7AJH3_9PORP/62-268--------------------------------------------------------------------------------
A4AVD2_MARSH/28-192--------------------------------------------------------------------------------
A6CF10_9PLAN/1565-1736--------------------------------------------------------------------------------
A4Z0W7_BRASO/36-203--------------------------------------------------------------------------------
Q7URI3_RHOBA/55-252--------------------------------------------------------------------------------
Q022Y3_SOLUE/158-351--------------------------------------------------------------------------------
A3ZYX9_9PLAN/31-241--------------------------------------------------------------------------------
Q7UYC2_RHOBA/27-225--------------------------------------------------------------------------------
Q08RB4_STIAD/354-520--------------------------------------------------------------------------------
B1KP96_SHEWM/43-237--------------------------------------------------------------------------------
Q7ULY5_RHOBA/53-228--------------------------------------------------------------------------------
Q9XAM0_STRCO/521-727--------------------------------------------------------------------------------
A6LD72_PARD8/35-236--------------------------------------------------------------------------------
A5V6S7_SPHWW/38-269--------------------------------------------------------------------------------
A3ZPX1_9PLAN/148-325--------------------------------------------------------------------------------
A6E8U4_9SPHI/241-449--------------------------------------------------------------------------------
Q7UFF8_RHOBA/54-264--------------------------------------------------------------------------------
A4SYN3_POLSQ/50-213--------------------------------------------------------------------------------
Q01QD3_SOLUE/67-266--------------------------------------------------------------------------------
Q21G79_SACD2/27-266--------------------------------------------------------------------------------
Q15XP9_PSEA6/43-289--------------------------------------------------------------------------------
A7NM29_ROSCS/68-253--------------------------------------------------------------------------------
Q02AV5_SOLUE/47-254--------------------------------------------------------------------------------
Q024T5_SOLUE/20-224--------------------------------------------------------------------------------
A6CH23_9PLAN/11-222--------------------------------------------------------------------------------
Q5LID8_BACFN/75-244--------------------------------------------------------------------------------
A4AN55_MARSH/13-232--------------------------------------------------------------------------------
Q7UP53_RHOBA/254-436--------------------------------------------------------------------------------
A3HYW7_9BACT/39-258--------------------------------------------------------------------------------
Q020M5_SOLUE/283-466--------------------------------------------------------------------------------
A7LZB4_BACO1/60-285--------------------------------------------------------------------------------
A6L8C0_PARD8/23-196--------------------------------------------------------------------------------
A4XES2_NOVAD/37-271--------------------------------------------------------------------------------
Q024G0_SOLUE/10-210--------------------------------------------------------------------------------
Q7UP53_RHOBA/88-251--------------------------------------------------------------------------------
Q7UJ71_RHOBA/62-282--------------------------------------------------------------------------------
A6C9B4_9PLAN/53-240--------------------------------------------------------------------------------
A0ACR9_STRAM/807-998--------------------------------------------------------------------------------
A6DSM6_9BACT/29-216--------------------------------------------------------------------------------
Q9XBE0_AMYOR/795-985--------------------------------------------------------------------------------
A6LB52_PARD8/744-943--------------------------------------------------------------------------------
A0M051_GRAFK/45-249--------------------------------------------------------------------------------
A6DM12_9BACT/183-370--------------------------------------------------------------------------------
A4ASP9_MARSH/24-229--------------------------------------------------------------------------------
A4ATY8_MARSH/64-260--------------------------------------------------------------------------------
A4ASM0_MARSH/38-261--------------------------------------------------------------------------------
Q15XH8_PSEA6/28-257--------------------------------------------------------------------------------
A6BZI2_9PLAN/34-270--------------------------------------------------------------------------------
A6DJ51_9BACT/30-221--------------------------------------------------------------------------------
A3ZYG0_9PLAN/42-220--------------------------------------------------------------------------------
A6LFJ8_PARD8/58-253--------------------------------------------------------------------------------
B4SNA4_STRM5/52-245--------------------------------------------------------------------------------
Q021Q3_SOLUE/25-318--------------------------------------------------------------------------------
A6DFB8_9BACT/988-1186--------------------------------------------------------------------------------
A6CBU4_9PLAN/476-662--------------------------------------------------------------------------------
Q7UTD6_RHOBA/106-307--------------------------------------------------------------------------------
A4CGG3_ROBBH/26-212--------------------------------------------------------------------------------
A4AUV7_MARSH/139-306--------------------------------------------------------------------------------
B0T1X3_CAUSK/51-253--------------------------------------------------------------------------------
A6C9Y7_9PLAN/38-232--------------------------------------------------------------------------------
A3I2W3_9BACT/58-253--------------------------------------------------------------------------------
A6DGC3_9BACT/39-228--------------------------------------------------------------------------------
A6BYQ3_9PLAN/523-721--------------------------------------------------------------------------------
B8H3I2_CAUCN/42-285--------------------------------------------------------------------------------
Q01U12_SOLUE/21-204--------------------------------------------------------------------------------
Q7UTD6_RHOBA/325-510--------------------------------------------------------------------------------
A4ARZ0_MARSH/21-221--------------------------------------------------------------------------------
Q01PI7_SOLUE/133-305--------------------------------------------------------------------------------
Q09C00_STIAD/650-816--------------------------------------------------------------------------------
A3ZT25_9PLAN/28-228--------------------------------------------------------------------------------
A4A1V7_9PLAN/150-329--------------------------------------------------------------------------------
A0YAF8_9GAMM/30-260--------------------------------------------------------------------------------
A6DSF7_9BACT/22-217--------------------------------------------------------------------------------
A4BYH9_9FLAO/26-192--------------------------------------------------------------------------------
A0ACX0_STRAM/280-457--------------------------------------------------------------------------------
Q01NY0_SOLUE/48-250--------------------------------------------------------------------------------
A6CCA5_9PLAN/71-236--------------------------------------------------------------------------------
A3I170_9BACT/40-240--------------------------------------------------------------------------------
A7AAJ2_9PORP/957-1147--------------------------------------------------------------------------------
A5IIW8_THEP1/74-230--------------------------------------------------------------------------------
A7LWH3_BACO1/23-209--------------------------------------------------------------------------------
Q01WT7_SOLUE/22-227--------------------------------------------------------------------------------
A6DM09_9BACT/22-216--------------------------------------------------------------------------------
A2TQP1_9FLAO/40-242--------------------------------------------------------------------------------
Q02B64_SOLUE/22-209--------------------------------------------------------------------------------
A6DTC7_9BACT/37-227--------------------------------------------------------------------------------
A6CA29_9PLAN/352-540--------------------------------------------------------------------------------
A6C8Y3_9PLAN/63-235--------------------------------------------------------------------------------
A3XPN2_LEEBM/32-218--------------------------------------------------------------------------------
A4A0Q4_9PLAN/26-218--------------------------------------------------------------------------------
A6E8U4_9SPHI/25-211--------------------------------------------------------------------------------
Q01UN1_SOLUE/9-241--------------------------------------------------------------------------------
A3ZQS2_9PLAN/31-212--------------------------------------------------------------------------------
A6DG40_9BACT/159-340--------------------------------------------------------------------------------
A6DLT3_9BACT/234-440--------------------------------------------------------------------------------
A6EKV1_9SPHI/655-832--------------------------------------------------------------------------------
A3ZY13_9PLAN/44-228--------------------------------------------------------------------------------
A6DLT3_9BACT/28-216--------------------------------------------------------------------------------
Q1AST8_RUBXD/20-211--------------------------------------------------------------------------------
A4FDZ7_SACEN/121-335--------------------------------------------------------------------------------
A7ABK7_9PORP/62-257--------------------------------------------------------------------------------
A6BYS0_9PLAN/54-263--------------------------------------------------------------------------------
Q01XX3_SOLUE/25-191--------------------------------------------------------------------------------
Q2Y669_NITMU/16-255--------------------------------------------------------------------------------
A3ZWI0_9PLAN/615-790--------------------------------------------------------------------------------
A3ZR79_9PLAN/39-201--------------------------------------------------------------------------------
A6CAH6_9PLAN/67-283--------------------------------------------------------------------------------
Q01TF2_SOLUE/30-207--------------------------------------------------------------------------------
Q2RZK0_SALRD/15-220--------------------------------------------------------------------------------
A6CGD1_9PLAN/671-851--------------------------------------------------------------------------------
A6C1K2_9PLAN/155-332--------------------------------------------------------------------------------
Q7UTX3_RHOBA/29-219--------------------------------------------------------------------------------
Q7UYB9_RHOBA/49-246--------------------------------------------------------------------------------
A3ZS39_9PLAN/38-281--------------------------------------------------------------------------------
Q026J8_SOLUE/86-284--------------------------------------------------------------------------------
A6EFU0_9SPHI/28-228--------------------------------------------------------------------------------
A7AG24_9PORP/243-456--------------------------------------------------------------------------------
A3ZX11_9PLAN/36-237--------------------------------------------------------------------------------
A6C3G1_9PLAN/151-333--------------------------------------------------------------------------------
Q7UWR3_RHOBA/519-700--------------------------------------------------------------------------------
Q7UZ09_RHOBA/53-231--------------------------------------------------------------------------------
A3ZQR2_9PLAN/150-327--------------------------------------------------------------------------------
A6C1I1_9PLAN/43-215--------------------------------------------------------------------------------
A6C5D8_9PLAN/56-241--------------------------------------------------------------------------------
A6DGI4_9BACT/22-219--------------------------------------------------------------------------------
Q7UKZ1_RHOBA/77-278--------------------------------------------------------------------------------
Q7ULK4_RHOBA/125-306--------------------------------------------------------------------------------
Q2Y774_NITMU/671-893--------------------------------------------------------------------------------
A6C6K0_9PLAN/64-244--------------------------------------------------------------------------------
A6LCM7_PARD8/20-194--------------------------------------------------------------------------------
Q027F9_SOLUE/8-228--------------------------------------------------------------------------------
A6DM04_9BACT/25-206--------------------------------------------------------------------------------
Q024Y0_SOLUE/27-212--------------------------------------------------------------------------------
A6CCA5_9PLAN/239-425--------------------------------------------------------------------------------
A3ZTD9_9PLAN/1170-1342--------------------------------------------------------------------------------
A3I2B6_9BACT/23-203--------------------------------------------------------------------------------
A4A0D3_9PLAN/28-213--------------------------------------------------------------------------------
Q7ULY5_RHOBA/234-440--------------------------------------------------------------------------------
A2U0D4_9FLAO/30-260--------------------------------------------------------------------------------
A3ZSI6_9PLAN/804-979--------------------------------------------------------------------------------
A4ASP0_MARSH/33-262--------------------------------------------------------------------------------
A6DNR0_9BACT/77-264--------------------------------------------------------------------------------
Q7UTX3_RHOBA/225-416--------------------------------------------------------------------------------
A4A202_9PLAN/27-207--------------------------------------------------------------------------------
Q7UYD6_RHOBA/61-249--------------------------------------------------------------------------------
A6DQD4_9BACT/44-244--------------------------------------------------------------------------------
Q7UYI5_RHOBA/85-260--------------------------------------------------------------------------------
A4APB3_MARSH/31-262--------------------------------------------------------------------------------
A4CHF9_ROBBH/43-248--------------------------------------------------------------------------------
A6LD40_PARD8/42-255--------------------------------------------------------------------------------
Q2GAA2_NOVAD/60-315--------------------------------------------------------------------------------
A3ZWI1_9PLAN/266-442--------------------------------------------------------------------------------
A3XQG8_LEEBM/44-246--------------------------------------------------------------------------------
L7CBW3_RHOBT/40-226--------------------------------------------------------------------------------
Q7URK6_RHOBA/266-443--------------------------------------------------------------------------------
A6LER8_PARD8/252-428--------------------------------------------------------------------------------
Q7US53_RHOBA/171-350--------------------------------------------------------------------------------
Q026X4_SOLUE/31-258--------------------------------------------------------------------------------
A3HX26_9BACT/40-244--------------------------------------------------------------------------------
A2TQP0_9FLAO/54-250--------------------------------------------------------------------------------
A3HS07_9BACT/30-219--------------------------------------------------------------------------------
A3ZR79_9PLAN/204-387--------------------------------------------------------------------------------
A3I0Y0_9BACT/33-262--------------------------------------------------------------------------------
A3ZT60_9PLAN/22-206--------------------------------------------------------------------------------
Q01RN4_SOLUE/31-268--------------------------------------------------------------------------------
A6C7J3_9PLAN/515-746--------------------------------------------------------------------------------
A3I2F1_9BACT/51-252--------------------------------------------------------------------------------
A4CGG3_ROBBH/243-451--------------------------------------------------------------------------------
K5D7N6_RHOBT/55-243--------------------------------------------------------------------------------
Q7UGD2_RHOBA/163-356--------------------------------------------------------------------------------
Q7UYA4_RHOBA/58-260--------------------------------------------------------------------------------

PF00337

Q9VPI7_DROME/41-166--------------------------------------------------------------------------------
Q9VPI7_DROME/226-369--------------------------------------------------------------------------------
Q7QF77_ANOGA/4-145--------------------------------------------------------------------------------
Q7QF77_ANOGA/165-293--------------------------------------------------------------------------------
Q7PPI9_ANOGA/742-883--------------------------------------------------------------------------------
Q7QHP5_ANOGA/12-144--------------------------------------------------------------------------------
Q18813_CAEEL/34-172--------------------------------------------------------------------------------
Q18813_CAEEL/180-310--------------------------------------------------------------------------------
LEG8_HUMAN/18-151--------------------------------------------------------------------------------
LEG8_HUMAN/186-316--------------------------------------------------------------------------------
Q9XVD0_CAEEL/131-257--------------------------------------------------------------------------------
B3GTH_ARATH/184-393--------------------------------------------------------------------------------
B3GTK_ARATH/190-404--------------------------------------------------------------------------------
LEG7_MOUSE/5-135--------------------------------------------------------------------------------
LEG3_MOUSE/131-261--------------------------------------------------------------------------------
LEG4_CHICK/4-134--------------------------------------------------------------------------------
Q7Q2T6_ANOGA/13-143--------------------------------------------------------------------------------
Q7PWU9_ANOGA/113-239--------------------------------------------------------------------------------
Q7PWU9_ANOGA/285-422--------------------------------------------------------------------------------
Q18625_CAEEL/13-145--------------------------------------------------------------------------------
LEG9_HUMAN/16-147--------------------------------------------------------------------------------
LEG4_PIG/18-149--------------------------------------------------------------------------------
LEG9_HUMAN/226-355--------------------------------------------------------------------------------
LEG4_PIG/193-323--------------------------------------------------------------------------------
LEC7_CAEEL/10-137--------------------------------------------------------------------------------
Q94215_CAEEL/11-140--------------------------------------------------------------------------------
Q9VPU6_DROME/164-300--------------------------------------------------------------------------------
Q9VPU6_DROME/3-145--------------------------------------------------------------------------------
Q7ZZ26_DANRE/9-141--------------------------------------------------------------------------------
O01329_CAEEL/100-226--------------------------------------------------------------------------------
O62353_CAEEL/138-266--------------------------------------------------------------------------------
Q18625_CAEEL/153-281--------------------------------------------------------------------------------
TECPR_DROME/815-954--------------------------------------------------------------------------------
LEG6_CHICK/3-133--------------------------------------------------------------------------------
Q9U2I7_CAEEL/14-147--------------------------------------------------------------------------------
GRIFN_RAT/4-132--------------------------------------------------------------------------------
GRIFN_DANRE/4-133--------------------------------------------------------------------------------
Q6AV44_ORYSJ/145-340--------------------------------------------------------------------------------
Q84T07_ORYSJ/162-372--------------------------------------------------------------------------------
B3GTI_ARATH/190-391--------------------------------------------------------------------------------
B3GTF_ARATH/170-363--------------------------------------------------------------------------------
B3GTG_ARATH/165-343--------------------------------------------------------------------------------
Q9VPI6_DROME/339-481--------------------------------------------------------------------------------
Q8SXU5_DROME/5-142--------------------------------------------------------------------------------
A1ZBB1_DROME/5-138--------------------------------------------------------------------------------
A4IHU8_XENTR/12-143--------------------------------------------------------------------------------
E7FEQ1_DANRE/97-223--------------------------------------------------------------------------------
F1QX26_DANRE/15-145--------------------------------------------------------------------------------
F6YWA7_MACMU/6-136--------------------------------------------------------------------------------
K1QS74_CRAGI/373-496--------------------------------------------------------------------------------
LEG2_HUMAN/7-128--------------------------------------------------------------------------------
LEG10_HUMAN/11-136--------------------------------------------------------------------------------
LEG12_MOUSE/29-158--------------------------------------------------------------------------------
W5JM94_ANODA/12-140--------------------------------------------------------------------------------

PF07675

Q7MUZ4_PORGI/41-208--------------------------------------------------------------------------------
HAGA1_PORGI/230-407--------------------------------------------------------------------------------
F5HGU5_PORGI/47-200--------------------------------------------------------------------------------
Q7MTE2_PORGI/1142-1311--------------------------------------------------------------------------------

PF00629

Q176I4_AEDAE/127-298--------------------------------------------------------------------------------
NRP2_HUMAN/646-802--------------------------------------------------------------------------------
Q7PZL9_ANOGA/167-335--------------------------------------------------------------------------------
MAMC2_HUMAN/170-329--------------------------------------------------------------------------------
MAMC2_HUMAN/509-666--------------------------------------------------------------------------------
ALK_HUMAN/480-636--------------------------------------------------------------------------------
MEP1B_HUMAN/265-429--------------------------------------------------------------------------------
PTPRM_HUMAN/27-184--------------------------------------------------------------------------------
PTPRU_DANRE/26-184--------------------------------------------------------------------------------
Q28WN9_DROPS/509-695--------------------------------------------------------------------------------
PTPRU_HUMAN/27-188--------------------------------------------------------------------------------
MEP1A_HUMAN/269-433--------------------------------------------------------------------------------
AEGP_MOUSE/661-815--------------------------------------------------------------------------------
AEGP_HUMAN/813-969--------------------------------------------------------------------------------
AEGP_HUMAN/656-809--------------------------------------------------------------------------------
AEGP_HUMAN/493-644--------------------------------------------------------------------------------
AEGP_HUMAN/271-425--------------------------------------------------------------------------------
AEGP_MOUSE/67-223--------------------------------------------------------------------------------
Q1RLY9_DANRE/637-804--------------------------------------------------------------------------------
PTPRU_CHICK/27-187--------------------------------------------------------------------------------
MEP1A_RAT/270-434--------------------------------------------------------------------------------
ENTK_BOVIN/363-520--------------------------------------------------------------------------------
A2AJX4_MOUSE/8-171--------------------------------------------------------------------------------
ZAN_RABIT/152-315--------------------------------------------------------------------------------
Q5TG12_HUMAN/36-194--------------------------------------------------------------------------------
MEP1B_RAT/266-430--------------------------------------------------------------------------------
Q28DN2_XENTR/27-184--------------------------------------------------------------------------------
NRP1_CHICK/641-801--------------------------------------------------------------------------------
Q17E33_AEDAE/237-421--------------------------------------------------------------------------------
AEGP_RAT/273-427--------------------------------------------------------------------------------
ZAN_PIG/149-312--------------------------------------------------------------------------------
AEGP_MOUSE/494-649--------------------------------------------------------------------------------
AEGP_MOUSE/979-1144--------------------------------------------------------------------------------
AEGP_RAT/817-973--------------------------------------------------------------------------------
Q17E33_AEDAE/18-192--------------------------------------------------------------------------------
Q176I3_AEDAE/155-323--------------------------------------------------------------------------------
B0S6D0_DANRE/630-787--------------------------------------------------------------------------------
B4HP69_DROSE/94-269--------------------------------------------------------------------------------
B4QA49_DROSI/136-311--------------------------------------------------------------------------------
B8JKC0_DANRE/268-432--------------------------------------------------------------------------------
D2HWA9_AILME/125-297--------------------------------------------------------------------------------
E1BZ39_CHICK/620-774--------------------------------------------------------------------------------
E9PWQ7_MOUSE/217-373--------------------------------------------------------------------------------
F1Q7F6_DANRE/345-500--------------------------------------------------------------------------------
F1QL06_DANRE/266-425--------------------------------------------------------------------------------
F1R3K1_DANRE/3-159--------------------------------------------------------------------------------
F1RDD1_DANRE/748-922--------------------------------------------------------------------------------
F5H0T8_HUMAN/373-535--------------------------------------------------------------------------------
F5H4B5_HUMAN/41-203--------------------------------------------------------------------------------
F6PMK1_XENTR/270-431--------------------------------------------------------------------------------
F6Q2U5_XENTR/171-329--------------------------------------------------------------------------------
F6RM13_MACMU/211-367--------------------------------------------------------------------------------
F6TDH8_CIOIN/81-235--------------------------------------------------------------------------------
F6ZQ08_XENTR/641-800--------------------------------------------------------------------------------
H3BVJ4_TETNG/269-432--------------------------------------------------------------------------------
H3BWX9_TETNG/646-801--------------------------------------------------------------------------------
H3CE92_TETNG/270-435--------------------------------------------------------------------------------
H3CJZ0_TETNG/58-219--------------------------------------------------------------------------------
H3CJZ0_TETNG/591-746--------------------------------------------------------------------------------
H3CQ93_TETNG/344-500--------------------------------------------------------------------------------
H3CU29_TETNG/52-210--------------------------------------------------------------------------------
H3DMT5_TETNG/350-507--------------------------------------------------------------------------------
H3DPC5_TETNG/223-385--------------------------------------------------------------------------------
L9KUF8_TUPCH/628-792--------------------------------------------------------------------------------
ENTK_MOUSE/392-549--------------------------------------------------------------------------------
MAMC2_MOUSE/342-497--------------------------------------------------------------------------------
NRP1_RAT/650-810--------------------------------------------------------------------------------
Q9VQS2_DROME/132-307--------------------------------------------------------------------------------

PF00457

U5MR46_CLOSA/70-253--------------------------------------------------------------------------------
XYNB_ASPFU/42-219--------------------------------------------------------------------------------
XYN3_MAGO7/54-234--------------------------------------------------------------------------------
F8DB45_HALXS/87-262--------------------------------------------------------------------------------
F9XDM7_MYCGM/45-223--------------------------------------------------------------------------------
M2QR82_CERS8/44-221--------------------------------------------------------------------------------
G7XIG9_ASPKW/42-219--------------------------------------------------------------------------------
A9G323_SORC5/221-397--------------------------------------------------------------------------------
G2QUC8_THITE/35-208--------------------------------------------------------------------------------
E3Q8W7_COLGM/43-217--------------------------------------------------------------------------------
A7EQZ6_SCLS1/49-220--------------------------------------------------------------------------------
K0J5P9_AMPXN/62-246--------------------------------------------------------------------------------
G4TKV8_PIRID/43-220--------------------------------------------------------------------------------
S8ATR1_PENO1/29-208--------------------------------------------------------------------------------
T0MBU2_COLGC/37-214--------------------------------------------------------------------------------
Q2UFR7_ASPOR/71-245--------------------------------------------------------------------------------
F7PGE0_9EURY/60-235--------------------------------------------------------------------------------
M9LS78_PSEA3/38-220--------------------------------------------------------------------------------
G1X5P3_ARTOA/57-231--------------------------------------------------------------------------------
E6UKJ6_RUMA7/55-250--------------------------------------------------------------------------------
G2XS85_BOTF4/46-225--------------------------------------------------------------------------------
C7Q365_CATAD/61-236--------------------------------------------------------------------------------
S7ZJ07_PENO1/39-216--------------------------------------------------------------------------------
E3QVD0_COLGM/44-216--------------------------------------------------------------------------------
G2X5X8_VERDV/37-215--------------------------------------------------------------------------------
C6WIK2_ACTMD/54-231--------------------------------------------------------------------------------
B1ZMX2_OPITP/39-216--------------------------------------------------------------------------------
A9EQP3_SORC5/210-404--------------------------------------------------------------------------------
F4H710_CELFA/52-228--------------------------------------------------------------------------------
S3E0R3_GLAL2/19-199--------------------------------------------------------------------------------
R0K9J6_SETT2/42-213--------------------------------------------------------------------------------
M7TVV3_BOTF1/41-218--------------------------------------------------------------------------------
T0KW32_COLGC/75-251--------------------------------------------------------------------------------
G0S9X3_CHATD/56-233--------------------------------------------------------------------------------
K5X1T9_AGABU/46-223--------------------------------------------------------------------------------
S3DEM3_GLAL2/50-221--------------------------------------------------------------------------------
B8M5E1_TALSN/53-227--------------------------------------------------------------------------------
V5FWP5_BYSSN/38-215--------------------------------------------------------------------------------
D9SP57_CLOC7/41-225--------------------------------------------------------------------------------
A8P4P6_COPC7/104-288--------------------------------------------------------------------------------
Q0UI10_PHANO/28-204--------------------------------------------------------------------------------
Q47QL8_THEFY/52-227--------------------------------------------------------------------------------
G2QWT6_THITE/50-225--------------------------------------------------------------------------------
R6YEV7_9FIRM/39-222--------------------------------------------------------------------------------
Q21G61_SACD2/43-220--------------------------------------------------------------------------------
F7W2U2_SORMK/27-207--------------------------------------------------------------------------------
R4LPY0_9ACTO/53-232--------------------------------------------------------------------------------
XYNB_ASPFN/42-219--------------------------------------------------------------------------------
C9RK54_FIBSS/46-247--------------------------------------------------------------------------------
XYNC_STRCO/61-238--------------------------------------------------------------------------------
S7ZVQ9_PENO1/51-226--------------------------------------------------------------------------------
G4UC47_NEUT9/40-217--------------------------------------------------------------------------------
E3QHP2_COLGM/50-227--------------------------------------------------------------------------------
M1W9A1_CLAP2/39-214--------------------------------------------------------------------------------
A8NZY3_COPC7/34-216--------------------------------------------------------------------------------
G2Q4M3_THIHA/47-221--------------------------------------------------------------------------------
A8NW94_COPC7/49-232--------------------------------------------------------------------------------
E3S3R6_PYRTT/42-215--------------------------------------------------------------------------------
G4TKT5_PIRID/54-231--------------------------------------------------------------------------------
Q2HCI0_CHAGB/40-217--------------------------------------------------------------------------------
I3VTR8_THESW/29-209--------------------------------------------------------------------------------
B3PIN1_CELJU/38-224--------------------------------------------------------------------------------
K5WVZ1_PHACS/44-221--------------------------------------------------------------------------------
G0SAF9_CHATD/37-199--------------------------------------------------------------------------------
G4TKT3_PIRID/54-231--------------------------------------------------------------------------------
S8AJR6_DACHA/43-221--------------------------------------------------------------------------------
M1LSN7_9CLOT/30-211--------------------------------------------------------------------------------
F0XC21_GROCL/46-221--------------------------------------------------------------------------------
M4GA15_MAGP6/41-223--------------------------------------------------------------------------------
B2A9I4_PODAN/43-221--------------------------------------------------------------------------------
G2X4G1_VERDV/41-216--------------------------------------------------------------------------------
B8MND2_TALSN/59-232--------------------------------------------------------------------------------
A9GHF8_SORC5/306-501--------------------------------------------------------------------------------
E5A0Q4_LEPMJ/78-250--------------------------------------------------------------------------------
G4U378_PIRID/48-223--------------------------------------------------------------------------------
C9RLL3_FIBSS/44-238--------------------------------------------------------------------------------
B2WG17_PYRTR/46-223--------------------------------------------------------------------------------
XYNA_BACSU/29-211--------------------------------------------------------------------------------
XYNA_EMENI/46-223--------------------------------------------------------------------------------
XYN3_ASPKW/29-208--------------------------------------------------------------------------------
E6UBP6_RUMA7/65-254--------------------------------------------------------------------------------
C7YSL3_NECH7/42-220--------------------------------------------------------------------------------
N1PCA4_MYCP1/49-227--------------------------------------------------------------------------------
G0R947_HYPJQ/52-226--------------------------------------------------------------------------------
G2Q913_THIHA/39-217--------------------------------------------------------------------------------
B2B3J5_PODAN/53-231--------------------------------------------------------------------------------
Q9KEF3_BACHD/29-208--------------------------------------------------------------------------------
Q2GN95_CHAGB/35-214--------------------------------------------------------------------------------
A9EUR0_SORC5/153-329--------------------------------------------------------------------------------
S8AS02_DACHA/46-242--------------------------------------------------------------------------------
U7Q3B8_SPOS1/53-234--------------------------------------------------------------------------------
J3NW75_GAGT3/48-227--------------------------------------------------------------------------------
G4TKT1_PIRID/54-222--------------------------------------------------------------------------------
XY11A_USTMA/36-218--------------------------------------------------------------------------------
M7SU57_EUTLA/19-190--------------------------------------------------------------------------------
B6QV47_PENMQ/55-228--------------------------------------------------------------------------------
M3CYK1_SPHMS/48-225--------------------------------------------------------------------------------
K1X7K7_MARBU/40-238--------------------------------------------------------------------------------
G2NBA0_9ACTO/53-228--------------------------------------------------------------------------------
U7PQP8_SPOS1/44-215--------------------------------------------------------------------------------
G0RUP7_HYPJQ/43-221--------------------------------------------------------------------------------
G8LXE2_CLOCD/39-223--------------------------------------------------------------------------------
T0L8D6_COLGC/39-215--------------------------------------------------------------------------------
G2QV82_THITE/46-224--------------------------------------------------------------------------------
Q2H5I3_CHAGB/51-228--------------------------------------------------------------------------------
XYN4_MAGO7/51-228--------------------------------------------------------------------------------
G8LXE2_CLOCD/424-608--------------------------------------------------------------------------------
K1WWU0_MARBU/46-224--------------------------------------------------------------------------------
C7PX63_CATAD/51-229--------------------------------------------------------------------------------
S8AMN0_PENO1/42-221--------------------------------------------------------------------------------
F4FB94_VERMA/40-218--------------------------------------------------------------------------------
E3S9S5_PYRTT/49-227--------------------------------------------------------------------------------
B8NYB7_ASPFN/69-243--------------------------------------------------------------------------------
J3NLQ4_GAGT3/38-211--------------------------------------------------------------------------------
L7VQD8_CLOSH/42-225--------------------------------------------------------------------------------
L0EBB6_THECK/28-208--------------------------------------------------------------------------------
A8FE31_BACP2/38-219--------------------------------------------------------------------------------
G4U379_PIRID/50-216--------------------------------------------------------------------------------
E3Q964_COLGM/44-223--------------------------------------------------------------------------------
C5BU21_TERTT/52-237--------------------------------------------------------------------------------
B8I7X1_CLOCE/38-221--------------------------------------------------------------------------------
A8NKZ6_COPC7/44-228--------------------------------------------------------------------------------
Q11SH7_CYTH3/43-226--------------------------------------------------------------------------------
B8I371_CLOCE/30-210--------------------------------------------------------------------------------
I2FN07_USTH4/36-218--------------------------------------------------------------------------------
G4TKT4_PIRID/54-231--------------------------------------------------------------------------------
C9Z2V1_STRSW/53-229--------------------------------------------------------------------------------
S8AP92_PENO1/40-211--------------------------------------------------------------------------------
T0K1I6_COLGC/42-222--------------------------------------------------------------------------------
C7ZN05_NECH7/1-172--------------------------------------------------------------------------------
XYNC_FIBSS/52-240--------------------------------------------------------------------------------
G1X9B1_ARTOA/43-221--------------------------------------------------------------------------------
A9GEL6_SORC5/142-318--------------------------------------------------------------------------------
K2RN85_MACPH/42-220--------------------------------------------------------------------------------
R4LM27_9ACTO/54-231--------------------------------------------------------------------------------
D5UGI1_CELFN/51-229--------------------------------------------------------------------------------
Q2HI25_CHAGB/36-208--------------------------------------------------------------------------------
XYNC_FIBSS/327-512--------------------------------------------------------------------------------
G4N696_MAGO7/47-225--------------------------------------------------------------------------------
G8SKM4_ACTS5/52-226--------------------------------------------------------------------------------
M2TBN8_COCH5/42-219--------------------------------------------------------------------------------
N1PGQ5_MYCP1/47-227--------------------------------------------------------------------------------
XYNA_GIBZE/50-227--------------------------------------------------------------------------------
B2WK18_PYRTR/41-214--------------------------------------------------------------------------------
S8AF15_DACHA/44-214--------------------------------------------------------------------------------
C5BMU2_TERTT/37-214--------------------------------------------------------------------------------
B6QNP6_PENMQ/54-227--------------------------------------------------------------------------------
U7PKR6_SPOS1/52-230--------------------------------------------------------------------------------
G3XY88_ASPNA/57-232--------------------------------------------------------------------------------
G9NQ12_HYPAI/48-222--------------------------------------------------------------------------------
F7W777_SORMK/45-222--------------------------------------------------------------------------------
Q0UBJ9_PHANO/41-216--------------------------------------------------------------------------------
T0JLP7_COLGC/68-241--------------------------------------------------------------------------------
D8PN69_SCHCM/41-226--------------------------------------------------------------------------------
C7ZC92_NECH7/39-216--------------------------------------------------------------------------------
B8E1P4_DICTD/41-222--------------------------------------------------------------------------------
D1BXH1_XYLCX/54-230--------------------------------------------------------------------------------
F0S4T0_PEDSD/87-269--------------------------------------------------------------------------------
G9MV13_HYPVG/54-228--------------------------------------------------------------------------------
Q2HCI7_CHAGB/53-216--------------------------------------------------------------------------------
L0E9J8_THECK/24-202--------------------------------------------------------------------------------
E4N0N4_KITSK/54-229--------------------------------------------------------------------------------
J3PC50_GAGT3/50-229--------------------------------------------------------------------------------
Q0CMZ1_ASPTN/41-218--------------------------------------------------------------------------------
S3D920_GLAL2/48-226--------------------------------------------------------------------------------
E6X8Q5_CELAD/57-241--------------------------------------------------------------------------------
F9F5R3_FUSOF/43-220--------------------------------------------------------------------------------
XYNB_ASPCL/42-219--------------------------------------------------------------------------------
G2Q4S6_THIHA/47-224--------------------------------------------------------------------------------
Q0UBV5_PHANO/22-194--------------------------------------------------------------------------------
G2X8M4_VERDV/40-224--------------------------------------------------------------------------------
H1YIW2_9SPHI/65-249--------------------------------------------------------------------------------
M7STD0_EUTLA/43-222--------------------------------------------------------------------------------
D4LFB0_RUMC1/42-232--------------------------------------------------------------------------------

PF01670

GUNA_ASPKW/28-239--------------------------------------------------------------------------------
G0RRG8_HYPJQ/29-234--------------------------------------------------------------------------------
Q2UFR8_ASPOR/29-239--------------------------------------------------------------------------------
Q9RJY3_STRCO/54-261--------------------------------------------------------------------------------
Q9S5X8_THEMA/18-255--------------------------------------------------------------------------------

PF00722

XTH8_ARATH/38-224--------------------------------------------------------------------------------
XTH1_ARATH/36-215--------------------------------------------------------------------------------
Q6BHG8_DEBHA/45-215--------------------------------------------------------------------------------
Q6BH77_DEBHA/56-228--------------------------------------------------------------------------------
Q6BH39_DEBHA/52-224--------------------------------------------------------------------------------
Q6BRL2_DEBHA/100-275--------------------------------------------------------------------------------
Q7CTY9_AGRT5/57-234--------------------------------------------------------------------------------
Q7CSS8_AGRT5/263-456--------------------------------------------------------------------------------
EXOK_RHIME/58-245--------------------------------------------------------------------------------
BRU1_SOYBN/32-213--------------------------------------------------------------------------------
Q6FNU8_CANGA/147-325--------------------------------------------------------------------------------
XTH10_ARATH/37-218--------------------------------------------------------------------------------
CRH2_YEAST/96-273--------------------------------------------------------------------------------
CRR1_ASHGO/155-333--------------------------------------------------------------------------------
XTH13_ARATH/26-207--------------------------------------------------------------------------------
Q7XTP9_ORYSJ/31-215--------------------------------------------------------------------------------
Q6ES26_ORYSJ/32-215--------------------------------------------------------------------------------
XTH31_ARATH/39-223--------------------------------------------------------------------------------
Q5AXN2_EMENI/49-224--------------------------------------------------------------------------------
Q6FWX2_CANGA/97-274--------------------------------------------------------------------------------
XTH33_ARATH/43-226--------------------------------------------------------------------------------
GUB_BACSU/54-238--------------------------------------------------------------------------------
Q6ZAN9_ORYSJ/28-212--------------------------------------------------------------------------------
Q7XNY6_ORYSJ/36-222--------------------------------------------------------------------------------
Q6Z2L4_ORYSJ/35-220--------------------------------------------------------------------------------
Q6RHY1_SOLLC/27-212--------------------------------------------------------------------------------
Q6CIZ6_KLULA/49-219--------------------------------------------------------------------------------
Q84T83_ORYSJ/36-221--------------------------------------------------------------------------------
Q8H7Q1_ORYSJ/3-189--------------------------------------------------------------------------------
Q8GVQ2_ORYSJ/40-224--------------------------------------------------------------------------------
Q6C4P9_YARLI/48-219--------------------------------------------------------------------------------
CRH1_YEAST/65-235--------------------------------------------------------------------------------
XTH17_ARATH/29-211--------------------------------------------------------------------------------
Q6ZAN8_ORYSJ/30-214--------------------------------------------------------------------------------
XTH2_ARATH/32-212--------------------------------------------------------------------------------
Q8GVR3_ORYSJ/46-232--------------------------------------------------------------------------------
XTH28_ARATH/31-216--------------------------------------------------------------------------------
Q7SGL2_NEUCR/50-224--------------------------------------------------------------------------------
Q5KNP5_CRYNJ/97-278--------------------------------------------------------------------------------
Q6YUP5_ORYSJ/36-221--------------------------------------------------------------------------------
Q9FZ05_SOLLC/27-209--------------------------------------------------------------------------------
Q825L5_STRAW/78-287--------------------------------------------------------------------------------
UTR2_CANAL/100-275--------------------------------------------------------------------------------
Q7S222_NEUCR/48-222--------------------------------------------------------------------------------
Q6Z998_ORYSJ/39-226--------------------------------------------------------------------------------
Q7N1F8_PHOLL/52-255--------------------------------------------------------------------------------
Q97FD3_CLOAB/57-242--------------------------------------------------------------------------------
CRR1_YEAST/147-325--------------------------------------------------------------------------------
Q7XBU8_ORYSJ/32-215--------------------------------------------------------------------------------
XTH32_ARATH/43-227--------------------------------------------------------------------------------
XTH26_ARATH/29-208--------------------------------------------------------------------------------
Q82M60_STRAW/400-624--------------------------------------------------------------------------------
Q6K9X1_ORYSJ/50-242--------------------------------------------------------------------------------
XTH21_ARATH/28-209--------------------------------------------------------------------------------
Q7S7D0_NEUCR/61-233--------------------------------------------------------------------------------
XTH25_ARATH/30-211--------------------------------------------------------------------------------
Q6FSM3_CANGA/48-218--------------------------------------------------------------------------------
Q6ES25_ORYSJ/25-208--------------------------------------------------------------------------------
Q5Z746_ORYSJ/26-208--------------------------------------------------------------------------------
CRH11_CANAL/50-220--------------------------------------------------------------------------------
Q5B4L5_EMENI/96-273--------------------------------------------------------------------------------
Q5Z6H1_ORYSJ/36-217--------------------------------------------------------------------------------
XTH24_ARATH/24-205--------------------------------------------------------------------------------
Q98C78_RHILO/80-268--------------------------------------------------------------------------------
Q7SBQ2_NEUCR/99-274--------------------------------------------------------------------------------
Q8XNF8_CLOPE/412-635--------------------------------------------------------------------------------
XTH1_SOLLC/33-214--------------------------------------------------------------------------------
Q7XTP8_ORYSJ/24-207--------------------------------------------------------------------------------
Q6CL87_KLULA/145-322--------------------------------------------------------------------------------
XTH3_ARATH/35-213--------------------------------------------------------------------------------
GUB_CLOTH/57-238--------------------------------------------------------------------------------
B9RG34_RICCO/58-238--------------------------------------------------------------------------------
C5Z8T4_SORBI/33-213--------------------------------------------------------------------------------
D3EBX7_GEOS4/64-257--------------------------------------------------------------------------------
D7SNC1_VITVI/38-220--------------------------------------------------------------------------------
E7FHE7_PYRFU/86-290--------------------------------------------------------------------------------
F2D903_HORVD/30-212--------------------------------------------------------------------------------
F2DT99_HORVD/27-208--------------------------------------------------------------------------------
F2DUU5_HORVD/27-204--------------------------------------------------------------------------------
G2XIS4_VERDV/50-220--------------------------------------------------------------------------------
G4NC59_MAGO7/98-270--------------------------------------------------------------------------------
K4DD58_SOLLC/24-203--------------------------------------------------------------------------------
M1AN43_SOLTU/24-201--------------------------------------------------------------------------------
M4EZF0_BRARP/17-194--------------------------------------------------------------------------------
Q5L861_BACFN/78-272--------------------------------------------------------------------------------
Q9WXN1_THEMA/253-454--------------------------------------------------------------------------------
T0UMT6_9STRE/50-231--------------------------------------------------------------------------------
V4IZ43_9ACTO/74-282--------------------------------------------------------------------------------
W5I2U1_WHEAT/24-204--------------------------------------------------------------------------------

PF03935

Q6BW61_DEBHA/174-674FPLHIDEKEPDDYLHNPDPLKDAAYDKNRFFYDLKNMDRRSMGGLLGVVFLIVAAVVVFILLPILTYS...GITEPYTP.
Q0UQN1_PHANO/94-573WPLIGDKDESDDEMHMP....REDDDIKYKAKLSDHFNRDSIASTIGLAIMIVGLLFIFIALPVMSFT...GAIEYNSSW
A5DEX4_PICGU/157-655FPLHIDEKEPDDYLHNPDPIADASYDKNRFMYDLKNMDRRSMGGLFGIIFLVIAVICVFILFPVLTYS...GVADHYTP.
A1C6M7_ASPCL/154-653LLLFPEDVEKDDHLHNPDP........SDREGQCDLWNRRGIINVAGLILLTLGFLILFIGYPMITAMK.GTVKSGPTCD
Q752M9_ASHGO/153-654FPLLIDEKEDDDYLHNPDPEEESRLDKQRFLLDLKHMDKRSAGGFVGILLLFIGGLMLFIVLPVLTYT...GAVEHHHA.
Q5KJ60_CRYNJ/92-619QGPIDDDDDMDDHLHTF.....TAAEKKDLSTPFNISSWRGWANALTLAVLAGGGVMLFAGYPIISFYY.GDDSSSGSNT
Q4P2E5_USTMA/148-679GIASSFQDEDDDWLHDP.......KAKSTVGTAESLTSMRGLLNVGTLLLIGLCLLMLFLGYPVLIEI...RKKYADGT.
A5DZI8_LODEL/240-745FPLSIDEKEPDDYLHNPDPVKDAEYEKNRFVYDMKNLDRRSLGGLIGLIVMALGALCVFVVLPALTYS...GATEHYKP.
Q4PGA6_USTMA/384-919WGDYDAESEPDDYLHEPDAEKYRNASSAK.....EMLSPRGLLNIGTLTVIGLGLILLFGGYPVISWL....SRSKASTK
Q4P8J4_USTMA/197-732WDTMDGKQEPDDDLHDP.....QVLPDIKHGWFGGAVGSRGVLNVGVLALLSMALVLLFGGYPIISYF....GRRHESTK
YEPB_SCHPO/124-627LSWVYRSKEEDDDFHDP......KSSVVSLMGEEDYLGWSRFCDLFFLFVLSLGIGLLFIVFPALTFT...GNITPSKEK
YEOB_SCHPO/134-636FSLSREDKEIDDFLHYPLPAKDAK.......KLSYFVGGEGLMQLLFLLFLAAGTGMLFIGLPILTYT...GHNSLAS..
A7TTP7_VANPO/229-744FPLLFDEKEDDDFLHNPDPEEEARLYKKRFVYDLQHMSRRSIGGWLGILLLLCGGAVVFIVIPALTYT...GFVDRGDRP
A5DZ87_LODEL/332-841FPLDINDKEADDHLHNPDPIQDAKYEKNRFWYDLKNGDSRSRLGIAGFVFLLAAAIAVFVVLPSLTYT...GVTDHKAVP
Q6FUB1_CANGA/183-684FPLLMEEKEDDDYLHNPDPEEEARLDRKRFSNDFKYMDKRSAGGLAGVLFLFIGLGCLFILLPALTYT...GVTEHAKP.
A7E6J8_SCLS1/168-668LLLFPEDVEKDDYLHNPDP.......SDKDLDKCDIWNRRGLTNVGGLIFIVLGVLALFVAYPVVTFVKDKIDPTHGAC.
Q5AEC0_CANAL/212-718FPLNIDEKEPDDYLHNPDPVHDVIYEKNRFWNDLKTADRKSFGGILGFLFLIAAAVAVFVVVPALTYS...GVTTHSPP.
A3LPW0_PICST/189-695FPLHIDEKEADDYLHNPDPVVDAEYDKNRFIYDLKNMDKRSLGGLIGLIVLFIAGLCVFVVLPALTFS...NVTHHSSI.
A7EWT0_SCLS1/211-717FILYDDEIEDDDDLHMP....HDNDDRDFKPTWYEWLERRSLINAIGGVFMVIGLLCVFILLPVLTFATRVWSTGREGSG
Q5KHK4_CRYNJ/69-588WGPMTTGPEEDDWMHNPDPIKNRNYDRGT......IFTPRGLINVGCLVMLILCLVTLFAGYPIITHF....TDTEIKTN
Q0UKL9_PHANO/161-653LLLFPEDVEKDDYLHNPDP.......NEKEQRDCDIFTRRGMVNVGGLAFLALGLLALFVGYPVLTFVDKMTKPEKGPCT
A3LPU3_PICST/148-653FPLYIDEKEPDDYLHNPDPVKDAEYDKNRFVYDLKTLDKRALGGLLGVIFLLVAAICVFVVLPVLTFS...RAGVHYTP.
Q6FQ11_CANGA/223-736FPLSMDEKEDDDFLHNPDPEEEARLDKHRFSEDLKHMNKKSFGGILGVLFLFLGAIALFIILPVLTYS...GAVDHHDNN
E7LUU1_YEASV/250-763.PLTLDEKEDDDYIHNPNVEEEAKLDRRRFVDDFKHMDRRSFLGLLGILFLFMAGIFIFIVLPAITFS...GVVYHHEHV
M7NJX3_PNEMU/194-674.....NIAEPDDYLHNP........ATKEKRKDYCIFTKRGILNIGSLVILIFGIISFFIGYPILLYA...RKIYEDIH.
Q5A4H2_CANAL/99-596.PLSIDEKEPDDYLHNPDPVQDAEYDKNRFLYDLKTMDKKSMNGLIAFIVMFLIAIAIFIILPVFTYT...GYNPKAKN.

PF10287

K0KZR6_WICCF/233-464--------------------------------------------------------------------------------
I2H1W8_TETBL/107-341--------------------------------------------------------------------------------
D0N3P2_PHYIT/250-486--------------------------------------------------------------------------------
A7TFI3_VANPO/109-343--------------------------------------------------------------------------------
N1PMX9_MYCP1/238-461--------------------------------------------------------------------------------
G0VAP6_NAUCC/104-338--------------------------------------------------------------------------------
S9W8F8_SCHCR/234-466--------------------------------------------------------------------------------
C5GJ05_AJEDR/167-389--------------------------------------------------------------------------------
K3W690_PYTUL/247-486--------------------------------------------------------------------------------
I2GUP8_TETBL/154-386--------------------------------------------------------------------------------
A5DXV9_LODEL/227-457--------------------------------------------------------------------------------
C4XY08_CLAL4/110-342--------------------------------------------------------------------------------
M3A440_MYCFI/207-432--------------------------------------------------------------------------------
D0MRW8_PHYIT/313-551--------------------------------------------------------------------------------
W1QLM9_OGAPD/217-448--------------------------------------------------------------------------------
C5DKG4_LACTC/102-336--------------------------------------------------------------------------------
J7R3E5_KAZNA/106-340--------------------------------------------------------------------------------
G0VBJ0_NAUCC/237-460--------------------------------------------------------------------------------
I2H8C5_TETBL/275-505--------------------------------------------------------------------------------
Q75A62_ASHGO/259-490--------------------------------------------------------------------------------
E3RIT6_PYRTT/99-331--------------------------------------------------------------------------------
B6JWV1_SCHJY/233-464--------------------------------------------------------------------------------
A5DNR6_PICGU/97-330--------------------------------------------------------------------------------
G8Y3C3_PICSO/237-463--------------------------------------------------------------------------------
C5M9J2_CANTT/224-453--------------------------------------------------------------------------------
G3AKA2_SPAPN/103-336--------------------------------------------------------------------------------
G3ARF7_SPAPN/199-428--------------------------------------------------------------------------------
G3JJN7_CORMM/201-421--------------------------------------------------------------------------------
C7YIC0_NECH7/221-441--------------------------------------------------------------------------------
Q0UV14_PHANO/96-328--------------------------------------------------------------------------------
K0KM65_WICCF/142-376--------------------------------------------------------------------------------
G1XB81_ARTOA/196-429--------------------------------------------------------------------------------
M1W9S2_CLAP2/235-455--------------------------------------------------------------------------------
Q6FJK5_CANGA/212-435--------------------------------------------------------------------------------
R1ESJ6_BOTPV/247-467--------------------------------------------------------------------------------
D0N6Y2_PHYIT/175-409--------------------------------------------------------------------------------
C5DIE9_LACTC/221-452--------------------------------------------------------------------------------
G8BET5_CANPC/99-332--------------------------------------------------------------------------------
G8JQC7_ERECY/209-441--------------------------------------------------------------------------------
E3G0R9_STIAD/153-380--------------------------------------------------------------------------------
C4R9F6_PICPG/189-423--------------------------------------------------------------------------------
L8G239_PSED2/205-429--------------------------------------------------------------------------------
A7TMJ4_VANPO/222-451--------------------------------------------------------------------------------
C5DXY8_ZYGRC/256-484--------------------------------------------------------------------------------
G3B3K2_CANTC/207-428--------------------------------------------------------------------------------
G0W356_NAUDC/104-338--------------------------------------------------------------------------------
Q7SG43_NEUCR/112-341--------------------------------------------------------------------------------
K3WLE5_PYTUL/196-423--------------------------------------------------------------------------------
S3DKR2_GLAL2/298-524--------------------------------------------------------------------------------
F2PH39_TRIEC/193-423--------------------------------------------------------------------------------
M2N8D8_BAUCO/220-449--------------------------------------------------------------------------------
Q6BRM6_DEBHA/197-423--------------------------------------------------------------------------------
C5M5H0_CANTT/101-334--------------------------------------------------------------------------------
G8ZNQ8_TORDC/230-458--------------------------------------------------------------------------------
D5GIX3_TUBMM/208-444--------------------------------------------------------------------------------
A3LP10_PICST/207-435--------------------------------------------------------------------------------
R4XDU4_TAPDE/242-471--------------------------------------------------------------------------------
A7TGR9_VANPO/102-336--------------------------------------------------------------------------------
H3H0J0_PHYRM/316-553--------------------------------------------------------------------------------
Q757Z0_ASHGO/117-351--------------------------------------------------------------------------------
Q5AJN2_CANAL/226-456--------------------------------------------------------------------------------
M3D6U8_SPHMS/213-438--------------------------------------------------------------------------------
H3GMI5_PHYRM/341-578--------------------------------------------------------------------------------
I2H9Q2_TETBL/105-339--------------------------------------------------------------------------------
G8ZYU9_TORDC/104-337--------------------------------------------------------------------------------
S0DQ79_GIBF5/217-437--------------------------------------------------------------------------------
M4BGZ3_HYAAE/337-572--------------------------------------------------------------------------------
F9XBT5_MYCGM/245-464--------------------------------------------------------------------------------
G8BXS9_TETPH/170-397--------------------------------------------------------------------------------
H2AXG7_KAZAF/104-337--------------------------------------------------------------------------------
U4LN65_PYROM/147-371--------------------------------------------------------------------------------
J7RTK3_KAZNA/245-466--------------------------------------------------------------------------------
C5FXD0_ARTOC/196-427--------------------------------------------------------------------------------
Q6CGN1_YARLI/220-451--------------------------------------------------------------------------------
G2WT64_VERDV/218-439--------------------------------------------------------------------------------
Q6FJ92_CANGA/109-343--------------------------------------------------------------------------------
G4U9Y4_NEUT9/21-245--------------------------------------------------------------------------------
E4ZV72_LEPMJ/267-498--------------------------------------------------------------------------------
G8BU49_TETPH/100-334--------------------------------------------------------------------------------
W1QLK8_OGAPD/133-365--------------------------------------------------------------------------------
G8JX30_ERECY/121-347--------------------------------------------------------------------------------
Q6CXP7_KLULA/106-342--------------------------------------------------------------------------------
C4JID9_UNCRE/192-415--------------------------------------------------------------------------------
Q6CVS7_KLULA/216-447--------------------------------------------------------------------------------
H2AXG9_KAZAF/107-341--------------------------------------------------------------------------------
A7TQU3_VANPO/143-371--------------------------------------------------------------------------------
K3XBG2_PYTUL/358-594--------------------------------------------------------------------------------
M7SLD2_EUTLA/204-432--------------------------------------------------------------------------------
R7YJQ9_CONA1/229-450--------------------------------------------------------------------------------
H6BRJ0_EXODN/215-434--------------------------------------------------------------------------------
K3X9Z2_PYTUL/110-344--------------------------------------------------------------------------------
L2FRA0_COLGN/221-441--------------------------------------------------------------------------------
Q7SG41_NEUCR/178-394--------------------------------------------------------------------------------
A5DBA4_PICGU/200-428--------------------------------------------------------------------------------
K2RHU7_MACPH/245-465--------------------------------------------------------------------------------
Q7SG42_NEUCR/163-390--------------------------------------------------------------------------------
YH6B_SCHPO/264-495--------------------------------------------------------------------------------
J8Q0R9_SACAR/105-339--------------------------------------------------------------------------------
K1XZI2_MARBU/332-545--------------------------------------------------------------------------------
F0UMR1_AJEC8/199-421--------------------------------------------------------------------------------
I2H2C5_TETBL/110-343--------------------------------------------------------------------------------
E9EMJ7_METAR/226-457--------------------------------------------------------------------------------
G3AYC4_CANTC/101-337--------------------------------------------------------------------------------
H2AVQ7_KAZAF/220-440--------------------------------------------------------------------------------
E4UXS3_ARTGP/195-422--------------------------------------------------------------------------------
U1HUX4_ENDPU/201-424--------------------------------------------------------------------------------
A7F2W5_SCLS1/255-477--------------------------------------------------------------------------------
C4R2B9_PICPG/119-353--------------------------------------------------------------------------------
F2SIK0_TRIRC/197-428--------------------------------------------------------------------------------
C4Y1A3_CLAL4/229-457--------------------------------------------------------------------------------

PF00840

K1WCU0_MARBU/20-452--------------------------------------------------------------------------------
G3XZK9_ASPNA/20-448--------------------------------------------------------------------------------
F4PY37_DICFS/22-455--------------------------------------------------------------------------------
G1XV93_ARTOA/22-459--------------------------------------------------------------------------------
L8WSW0_THACA/22-455--------------------------------------------------------------------------------
G2QZA7_THITE/22-417--------------------------------------------------------------------------------
E4ZFU3_LEPMJ/20-452--------------------------------------------------------------------------------
M2UA27_COCH5/21-452--------------------------------------------------------------------------------
E3L6D5_PUCGT/29-447--------------------------------------------------------------------------------
S3D4J2_GLAL2/21-452--------------------------------------------------------------------------------
I1FU52_AMPQE/20-456--------------------------------------------------------------------------------
B6QIG2_PENMQ/28-458--------------------------------------------------------------------------------
G2WXB9_VERDV/20-447--------------------------------------------------------------------------------
Q7S390_NEUCR/20-440--------------------------------------------------------------------------------
V2WZE7_MONRO/22-456--------------------------------------------------------------------------------
A7EUL3_SCLS1/19-449--------------------------------------------------------------------------------
S3CP84_GLAL2/21-459--------------------------------------------------------------------------------
N4UZJ1_COLOR/19-440--------------------------------------------------------------------------------
G7XKW4_ASPKW/24-460--------------------------------------------------------------------------------
F7W7F9_SORMK/30-440--------------------------------------------------------------------------------
G2YS63_BOTF4/20-452--------------------------------------------------------------------------------
E3K8B1_PUCGT/22-457--------------------------------------------------------------------------------
Q55FE6_DICDI/22-455--------------------------------------------------------------------------------
M2N728_BAUCO/20-450--------------------------------------------------------------------------------
R8BSD2_TOGMI/20-444--------------------------------------------------------------------------------
G2Q359_THIHA/20-453--------------------------------------------------------------------------------
G4V088_NEUT9/21-421--------------------------------------------------------------------------------
B2AQ71_PODAN/25-431--------------------------------------------------------------------------------
S7ZRD6_PENO1/28-461--------------------------------------------------------------------------------
CBHB_ASPFU/29-463--------------------------------------------------------------------------------
U4LWF8_PYROM/21-452--------------------------------------------------------------------------------
F7W4B0_SORMK/24-424--------------------------------------------------------------------------------
G2WQW0_VERDV/20-447--------------------------------------------------------------------------------
B2A8V6_PODAN/19-451--------------------------------------------------------------------------------
R8BMF8_TOGMI/19-453--------------------------------------------------------------------------------
L2FC27_COLGN/19-441--------------------------------------------------------------------------------
H1W5V0_COLHI/19-443--------------------------------------------------------------------------------
M4GCD6_MAGP6/30-424--------------------------------------------------------------------------------
M2QWB1_CERS8/85-519--------------------------------------------------------------------------------
D8QBJ3_SCHCM/21-453--------------------------------------------------------------------------------
E3KSU8_PUCGT/22-454--------------------------------------------------------------------------------
U4L139_PYROM/20-454--------------------------------------------------------------------------------
S3CAD2_OPHP1/20-451--------------------------------------------------------------------------------
G0S477_CHATD/21-451--------------------------------------------------------------------------------
C7ZHP8_NECH7/23-415--------------------------------------------------------------------------------
R0K7Q4_SETT2/24-451--------------------------------------------------------------------------------
M4BUX1_HYAAE/30-470--------------------------------------------------------------------------------
G2WZP1_VERDV/20-456--------------------------------------------------------------------------------
N4UQR7_COLOR/21-445--------------------------------------------------------------------------------
U7Q8V8_SPOS1/21-424--------------------------------------------------------------------------------
J3Q1X0_PUCT1/27-447--------------------------------------------------------------------------------
M4G9M2_MAGP6/27-444--------------------------------------------------------------------------------
B6HC69_PENCW/20-452--------------------------------------------------------------------------------
Q2GUM4_CHAGB/23-447--------------------------------------------------------------------------------
U7PKV6_SPOS1/26-451--------------------------------------------------------------------------------
K1WM38_MARBU/21-461--------------------------------------------------------------------------------
G0RVK1_HYPJQ/20-446--------------------------------------------------------------------------------
H3G8U1_PHYRM/34-471--------------------------------------------------------------------------------
M7SVI4_EUTLA/21-454--------------------------------------------------------------------------------
M4FNF9_MAGP6/20-447--------------------------------------------------------------------------------
R8BQZ2_TOGMI/20-451--------------------------------------------------------------------------------
S3D235_GLAL2/20-454--------------------------------------------------------------------------------
F0XKB1_GROCL/20-444--------------------------------------------------------------------------------
C7YH34_NECH7/20-451--------------------------------------------------------------------------------
F9FPS1_FUSOF/20-451--------------------------------------------------------------------------------
CBHA_EMENI/20-446--------------------------------------------------------------------------------
F4RKA2_MELLP/26-456--------------------------------------------------------------------------------
J3Q4E0_PUCT1/22-425--------------------------------------------------------------------------------
G4N143_MAGO7/22-445--------------------------------------------------------------------------------
E3JU73_PUCGT/29-437--------------------------------------------------------------------------------
L8WJB0_THACA/84-513--------------------------------------------------------------------------------
M7TJ66_BOTF1/21-446--------------------------------------------------------------------------------
F4S1M9_MELLP/23-458--------------------------------------------------------------------------------
M5BZ75_THACB/20-450--------------------------------------------------------------------------------
CELB_ASPFN/20-414--------------------------------------------------------------------------------
K5WYE3_AGABU/21-450--------------------------------------------------------------------------------
F4RTE7_MELLP/22-447--------------------------------------------------------------------------------
N1PY93_MYCP1/21-450--------------------------------------------------------------------------------
F0ZJZ1_DICPU/21-454--------------------------------------------------------------------------------
G4NI68_MAGO7/22-416--------------------------------------------------------------------------------
H1VQX8_COLHI/20-456--------------------------------------------------------------------------------
M2SZK0_COCSN/20-452--------------------------------------------------------------------------------
D0N841_PHYIT/25-462--------------------------------------------------------------------------------
A8NU36_COPC7/21-457--------------------------------------------------------------------------------
L2FY65_COLGN/20-452--------------------------------------------------------------------------------
G4MMG0_MAGO7/20-450--------------------------------------------------------------------------------
I1RVH7_GIBZE/22-419--------------------------------------------------------------------------------
H3GA97_PHYRM/27-460--------------------------------------------------------------------------------
M3ARV6_MYCFI/20-450--------------------------------------------------------------------------------
S8A7U8_DACHA/23-453--------------------------------------------------------------------------------
F4RKA1_MELLP/25-454--------------------------------------------------------------------------------
R1GZN3_BOTPV/19-452--------------------------------------------------------------------------------
S3DFW5_GLAL2/20-452--------------------------------------------------------------------------------
G4TMW4_PIRID/20-450--------------------------------------------------------------------------------
CBHA_ASPFU/20-450--------------------------------------------------------------------------------
U7Q430_SPOS1/20-452--------------------------------------------------------------------------------
E9G5J5_DAPPU/22-463--------------------------------------------------------------------------------
F4S1M8_MELLP/21-456--------------------------------------------------------------------------------
F4S1N8_MELLP/22-461--------------------------------------------------------------------------------
S7ZJL3_PENO1/20-451--------------------------------------------------------------------------------
K5ULV7_PHACS/21-445--------------------------------------------------------------------------------
N4V9B4_COLOR/24-453--------------------------------------------------------------------------------
G2QNN8_THIHA/23-447--------------------------------------------------------------------------------
R1EEG3_BOTPV/22-455--------------------------------------------------------------------------------
M4BJM4_HYAAE/27-464--------------------------------------------------------------------------------
E3K8C2_PUCGT/23-457--------------------------------------------------------------------------------
K3X3U7_PYTUL/24-462--------------------------------------------------------------------------------
F9XAF9_MYCGM/21-444--------------------------------------------------------------------------------
L2FAS8_COLGN/19-444--------------------------------------------------------------------------------
K5WIZ5_PHACS/21-445--------------------------------------------------------------------------------
S8AFI7_DACHA/25-419--------------------------------------------------------------------------------
E3QH29_COLGM/20-451--------------------------------------------------------------------------------
M1WAR4_CLAP2/22-453--------------------------------------------------------------------------------
B2ACE0_PODAN/21-453--------------------------------------------------------------------------------
H3G7U3_PHYRM/13-452--------------------------------------------------------------------------------
G4NIA4_MAGO7/20-446--------------------------------------------------------------------------------
G4ULV4_NEUT9/157-586--------------------------------------------------------------------------------
F9FY42_FUSOF/22-415--------------------------------------------------------------------------------
B2ASX1_PODAN/25-450--------------------------------------------------------------------------------
C7ZHU8_NECH7/20-451--------------------------------------------------------------------------------
D8PLS5_SCHCM/21-454--------------------------------------------------------------------------------
S8AA61_DACHA/19-434--------------------------------------------------------------------------------
CBHB_EMENI/26-460--------------------------------------------------------------------------------
N4V9A4_COLOR/19-434--------------------------------------------------------------------------------
B8NIG8_ASPFN/28-463--------------------------------------------------------------------------------
G1XLC3_ARTOA/25-418--------------------------------------------------------------------------------
CELB_EMENI/21-427--------------------------------------------------------------------------------
G2QZD9_THITE/20-450--------------------------------------------------------------------------------
G0RYS9_CHATD/25-449--------------------------------------------------------------------------------

PF00139

I1J0Z7_BRADI/24-270--------------------------------------------------------------------------------
M0UWM0_HORVD/54-310--------------------------------------------------------------------------------
K3YQI1_SETIT/31-293--------------------------------------------------------------------------------
D7MX72_ARALL/27-278--------------------------------------------------------------------------------
I1QF95_ORYGL/9-257--------------------------------------------------------------------------------
B9SDJ5_RICCO/21-269--------------------------------------------------------------------------------
M4EIG5_BRARP/19-266--------------------------------------------------------------------------------
I1KL69_SOYBN/32-282--------------------------------------------------------------------------------
I1GT36_BRADI/22-278--------------------------------------------------------------------------------
M4DR71_BRARP/23-281--------------------------------------------------------------------------------
K7UKG6_MAIZE/22-274--------------------------------------------------------------------------------
C5Z960_SORBI/22-274--------------------------------------------------------------------------------
J3MID1_ORYBR/697-950--------------------------------------------------------------------------------
C5YGS5_SORBI/740-993--------------------------------------------------------------------------------
F6HBM8_VITVI/38-285--------------------------------------------------------------------------------
M0ZZ78_SOLTU/22-275--------------------------------------------------------------------------------
J3MID6_ORYBR/47-299--------------------------------------------------------------------------------
I1KL68_SOYBN/57-300--------------------------------------------------------------------------------
B9S3F5_RICCO/21-271--------------------------------------------------------------------------------
B9SXJ7_RICCO/26-271--------------------------------------------------------------------------------
M0VXQ0_HORVD/20-275--------------------------------------------------------------------------------
I1GT33_BRADI/25-286--------------------------------------------------------------------------------
B9SXJ9_RICCO/25-271--------------------------------------------------------------------------------
M7ZXG6_TRIUA/26-279--------------------------------------------------------------------------------
B9SDJ4_RICCO/29-277--------------------------------------------------------------------------------
B9RKX4_RICCO/32-295--------------------------------------------------------------------------------
J3MID3_ORYBR/25-284--------------------------------------------------------------------------------
A9STE4_PHYPA/28-284--------------------------------------------------------------------------------
K7LD59_SOYBN/26-276--------------------------------------------------------------------------------
F6HW43_VITVI/37-287--------------------------------------------------------------------------------
B9SPG3_RICCO/28-274--------------------------------------------------------------------------------
I1I8J5_BRADI/41-316--------------------------------------------------------------------------------
C5WQT3_SORBI/3-256--------------------------------------------------------------------------------
M7Z7K8_TRIUA/24-276--------------------------------------------------------------------------------
M7Z873_TRIUA/26-278--------------------------------------------------------------------------------
I1Q9S6_ORYGL/27-278--------------------------------------------------------------------------------
B9RX67_RICCO/38-289--------------------------------------------------------------------------------
Q7XZX1_ORYSJ/59-312--------------------------------------------------------------------------------
I1H3V1_BRADI/27-275--------------------------------------------------------------------------------
C5YTD3_SORBI/42-297--------------------------------------------------------------------------------
C5WZ65_SORBI/40-297--------------------------------------------------------------------------------
F6HWD4_VITVI/48-292--------------------------------------------------------------------------------
M4C9K1_BRARP/30-282--------------------------------------------------------------------------------
D7L7Q8_ARALL/26-272--------------------------------------------------------------------------------
I1LMH1_SOYBN/27-284--------------------------------------------------------------------------------
I1Q7T2_ORYGL/56-310--------------------------------------------------------------------------------
K7UIK5_MAIZE/47-318--------------------------------------------------------------------------------
B9S3F7_RICCO/27-283--------------------------------------------------------------------------------
Q6Z8M4_ORYSJ/40-308--------------------------------------------------------------------------------
M4F2M7_BRARP/21-273--------------------------------------------------------------------------------
M0Y8Y9_HORVD/24-281--------------------------------------------------------------------------------
B9RX81_RICCO/37-286--------------------------------------------------------------------------------
Q7XUC7_ORYSJ/28-274--------------------------------------------------------------------------------
Q6K8L8_ORYSJ/26-289--------------------------------------------------------------------------------
I1L3I1_SOYBN/35-302--------------------------------------------------------------------------------
M4EJC2_BRARP/29-277--------------------------------------------------------------------------------
F6HWD7_VITVI/37-289--------------------------------------------------------------------------------
F6HW36_VITVI/35-286--------------------------------------------------------------------------------
M1DPR0_SOLTU/22-264--------------------------------------------------------------------------------
K4D2U1_SOLLC/29-283--------------------------------------------------------------------------------
I1H2L8_BRADI/27-276--------------------------------------------------------------------------------
C5XCD6_SORBI/32-291--------------------------------------------------------------------------------
K3Y5L7_SETIT/33-273--------------------------------------------------------------------------------
M1BJQ2_SOLTU/21-281--------------------------------------------------------------------------------
I1LM84_SOYBN/28-267--------------------------------------------------------------------------------
M4CN93_BRARP/29-292--------------------------------------------------------------------------------
Q8H4J3_ORYSJ/28-282--------------------------------------------------------------------------------
B9RX64_RICCO/27-280--------------------------------------------------------------------------------
J3MPZ5_ORYBR/33-302--------------------------------------------------------------------------------
Q84ZH8_ORYSJ/24-276--------------------------------------------------------------------------------
M0YJP2_HORVD/48-317--------------------------------------------------------------------------------
K3Y3M9_SETIT/30-282--------------------------------------------------------------------------------
F6HL81_VITVI/33-286--------------------------------------------------------------------------------
LRK61_ARATH/33-294--------------------------------------------------------------------------------
B9T8H0_RICCO/20-272--------------------------------------------------------------------------------
M1AHJ3_SOLTU/28-281--------------------------------------------------------------------------------
M7YY54_TRIUA/30-272--------------------------------------------------------------------------------
M4CLT1_BRARP/22-275--------------------------------------------------------------------------------
B9SML1_RICCO/44-289--------------------------------------------------------------------------------
M4DP68_BRARP/19-264--------------------------------------------------------------------------------
Q0D8S6_ORYSJ/77-329--------------------------------------------------------------------------------
M8A5Y7_TRIUA/53-300--------------------------------------------------------------------------------
C5Z959_SORBI/30-282--------------------------------------------------------------------------------
LRKS1_ARATH/29-288--------------------------------------------------------------------------------
M4ESL4_BRARP/22-290--------------------------------------------------------------------------------
B9SKY8_RICCO/25-281--------------------------------------------------------------------------------
M4FFA7_BRARP/24-263--------------------------------------------------------------------------------
J3LWI6_ORYBR/44-294--------------------------------------------------------------------------------
K7L999_SOYBN/59-308--------------------------------------------------------------------------------
M7YCL0_TRIUA/32-284--------------------------------------------------------------------------------
D7MR66_ARALL/26-282--------------------------------------------------------------------------------
J3MPZ8_ORYBR/32-293--------------------------------------------------------------------------------
F6GUY7_VITVI/27-280--------------------------------------------------------------------------------
B9HG10_POPTR/32-282--------------------------------------------------------------------------------
B9GZH8_POPTR/30-270--------------------------------------------------------------------------------
B9HCZ3_POPTR/23-280--------------------------------------------------------------------------------
I1JFJ9_SOYBN/45-285--------------------------------------------------------------------------------
I1MX65_SOYBN/42-290--------------------------------------------------------------------------------
M7Y9L8_TRIUA/34-283--------------------------------------------------------------------------------
Q652V6_ORYSJ/38-298--------------------------------------------------------------------------------
Q6ZFB7_ORYSJ/37-281--------------------------------------------------------------------------------
Q6ZIQ8_ORYSJ/39-305--------------------------------------------------------------------------------
Q6ZLL9_ORYSJ/30-291--------------------------------------------------------------------------------
Q7XUN6_ORYSJ/30-280--------------------------------------------------------------------------------
Q84ZI0_ORYSJ/31-304--------------------------------------------------------------------------------
U5G5V7_POPTR/26-278--------------------------------------------------------------------------------
W5AMW1_WHEAT/26-276--------------------------------------------------------------------------------
W5AND9_WHEAT/35-289--------------------------------------------------------------------------------
W5GWA8_WHEAT/27-281--------------------------------------------------------------------------------
W5H3F4_WHEAT/32-280--------------------------------------------------------------------------------

PF03388

YQF8_SCHPO/24-250--------------------------------------------------------------------------------
YOC5_SCHPO/23-229--------------------------------------------------------------------------------
EMP47_YEAST/36-253--------------------------------------------------------------------------------
LMAN1_HUMAN/44-269--------------------------------------------------------------------------------
Q9V3A8_DROME/33-259--------------------------------------------------------------------------------
Q9VCC2_DROME/33-258--------------------------------------------------------------------------------
LMAN2_CANFA/52-278--------------------------------------------------------------------------------
Q22170_CAEEL/43-272--------------------------------------------------------------------------------

PF02210

CNTP4_HUMAN/821-940--------------------------------------------------------------------------------
Q9VZ96_DROME/275-414--------------------------------------------------------------------------------
Q9VZ96_DROME/514-640--------------------------------------------------------------------------------
Q9VZ96_DROME/698-817--------------------------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------------------------------------------------------------------------
EYS_HUMAN/3007-3141--------------------------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------------------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------------------------------------------------------------------------
Q7PSM9_ANOGA/919-1050--------------------------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------------------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------------------------------------------------------------------------
CNTP1_MOUSE/390-516--------------------------------------------------------------------------------
Q18291_CAEEL/303-430--------------------------------------------------------------------------------
Q18291_CAEEL/495-627--------------------------------------------------------------------------------
Q18291_CAEEL/722-843--------------------------------------------------------------------------------
Q18291_CAEEL/906-1035--------------------------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------------------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------------------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------------------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------------------------------------------------------------------------
NRX3A_MOUSE/475-619--------------------------------------------------------------------------------
NRX3A_HUMAN/287-413--------------------------------------------------------------------------------
CNTP4_MOUSE/400-526--------------------------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------------------------------------------------------------------------
CRUM1_MOUSE/513-650--------------------------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------------------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------------------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------------------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------------------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------------------------------------------------------------------------
Q9VJ82_DROME/55-178--------------------------------------------------------------------------------
Q9VJ82_DROME/238-367--------------------------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------------------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------------------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------------------------------------------------------------------------
CSPG4_HUMAN/55-178--------------------------------------------------------------------------------
CSPG4_HUMAN/230-363--------------------------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------------------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------------------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------------------------------------------------------------------------
Q8IQH0_DROME/220-342--------------------------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------------------------------------------------------------------------
EYS_DROME/1723-1856--------------------------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------------------------------------------------------------------------
CNTP5_HUMAN/819-938--------------------------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------------------------------------------------------------------------
NRX3B_HUMAN/117-236--------------------------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------------------------------------------------------------------------
STAN_DROME/1584-1736--------------------------------------------------------------------------------
STAN_DROME/1826-1946--------------------------------------------------------------------------------
NRX3A_HUMAN/55-184--------------------------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------------------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------------------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------------------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------------------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------------------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------------------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------------------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------------------------------------------------------------------------
Q7Q1N4_ANOGA/1163-1293--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------------------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------------------------------------------------------------------------
EGFLA_MOUSE/641-767--------------------------------------------------------------------------------
EGFLA_HUMAN/868-996--------------------------------------------------------------------------------
Q19617_CAEEL/154-276--------------------------------------------------------------------------------
NRX2A_RAT/949-1077--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------------------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------------------------------------------------------------------------
O45000_CAEEL/275-401--------------------------------------------------------------------------------
Q22574_CAEEL/136-267--------------------------------------------------------------------------------
Q22574_CAEEL/415-539--------------------------------------------------------------------------------
NRX1A_MOUSE/753-884--------------------------------------------------------------------------------
CADN_DROME/2407-2568--------------------------------------------------------------------------------
CADN_DROME/2661-2796--------------------------------------------------------------------------------
FAT2_RAT/3802-3923--------------------------------------------------------------------------------
CELR3_RAT/1534-1693--------------------------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------------------------------------------------------------------------
CRB_DROME/1585-1722--------------------------------------------------------------------------------
CNTP1_HUMAN/203-332--------------------------------------------------------------------------------
CNTP1_HUMAN/813-939--------------------------------------------------------------------------------
CRUM1_HUMAN/514-651--------------------------------------------------------------------------------
CRUM1_HUMAN/743-860--------------------------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------------------------------------------------------------------------
CNTP1_RAT/1089-1219--------------------------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------------------------------------------------------------------------
PROS_RABIT/485-617--------------------------------------------------------------------------------
LAMA_DROME/2704-2846--------------------------------------------------------------------------------
LAMA_DROME/2905-3031--------------------------------------------------------------------------------
LAMA_DROME/3083-3205--------------------------------------------------------------------------------
LAMA_DROME/3379-3514--------------------------------------------------------------------------------
LAMA_DROME/3563-3691--------------------------------------------------------------------------------
Q19350_CAEEL/789-914--------------------------------------------------------------------------------
CADE_DROME/1153-1296--------------------------------------------------------------------------------
NRX1A_BOVIN/58-192--------------------------------------------------------------------------------
GAS6_MOUSE/322-450--------------------------------------------------------------------------------
NRX2A_RAT/57-187--------------------------------------------------------------------------------
NRX2B_RAT/119-268--------------------------------------------------------------------------------
COBA2_MOUSE/90-213--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------------------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------------------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------------------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------------------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------------------------------------------------------------------------
CNTP5_HUMAN/209-338--------------------------------------------------------------------------------
CNTP5_HUMAN/395-521--------------------------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------------------------------------------------------------------------
NRX4_DROME/824-943--------------------------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------------------------------------------------------------------------
NRX1A_CHICK/364-508--------------------------------------------------------------------------------
NRX1A_CHICK/789-917--------------------------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------------------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------------------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------------------------------------------------------------------------
NRX2A_HUMAN/521-666--------------------------------------------------------------------------------
NRX2A_HUMAN/760-890--------------------------------------------------------------------------------
CELR2_RAT/869-995--------------------------------------------------------------------------------
CNTP2_HUMAN/216-345--------------------------------------------------------------------------------
CNTP2_HUMAN/401-529--------------------------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------------------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------------------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------------------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------------------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------------------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------------------------------------------------------------------------
B1AM99_HUMAN/398-521--------------------------------------------------------------------------------
B4NSJ9_DROSI/33-158--------------------------------------------------------------------------------
B4Q5I2_DROSI/631-761--------------------------------------------------------------------------------
B4QRF1_DROSI/2162-2287--------------------------------------------------------------------------------
B7ZC61_MOUSE/681-798--------------------------------------------------------------------------------
C1P641_CAEEL/3508-3630--------------------------------------------------------------------------------
C3ZLC2_BRAFL/400-531--------------------------------------------------------------------------------
E9PDN6_HUMAN/215-343--------------------------------------------------------------------------------
F1QGG9_DANRE/493-622--------------------------------------------------------------------------------
F1QQE4_DANRE/1172-1299--------------------------------------------------------------------------------
F1R9W4_DANRE/32-162--------------------------------------------------------------------------------
F1RCV3_DANRE/1181-1305--------------------------------------------------------------------------------
F6X197_CIOIN/154-276--------------------------------------------------------------------------------
F7ER04_CALJA/128-245--------------------------------------------------------------------------------
G3HJH2_CRIGR/1596-1721--------------------------------------------------------------------------------
G3UNZ8_MELGA/755-882--------------------------------------------------------------------------------
G5E9F8_HUMAN/383-515--------------------------------------------------------------------------------
H9H2C7_MELGA/307-434--------------------------------------------------------------------------------
M9NF15_DROME/1112-1240--------------------------------------------------------------------------------
LAMA3_MOUSE/3183-3307--------------------------------------------------------------------------------
Q8MPN3_DROME/3806-3929--------------------------------------------------------------------------------
Q9VCZ9_DROME/1230-1354--------------------------------------------------------------------------------
CADN2_DROME/1039-1199--------------------------------------------------------------------------------
W4YVD3_STRPU/3-125--------------------------------------------------------------------------------

PF00054

AGRIN_CHICK/1416-1546--------------------------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------------------------------------------------------------------------
AGRIN_CHICK/1933-2064--------------------------------------------------------------------------------
LAMA1_HUMAN/2920-3051--------------------------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------------------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------------------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------------------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------------------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------------------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------------------------------------------------------------------------
CSPG4_RAT/55-182--------------------------------------------------------------------------------
AGRIN_RAT/1291-1422--------------------------------------------------------------------------------
AGRIN_RAT/1559-1694--------------------------------------------------------------------------------
SHBG_RAT/76-206--------------------------------------------------------------------------------
CRB_DROME/1048-1183--------------------------------------------------------------------------------
AGRIN_RAT/1811-1942--------------------------------------------------------------------------------
SLIT_DROME/1204-1335--------------------------------------------------------------------------------
PROS_HUMAN/329-459--------------------------------------------------------------------------------
CRB_DROME/1281-1443--------------------------------------------------------------------------------
SHBG_HUMAN/75-205--------------------------------------------------------------------------------
FAT_DROME/4156-4306--------------------------------------------------------------------------------

PF00354

SAMP_MOUSE/27-220--------------------------------------------------------------------------------
CRP1_LIMPO/33-237--------------------------------------------------------------------------------
CRP_XENLA/23-219--------------------------------------------------------------------------------
CRP_RABIT/26-221--------------------------------------------------------------------------------
CRP_HUMAN/25-220--------------------------------------------------------------------------------
SAMP_HUMAN/26-219--------------------------------------------------------------------------------
Q542I3_MOUSE/26-221--------------------------------------------------------------------------------
FP_CRIMI/26-219--------------------------------------------------------------------------------

PF13385

A9V7L7_MONBE/717-870--------------------------------------------------------------------------------
A9V0U4_MONBE/809-963--------------------------------------------------------------------------------
A9VE19_MONBE/544-692--------------------------------------------------------------------------------
A9V0U4_MONBE/590-745--------------------------------------------------------------------------------
B9JMF4_AGRRK/595-752--------------------------------------------------------------------------------
C9ZAH4_STRSW/174-331--------------------------------------------------------------------------------
B5HCG7_STRPR/182-340--------------------------------------------------------------------------------
D3EBL1_GEOS4/644-797--------------------------------------------------------------------------------
Q82NZ6_STRAW/693-850--------------------------------------------------------------------------------
C7Q3C0_CATAD/682-839--------------------------------------------------------------------------------
C6WP14_ACTMD/1442-1597--------------------------------------------------------------------------------
A7RQU2_NEMVE/46-196--------------------------------------------------------------------------------
B3RTE4_TRIAD/419-588--------------------------------------------------------------------------------
Q11RF9_CYTH3/68-223--------------------------------------------------------------------------------
D2AYT0_STRRD/833-984--------------------------------------------------------------------------------
Q01PZ1_SOLUE/560-711--------------------------------------------------------------------------------
D0LXW7_HALO1/121-278--------------------------------------------------------------------------------
A9ERE1_SORC5/156-299--------------------------------------------------------------------------------
A7RK85_NEMVE/111-274--------------------------------------------------------------------------------
Q7UP09_RHOBA/489-653--------------------------------------------------------------------------------
D2QJX5_SPILD/494-660--------------------------------------------------------------------------------
A5G5W5_GEOUR/3125-3280--------------------------------------------------------------------------------
Q12UM1_METBU/211-367--------------------------------------------------------------------------------
A5G5W5_GEOUR/2834-2981--------------------------------------------------------------------------------
Q3A7I8_PELCD/252-409--------------------------------------------------------------------------------
Q2S986_HAHCH/536-688--------------------------------------------------------------------------------
C5BR34_TERTT/286-438--------------------------------------------------------------------------------
Q5E1F1_VIBF1/338-497--------------------------------------------------------------------------------
D0LH97_HALO1/423-584--------------------------------------------------------------------------------
Q2SIZ0_HAHCH/349-511--------------------------------------------------------------------------------
Q21ES8_SACD2/355-516--------------------------------------------------------------------------------
A1U1N6_MARAV/358-517--------------------------------------------------------------------------------
Q7UQA7_RHOBA/111-269--------------------------------------------------------------------------------
Q5JEI1_THEKO/104-250--------------------------------------------------------------------------------
D2RI28_ARCPA/205-357--------------------------------------------------------------------------------
D2QKT6_SPILD/67-225--------------------------------------------------------------------------------
A7RFD3_NEMVE/591-745--------------------------------------------------------------------------------
A5FGU3_FLAJ1/61-211--------------------------------------------------------------------------------
A5FGS6_FLAJ1/61-211--------------------------------------------------------------------------------
A5FKP6_FLAJ1/648-806--------------------------------------------------------------------------------
B1WQC8_CYAA5/1492-1639--------------------------------------------------------------------------------
B2J7Y5_NOSP7/1082-1239--------------------------------------------------------------------------------
B8GR77_THISH/232-391--------------------------------------------------------------------------------
A5US22_ROSS1/44-194--------------------------------------------------------------------------------
B8FIJ2_DESAA/1835-1990--------------------------------------------------------------------------------
B8FIJ2_DESAA/2139-2295--------------------------------------------------------------------------------
B8FIJ2_DESAA/3101-3258--------------------------------------------------------------------------------
B1WQC8_CYAA5/529-689--------------------------------------------------------------------------------
A0L6L9_MAGSM/6883-7036--------------------------------------------------------------------------------
A0L6L9_MAGSM/10297-10458--------------------------------------------------------------------------------
A0L6L9_MAGSM/11015-11176--------------------------------------------------------------------------------
A0L6L9_MAGSM/7697-7855--------------------------------------------------------------------------------
Q11V34_CYTH3/475-632--------------------------------------------------------------------------------
D1YWM2_METPS/639-793--------------------------------------------------------------------------------
A9AX01_HERA2/2983-3139--------------------------------------------------------------------------------
C5CYC7_VARPS/584-746--------------------------------------------------------------------------------
A9VEK3_MONBE/43-204--------------------------------------------------------------------------------
A9UYJ6_MONBE/611-770--------------------------------------------------------------------------------
A4CID0_ROBBH/183-344--------------------------------------------------------------------------------
Q01ZJ6_SOLUE/448-593--------------------------------------------------------------------------------
Q112U0_TRIEI/322-477--------------------------------------------------------------------------------
A9AVC5_HERA2/53-212--------------------------------------------------------------------------------
C3YCM4_BRAFL/399-559--------------------------------------------------------------------------------
A9AX01_HERA2/3464-3613--------------------------------------------------------------------------------
A9AX01_HERA2/1709-1859--------------------------------------------------------------------------------
A9AX01_HERA2/3687-3839--------------------------------------------------------------------------------
A9AVE2_HERA2/55-206--------------------------------------------------------------------------------
A0ZJ67_NODSP/534-687--------------------------------------------------------------------------------
A9WA06_CHLAA/1561-1710--------------------------------------------------------------------------------
D2GX75_AILME/1328-1494--------------------------------------------------------------------------------
GPR98_DANRE/1321-1486--------------------------------------------------------------------------------
B3PKP2_CELJU/973-1129--------------------------------------------------------------------------------
Q21FF7_SACD2/1013-1165--------------------------------------------------------------------------------
Q21FF7_SACD2/697-861--------------------------------------------------------------------------------
B8E3D6_DICTD/93-243--------------------------------------------------------------------------------
C6D6G1_PAESJ/694-843--------------------------------------------------------------------------------
Q9KBP7_BACHD/623-775--------------------------------------------------------------------------------
C7R5J8_JONDD/646-797--------------------------------------------------------------------------------
C7R5J7_JONDD/547-698--------------------------------------------------------------------------------
D4J0Z2_BUTFI/89-242--------------------------------------------------------------------------------
A5GAT0_GEOUR/82-245--------------------------------------------------------------------------------
C6W5Q6_DYAFD/72-233--------------------------------------------------------------------------------
D5SQB3_PLAL2/445-615--------------------------------------------------------------------------------
A0C6A9_PARTE/84-241--------------------------------------------------------------------------------
A4HMI3_LEIBR/697-852--------------------------------------------------------------------------------
A5JZZ5_PLAVS/101-250--------------------------------------------------------------------------------
D2W1V6_NAEGR/225-370--------------------------------------------------------------------------------
Q3A7I8_PELCD/471-622--------------------------------------------------------------------------------
B0R0F2_DANRE/89-248--------------------------------------------------------------------------------
B3RQA7_TRIAD/115-267--------------------------------------------------------------------------------
D3F200_CONWI/289-437--------------------------------------------------------------------------------
C6WK26_ACTMD/261-414--------------------------------------------------------------------------------
A0ZJ64_NODSP/411-564--------------------------------------------------------------------------------
P73139_SYNY3/1330-1483--------------------------------------------------------------------------------
D3F0R0_CONWI/85-255--------------------------------------------------------------------------------
C1F1C3_ACIC5/51-208--------------------------------------------------------------------------------
B5HK67_STRPR/818-980--------------------------------------------------------------------------------
D9TDD0_MICAI/805-962--------------------------------------------------------------------------------
Q82GV4_STRAW/292-440--------------------------------------------------------------------------------
D2BE74_STRRD/722-881--------------------------------------------------------------------------------
B5I5M1_9ACTO/761-922--------------------------------------------------------------------------------
B1VPR2_STRGG/846-1008--------------------------------------------------------------------------------
B5HSG2_9ACTO/789-950--------------------------------------------------------------------------------
B1VKK7_STRGG/744-905--------------------------------------------------------------------------------
C6WQK6_ACTMD/756-914--------------------------------------------------------------------------------
C9Z2C7_STRSW/793-953--------------------------------------------------------------------------------
D2PTR0_KRIFD/729-887--------------------------------------------------------------------------------
D2PTR0_KRIFD/514-676--------------------------------------------------------------------------------
B5H1J2_STRC2/810-972--------------------------------------------------------------------------------
B5H1J2_STRC2/1032-1193--------------------------------------------------------------------------------
C6WL54_ACTMD/905-1058--------------------------------------------------------------------------------
E6W606_DESIS/780-953--------------------------------------------------------------------------------
C5C072_BEUC1/602-756--------------------------------------------------------------------------------
A0L6L9_MAGSM/10522-10674--------------------------------------------------------------------------------
D0LH97_HALO1/144-304--------------------------------------------------------------------------------
Q12UM1_METBU/421-574--------------------------------------------------------------------------------
D3SUF1_NATMM/128-286--------------------------------------------------------------------------------
Q12UM1_METBU/635-797--------------------------------------------------------------------------------
B1Y080_LEPCP/302-473--------------------------------------------------------------------------------
Q025I9_SOLUE/271-426--------------------------------------------------------------------------------
Q025I9_SOLUE/616-778--------------------------------------------------------------------------------
C6XUD8_PEDHD/202-348--------------------------------------------------------------------------------
E6W633_DESIS/617-776--------------------------------------------------------------------------------
B8FF04_DESAA/2231-2395--------------------------------------------------------------------------------
C7PKJ2_CHIPD/89-251--------------------------------------------------------------------------------
D2PTT7_KRIFD/1092-1258--------------------------------------------------------------------------------
D2PTT7_KRIFD/1416-1585--------------------------------------------------------------------------------

PF02973

NANA_STRR6/118-309--------------------------------------------------------------------------------
Q8CWP8_STRR6/42-227--------------------------------------------------------------------------------
Q8XMG4_CLOPE/50-236--------------------------------------------------------------------------------

PF07953

A7GBG3_CLOBL/878-1072--------------------------------------------------------------------------------
F4AAX8_CLOBO/847-1023--------------------------------------------------------------------------------
O87710_9CLOT/811-986--------------------------------------------------------------------------------
B1INP6_CLOBK/847-1023--------------------------------------------------------------------------------
Q8GR96_CLOBO/872-1066--------------------------------------------------------------------------------
BXE_CLOBO/859-1054--------------------------------------------------------------------------------
B1Q6N5_CLOBO/816-992--------------------------------------------------------------------------------
BXEN_CLOBU/812-988--------------------------------------------------------------------------------
Q3ZUA3_9CLOT/40-243--------------------------------------------------------------------------------
O06018_CLOBO/848-1024--------------------------------------------------------------------------------
Q841S3_CLOBO/880-1071--------------------------------------------------------------------------------
BXA1_CLOBH/885-1079--------------------------------------------------------------------------------
BXG_CLOBO/877-1074--------------------------------------------------------------------------------

PF06439

A3HZT9_9BACT/35-266--------------------------------------------------------------------------------
A6LBG6_PARD8/26-215--------------------------------------------------------------------------------
B0T1W6_CAUSK/37-271--------------------------------------------------------------------------------
A4SXW4_POLSQ/31-195--------------------------------------------------------------------------------
A6DIW7_9BACT/14-204--------------------------------------------------------------------------------
A7LWH3_BACO1/242-448--------------------------------------------------------------------------------
A6LFX0_PARD8/51-268--------------------------------------------------------------------------------
Q1IP75_KORVE/134-305--------------------------------------------------------------------------------
Q01PY8_SOLUE/18-214--------------------------------------------------------------------------------
Q021Z2_SOLUE/148-318--------------------------------------------------------------------------------
A6C286_9PLAN/26-230--------------------------------------------------------------------------------
A6L9A1_PARD8/27-220--------------------------------------------------------------------------------
Q7UXM1_RHOBA/116-314--------------------------------------------------------------------------------
Q7UGT3_RHOBA/50-260--------------------------------------------------------------------------------
A6DGN3_9BACT/486-705--------------------------------------------------------------------------------
Q026J2_SOLUE/86-285--------------------------------------------------------------------------------
A7AJH3_9PORP/62-268--------------------------------------------------------------------------------
A4AVD2_MARSH/28-192--------------------------------------------------------------------------------
A6CF10_9PLAN/1565-1736--------------------------------------------------------------------------------
A4Z0W7_BRASO/36-203--------------------------------------------------------------------------------
Q7URI3_RHOBA/55-252--------------------------------------------------------------------------------
Q022Y3_SOLUE/158-351--------------------------------------------------------------------------------
A3ZYX9_9PLAN/31-241--------------------------------------------------------------------------------
Q7UYC2_RHOBA/27-225--------------------------------------------------------------------------------
Q08RB4_STIAD/354-520--------------------------------------------------------------------------------
B1KP96_SHEWM/43-237--------------------------------------------------------------------------------
Q7ULY5_RHOBA/53-228--------------------------------------------------------------------------------
Q9XAM0_STRCO/521-727--------------------------------------------------------------------------------
A6LD72_PARD8/35-236--------------------------------------------------------------------------------
A5V6S7_SPHWW/38-269--------------------------------------------------------------------------------
A3ZPX1_9PLAN/148-325--------------------------------------------------------------------------------
A6E8U4_9SPHI/241-449--------------------------------------------------------------------------------
Q7UFF8_RHOBA/54-264--------------------------------------------------------------------------------
A4SYN3_POLSQ/50-213--------------------------------------------------------------------------------
Q01QD3_SOLUE/67-266--------------------------------------------------------------------------------
Q21G79_SACD2/27-266--------------------------------------------------------------------------------
Q15XP9_PSEA6/43-289--------------------------------------------------------------------------------
A7NM29_ROSCS/68-253--------------------------------------------------------------------------------
Q02AV5_SOLUE/47-254--------------------------------------------------------------------------------
Q024T5_SOLUE/20-224--------------------------------------------------------------------------------
A6CH23_9PLAN/11-222--------------------------------------------------------------------------------
Q5LID8_BACFN/75-244--------------------------------------------------------------------------------
A4AN55_MARSH/13-232--------------------------------------------------------------------------------
Q7UP53_RHOBA/254-436--------------------------------------------------------------------------------
A3HYW7_9BACT/39-258--------------------------------------------------------------------------------
Q020M5_SOLUE/283-466--------------------------------------------------------------------------------
A7LZB4_BACO1/60-285--------------------------------------------------------------------------------
A6L8C0_PARD8/23-196--------------------------------------------------------------------------------
A4XES2_NOVAD/37-271--------------------------------------------------------------------------------
Q024G0_SOLUE/10-210--------------------------------------------------------------------------------
Q7UP53_RHOBA/88-251--------------------------------------------------------------------------------
Q7UJ71_RHOBA/62-282--------------------------------------------------------------------------------
A6C9B4_9PLAN/53-240--------------------------------------------------------------------------------
A0ACR9_STRAM/807-998--------------------------------------------------------------------------------
A6DSM6_9BACT/29-216--------------------------------------------------------------------------------
Q9XBE0_AMYOR/795-985--------------------------------------------------------------------------------
A6LB52_PARD8/744-943--------------------------------------------------------------------------------
A0M051_GRAFK/45-249--------------------------------------------------------------------------------
A6DM12_9BACT/183-370--------------------------------------------------------------------------------
A4ASP9_MARSH/24-229--------------------------------------------------------------------------------
A4ATY8_MARSH/64-260--------------------------------------------------------------------------------
A4ASM0_MARSH/38-261--------------------------------------------------------------------------------
Q15XH8_PSEA6/28-257--------------------------------------------------------------------------------
A6BZI2_9PLAN/34-270--------------------------------------------------------------------------------
A6DJ51_9BACT/30-221--------------------------------------------------------------------------------
A3ZYG0_9PLAN/42-220--------------------------------------------------------------------------------
A6LFJ8_PARD8/58-253--------------------------------------------------------------------------------
B4SNA4_STRM5/52-245--------------------------------------------------------------------------------
Q021Q3_SOLUE/25-318--------------------------------------------------------------------------------
A6DFB8_9BACT/988-1186--------------------------------------------------------------------------------
A6CBU4_9PLAN/476-662--------------------------------------------------------------------------------
Q7UTD6_RHOBA/106-307--------------------------------------------------------------------------------
A4CGG3_ROBBH/26-212--------------------------------------------------------------------------------
A4AUV7_MARSH/139-306--------------------------------------------------------------------------------
B0T1X3_CAUSK/51-253--------------------------------------------------------------------------------
A6C9Y7_9PLAN/38-232--------------------------------------------------------------------------------
A3I2W3_9BACT/58-253--------------------------------------------------------------------------------
A6DGC3_9BACT/39-228--------------------------------------------------------------------------------
A6BYQ3_9PLAN/523-721--------------------------------------------------------------------------------
B8H3I2_CAUCN/42-285--------------------------------------------------------------------------------
Q01U12_SOLUE/21-204--------------------------------------------------------------------------------
Q7UTD6_RHOBA/325-510--------------------------------------------------------------------------------
A4ARZ0_MARSH/21-221--------------------------------------------------------------------------------
Q01PI7_SOLUE/133-305--------------------------------------------------------------------------------
Q09C00_STIAD/650-816--------------------------------------------------------------------------------
A3ZT25_9PLAN/28-228--------------------------------------------------------------------------------
A4A1V7_9PLAN/150-329--------------------------------------------------------------------------------
A0YAF8_9GAMM/30-260--------------------------------------------------------------------------------
A6DSF7_9BACT/22-217--------------------------------------------------------------------------------
A4BYH9_9FLAO/26-192--------------------------------------------------------------------------------
A0ACX0_STRAM/280-457--------------------------------------------------------------------------------
Q01NY0_SOLUE/48-250--------------------------------------------------------------------------------
A6CCA5_9PLAN/71-236--------------------------------------------------------------------------------
A3I170_9BACT/40-240--------------------------------------------------------------------------------
A7AAJ2_9PORP/957-1147--------------------------------------------------------------------------------
A5IIW8_THEP1/74-230--------------------------------------------------------------------------------
A7LWH3_BACO1/23-209--------------------------------------------------------------------------------
Q01WT7_SOLUE/22-227--------------------------------------------------------------------------------
A6DM09_9BACT/22-216--------------------------------------------------------------------------------
A2TQP1_9FLAO/40-242--------------------------------------------------------------------------------
Q02B64_SOLUE/22-209--------------------------------------------------------------------------------
A6DTC7_9BACT/37-227--------------------------------------------------------------------------------
A6CA29_9PLAN/352-540--------------------------------------------------------------------------------
A6C8Y3_9PLAN/63-235--------------------------------------------------------------------------------
A3XPN2_LEEBM/32-218--------------------------------------------------------------------------------
A4A0Q4_9PLAN/26-218--------------------------------------------------------------------------------
A6E8U4_9SPHI/25-211--------------------------------------------------------------------------------
Q01UN1_SOLUE/9-241--------------------------------------------------------------------------------
A3ZQS2_9PLAN/31-212--------------------------------------------------------------------------------
A6DG40_9BACT/159-340--------------------------------------------------------------------------------
A6DLT3_9BACT/234-440--------------------------------------------------------------------------------
A6EKV1_9SPHI/655-832--------------------------------------------------------------------------------
A3ZY13_9PLAN/44-228--------------------------------------------------------------------------------
A6DLT3_9BACT/28-216--------------------------------------------------------------------------------
Q1AST8_RUBXD/20-211--------------------------------------------------------------------------------
A4FDZ7_SACEN/121-335--------------------------------------------------------------------------------
A7ABK7_9PORP/62-257--------------------------------------------------------------------------------
A6BYS0_9PLAN/54-263--------------------------------------------------------------------------------
Q01XX3_SOLUE/25-191--------------------------------------------------------------------------------
Q2Y669_NITMU/16-255--------------------------------------------------------------------------------
A3ZWI0_9PLAN/615-790--------------------------------------------------------------------------------
A3ZR79_9PLAN/39-201--------------------------------------------------------------------------------
A6CAH6_9PLAN/67-283--------------------------------------------------------------------------------
Q01TF2_SOLUE/30-207--------------------------------------------------------------------------------
Q2RZK0_SALRD/15-220--------------------------------------------------------------------------------
A6CGD1_9PLAN/671-851--------------------------------------------------------------------------------
A6C1K2_9PLAN/155-332--------------------------------------------------------------------------------
Q7UTX3_RHOBA/29-219--------------------------------------------------------------------------------
Q7UYB9_RHOBA/49-246--------------------------------------------------------------------------------
A3ZS39_9PLAN/38-281--------------------------------------------------------------------------------
Q026J8_SOLUE/86-284--------------------------------------------------------------------------------
A6EFU0_9SPHI/28-228--------------------------------------------------------------------------------
A7AG24_9PORP/243-456--------------------------------------------------------------------------------
A3ZX11_9PLAN/36-237--------------------------------------------------------------------------------
A6C3G1_9PLAN/151-333--------------------------------------------------------------------------------
Q7UWR3_RHOBA/519-700--------------------------------------------------------------------------------
Q7UZ09_RHOBA/53-231--------------------------------------------------------------------------------
A3ZQR2_9PLAN/150-327--------------------------------------------------------------------------------
A6C1I1_9PLAN/43-215--------------------------------------------------------------------------------
A6C5D8_9PLAN/56-241--------------------------------------------------------------------------------
A6DGI4_9BACT/22-219--------------------------------------------------------------------------------
Q7UKZ1_RHOBA/77-278--------------------------------------------------------------------------------
Q7ULK4_RHOBA/125-306--------------------------------------------------------------------------------
Q2Y774_NITMU/671-893--------------------------------------------------------------------------------
A6C6K0_9PLAN/64-244--------------------------------------------------------------------------------
A6LCM7_PARD8/20-194--------------------------------------------------------------------------------
Q027F9_SOLUE/8-228--------------------------------------------------------------------------------
A6DM04_9BACT/25-206--------------------------------------------------------------------------------
Q024Y0_SOLUE/27-212--------------------------------------------------------------------------------
A6CCA5_9PLAN/239-425--------------------------------------------------------------------------------
A3ZTD9_9PLAN/1170-1342--------------------------------------------------------------------------------
A3I2B6_9BACT/23-203--------------------------------------------------------------------------------
A4A0D3_9PLAN/28-213--------------------------------------------------------------------------------
Q7ULY5_RHOBA/234-440--------------------------------------------------------------------------------
A2U0D4_9FLAO/30-260--------------------------------------------------------------------------------
A3ZSI6_9PLAN/804-979--------------------------------------------------------------------------------
A4ASP0_MARSH/33-262--------------------------------------------------------------------------------
A6DNR0_9BACT/77-264--------------------------------------------------------------------------------
Q7UTX3_RHOBA/225-416--------------------------------------------------------------------------------
A4A202_9PLAN/27-207--------------------------------------------------------------------------------
Q7UYD6_RHOBA/61-249--------------------------------------------------------------------------------
A6DQD4_9BACT/44-244--------------------------------------------------------------------------------
Q7UYI5_RHOBA/85-260--------------------------------------------------------------------------------
A4APB3_MARSH/31-262--------------------------------------------------------------------------------
A4CHF9_ROBBH/43-248--------------------------------------------------------------------------------
A6LD40_PARD8/42-255--------------------------------------------------------------------------------
Q2GAA2_NOVAD/60-315--------------------------------------------------------------------------------
A3ZWI1_9PLAN/266-442--------------------------------------------------------------------------------
A3XQG8_LEEBM/44-246--------------------------------------------------------------------------------
L7CBW3_RHOBT/40-226--------------------------------------------------------------------------------
Q7URK6_RHOBA/266-443--------------------------------------------------------------------------------
A6LER8_PARD8/252-428--------------------------------------------------------------------------------
Q7US53_RHOBA/171-350--------------------------------------------------------------------------------
Q026X4_SOLUE/31-258--------------------------------------------------------------------------------
A3HX26_9BACT/40-244--------------------------------------------------------------------------------
A2TQP0_9FLAO/54-250--------------------------------------------------------------------------------
A3HS07_9BACT/30-219--------------------------------------------------------------------------------
A3ZR79_9PLAN/204-387--------------------------------------------------------------------------------
A3I0Y0_9BACT/33-262--------------------------------------------------------------------------------
A3ZT60_9PLAN/22-206--------------------------------------------------------------------------------
Q01RN4_SOLUE/31-268--------------------------------------------------------------------------------
A6C7J3_9PLAN/515-746--------------------------------------------------------------------------------
A3I2F1_9BACT/51-252--------------------------------------------------------------------------------
A4CGG3_ROBBH/243-451--------------------------------------------------------------------------------
K5D7N6_RHOBT/55-243--------------------------------------------------------------------------------
Q7UGD2_RHOBA/163-356--------------------------------------------------------------------------------
Q7UYA4_RHOBA/58-260--------------------------------------------------------------------------------

PF00337

Q9VPI7_DROME/41-166--------------------------------------------------------------------------------
Q9VPI7_DROME/226-369--------------------------------------------------------------------------------
Q7QF77_ANOGA/4-145--------------------------------------------------------------------------------
Q7QF77_ANOGA/165-293--------------------------------------------------------------------------------
Q7PPI9_ANOGA/742-883--------------------------------------------------------------------------------
Q7QHP5_ANOGA/12-144--------------------------------------------------------------------------------
Q18813_CAEEL/34-172--------------------------------------------------------------------------------
Q18813_CAEEL/180-310--------------------------------------------------------------------------------
LEG8_HUMAN/18-151--------------------------------------------------------------------------------
LEG8_HUMAN/186-316--------------------------------------------------------------------------------
Q9XVD0_CAEEL/131-257--------------------------------------------------------------------------------
B3GTH_ARATH/184-393--------------------------------------------------------------------------------
B3GTK_ARATH/190-404--------------------------------------------------------------------------------
LEG7_MOUSE/5-135--------------------------------------------------------------------------------
LEG3_MOUSE/131-261--------------------------------------------------------------------------------
LEG4_CHICK/4-134--------------------------------------------------------------------------------
Q7Q2T6_ANOGA/13-143--------------------------------------------------------------------------------
Q7PWU9_ANOGA/113-239--------------------------------------------------------------------------------
Q7PWU9_ANOGA/285-422--------------------------------------------------------------------------------
Q18625_CAEEL/13-145--------------------------------------------------------------------------------
LEG9_HUMAN/16-147--------------------------------------------------------------------------------
LEG4_PIG/18-149--------------------------------------------------------------------------------
LEG9_HUMAN/226-355--------------------------------------------------------------------------------
LEG4_PIG/193-323--------------------------------------------------------------------------------
LEC7_CAEEL/10-137--------------------------------------------------------------------------------
Q94215_CAEEL/11-140--------------------------------------------------------------------------------
Q9VPU6_DROME/164-300--------------------------------------------------------------------------------
Q9VPU6_DROME/3-145--------------------------------------------------------------------------------
Q7ZZ26_DANRE/9-141--------------------------------------------------------------------------------
O01329_CAEEL/100-226--------------------------------------------------------------------------------
O62353_CAEEL/138-266--------------------------------------------------------------------------------
Q18625_CAEEL/153-281--------------------------------------------------------------------------------
TECPR_DROME/815-954--------------------------------------------------------------------------------
LEG6_CHICK/3-133--------------------------------------------------------------------------------
Q9U2I7_CAEEL/14-147--------------------------------------------------------------------------------
GRIFN_RAT/4-132--------------------------------------------------------------------------------
GRIFN_DANRE/4-133--------------------------------------------------------------------------------
Q6AV44_ORYSJ/145-340--------------------------------------------------------------------------------
Q84T07_ORYSJ/162-372--------------------------------------------------------------------------------
B3GTI_ARATH/190-391--------------------------------------------------------------------------------
B3GTF_ARATH/170-363--------------------------------------------------------------------------------
B3GTG_ARATH/165-343--------------------------------------------------------------------------------
Q9VPI6_DROME/339-481--------------------------------------------------------------------------------
Q8SXU5_DROME/5-142--------------------------------------------------------------------------------
A1ZBB1_DROME/5-138--------------------------------------------------------------------------------
A4IHU8_XENTR/12-143--------------------------------------------------------------------------------
E7FEQ1_DANRE/97-223--------------------------------------------------------------------------------
F1QX26_DANRE/15-145--------------------------------------------------------------------------------
F6YWA7_MACMU/6-136--------------------------------------------------------------------------------
K1QS74_CRAGI/373-496--------------------------------------------------------------------------------
LEG2_HUMAN/7-128--------------------------------------------------------------------------------
LEG10_HUMAN/11-136--------------------------------------------------------------------------------
LEG12_MOUSE/29-158--------------------------------------------------------------------------------
W5JM94_ANODA/12-140--------------------------------------------------------------------------------

PF07675

Q7MUZ4_PORGI/41-208-------------------------------------------------------------------------MIPLSES
HAGA1_PORGI/230-407-------------------------------------------------------------------------TYVLNES
F5HGU5_PORGI/47-200-------------------------------------------------------------------------.TILYES
Q7MTE2_PORGI/1142-1311-------------------------------------------------------------------------.TETFES

PF00629

Q176I4_AEDAE/127-298------------------------------------------------------------------------------CD
NRP2_HUMAN/646-802------------------------------------------------------------------------------CN
Q7PZL9_ANOGA/167-335------------------------------------------------------------------------------CD
MAMC2_HUMAN/170-329------------------------------------------------------------------------------CD
MAMC2_HUMAN/509-666------------------------------------------------------------------------------CT
ALK_HUMAN/480-636------------------------------------------------------------------------------CN
MEP1B_HUMAN/265-429------------------------------------------------------------------------------CS
PTPRM_HUMAN/27-184------------------------------------------------------------------------------CL
PTPRU_DANRE/26-184------------------------------------------------------------------------------CT
Q28WN9_DROPS/509-695------------------------------------------------------------------------------CD
PTPRU_HUMAN/27-188------------------------------------------------------------------------------CT
MEP1A_HUMAN/269-433------------------------------------------------------------------------------CT
AEGP_MOUSE/661-815------------------------------------------------------------------------------CN
AEGP_HUMAN/813-969------------------------------------------------------------------------------CS
AEGP_HUMAN/656-809------------------------------------------------------------------------------CN
AEGP_HUMAN/493-644------------------------------------------------------------------------------TD
AEGP_HUMAN/271-425------------------------------------------------------------------------------TD
AEGP_MOUSE/67-223------------------------------------------------------------------------------CN
Q1RLY9_DANRE/637-804------------------------------------------------------------------------------CD
PTPRU_CHICK/27-187------------------------------------------------------------------------------CT
MEP1A_RAT/270-434------------------------------------------------------------------------------CA
ENTK_BOVIN/363-520------------------------------------------------------------------------------CN
A2AJX4_MOUSE/8-171------------------------------------------------------------------------------CN
ZAN_RABIT/152-315------------------------------------------------------------------------------CV
Q5TG12_HUMAN/36-194------------------------------------------------------------------------------CT
MEP1B_RAT/266-430------------------------------------------------------------------------------CD
Q28DN2_XENTR/27-184------------------------------------------------------------------------------CT
NRP1_CHICK/641-801------------------------------------------------------------------------------CG
Q17E33_AEDAE/237-421------------------------------------------------------------------------------CD
AEGP_RAT/273-427------------------------------------------------------------------------------TD
ZAN_PIG/149-312------------------------------------------------------------------------------CD
AEGP_MOUSE/494-649------------------------------------------------------------------------------TD
AEGP_MOUSE/979-1144------------------------------------------------------------------------------CD
AEGP_RAT/817-973------------------------------------------------------------------------------CS
Q17E33_AEDAE/18-192------------------------------------------------------------------------------CN
Q176I3_AEDAE/155-323------------------------------------------------------------------------------CD
B0S6D0_DANRE/630-787------------------------------------------------------------------------------CD
B4HP69_DROSE/94-269------------------------------------------------------------------------------CD
B4QA49_DROSI/136-311------------------------------------------------------------------------------CD
B8JKC0_DANRE/268-432------------------------------------------------------------------------------CH
D2HWA9_AILME/125-297------------------------------------------------------------------------------CG
E1BZ39_CHICK/620-774------------------------------------------------------------------------------CN
E9PWQ7_MOUSE/217-373------------------------------------------------------------------------------CT
F1Q7F6_DANRE/345-500------------------------------------------------------------------------------CD
F1QL06_DANRE/266-425------------------------------------------------------------------------------CA
F1R3K1_DANRE/3-159------------------------------------------------------------------------------CL
F1RDD1_DANRE/748-922------------------------------------------------------------------------------CG
F5H0T8_HUMAN/373-535------------------------------------------------------------------------------CD
F5H4B5_HUMAN/41-203------------------------------------------------------------------------------CD
F6PMK1_XENTR/270-431------------------------------------------------------------------------------CT
F6Q2U5_XENTR/171-329------------------------------------------------------------------------------CD
F6RM13_MACMU/211-367------------------------------------------------------------------------------CS
F6TDH8_CIOIN/81-235------------------------------------------------------------------------------CS
F6ZQ08_XENTR/641-800------------------------------------------------------------------------------CN
H3BVJ4_TETNG/269-432------------------------------------------------------------------------------CS
H3BWX9_TETNG/646-801------------------------------------------------------------------------------CD
H3CE92_TETNG/270-435------------------------------------------------------------------------------CD
H3CJZ0_TETNG/58-219------------------------------------------------------------------------------CD
H3CJZ0_TETNG/591-746------------------------------------------------------------------------------CN
H3CQ93_TETNG/344-500------------------------------------------------------------------------------CT
H3CU29_TETNG/52-210------------------------------------------------------------------------------CS
H3DMT5_TETNG/350-507------------------------------------------------------------------------------CN
H3DPC5_TETNG/223-385------------------------------------------------------------------------------CT
L9KUF8_TUPCH/628-792------------------------------------------------------------------------------CH
ENTK_MOUSE/392-549------------------------------------------------------------------------------CT
MAMC2_MOUSE/342-497------------------------------------------------------------------------------CD
NRP1_RAT/650-810------------------------------------------------------------------------------CE
Q9VQS2_DROME/132-307------------------------------------------------------------------------------CD

PF00457

U5MR46_CLOSA/70-253------------------------------------------------------------------------------NG
XYNB_ASPFU/42-219------------------------------------------------------------------------------NN
XYN3_MAGO7/54-234------------------------------------------------------------------------------HN
F8DB45_HALXS/87-262------------------------------------------------------------------------------HE
F9XDM7_MYCGM/45-223------------------------------------------------------------------------------NN
M2QR82_CERS8/44-221------------------------------------------------------------------------------NN
G7XIG9_ASPKW/42-219------------------------------------------------------------------------------SN
A9G323_SORC5/221-397------------------------------------------------------------------------------HC
G2QUC8_THITE/35-208------------------------------------------------------------------------------.D
E3Q8W7_COLGM/43-217------------------------------------------------------------------------------..
A7EQZ6_SCLS1/49-220------------------------------------------------------------------------------..
K0J5P9_AMPXN/62-246------------------------------------------------------------------------------HD
G4TKV8_PIRID/43-220------------------------------------------------------------------------------NN
S8ATR1_PENO1/29-208------------------------------------------------------------------------------NG
T0MBU2_COLGC/37-214------------------------------------------------------------------------------HN
Q2UFR7_ASPOR/71-245------------------------------------------------------------------------------SA
F7PGE0_9EURY/60-235------------------------------------------------------------------------------HD
M9LS78_PSEA3/38-220------------------------------------------------------------------------------QS
G1X5P3_ARTOA/57-231------------------------------------------------------------------------------SN
E6UKJ6_RUMA7/55-250------------------------------------------------------------------------------..
G2XS85_BOTF4/46-225------------------------------------------------------------------------------SG
C7Q365_CATAD/61-236------------------------------------------------------------------------------NN
S7ZJ07_PENO1/39-216------------------------------------------------------------------------------NN
E3QVD0_COLGM/44-216------------------------------------------------------------------------------..
G2X5X8_VERDV/37-215------------------------------------------------------------------------------HN
C6WIK2_ACTMD/54-231------------------------------------------------------------------------------HN
B1ZMX2_OPITP/39-216------------------------------------------------------------------------------DH
A9EQP3_SORC5/210-404------------------------------------------------------------------------------.N
F4H710_CELFA/52-228------------------------------------------------------------------------------HD
S3E0R3_GLAL2/19-199------------------------------------------------------------------------------AQ
R0K9J6_SETT2/42-213------------------------------------------------------------------------------NN
M7TVV3_BOTF1/41-218------------------------------------------------------------------------------SG
T0KW32_COLGC/75-251------------------------------------------------------------------------------AG
G0S9X3_CHATD/56-233------------------------------------------------------------------------------HG
K5X1T9_AGABU/46-223------------------------------------------------------------------------------VN
S3DEM3_GLAL2/50-221------------------------------------------------------------------------------..
B8M5E1_TALSN/53-227------------------------------------------------------------------------------..
V5FWP5_BYSSN/38-215------------------------------------------------------------------------------NN
D9SP57_CLOC7/41-225------------------------------------------------------------------------------FE
A8P4P6_COPC7/104-288------------------------------------------------------------------------------HD
Q0UI10_PHANO/28-204------------------------------------------------------------------------------NS
Q47QL8_THEFY/52-227------------------------------------------------------------------------------HD
G2QWT6_THITE/50-225------------------------------------------------------------------------------.N
R6YEV7_9FIRM/39-222------------------------------------------------------------------------------QD
Q21G61_SACD2/43-220------------------------------------------------------------------------------HG
F7W2U2_SORMK/27-207------------------------------------------------------------------------------.A
R4LPY0_9ACTO/53-232------------------------------------------------------------------------------SG
XYNB_ASPFN/42-219------------------------------------------------------------------------------NN
C9RK54_FIBSS/46-247------------------------------------------------------------------------------.G
XYNC_STRCO/61-238------------------------------------------------------------------------------.D
S7ZVQ9_PENO1/51-226------------------------------------------------------------------------------..
G4UC47_NEUT9/40-217------------------------------------------------------------------------------NN
E3QHP2_COLGM/50-227------------------------------------------------------------------------------HN
M1W9A1_CLAP2/39-214------------------------------------------------------------------------------.G
A8NZY3_COPC7/34-216------------------------------------------------------------------------------QA
G2Q4M3_THIHA/47-221------------------------------------------------------------------------------..
A8NW94_COPC7/49-232------------------------------------------------------------------------------HD
E3S3R6_PYRTT/42-215------------------------------------------------------------------------------..
G4TKT5_PIRID/54-231------------------------------------------------------------------------------HN
Q2HCI0_CHAGB/40-217------------------------------------------------------------------------------HE
I3VTR8_THESW/29-209------------------------------------------------------------------------------.T
B3PIN1_CELJU/38-224------------------------------------------------------------------------------NN
K5WVZ1_PHACS/44-221------------------------------------------------------------------------------NG
G0SAF9_CHATD/37-199------------------------------------------------------------------------------HN
G4TKT3_PIRID/54-231------------------------------------------------------------------------------KD
S8AJR6_DACHA/43-221------------------------------------------------------------------------------HD
M1LSN7_9CLOT/30-211------------------------------------------------------------------------------AT
F0XC21_GROCL/46-221------------------------------------------------------------------------------.S
M4GA15_MAGP6/41-223------------------------------------------------------------------------------QG
B2A9I4_PODAN/43-221------------------------------------------------------------------------------HN
G2X4G1_VERDV/41-216------------------------------------------------------------------------------HG
B8MND2_TALSN/59-232------------------------------------------------------------------------------.S
A9GHF8_SORC5/306-501------------------------------------------------------------------------------.G
E5A0Q4_LEPMJ/78-250------------------------------------------------------------------------------RQ
G4U378_PIRID/48-223------------------------------------------------------------------------------.G
C9RLL3_FIBSS/44-238------------------------------------------------------------------------------.N
B2WG17_PYRTR/46-223------------------------------------------------------------------------------HN
XYNA_BACSU/29-211------------------------------------------------------------------------------AS
XYNA_EMENI/46-223------------------------------------------------------------------------------SN
XYN3_ASPKW/29-208------------------------------------------------------------------------------AG
E6UBP6_RUMA7/65-254------------------------------------------------------------------------------SD
C7YSL3_NECH7/42-220------------------------------------------------------------------------------HG
N1PCA4_MYCP1/49-227------------------------------------------------------------------------------NN
G0R947_HYPJQ/52-226------------------------------------------------------------------------------AS
G2Q913_THIHA/39-217------------------------------------------------------------------------------HD
B2B3J5_PODAN/53-231------------------------------------------------------------------------------HS
Q9KEF3_BACHD/29-208------------------------------------------------------------------------------..
Q2GN95_CHAGB/35-214------------------------------------------------------------------------------HD
A9EUR0_SORC5/153-329------------------------------------------------------------------------------HC
S8AS02_DACHA/46-242------------------------------------------------------------------------------NN
U7Q3B8_SPOS1/53-234------------------------------------------------------------------------------.A
J3NW75_GAGT3/48-227------------------------------------------------------------------------------HN
G4TKT1_PIRID/54-222------------------------------------------------------------------------------KD
XY11A_USTMA/36-218------------------------------------------------------------------------------QS
M7SU57_EUTLA/19-190------------------------------------------------------------------------------..
B6QV47_PENMQ/55-228------------------------------------------------------------------------------AG
M3CYK1_SPHMS/48-225------------------------------------------------------------------------------SN
K1X7K7_MARBU/40-238------------------------------------------------------------------------------NN
G2NBA0_9ACTO/53-228------------------------------------------------------------------------------NN
U7PQP8_SPOS1/44-215------------------------------------------------------------------------------..
G0RUP7_HYPJQ/43-221------------------------------------------------------------------------------NN
G8LXE2_CLOCD/39-223------------------------------------------------------------------------------YQ
T0L8D6_COLGC/39-215------------------------------------------------------------------------------HN
G2QV82_THITE/46-224------------------------------------------------------------------------------..
Q2H5I3_CHAGB/51-228------------------------------------------------------------------------------HG
XYN4_MAGO7/51-228------------------------------------------------------------------------------HD
G8LXE2_CLOCD/424-608------------------------------------------------------------------------------HG
K1WWU0_MARBU/46-224------------------------------------------------------------------------------HD
C7PX63_CATAD/51-229------------------------------------------------------------------------------NS
S8AMN0_PENO1/42-221------------------------------------------------------------------------------NN
F4FB94_VERMA/40-218------------------------------------------------------------------------------HN
E3S9S5_PYRTT/49-227------------------------------------------------------------------------------NN
B8NYB7_ASPFN/69-243------------------------------------------------------------------------------.A
J3NLQ4_GAGT3/38-211------------------------------------------------------------------------------..
L7VQD8_CLOSH/42-225------------------------------------------------------------------------------HG
L0EBB6_THECK/28-208------------------------------------------------------------------------------.A
A8FE31_BACP2/38-219------------------------------------------------------------------------------HG
G4U379_PIRID/50-216------------------------------------------------------------------------------..
E3Q964_COLGM/44-223------------------------------------------------------------------------------NN
C5BU21_TERTT/52-237------------------------------------------------------------------------------HG
B8I7X1_CLOCE/38-221------------------------------------------------------------------------------ID
A8NKZ6_COPC7/44-228------------------------------------------------------------------------------HD
Q11SH7_CYTH3/43-226------------------------------------------------------------------------------HN
B8I371_CLOCE/30-210------------------------------------------------------------------------------.A
I2FN07_USTH4/36-218------------------------------------------------------------------------------HS
G4TKT4_PIRID/54-231------------------------------------------------------------------------------KD
C9Z2V1_STRSW/53-229------------------------------------------------------------------------------DN
S8AP92_PENO1/40-211------------------------------------------------------------------------------NN
T0K1I6_COLGC/42-222------------------------------------------------------------------------------NN
C7ZN05_NECH7/1-172------------------------------------------------------------------------------..
XYNC_FIBSS/52-240------------------------------------------------------------------------------..
G1X9B1_ARTOA/43-221------------------------------------------------------------------------------HD
A9GEL6_SORC5/142-318------------------------------------------------------------------------------HC
K2RN85_MACPH/42-220------------------------------------------------------------------------------NN
R4LM27_9ACTO/54-231------------------------------------------------------------------------------HN
D5UGI1_CELFN/51-229------------------------------------------------------------------------------HS
Q2HI25_CHAGB/36-208------------------------------------------------------------------------------QG
XYNC_FIBSS/327-512------------------------------------------------------------------------------..
G4N696_MAGO7/47-225------------------------------------------------------------------------------..
G8SKM4_ACTS5/52-226------------------------------------------------------------------------------NN
M2TBN8_COCH5/42-219------------------------------------------------------------------------------..
N1PGQ5_MYCP1/47-227------------------------------------------------------------------------------NN
XYNA_GIBZE/50-227------------------------------------------------------------------------------HN
B2WK18_PYRTR/41-214------------------------------------------------------------------------------..
S8AF15_DACHA/44-214------------------------------------------------------------------------------NN
C5BMU2_TERTT/37-214------------------------------------------------------------------------------QN
B6QNP6_PENMQ/54-227------------------------------------------------------------------------------.A
U7PKR6_SPOS1/52-230------------------------------------------------------------------------------NN
G3XY88_ASPNA/57-232------------------------------------------------------------------------------.A
G9NQ12_HYPAI/48-222------------------------------------------------------------------------------SS
F7W777_SORMK/45-222------------------------------------------------------------------------------HN
Q0UBJ9_PHANO/41-216------------------------------------------------------------------------------..
T0JLP7_COLGC/68-241------------------------------------------------------------------------------.R
D8PN69_SCHCM/41-226------------------------------------------------------------------------------DG
C7ZC92_NECH7/39-216------------------------------------------------------------------------------HD
B8E1P4_DICTD/41-222------------------------------------------------------------------------------FD
D1BXH1_XYLCX/54-230------------------------------------------------------------------------------SG
F0S4T0_PEDSD/87-269------------------------------------------------------------------------------NN
G9MV13_HYPVG/54-228------------------------------------------------------------------------------SN
Q2HCI7_CHAGB/53-216------------------------------------------------------------------------------HS
L0E9J8_THECK/24-202------------------------------------------------------------------------------..
E4N0N4_KITSK/54-229------------------------------------------------------------------------------DG
J3PC50_GAGT3/50-229------------------------------------------------------------------------------HN
Q0CMZ1_ASPTN/41-218------------------------------------------------------------------------------NN
S3D920_GLAL2/48-226------------------------------------------------------------------------------NN
E6X8Q5_CELAD/57-241------------------------------------------------------------------------------NG
F9F5R3_FUSOF/43-220------------------------------------------------------------------------------NN
XYNB_ASPCL/42-219------------------------------------------------------------------------------KN
G2Q4S6_THIHA/47-224------------------------------------------------------------------------------HS
Q0UBV5_PHANO/22-194------------------------------------------------------------------------------..
G2X8M4_VERDV/40-224------------------------------------------------------------------------------HD
H1YIW2_9SPHI/65-249------------------------------------------------------------------------------NN
M7STD0_EUTLA/43-222------------------------------------------------------------------------------HN
D4LFB0_RUMC1/42-232------------------------------------------------------------------------------ED

PF01670

GUNA_ASPKW/28-239------------------------------------------------------------------------------SP
G0RRG8_HYPJQ/29-234------------------------------------------------------------------------------.N
Q2UFR8_ASPOR/29-239------------------------------------------------------------------------------.P
Q9RJY3_STRCO/54-261------------------------------------------------------------------------------QG
Q9S5X8_THEMA/18-255------------------------------------------------------------------------------.I

PF00722

XTH8_ARATH/38-224-------------------------------------------------------------------------------F
XTH1_ARATH/36-215-------------------------------------------------------------------------------F
Q6BHG8_DEBHA/45-215-------------------------------------------------------------------------------K
Q6BH77_DEBHA/56-228-------------------------------------------------------------------------------G
Q6BH39_DEBHA/52-224-------------------------------------------------------------------------------N
Q6BRL2_DEBHA/100-275-------------------------------------------------------------------------------N
Q7CTY9_AGRT5/57-234-------------------------------------------------------------------------------N
Q7CSS8_AGRT5/263-456-------------------------------------------------------------------------------I
EXOK_RHIME/58-245-------------------------------------------------------------------------------N
BRU1_SOYBN/32-213-------------------------------------------------------------------------------F
Q6FNU8_CANGA/147-325-------------------------------------------------------------------------------M
XTH10_ARATH/37-218-------------------------------------------------------------------------------F
CRH2_YEAST/96-273-------------------------------------------------------------------------------N
CRR1_ASHGO/155-333-------------------------------------------------------------------------------M
XTH13_ARATH/26-207-------------------------------------------------------------------------------F
Q7XTP9_ORYSJ/31-215-------------------------------------------------------------------------------M
Q6ES26_ORYSJ/32-215-------------------------------------------------------------------------------F
XTH31_ARATH/39-223-------------------------------------------------------------------------------F
Q5AXN2_EMENI/49-224-------------------------------------------------------------------------------T
Q6FWX2_CANGA/97-274-------------------------------------------------------------------------------N
XTH33_ARATH/43-226-------------------------------------------------------------------------------I
GUB_BACSU/54-238-------------------------------------------------------------------------------N
Q6ZAN9_ORYSJ/28-212-------------------------------------------------------------------------------L
Q7XNY6_ORYSJ/36-222-------------------------------------------------------------------------------F
Q6Z2L4_ORYSJ/35-220-------------------------------------------------------------------------------F
Q6RHY1_SOLLC/27-212-------------------------------------------------------------------------------F
Q6CIZ6_KLULA/49-219-------------------------------------------------------------------------------E
Q84T83_ORYSJ/36-221-------------------------------------------------------------------------------F
Q8H7Q1_ORYSJ/3-189-------------------------------------------------------------------------------F
Q8GVQ2_ORYSJ/40-224-------------------------------------------------------------------------------F
Q6C4P9_YARLI/48-219-------------------------------------------------------------------------------P
CRH1_YEAST/65-235-------------------------------------------------------------------------------S
XTH17_ARATH/29-211-------------------------------------------------------------------------------F
Q6ZAN8_ORYSJ/30-214-------------------------------------------------------------------------------M
XTH2_ARATH/32-212-------------------------------------------------------------------------------F
Q8GVR3_ORYSJ/46-232-------------------------------------------------------------------------------F
XTH28_ARATH/31-216-------------------------------------------------------------------------------F
Q7SGL2_NEUCR/50-224-------------------------------------------------------------------------------T
Q5KNP5_CRYNJ/97-278-------------------------------------------------------------------------------N
Q6YUP5_ORYSJ/36-221-------------------------------------------------------------------------------F
Q9FZ05_SOLLC/27-209-------------------------------------------------------------------------------F
Q825L5_STRAW/78-287-------------------------------------------------------------------------------H
UTR2_CANAL/100-275-------------------------------------------------------------------------------N
Q7S222_NEUCR/48-222-------------------------------------------------------------------------------G
Q6Z998_ORYSJ/39-226-------------------------------------------------------------------------------M
Q7N1F8_PHOLL/52-255-------------------------------------------------------------------------------L
Q97FD3_CLOAB/57-242-------------------------------------------------------------------------------N
CRR1_YEAST/147-325-------------------------------------------------------------------------------M
Q7XBU8_ORYSJ/32-215-------------------------------------------------------------------------------F
XTH32_ARATH/43-227-------------------------------------------------------------------------------F
XTH26_ARATH/29-208-------------------------------------------------------------------------------F
Q82M60_STRAW/400-624-------------------------------------------------------------------------------G
Q6K9X1_ORYSJ/50-242-------------------------------------------------------------------------------F
XTH21_ARATH/28-209-------------------------------------------------------------------------------F
Q7S7D0_NEUCR/61-233-------------------------------------------------------------------------------D
XTH25_ARATH/30-211-------------------------------------------------------------------------------F
Q6FSM3_CANGA/48-218-------------------------------------------------------------------------------E
Q6ES25_ORYSJ/25-208-------------------------------------------------------------------------------F
Q5Z746_ORYSJ/26-208-------------------------------------------------------------------------------F
CRH11_CANAL/50-220-------------------------------------------------------------------------------L
Q5B4L5_EMENI/96-273-------------------------------------------------------------------------------N
Q5Z6H1_ORYSJ/36-217-------------------------------------------------------------------------------F
XTH24_ARATH/24-205-------------------------------------------------------------------------------F
Q98C78_RHILO/80-268-------------------------------------------------------------------------------N
Q7SBQ2_NEUCR/99-274-------------------------------------------------------------------------------D
Q8XNF8_CLOPE/412-635-------------------------------------------------------------------------------G
XTH1_SOLLC/33-214-------------------------------------------------------------------------------F
Q7XTP8_ORYSJ/24-207-------------------------------------------------------------------------------I
Q6CL87_KLULA/145-322-------------------------------------------------------------------------------M
XTH3_ARATH/35-213-------------------------------------------------------------------------------F
GUB_CLOTH/57-238-------------------------------------------------------------------------------.
B9RG34_RICCO/58-238-------------------------------------------------------------------------------.
C5Z8T4_SORBI/33-213-------------------------------------------------------------------------------.
D3EBX7_GEOS4/64-257-------------------------------------------------------------------------------.
D7SNC1_VITVI/38-220-------------------------------------------------------------------------------.
E7FHE7_PYRFU/86-290-------------------------------------------------------------------------------.
F2D903_HORVD/30-212-------------------------------------------------------------------------------.
F2DT99_HORVD/27-208-------------------------------------------------------------------------------.
F2DUU5_HORVD/27-204-------------------------------------------------------------------------------.
G2XIS4_VERDV/50-220-------------------------------------------------------------------------------.
G4NC59_MAGO7/98-270-------------------------------------------------------------------------------.
K4DD58_SOLLC/24-203-------------------------------------------------------------------------------.
M1AN43_SOLTU/24-201-------------------------------------------------------------------------------.
M4EZF0_BRARP/17-194-------------------------------------------------------------------------------.
Q5L861_BACFN/78-272-------------------------------------------------------------------------------.
Q9WXN1_THEMA/253-454-------------------------------------------------------------------------------.
T0UMT6_9STRE/50-231-------------------------------------------------------------------------------.
V4IZ43_9ACTO/74-282-------------------------------------------------------------------------------.
W5I2U1_WHEAT/24-204-------------------------------------------------------------------------------F

PF03935

Q6BW61_DEBHA/174-674.............ESYEILTSYRYPLLSAIR.TGLVDPDTPEDALTKKTS.K.DATWKLVFSDEFNAAGR-TFYEGDDQF
Q0UQN1_PHANO/94-573GKPFWA.ANIYKAEAWAHVNDVKYPFIQNIR.TGLIDPDTPKSAMKRKGE.Y.GDEYELVFSDEFNVENR-TFYEGDDPY
A5DEX4_PICGU/157-655.............ESYEILTHYKYPILSAIR.TSLVDPDTPDEYLTRKVT.T.G.TWKLVFSDEFNKDGR-TFYDGDDQF
A1C6M7_ASPCL/154-653P............RDTLCLDVGDRPLLSNIR.RGLIDPDTPKSARSKKSA.D.GKEWKLVFSDEFNTDGR-TFYDGDDPF
Q752M9_ASHGO/153-654.............KLTEVLSPYQYPQLSAIR.TSLVDPDTPKDARKRKSL.K.GETWPLVFSDEFNAVGR-TFFEGDDQF
Q5KJ60_CRYNJ/92-619SG..........YNLGGINASGQYPSITGLP..SLIDSDTPEYLYTRTGF.D.GKEWTLVFSDEFEKDGR-TFFEGDDPF
Q4P2E5_USTMA/148-679.............ASASLSTTTTFTTFPVNMKRGLVDQETPQSAYKRTSPVD.NSAWHLVFSDEFNTPGR-TFWPGDDPF
A5DZI8_LODEL/240-745.............ESYEVLTRYSYPMLSAIR.QSLIDPDTPLDAMLKKSK.L.GDTWPLVFSDEFNVEGR-TFYDGDDQF
Q4PGA6_USTMA/384-919GG..........FNLGGANATGQVADLKIGR..GLIDPDTPESVKTRTTLNGSGKKMNLVFSDEFNRDGR-SFYPGDDPF
Q4P8J4_USTMA/197-732GG..........YNLGGVNASGQIASIPGLR.SSLIDPDTPQDARTRLSP.DGTKTMKLVFSDEFNTPGR-SFYPGDDPF
YEPB_SCHPO/124-627FD..........AIMANQITDHLFAHMRVPR.TNLIDKDTPSTAYHRTGY.N.GRKYNLVFSDEFNKEGR-SFYSGNDQF
YEOB_SCHPO/134-636.............TRVTGITNHQFRILRLLRYGSLIDPDTPESAYTFDSQ.D.LGTLDLVFSDEFNYPGR-AFYDGDDQF
A7TTP7_VANPO/229-744RQGGSSSGGGSQNGDNEYLTAYTYPQLAAIR.TTLVDPDTPSAAKTRKAK.D.GSSWNLVFSDEFNAEGR-TFYDGDDQF
A5DZ87_LODEL/332-841.............LTYLILTQYKYPTLSAIR.QSLIDPDTPLDARTIEAR.D.GSDWSLVFSDEFNVVGR-TFYEGDDQF
Q6FUB1_CANGA/183-684.............VVQEILSAYQYPQLSAIR.TKLVDPDTPQSALSRQAR.D.GSYWKLVFSDEFNAEGR-TFYDGEDQF
A7E6J8_SCLS1/168-668.............AAAIDCLSIKIPLLKNVR.TGLIDPDTPDSVKSKTAQ.D.GTKLKLVFSDEFNTDGR-TFYDGDDPF
Q5AEC0_CANAL/212-718.............QEYEILSHYSYPLLSAIR.TSLIDPDTPQDALKMKAK.D.GSNWSLVFSDEFNIMGR-TFYEGDDQF
A3LPW0_PICST/189-695.............QSYEILTDYTYPLLSAIR.TSLVDPDTPSSAFNHTAQ.N.GDVWTLVFSDEFNAEGR-TFYEGDDQF
A7EWT0_SCLS1/211-717SGYV......DYGPAWAHVNNNTYPLLKNVR.TTLIDPDTPQTARTRESTFN.GETLNLVFSDEFNNNNR-TFYPGDDPF
Q5KHK4_CRYNJ/69-588GA..........YNIGGINSTGQVPLISNIP..TVIDSDTPVDKYTRTGF.D.GKTYSLVFSDEFEKEGR-TFFPGDDPF
Q0UKL9_PHANO/161-653G............NPLCIQGKQNEPILSTYE.RG..S.STPT...............QLGFSDEFNVDGP-LFYDGDDPY
A3LPU3_PICST/148-653.............EEYEILTHYQYPLLSAIR.TNLVDPDTPSDALTIKAQ.D.GSNWSLVFSDEFNAEGR-TFYDGDDQF
Q6FQ11_CANGA/223-736IHPANS..TNFTNHNAVPLSLYQYPQLSAIR.TSLVDPDTPQSALTRKAK.D.GSDWRLVFSDEFNAAGR-TFYDGDDQF
E7LUU1_YEASV/250-763HAANSA.GSSSSNTTSKSLTEYQYPQLAAIR.TTLVDPDTPDSAKTRVAK.D.GSKWQLVFSDEFNAEGR-TFYDGDDQF
M7NJX3_PNEMU/194-674.............RCPDCIKTLPIDLLGATR..GLIDPDTPEEFYELKNS.D.GKVYKLVFSDEFNKDGR-TFYPGDDQF
Q5A4H2_CANAL/99-596F............ENYEVLTRYSYPRLSAIR.TSLIDPDTPEDALFWKSK.N.GEEWPLVFSDEFNAEGR-TFYEGDDQF

PF10287

K0KZR6_WICCF/233-464------------------------------------------------------------------------------SD
I2H1W8_TETBL/107-341------------------------------------------------------------------------------SD
D0N3P2_PHYIT/250-486------------------------------------------------------------------------------GS
A7TFI3_VANPO/109-343------------------------------------------------------------------------------VS
N1PMX9_MYCP1/238-461------------------------------------------------------------------------------.G
G0VAP6_NAUCC/104-338------------------------------------------------------------------------------SD
S9W8F8_SCHCR/234-466------------------------------------------------------------------------------SD
C5GJ05_AJEDR/167-389------------------------------------------------------------------------------GN
K3W690_PYTUL/247-486------------------------------------------------------------------------------GP
I2GUP8_TETBL/154-386------------------------------------------------------------------------------SS
A5DXV9_LODEL/227-457------------------------------------------------------------------------------GA
C4XY08_CLAL4/110-342------------------------------------------------------------------------------GT
M3A440_MYCFI/207-432------------------------------------------------------------------------------SG
D0MRW8_PHYIT/313-551------------------------------------------------------------------------------SD
W1QLM9_OGAPD/217-448------------------------------------------------------------------------------SG
C5DKG4_LACTC/102-336------------------------------------------------------------------------------AD
J7R3E5_KAZNA/106-340------------------------------------------------------------------------------SA
G0VBJ0_NAUCC/237-460------------------------------------------------------------------------------GS
I2H8C5_TETBL/275-505------------------------------------------------------------------------------GS
Q75A62_ASHGO/259-490------------------------------------------------------------------------------SG
E3RIT6_PYRTT/99-331------------------------------------------------------------------------------SN
B6JWV1_SCHJY/233-464------------------------------------------------------------------------------GS
A5DNR6_PICGU/97-330------------------------------------------------------------------------------.N
G8Y3C3_PICSO/237-463------------------------------------------------------------------------------GD
C5M9J2_CANTT/224-453------------------------------------------------------------------------------GA
G3AKA2_SPAPN/103-336------------------------------------------------------------------------------GE
G3ARF7_SPAPN/199-428------------------------------------------------------------------------------SA
G3JJN7_CORMM/201-421------------------------------------------------------------------------------QA
C7YIC0_NECH7/221-441------------------------------------------------------------------------------GA
Q0UV14_PHANO/96-328------------------------------------------------------------------------------AD
K0KM65_WICCF/142-376------------------------------------------------------------------------------SG
G1XB81_ARTOA/196-429------------------------------------------------------------------------------..
M1W9S2_CLAP2/235-455------------------------------------------------------------------------------SD
Q6FJK5_CANGA/212-435------------------------------------------------------------------------------GD
R1ESJ6_BOTPV/247-467------------------------------------------------------------------------------GS
D0N6Y2_PHYIT/175-409------------------------------------------------------------------------------GT
C5DIE9_LACTC/221-452------------------------------------------------------------------------------SG
G8BET5_CANPC/99-332------------------------------------------------------------------------------GD
G8JQC7_ERECY/209-441------------------------------------------------------------------------------SA
E3G0R9_STIAD/153-380------------------------------------------------------------------------------AS
C4R9F6_PICPG/189-423------------------------------------------------------------------------------GS
L8G239_PSED2/205-429------------------------------------------------------------------------------AA
A7TMJ4_VANPO/222-451------------------------------------------------------------------------------SG
C5DXY8_ZYGRC/256-484------------------------------------------------------------------------------GS
G3B3K2_CANTC/207-428------------------------------------------------------------------------------GD
G0W356_NAUDC/104-338------------------------------------------------------------------------------SD
Q7SG43_NEUCR/112-341------------------------------------------------------------------------------GS
K3WLE5_PYTUL/196-423------------------------------------------------------------------------------SS
S3DKR2_GLAL2/298-524------------------------------------------------------------------------------GV
F2PH39_TRIEC/193-423------------------------------------------------------------------------------GQ
M2N8D8_BAUCO/220-449------------------------------------------------------------------------------..
Q6BRM6_DEBHA/197-423------------------------------------------------------------------------------GD
C5M5H0_CANTT/101-334------------------------------------------------------------------------------GN
G8ZNQ8_TORDC/230-458------------------------------------------------------------------------------GA
D5GIX3_TUBMM/208-444------------------------------------------------------------------------------GT
A3LP10_PICST/207-435------------------------------------------------------------------------------GD
R4XDU4_TAPDE/242-471------------------------------------------------------------------------------.V
A7TGR9_VANPO/102-336------------------------------------------------------------------------------AD
H3H0J0_PHYRM/316-553------------------------------------------------------------------------------GS
Q757Z0_ASHGO/117-351------------------------------------------------------------------------------GS
Q5AJN2_CANAL/226-456------------------------------------------------------------------------------GA
M3D6U8_SPHMS/213-438------------------------------------------------------------------------------SG
H3GMI5_PHYRM/341-578------------------------------------------------------------------------------SD
I2H9Q2_TETBL/105-339------------------------------------------------------------------------------SD
G8ZYU9_TORDC/104-337------------------------------------------------------------------------------SD
S0DQ79_GIBF5/217-437------------------------------------------------------------------------------GH
M4BGZ3_HYAAE/337-572------------------------------------------------------------------------------.T
F9XBT5_MYCGM/245-464------------------------------------------------------------------------------GN
G8BXS9_TETPH/170-397------------------------------------------------------------------------------SS
H2AXG7_KAZAF/104-337------------------------------------------------------------------------------DS
U4LN65_PYROM/147-371------------------------------------------------------------------------------GG
J7RTK3_KAZNA/245-466------------------------------------------------------------------------------GS
C5FXD0_ARTOC/196-427------------------------------------------------------------------------------GE
Q6CGN1_YARLI/220-451------------------------------------------------------------------------------SD
G2WT64_VERDV/218-439------------------------------------------------------------------------------GD
Q6FJ92_CANGA/109-343------------------------------------------------------------------------------QS
G4U9Y4_NEUT9/21-245------------------------------------------------------------------------------GS
E4ZV72_LEPMJ/267-498------------------------------------------------------------------------------.D
G8BU49_TETPH/100-334------------------------------------------------------------------------------DD
W1QLK8_OGAPD/133-365------------------------------------------------------------------------------GS
G8JX30_ERECY/121-347------------------------------------------------------------------------------GD
Q6CXP7_KLULA/106-342------------------------------------------------------------------------------TS
C4JID9_UNCRE/192-415------------------------------------------------------------------------------GE
Q6CVS7_KLULA/216-447------------------------------------------------------------------------------SA
H2AXG9_KAZAF/107-341------------------------------------------------------------------------------SS
A7TQU3_VANPO/143-371------------------------------------------------------------------------------SA
K3XBG2_PYTUL/358-594------------------------------------------------------------------------------GT
M7SLD2_EUTLA/204-432------------------------------------------------------------------------------.D
R7YJQ9_CONA1/229-450------------------------------------------------------------------------------GD
H6BRJ0_EXODN/215-434------------------------------------------------------------------------------GQ
K3X9Z2_PYTUL/110-344------------------------------------------------------------------------------GS
L2FRA0_COLGN/221-441------------------------------------------------------------------------------GE
Q7SG41_NEUCR/178-394------------------------------------------------------------------------------..
A5DBA4_PICGU/200-428------------------------------------------------------------------------------GD
K2RHU7_MACPH/245-465------------------------------------------------------------------------------GE
Q7SG42_NEUCR/163-390------------------------------------------------------------------------------GS
YH6B_SCHPO/264-495------------------------------------------------------------------------------SD
J8Q0R9_SACAR/105-339------------------------------------------------------------------------------SD
K1XZI2_MARBU/332-545------------------------------------------------------------------------------HS
F0UMR1_AJEC8/199-421------------------------------------------------------------------------------GN
I2H2C5_TETBL/110-343------------------------------------------------------------------------------TS
E9EMJ7_METAR/226-457------------------------------------------------------------------------------SD
G3AYC4_CANTC/101-337------------------------------------------------------------------------------ED
H2AVQ7_KAZAF/220-440------------------------------------------------------------------------------GA
E4UXS3_ARTGP/195-422------------------------------------------------------------------------------GK
U1HUX4_ENDPU/201-424------------------------------------------------------------------------------GQ
A7F2W5_SCLS1/255-477------------------------------------------------------------------------------GS
C4R2B9_PICPG/119-353------------------------------------------------------------------------------AT
F2SIK0_TRIRC/197-428------------------------------------------------------------------------------GQ
C4Y1A3_CLAL4/229-457------------------------------------------------------------------------------GD

PF00840

K1WCU0_MARBU/20-452----------------------------AGTNKPETHPPLEVSTC..TA............SG...CTTS.AQSIVVDAN
G3XZK9_ASPNA/20-448----------------------------AGTLTEEVHPSLTWQKC..TS............EG..SCTEQ.SGSVVIDSN
F4PY37_DICFS/22-455----------------------------AGKLSPEVHPPITWQQC..DA............NG..QCNTV.QGEIVIDAN
G1XV93_ARTOA/22-459----------------------------PGSVTAETHPGLTSSVC..TR............SG..GCTTK.NTKIVVDAN
L8WSW0_THACA/22-455----------------------------VGTNKAEVHPTLTWQKC..TK............SG..GCQTQSQGKIVLDAN
G2QZA7_THITE/22-417----------------------------IGKAVPEVHPKLTTQKC..TL............RG..GCKPV.RTSVVLDSS
E4ZFU3_LEPMJ/20-452----------------------------VGTEQTETHPGMTWQTC..TA............KG..SCTAK.NGKVVIDAN
M2UA27_COCH5/21-452----------------------------VGTSTAENHPKLTWQTC..TG............TGGTNCSNK.SGSIVLDSN
E3L6D5_PUCGT/29-447----------------------------....LQESPPSLKIQNC..ES............DG..KCSEI.RMSVTLDAD
S3D4J2_GLAL2/21-452----------------------------VGTQQKETHPSMTWQKC..TG............TGGTSCTTQ.NGKVVIDSN
I1FU52_AMPQE/20-456----------------------------IGTNAPENHPPLSIQSC..TS............PG..QCQTQ.QASIVLDSN
B6QIG2_PENMQ/28-458----------------------------IGTLTTETHPPLTWSTC..KS............GG..SCTSN.SGSIVLDAN
G2WXB9_VERDV/20-447----------------------------VGTETPETHPPLTWKDC..SS.............G..TCSDV.QGSVVVDAN
Q7S390_NEUCR/20-440----------------------------PGKLTPEVHPKLPTWAC..TV............AD..GCIQK.DTSLVLDSD
V2WZE7_MONRO/22-456----------------------------VGTNTAENHPKLSVSKC..SA............GG..SCATQ.QGSVVLDSN
A7EUL3_SCLS1/19-449----------------------------IGTYTTETHPSLTWQSC..TA............KG..SCTTQ.SGSIVLDGN
S3CP84_GLAL2/21-459----------------------------.ATLQPEVHPLMRWESC..SS............AG...CSKQ.NGSLVLDAE
N4UZJ1_COLOR/19-440----------------------------AGTQQTETHPKLTWQQC..TA.............S..SCTNV.NGEVVIDAN
G7XKW4_ASPKW/24-460----------------------------VGTYTTETHPSLTWQTC..TS............SG..SCTTN.NGAVVIDAN
F7W7F9_SORMK/30-440----------------------------IGTGIPEVHPRFRTQKC..TK............FG..GCKNQ.QTYLVADSR
G2YS63_BOTF4/20-452----------------------------AGTLTTETHPPLSVSQC..TA............SG...CTTS.AQSIVVDAN
E3K8B1_PUCGT/22-457----------------------------.GKIKPEKPVPFIVKEC..AS............GS..NCKDL.SGGLTIDAN
Q55FE6_DICDI/22-455----------------------------IGKLTPEVHPPMTFQKC..SE............GG..SCETI.QGEVVVDAN
M2N728_BAUCO/20-450----------------------------AGTLTAEVHPPLTVSNC..TA............NG...CTTE.SHTIVLDAN
R8BSD2_TOGMI/20-444----------------------------VGKEQTETHPKMSWKKC..TS............GG..SCTTT.NAEVVIDAN
G2Q359_THIHA/20-453----------------------------AGTLTEEIHPSLPIEVC..TA............PG..SCTKE.DTTVVLDAN
G4V088_NEUT9/21-421----------------------------IGTLTPESHPKLPTKRC..TL............SG..GCQTV.STSIVLDAF
B2AQ71_PODAN/25-431----------------------------IGTLTPELHPRFPTQQC..TS............SG..ICTTK.QTSLVTDAL
S7ZRD6_PENO1/28-461----------------------------AGTLTAESHPALTWQKC..SA............GG..SCTPV.SGSVVIDAN
CBHB_ASPFU/29-463----------------------------VGTSQAEVHPSMTWQSC..TA............GG..SCTTN.NGKVVIDAN
U4LWF8_PYROM/21-452----------------------------AGTLTAENHPTMTWQQC..TK............SG...CTTT.NGKVVLDSN
F7W4B0_SORMK/24-424----------------------------IGTFVPESHPKLPIKKC..TL............AG..GCQTV.NTLITIDAF
G2WQW0_VERDV/20-447----------------------------VGTEEPEVHPKITWKRCTGTN............GS..NCATV.NGEIVIDAN
B2A8V6_PODAN/19-451----------------------------VGTYTAERHPSMPIQVC..TA............PG..QCTRE.STEVVLDAN
R8BMF8_TOGMI/19-453----------------------------IGTNTAEKHPSMPIQSC..SA............SG...CTTE.QTSVVLDAN
L2FC27_COLGN/19-441----------------------------VGDLQQEIHPKLSWKQC..TS............ST...CDTV.QGEITIDAE
H1W5V0_COLHI/19-443----------------------------VGTEQSETHPRLNWQRC..TS.............G..SCSNV.NAEVVIDAN
M4GCD6_MAGP6/30-424----------------------------....TKEVHPRLTTWKC..TT............SG..GCKSQ.NTALVIDSL
M2QWB1_CERS8/85-519----------------------------IGTQTAEVHPTLSWSQC..TA............DG..TCTSQ.SGSVVLDAN
D8QBJ3_SCHCM/21-453----------------------------VGNLTAETHPSLSWQEC..TS............SG...CTDH.SAAITIDAN
E3KSU8_PUCGT/22-454----------------------------VGTMNPEVPPEITIDNC..TA............KG...CEPL.KGGATIDAN
U4L139_PYROM/20-454----------------------------VGTNTAESHPQLRSQTC..TK............SG..GCSTQ.STSVVLDSN
S3CAD2_OPHP1/20-451----------------------------VGNNTIEVHPRLTTWRC..TH............AG..GCTPR.NTAVVLDAN
G0S477_CHATD/21-451----------------------------ACSLTTETHPRLTWKRC..TS............GG..NCSTV.NGAVTIDAN
C7ZHP8_NECH7/23-415----------------------------...NTPEVHPRLDTFRC..TV............LG..GCKKQ.TNYIVMESS
R0K7Q4_SETT2/24-451----------------------------.GKEQTETHPKMTWQRC..TG............KGGTSCSNV.NGEIVIDAN
M4BUX1_HYAAE/30-470----------------------------VGTSTAEVHPPLTTQTC..TK............DG...CKDD.KTSVVLDSN
G2WZP1_VERDV/20-456----------------------------ACTSQAETHPPLTWQKCTGTG............GS..SCTNV.SGSVVLDSN
N4UQR7_COLOR/21-445----------------------------IGDLQEEIHPKLSWTRC..NA............ST...CDTV.QGEITVDAE
U7Q8V8_SPOS1/21-424----------------------------IGTAVPEVHPKLPTQFC..TT............AG..GCKTM.QTSLVTDAL
J3Q1X0_PUCT1/27-447----------------------------..KSTPEPNLPLHFEKC..TP............DH..GCKKV.PGGITLDAN
M4G9M2_MAGP6/27-444----------------------------EGT...EAHPELPTRFC..TK............AG..GCVTK.QTKIVAKAE
B6HC69_PENCW/20-452----------------------------AGTLTAETHPSLTWQKC..TA............EG..SCTDQ.KGSVVIDSN
Q2GUM4_CHAGB/23-447----------------------------VGTSTSETHPKITWKKC..SS............GG..SCSTV.NAEVVIDAN
U7PKV6_SPOS1/26-451----------------------------VGTQQTETHPKMPYQKC..TA............KG..SCTTQ.QGEIVIDAN
K1WM38_MARBU/21-461----------------------------.GTFTAEVHPPLTWQTC..TA............PG..SCTTI.NGKVVLDSN
G0RVK1_HYPJQ/20-446----------------------------ACTLQSETHPPLTWQKC..SS............GG..TCTQQ.TGSVVIDAN
H3G8U1_PHYRM/34-471----------------------------AGTSTPEVHPPLASKQC..SK............AG..GCVTE.ATSVVLDAN
M7SVI4_EUTLA/21-454----------------------------VGEEDPETHPALTWSKC..TA............AG..ACTEV.AGTVVIDSN
M4FNF9_MAGP6/20-447----------------------------VGKDTAETHPRMTWQKC..TA............PG..RCSNV.NGEVTIDAN
R8BQZ2_TOGMI/20-451----------------------------VGTSTTETHPKMSWSKC..SS............GG..SCTSQ.SGEVVIDSN
S3D235_GLAL2/20-454----------------------------IGTLTPEVHPPLTWQTC..TA............PG..SCTTV.NGKIVLDSN
F0XKB1_GROCL/20-444----------------------------VGTQQTETHPTMTWKKC..TS............AG..QCAAV.NGEVVVDAN
C7YH34_NECH7/20-451----------------------------ACTLNTENKPALTWAKC..TS............SG...CSNV.RGSVVVDAN
F9FPS1_FUSOF/20-451----------------------------VCSLNTETKPALTWSKC..TS............SG...CSDV.KGSVVIDAN
CBHA_EMENI/20-446----------------------------AGTAQEEVHPSLTWQRC..EA............SG..SCTEV.AGSVVLDSN
F4RKA2_MELLP/26-456----------------------------ADTALKERHPRLNFESC..TK............AK..GCVKI.KASVTLDAT
J3Q4E0_PUCT1/22-425----------------------------AGSVNPEVPPPITIKNC..IG............KT...CKDV.TGGATIDAN
G4N143_MAGO7/22-445----------------------------VGTQTAENHPKMTWKKC..TG............KA..SCTTV.NGEVVIDAN
E3JU73_PUCGT/29-437----------------------------.....AEPNLPLEIQTC..TV............GK..GCKRI.PGSITLDAN
L8WJB0_THACA/84-513----------------------------VGTSKAEVHPPLPWQKC..TK............SG..GCVTQSSGKVVLDAN
M7TJ66_BOTF1/21-446----------------------------VGTSTAETHPALTVQKC..AA............GG..TCTDE.SDSIVLDAN
F4S1M9_MELLP/23-458----------------------------VGTQTPEKPPPLSISSC..TK............GA..GCTEK.VRSVTLDAN
M5BZ75_THACB/20-450----------------------------AGTVTAETHPSLPWQKC..TK............SG..GCVTQSSGKIVLDSN
CELB_ASPFN/20-414----------------------------VGT.TADAHPRLTTYKC..TS............QN..GCTRQ.NTSVVLDAA
K5WYE3_AGABU/21-450----------------------------VGTNMAENHPSLTWQRC..TS............SG...CQNV.NGKVVLDAN
F4RTE7_MELLP/22-447----------------------------IGKLIPEVQPKLNYQTC..TK............AG..GCTKH.NGTVTLDSK
N1PY93_MYCP1/21-450----------------------------AGTNTAETHPTLPISSC..TA............AE...CLNL.GTSITLDAN
F0ZJZ1_DICPU/21-454----------------------------VGKFSPEVHPPITWQEC..AD............DG..SCKTM.NGEIVIDAN
G4NI68_MAGO7/22-416----------------------------.....TEVHPKITTYRC..TK............EG..GCTEK.TNYIVIDSL
H1VQX8_COLHI/20-456----------------------------VCTSQVETHPPLQWQKX..AA............GG..SCTNV.AGSVVLDSN
M2SZK0_COCSN/20-452----------------------------VGTQKEEVHPKLSWQSC..TA............PG..SCTTQ.NGEVVVDAN
D0N841_PHYIT/25-462----------------------------AGSNKAETHPPFTTQTC..TK............SG...CTDE.DTSIVLDAN
A8NU36_COPC7/21-457----------------------------VGREVAENHPRLPWQRC..TR............NG..GCQTVSNGQVVLDAN
L2FY65_COLGN/20-452----------------------------VCTLNTETKPALTWSTC..AA............GG..SCTTN.NGAITVDAN
G4MMG0_MAGO7/20-450----------------------------ACSLTAETHPSLTWQKC..SS............GG..SCTNV.AGSVTIDAN
I1RVH7_GIBZE/22-419----------------------------..DKTQEKHPKIETYRC..TK............AK..GCKKA.TNYIVADAE
H3GA97_PHYRM/27-460----------------------------AGTNIPEVHPSLPSQVC..TKVTNVLGQVDQVDAKVVNCVTE.KSSVVIDAN
M3ARV6_MYCFI/20-450----------------------------AGTNTAETHPALPISEC..TA............SG...CSTL.DTSITLDAN
S8A7U8_DACHA/23-453----------------------------VGTQKAETHPSMSFETC..DG............SG..SCSSN.SGEVVIDAN
F4RKA1_MELLP/25-454----------------------------.HTTPTEIQPKFNYELC..TK.............K..GCFKH.KGTVTADVS
R1GZN3_BOTPV/19-452----------------------------VGTQKSEVHPSLTWQTC..TS............SG...CTTN.QGSIVVDAN
S3DFW5_GLAL2/20-452----------------------------AGTVTAETHPALTVSQC..TA............SG...CKTS.AQSIVLDSN
G4TMW4_PIRID/20-450----------------------------VGTQLAESHPSLSWQKC..TK............SG..GCTNV.AGSIVLDAN
CBHA_ASPFU/20-450----------------------------VGTQTPETHPPLTWQKC..TA............AG..SCSQQ.SGSVVIDAN
U7Q430_SPOS1/20-452----------------------------VGKETTETHPKMSWQKC..SG............AG..SCSTV.QGEVTIDSN
E9G5J5_DAPPU/22-463----------------------------VGTQAAEEPLNLPISVC..TA............PG..NCQTE.ADAVVLDSN
F4S1M8_MELLP/21-456----------------------------AGTNTPETGPALSVQTC..TK............GG..GCKKT.SSKVTLDAN
F4S1N8_MELLP/22-461----------------------------AGSKTPEVHPKVTVQQC..SK............GG..SCKDL.SLSITLDAN
S7ZJL3_PENO1/20-451----------------------------VGTQKPETHPPLAWKEC..TS............SG...CTSK.DGSVVIDAN
K5ULV7_PHACS/21-445----------------------------AGTQTPETHPSLSSQKC..TA............SG..GCVTQ.DTSVVLDGN
N4V9B4_COLOR/24-453----------------------------VGKEQTETHPKLTWQKC..TA............PG..RCSNV.NGEVVLDSN
G2QNN8_THIHA/23-447----------------------------AGNLQTETHPRLTWSKC..TA............PG..SCQQV.NGEVVIDSN
R1EEG3_BOTPV/22-455----------------------------VGTQTAETHPKLTTQKC..TT............AG..GCADQ.STSIVLDAN
M4BJM4_HYAAE/27-464----------------------------VGTNTKEVHPPLISSRC..SK............TN..GCVHE.TTSIVLDAN
E3K8C2_PUCGT/23-457----------------------------...KTPENPASFIITDC..GN............GS..KCKEV.SGGLTIDAN
K3X3U7_PYTUL/24-462----------------------------IGTNQPEVHPALPSQTC..TS............GS..GCTTE.STKIVLDAN
F9XAF9_MYCGM/21-444----------------------------IGTNTPEVNPSLPFSQC..TS............SG...CTKV.NTGVTLDAN
L2FAS8_COLGN/19-444----------------------------VGTEEAEVHPKLSWSDC..TS.............G..SCSTK.SSDVVIDAN
K5WIZ5_PHACS/21-445----------------------------AGTQTPETHPTLSSQKC..TT............AG..GCVNQ.STKVVLDSN
S8AFI7_DACHA/25-419----------------------------...KTREVHPKVTTYKC..TK............RG..GCKKN.TNYVVLDAA
E3QH29_COLGM/20-451----------------------------ACKLTAETKPALSWSNC..AA............GG..TCTKV.NAAVTVDSN
M1WAR4_CLAP2/22-453----------------------------ACSSKPETHPPLSWSRC..SR............SG...CRSV.QGAVTVDAN
B2ACE0_PODAN/21-453----------------------------VCSLTPESHPPLTWQRC..SA............GG..SCTNV.AGSVTLDSN
H3G7U3_PHYRM/13-452----------------------------AGSNRAETHPPLTTQTC..TK............AG...CTDE.DTSIVLDAN
G4NIA4_MAGO7/20-446----------------------------VGTNEPEVHPKMTWKKC..SS............GG..SCSTV.NGEVVIDGN
G4ULV4_NEUT9/157-586----------------------------VCSLTAETHPSLNWSKC..TS............SG...CTNV.AGSITVDAN
F9FY42_FUSOF/22-415----------------------------..DKAKEQHPKLETYRC..TK............AS..GCKKQ.TNYIVADAG
B2ASX1_PODAN/25-450----------------------------VGTQQTETHPRITWKRC..TG............KA..NCTTV.QAEVVIDSN
C7ZHU8_NECH7/20-451----------------------------ACTSTQETHPPLTWSKC..TS............SG...CTEV.SGSVVVDAN
D8PLS5_SCHCM/21-454----------------------------VGTLQSETHPSLTYQTC..TS............SG...CTSH.NGKVVLDSN
S8AA61_DACHA/19-434----------------------------PGTLTPEVHPSLPIKTC..AT............NR..GCKTL.NTKVVLDSN
CBHB_EMENI/26-460----------------------------VGTQQAEVHPGLTWQTC..TS............SG..SCTTV.NGEVTIDAN
N4V9A4_COLOR/19-434----------------------------.GHFVPEVHPALSWSRC..TS............PG..SCDPV.DGAVTIDAA
B8NIG8_ASPFN/28-463----------------------------VGTYQTETHPSMTWQTC..GN............GG..SCSTN.QGSVVLDAN
G1XLC3_ARTOA/25-418----------------------------...KTKEKHPKLETYKC..TK............KG..GCKKQ.TNYVVLDSS
CELB_EMENI/21-427----------------------------....TPEIRPRLTTYHC..TS............AN..GCTEQ.NTSVVLDAA
G2QZD9_THITE/20-450----------------------------ACTLTAENHPTLSWSKC..TS............GG..SCTSV.SGSVTIDAN
G0RYS9_CHATD/25-449----------------------------AGTQQTETHPRLSWKRC..SS............GG..NCQTV.NAEIVIDAN

PF00139

I1J0Z7_BRADI/24-270------------------SLQ..FTYP.SFDD.TTNES....DFS.----------------------------------
M0UWM0_HORVD/54-310------------------AIS..FNYDNSF......SSDD......----------------------------------
K3YQI1_SETIT/31-293------------------DDE..FVYS.GFA...AG..GS..NLTH----------------------------------
D7MX72_ARALL/27-278------------------EIK..FLNH.GF....LG...A..NLL.----------------------------------
I1QF95_ORYGL/9-257------------------ALS..FNYP.TF.....ASSDN.QNID.----------------------------------
B9SDJ5_RICCO/21-269------------------AVS..FSIS.HF......DPGA.SNIL.----------------------------------
M4EIG5_BRARP/19-266------------------SVQ..FNIT.RF......TSNS.PEVA.----------------------------------
I1KL69_SOYBN/32-282------------------SLS..FNFT.SF......DPND.KSIV.----------------------------------
I1GT36_BRADI/22-278------------------DGQ..FTYQ.GF....AA...A..NLT.----------------------------------
M4DR71_BRARP/23-281------------------AIK..FNFN.HF.......EGT..NLI.----------------------------------
K7UKG6_MAIZE/22-274------------------E....FTYN.GF....GG...S..DLL.----------------------------------
C5Z960_SORBI/22-274------------------HEQ..FVFT.GF....SG...S..NLT.----------------------------------
J3MID1_ORYBR/697-950------------------DHQ..FVFS.GF....SG...A..NLT.----------------------------------
C5YGS5_SORBI/740-993------------------DDQ..FLFS.GF....TQ...S..SLN.----------------------------------
F6HBM8_VITVI/38-285------------------SLS..FNFT.TF......EPNN.GQIS.----------------------------------
M0ZZ78_SOLTU/22-275------------------SLS..FNFD.SF......NLND.QNIT.----------------------------------
J3MID6_ORYBR/47-299------------------DDQ..LLYH.GFT...S....A..NLI.----------------------------------
I1KL68_SOYBN/57-300------------------SLS..FNYQ.QL......GDTG.IALN.----------------------------------
B9S3F5_RICCO/21-271------------------QNQ..FIYH.GF....NE...S..NLN.----------------------------------
B9SXJ7_RICCO/26-271------------------SLN..FNYT.KFQ..DSDRD....QFI.----------------------------------
M0VXQ0_HORVD/20-275------------------DVQVQFAFP.GF....AG...A..NLT.----------------------------------
I1GT33_BRADI/25-286------------------DGQ..FSYQ.GF....SR...A..NVT.----------------------------------
B9SXJ9_RICCO/25-271------------------CLS..FTYP.KFE..TENET....DLI.----------------------------------
M7ZXG6_TRIUA/26-279------------------DNQ.RFVYS.GF....AD...T..SLA.----------------------------------
B9SDJ4_RICCO/29-277------------------TLS..FNIT.RF......DKSSNLPIL.----------------------------------
B9RKX4_RICCO/32-295------------------KIN..FTYE.SFPM.HNLNF.....LK.----------------------------------
J3MID3_ORYBR/25-284------------------EEN..FVYS.SF....ADAGEA..NLA.----------------------------------
A9STE4_PHYPA/28-284------------------LKTIEFSFP.NFKS.PENDGTI..NIP.----------------------------------
K7LD59_SOYBN/26-276------------------CLS..FNFS.TFE..RKDED....HLL.----------------------------------
F6HW43_VITVI/37-287------------------SLS..FNLG.NF......DPND.HEII.----------------------------------
B9SPG3_RICCO/28-274------------------SSS..FSFQ.SFH..KDPNFDS..NIAL----------------------------------
I1I8J5_BRADI/41-316------------------ATT..FSFA.GFHP.DLRNV....NLT.----------------------------------
C5WQT3_SORBI/3-256------------------ETA..FTFN.GF....SS...A..NLS.----------------------------------
M7Z7K8_TRIUA/24-276------------------SDE..FIFN.GF.......SEE..NLK.----------------------------------
M7Z873_TRIUA/26-278------------------DDQ..FVYS.GF....TG...S..NLA.----------------------------------
I1Q9S6_ORYGL/27-278------------------DNQ..FAYS.GF....SG...A..NLT.----------------------------------
B9RX67_RICCO/38-289------------------SLS..FDFP.SF......NQND.RNIR.----------------------------------
Q7XZX1_ORYSJ/59-312------------------DDR..FVYA.GF....TG...A..PLA.----------------------------------
I1H3V1_BRADI/27-275------------------E....FLFS.GF....AG...A..NIT.----------------------------------
C5YTD3_SORBI/42-297------------------SLS..FSYT.FF......NPDD......----------------------------------
C5WZ65_SORBI/40-297------------------ALS..FNYD.SF.....GPEDL.KDIR.----------------------------------
F6HWD4_VITVI/48-292------------------SLD..FNFT.SF......SPYN.DNIT.----------------------------------
M4C9K1_BRARP/30-282------------------NLE..FTFN.GFY..PPL...R..DIS.----------------------------------
D7L7Q8_ARALL/26-272------------------NSS..FSFN.GFA..ISPSFDK..SVAL----------------------------------
I1LMH1_SOYBN/27-284------------------SQQEEFFFN.GF....GGAASS..NIT.----------------------------------
I1Q7T2_ORYGL/56-310------------------EHQ..FVFS.GF....TG...S..NLV.----------------------------------
K7UIK5_MAIZE/47-318------------------TTS..FSFP.KFDQ.NRLQLST..NLT.----------------------------------
B9S3F7_RICCO/27-283------------------ADQ..FIYN.GF....NG...A..NLS.----------------------------------
Q6Z8M4_ORYSJ/40-308------------------AVS..FSFS.SFHA.EARGV....NVT.----------------------------------
M4F2M7_BRARP/21-273------------------TLN..FTYD.GFP...QR...S..YIS.----------------------------------
M0Y8Y9_HORVD/24-281------------------DVD..FTYQ.GFQ...HA...P..NLS.----------------------------------
B9RX81_RICCO/37-286------------------AIS..FNYP.DF......SNPQ..NLN.----------------------------------
Q7XUC7_ORYSJ/28-274------------------CLQ..FTYP.SFG..TPNKA....DFN.----------------------------------
Q6K8L8_ORYSJ/26-289------------------DGQ..FLYN.GF....AG...V..NLT.----------------------------------
I1L3I1_SOYBN/35-302------------------SLS..FSFN.NF......SEDQ.EDLI.----------------------------------
M4EJC2_BRARP/29-277------------------DSS..FSFN.GFA..KSPAFEK..NIAL----------------------------------
F6HWD7_VITVI/37-289------------------SLS..FNFT.GF......DRNK.GQIY.----------------------------------
F6HW36_VITVI/35-286------------------SLS..FNFS.SF......GSNN.HNIS.----------------------------------
M1DPR0_SOLTU/22-264------------------SVS..FQIS.RF......GPDV.TDIL.----------------------------------
K4D2U1_SOLLC/29-283------------------CLS..FNYQ.NFT..KQNEN....DFI.----------------------------------
I1H2L8_BRADI/27-276------------------CLR..FTYP.SFD..ITNKD....DFS.----------------------------------
C5XCD6_SORBI/32-291------------------DEQ..FVYN.GF....KG...A..NLT.----------------------------------
K3Y5L7_SETIT/33-273------------------CLQ..FSYP.TFD..AANEA....DFS.----------------------------------
M1BJQ2_SOLTU/21-281------------------AVE..FLFN.SFTANTTP...A...LN.----------------------------------
I1LM84_SOYBN/28-267------------------TTQ..FDFA.TLT..MS.......TLK.----------------------------------
M4CN93_BRARP/29-292------------------TTE..FTFR.GFK..GNE...S..EIR.----------------------------------
Q8H4J3_ORYSJ/28-282------------------EER..FLYS.GF....SG...T..DIL.----------------------------------
B9RX64_RICCO/27-280------------------QLN..FSYS.SF......DSNH.PEIF.----------------------------------
J3MPZ5_ORYBR/33-302------------------ALS..FNYS.NF.....GPDEQ.KNIR.----------------------------------
Q84ZH8_ORYSJ/24-276------------------EEQ..FIYS.GF....SQ...A..NLS.----------------------------------
M0YJP2_HORVD/48-317------------------SIT..FSFP.SFDN.SLRQLPG..NLT.----------------------------------
K3Y3M9_SETIT/30-282------------------DDQ..FVYS.GF....TG...A..NLT.----------------------------------
F6HL81_VITVI/33-286------------------DVS..FTYN.GFQ...TA...A..NLS.----------------------------------
LRK61_ARATH/33-294------------------TAK..FTFI.GFK..ENQ...T..DIQ.----------------------------------
B9T8H0_RICCO/20-272------------------DLS..FTYN.GF....RS...A..NLS.----------------------------------
M1AHJ3_SOLTU/28-281------------------DLD..FTYN.GF....HS...T..NLS.----------------------------------
M7YY54_TRIUA/30-272------------------ALR..FAYQ.SFD..AASEA....DFS.----------------------------------
M4CLT1_BRARP/22-275------------------RTN..FTYN.GFS..PLP...T..DLS.----------------------------------
B9SML1_RICCO/44-289------------------SVN..FTIP.RF......NNEA.SNIQ.----------------------------------
M4DP68_BRARP/19-264------------------SLH..FNIS.RF......TPGD.PNIA.----------------------------------
Q0D8S6_ORYSJ/77-329------------------DGQ..FVFN.GF....LN...S..SLT.----------------------------------
M8A5Y7_TRIUA/53-300------------------CLQ..FTYP.SFN..AGNRD....GFS.----------------------------------
C5Z959_SORBI/30-282------------------EDQ..FVYS.GF....SG...N..NLT.----------------------------------
LRKS1_ARATH/29-288------------------AID..FLYN.SFSSVTNR...T..DVI.----------------------------------
M4ESL4_BRARP/22-290------------------AAR..FNFN.HF.......DGS..NLV.----------------------------------
B9SKY8_RICCO/25-281------------------SEE..FTFN.GFN..GKE...K..LLA.----------------------------------
M4FFA7_BRARP/24-263------------------TTE..FDFS.TLA..IS.......NLK.----------------------------------
J3LWI6_ORYBR/44-294------------------SLS..FSYD.SF......VSDD......----------------------------------
K7L999_SOYBN/59-308------------------CLS..FNFS.TF......QPNS.NNLID----------------------------------
M7YCL0_TRIUA/32-284------------------EHQ..FSFS.GF....SN...T..NLT.----------------------------------
D7MR66_ARALL/26-282------------------RDQ..FLHY.NF.....S..QA..DLH.----------------------------------
J3MPZ8_ORYBR/32-293------------------ALS..FNYT.NF.....TRGDE.NAIK.----------------------------------
F6GUY7_VITVI/27-280------------------EAQ..FIHN.GF....QG...A..SLH.----------------------------------
B9HG10_POPTR/32-282------------------SLS..FNFT.SF......SPNM.ANIF.----------------------------------
B9GZH8_POPTR/30-270------------------.IS..FQRT.RF.....DPSDT..NII.----------------------------------
B9HCZ3_POPTR/23-280------------------.VE..FLFN.GF.....NGSEA..NLT.----------------------------------
I1JFJ9_SOYBN/45-285------------------.VS..FTFN.KF......NPVQ.PNIM.----------------------------------
I1MX65_SOYBN/42-290------------------SLN..FNIT.NF....ANSESA.KNML.----------------------------------
M7Y9L8_TRIUA/34-283------------------.QS..FVYS.GF.....R..GA..DIT.----------------------------------
Q652V6_ORYSJ/38-298------------------.DH..FRYD.GF.....A..GA..PLD.----------------------------------
Q6ZFB7_ORYSJ/37-281------------------.VS..FNYS.SF.....SNASK..NIT.----------------------------------
Q6ZIQ8_ORYSJ/39-305------------------.TT..FSFP.TFDK.SLMQLGA..NLT.----------------------------------
Q6ZLL9_ORYSJ/30-291------------------..Q..FIYT.GF.....A..GA..NLT.----------------------------------
Q7XUN6_ORYSJ/30-280------------------.ER..FVFN.GF.....T..GA..NLS.----------------------------------
Q84ZI0_ORYSJ/31-304------------------.HQ..FVYS.GF.....T..GS..NLT.----------------------------------
U5G5V7_POPTR/26-278------------------.NH..FIYH.GF.....T..GA..NLL.----------------------------------
W5AMW1_WHEAT/26-276------------------..Q..LLYH.GF......TAGT..NLT.----------------------------------
W5AND9_WHEAT/35-289------------------.NQ..FVYS.GF.....A..GA..NLA.----------------------------------
W5GWA8_WHEAT/27-281------------------..Q..FIYS.GF.....S..GS..NLA.----------------------------------
W5H3F4_WHEAT/32-280------------------.HQ..FVYS.GF......AGSS..SLL.----------------------------------

PF03388

YQF8_SCHPO/24-250-------------------TS--HLERLSLEAPYINHGMRNL..W-----------------------------------
YOC5_SCHPO/23-229-------------------SQ--FLQLHSL........SNAIPVE-----------------------------------
EMP47_YEAST/36-253-------------------DA--SKLSSDYSLPDLINARKVPN.N-----------------------------------
LMAN1_HUMAN/44-269-------------------RR--FEYKYSFKGPHLVQSDGTVP.F-----------------------------------
Q9V3A8_DROME/33-259-------------------RR--FEYKYSFKPPYLAQKDGTVP.F-----------------------------------
Q9VCC2_DROME/33-258-------------------DY--MKREHSLVRPFQGVG.VILP.H-----------------------------------
LMAN2_CANFA/52-278-------------------EH--LKREHSLIKPYQGVGSSSMP.L-----------------------------------
Q22170_CAEEL/43-272-------------------GY--YKREHSLIKPYTGSG.ADIP.N-----------------------------------

PF02210

CNTP4_HUMAN/821-940--------------------------------------------------------------------------------
Q9VZ96_DROME/275-414--------------------------------------------------------------------------------
Q9VZ96_DROME/514-640--------------------------------------------------------------------------------
Q9VZ96_DROME/698-817--------------------------------------------------------------------------------
Q9VZ96_DROME/1351-1503--------------------------------------------------------------------------------
EYS_HUMAN/3007-3141--------------------------------------------------------------------------------
Q7PH68_ANOGA/3924-4055--------------------------------------------------------------------------------
Q7PSM9_ANOGA/688-822--------------------------------------------------------------------------------
Q7PSM9_ANOGA/919-1050--------------------------------------------------------------------------------
Q7PSM9_ANOGA/1115-1244--------------------------------------------------------------------------------
CELR1_MOUSE/1734-1864--------------------------------------------------------------------------------
CNTP1_MOUSE/390-516--------------------------------------------------------------------------------
Q18291_CAEEL/303-430--------------------------------------------------------------------------------
Q18291_CAEEL/495-627--------------------------------------------------------------------------------
Q18291_CAEEL/722-843--------------------------------------------------------------------------------
Q18291_CAEEL/906-1035--------------------------------------------------------------------------------
Q18291_CAEEL/1129-1266--------------------------------------------------------------------------------
LAMA5_MOUSE/2974-3103--------------------------------------------------------------------------------
LAMA5_MOUSE/3367-3497--------------------------------------------------------------------------------
LAMA5_MOUSE/3547-3670--------------------------------------------------------------------------------
NRX3A_MOUSE/475-619--------------------------------------------------------------------------------
NRX3A_HUMAN/287-413--------------------------------------------------------------------------------
CNTP4_MOUSE/400-526--------------------------------------------------------------------------------
CNTP4_MOUSE/1048-1178--------------------------------------------------------------------------------
CRUM1_MOUSE/513-650--------------------------------------------------------------------------------
PGBM_HUMAN/4234-4364--------------------------------------------------------------------------------
LAMA5_HUMAN/2970-3099--------------------------------------------------------------------------------
LAMA5_HUMAN/3370-3499--------------------------------------------------------------------------------
LAMA5_HUMAN/3549-3673--------------------------------------------------------------------------------
FAT1_HUMAN/3859-3985--------------------------------------------------------------------------------
Q9VJ82_DROME/55-178--------------------------------------------------------------------------------
Q9VJ82_DROME/238-367--------------------------------------------------------------------------------
LAMA4_HUMAN/1079-1210--------------------------------------------------------------------------------
LAMA4_HUMAN/1499-1626--------------------------------------------------------------------------------
CADH4_CAEEL/3750-3871--------------------------------------------------------------------------------
CSPG4_HUMAN/55-178--------------------------------------------------------------------------------
CSPG4_HUMAN/230-363--------------------------------------------------------------------------------
FAT2_HUMAN/3800-3921--------------------------------------------------------------------------------
LAMA3_HUMAN/3186-3311--------------------------------------------------------------------------------
CTP5B_MOUSE/1031-1159--------------------------------------------------------------------------------
Q8IQH0_DROME/220-342--------------------------------------------------------------------------------
Q8IQH0_DROME/1032-1156--------------------------------------------------------------------------------
EYS_DROME/1723-1856--------------------------------------------------------------------------------
FAT3_HUMAN/3865-3994--------------------------------------------------------------------------------
CNTP5_HUMAN/819-938--------------------------------------------------------------------------------
CNTP3_HUMAN/1046-1176--------------------------------------------------------------------------------
NRX3B_HUMAN/117-236--------------------------------------------------------------------------------
CELR3_HUMAN/1793-1924--------------------------------------------------------------------------------
STAN_DROME/1584-1736--------------------------------------------------------------------------------
STAN_DROME/1826-1946--------------------------------------------------------------------------------
NRX3A_HUMAN/55-184--------------------------------------------------------------------------------
NRX3A_HUMAN/899-1027--------------------------------------------------------------------------------
Q7PQ15_ANOGA/414-542--------------------------------------------------------------------------------
Q7PQ15_ANOGA/635-761--------------------------------------------------------------------------------
Q7PQ15_ANOGA/1195-1324--------------------------------------------------------------------------------
Q7PT06_ANOGA/181-303--------------------------------------------------------------------------------
Q7PT06_ANOGA/786-905--------------------------------------------------------------------------------
Q7PT06_ANOGA/994-1118--------------------------------------------------------------------------------
Q7PT75_ANOGA/1039-1184--------------------------------------------------------------------------------
Q7Q1N4_ANOGA/1163-1293--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/259-395--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/602-734--------------------------------------------------------------------------------
Q7Q3I9_ANOGA/875-1043--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/428-553--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1025-1153--------------------------------------------------------------------------------
Q7Q5D1_ANOGA/1257-1408--------------------------------------------------------------------------------
Q7Q4H3_ANOGA/211-342--------------------------------------------------------------------------------
EGFLA_MOUSE/641-767--------------------------------------------------------------------------------
EGFLA_HUMAN/868-996--------------------------------------------------------------------------------
Q19617_CAEEL/154-276--------------------------------------------------------------------------------
NRX2A_RAT/949-1077--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3556-3683--------------------------------------------------------------------------------
Q7Q1M9_ANOGA/1015-1178--------------------------------------------------------------------------------
O45000_CAEEL/275-401--------------------------------------------------------------------------------
Q22574_CAEEL/136-267--------------------------------------------------------------------------------
Q22574_CAEEL/415-539--------------------------------------------------------------------------------
NRX1A_MOUSE/753-884--------------------------------------------------------------------------------
CADN_DROME/2407-2568--------------------------------------------------------------------------------
CADN_DROME/2661-2796--------------------------------------------------------------------------------
FAT2_RAT/3802-3923--------------------------------------------------------------------------------
CELR3_RAT/1534-1693--------------------------------------------------------------------------------
SLIT2_HUMAN/1188-1316--------------------------------------------------------------------------------
CRB_DROME/1585-1722--------------------------------------------------------------------------------
CNTP1_HUMAN/203-332--------------------------------------------------------------------------------
CNTP1_HUMAN/813-939--------------------------------------------------------------------------------
CRUM1_HUMAN/514-651--------------------------------------------------------------------------------
CRUM1_HUMAN/743-860--------------------------------------------------------------------------------
CRUM1_HUMAN/980-1105--------------------------------------------------------------------------------
CNTP1_RAT/1089-1219--------------------------------------------------------------------------------
LAMA4_MOUSE/1258-1374--------------------------------------------------------------------------------
PROS_RABIT/485-617--------------------------------------------------------------------------------
LAMA_DROME/2704-2846--------------------------------------------------------------------------------
LAMA_DROME/2905-3031--------------------------------------------------------------------------------
LAMA_DROME/3083-3205--------------------------------------------------------------------------------
LAMA_DROME/3379-3514--------------------------------------------------------------------------------
LAMA_DROME/3563-3691--------------------------------------------------------------------------------
Q19350_CAEEL/789-914--------------------------------------------------------------------------------
CADE_DROME/1153-1296--------------------------------------------------------------------------------
NRX1A_BOVIN/58-192--------------------------------------------------------------------------------
GAS6_MOUSE/322-450--------------------------------------------------------------------------------
NRX2A_RAT/57-187--------------------------------------------------------------------------------
NRX2B_RAT/119-268--------------------------------------------------------------------------------
COBA2_MOUSE/90-213--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2700-2843--------------------------------------------------------------------------------
Q7PPF9_ANOGA/2902-3028--------------------------------------------------------------------------------
Q7PPF9_ANOGA/3080-3203--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1604-1755--------------------------------------------------------------------------------
Q7PPU8_ANOGA/1846-1967--------------------------------------------------------------------------------
Q8IP51_DROME/2616-2755--------------------------------------------------------------------------------
Q8IP51_DROME/2804-2944--------------------------------------------------------------------------------
Q8MPN3_DROME/3548-3676--------------------------------------------------------------------------------
Q8MPN3_DROME/4059-4188--------------------------------------------------------------------------------
CNTP5_HUMAN/209-338--------------------------------------------------------------------------------
CNTP5_HUMAN/395-521--------------------------------------------------------------------------------
CNTP5_HUMAN/1044-1173--------------------------------------------------------------------------------
NRX4_DROME/824-943--------------------------------------------------------------------------------
HMR1_CAEEL/2312-2461--------------------------------------------------------------------------------
NRX1A_CHICK/364-508--------------------------------------------------------------------------------
NRX1A_CHICK/789-917--------------------------------------------------------------------------------
CELR2_HUMAN/1395-1554--------------------------------------------------------------------------------
CELR1_HUMAN/1470-1629--------------------------------------------------------------------------------
CELR1_HUMAN/1719-1849--------------------------------------------------------------------------------
NRX2A_HUMAN/521-666--------------------------------------------------------------------------------
NRX2A_HUMAN/760-890--------------------------------------------------------------------------------
CELR2_RAT/869-995--------------------------------------------------------------------------------
CNTP2_HUMAN/216-345--------------------------------------------------------------------------------
CNTP2_HUMAN/401-529--------------------------------------------------------------------------------
CNTP2_HUMAN/1055-1187--------------------------------------------------------------------------------
NRX1A_HUMAN/1156-1275--------------------------------------------------------------------------------
Q9VCZ9_DROME/132-266--------------------------------------------------------------------------------
Q9VCZ9_DROME/386-520--------------------------------------------------------------------------------
Q9VCZ9_DROME/582-719--------------------------------------------------------------------------------
Q9VCZ9_DROME/814-942--------------------------------------------------------------------------------
B1AM99_HUMAN/398-521--------------------------------------------------------------------------------
B4NSJ9_DROSI/33-158--------------------------------------------------------------------------------
B4Q5I2_DROSI/631-761--------------------------------------------------------------------------------
B4QRF1_DROSI/2162-2287--------------------------------------------------------------------------------
B7ZC61_MOUSE/681-798--------------------------------------------------------------------------------
C1P641_CAEEL/3508-3630--------------------------------------------------------------------------------
C3ZLC2_BRAFL/400-531--------------------------------------------------------------------------------
E9PDN6_HUMAN/215-343--------------------------------------------------------------------------------
F1QGG9_DANRE/493-622--------------------------------------------------------------------------------
F1QQE4_DANRE/1172-1299--------------------------------------------------------------------------------
F1R9W4_DANRE/32-162--------------------------------------------------------------------------------
F1RCV3_DANRE/1181-1305--------------------------------------------------------------------------------
F6X197_CIOIN/154-276--------------------------------------------------------------------------------
F7ER04_CALJA/128-245--------------------------------------------------------------------------------
G3HJH2_CRIGR/1596-1721--------------------------------------------------------------------------------
G3UNZ8_MELGA/755-882--------------------------------------------------------------------------------
G5E9F8_HUMAN/383-515--------------------------------------------------------------------------------
H9H2C7_MELGA/307-434--------------------------------------------------------------------------------
M9NF15_DROME/1112-1240--------------------------------------------------------------------------------
LAMA3_MOUSE/3183-3307--------------------------------------------------------------------------------
Q8MPN3_DROME/3806-3929--------------------------------------------------------------------------------
Q9VCZ9_DROME/1230-1354--------------------------------------------------------------------------------
CADN2_DROME/1039-1199--------------------------------------------------------------------------------
W4YVD3_STRPU/3-125--------------------------------------------------------------------------------

PF00054

AGRIN_CHICK/1416-1546--------------------------------------------------------------------------------
AGRIN_CHICK/1682-1817--------------------------------------------------------------------------------
AGRIN_CHICK/1933-2064--------------------------------------------------------------------------------
LAMA1_HUMAN/2920-3051--------------------------------------------------------------------------------
LAMA1_HUMAN/2514-2658--------------------------------------------------------------------------------
LAMA1_HUMAN/2743-2872--------------------------------------------------------------------------------
LAMA2_HUMAN/2793-2921--------------------------------------------------------------------------------
LAMA2_HUMAN/2554-2695--------------------------------------------------------------------------------
LAMA2_HUMAN/2174-2314--------------------------------------------------------------------------------
LAMA2_HUMAN/2368-2507--------------------------------------------------------------------------------
CSPG4_RAT/55-182--------------------------------------------------------------------------------
AGRIN_RAT/1291-1422--------------------------------------------------------------------------------
AGRIN_RAT/1559-1694--------------------------------------------------------------------------------
SHBG_RAT/76-206--------------------------------------------------------------------------------
CRB_DROME/1048-1183--------------------------------------------------------------------------------
AGRIN_RAT/1811-1942--------------------------------------------------------------------------------
SLIT_DROME/1204-1335--------------------------------------------------------------------------------
PROS_HUMAN/329-459--------------------------------------------------------------------------------
CRB_DROME/1281-1443--------------------------------------------------------------------------------
SHBG_HUMAN/75-205--------------------------------------------------------------------------------
FAT_DROME/4156-4306--------------------------------------------------------------------------------

PF00354

SAMP_MOUSE/27-220---------------K--V---FVFPRES--------E------TD----HV----------------------------
CRP1_LIMPO/33-237---------------K--V---.KFPPSS--------S------PS----FP----------------------------
CRP_XENLA/23-219---------------N--V---FLFPKPS--------V------TT----YA----------------------------
CRP_RABIT/26-221---------------K--A---FVFPKES--------D------NS----YV----------------------------
CRP_HUMAN/25-220---------------K--A---FVFPKES--------D------TS----YV----------------------------
SAMP_HUMAN/26-219---------------K--V---FVFPRES--------V------TD----HV----------------------------
Q542I3_MOUSE/26-221---------------K--A---FVFPKES--------D------TS----YV----------------------------
FP_CRIMI/26-219---------------K--V---FVFPRES--------E------SD----YV----------------------------

PF13385

A9V7L7_MONBE/717-870---------------------------VG--------N.--...NS----YV----------------------------
A9V0U4_MONBE/809-963---------------------------VG--------N.--...GS----WV----------------------------
A9VE19_MONBE/544-692---------------------------PG--------N.--...GS----WV----------------------------
A9V0U4_MONBE/590-745---------------------------DG--------D.--...ND----YV----------------------------
B9JMF4_AGRRK/595-752---------------------------SS--------N.--...SA----YV----------------------------
C9ZAH4_STRSW/174-331---------------------------RG--------S.--...HQ----YV----------------------------
B5HCG7_STRPR/182-340---------------------------PR--------G.--..SYQ----FV----------------------------
D3EBL1_GEOS4/644-797---------------------------NG--------S.--...DG----YI----------------------------
Q82NZ6_STRAW/693-850---------------------------DG--------A.--...DG----HV----------------------------
C7Q3C0_CATAD/682-839---------------------------DG--------A.--...SG----YV----------------------------
C6WP14_ACTMD/1442-1597---------------------------HG--------G.--...QA----QV----------------------------
A7RQU2_NEMVE/46-196---------------------------NG--------T.--...AS----SV----------------------------
B3RTE4_TRIAD/419-588---------------------------RS--------E.--...DG----YA----------------------------
Q11RF9_CYTH3/68-223---------------------------FT--------Y.--...GN----SI----------------------------
D2AYT0_STRRD/833-984---------------------------LG--------G.--...ST----YL----------------------------
Q01PZ1_SOLUE/560-711---------------------------DG--------V.--...SG----QL----------------------------
D0LXW7_HALO1/121-278---------------------------FS--------G.--...DA----VL----------------------------
A9ERE1_SORC5/156-299---------------------------TM--------..--...GS----KL----------------------------
A7RK85_NEMVE/111-274---------------------------LT--------R.--...DG----NV----------------------------
Q7UP09_RHOBA/489-653---------------------------LT--------G.--...DD----AV----------------------------
D2QJX5_SPILD/494-660---------------------------SN--------G.--...DD----IL----------------------------
A5G5W5_GEOUR/3125-3280---------------------------DG--------S.--...ND----YV----------------------------
Q12UM1_METBU/211-367---------------------------HD--------D.--...SD----VV----------------------------
A5G5W5_GEOUR/2834-2981---------------------------DG--------A.--...ND----YI----------------------------
Q3A7I8_PELCD/252-409---------------------------LD--------G.--...SG----YL----------------------------
Q2S986_HAHCH/536-688---------------------------NG--------S.--...SQ----YI----------------------------
C5BR34_TERTT/286-438---------------------------DG--------N.--..TDG----YV----------------------------
Q5E1F1_VIBF1/338-497---------------------------KS--------Q.--...TQ----YI----------------------------
D0LH97_HALO1/423-584---------------------------SG--------G.--...EA----PN----------------------------
Q2SIZ0_HAHCH/349-511---------------------------GA--------T.--...SN----SK----------------------------
Q21ES8_SACD2/355-516---------------------------GS--------T.--...SG----SQ----------------------------
A1U1N6_MARAV/358-517---------------------------GS--------T.--...SA----SR----------------------------
Q7UQA7_RHOBA/111-269---------------------------ES--------V.--...HP----AT----------------------------
Q5JEI1_THEKO/104-250---------------------------KT--------G.--....A----GV----------------------------
D2RI28_ARCPA/205-357---------------------------DG--------E.--...DD----YV----------------------------
D2QKT6_SPILD/67-225---------------------------FN--------R.--...NA----YI----------------------------
A7RFD3_NEMVE/591-745---------------------------LG--------N.--..PKS----YI----------------------------
A5FGU3_FLAJ1/61-211---------------------------NN--------K.--...AL----EA----------------------------
A5FGS6_FLAJ1/61-211---------------------------NN--------K.--...AF----QA----------------------------
A5FKP6_FLAJ1/648-806---------------------------NG--------A.--...GS----YI----------------------------
B1WQC8_CYAA5/1492-1639---------------------------FN--------G.--..VNT----YI----------------------------
B2J7Y5_NOSP7/1082-1239---------------------------NG--------Q.--...SD----YV----------------------------
B8GR77_THISH/232-391---------------------------DG--------S.--...SA----YV----------------------------
A5US22_ROSS1/44-194---------------------------LS--------G.--...SG----YL----------------------------
B8FIJ2_DESAA/1835-1990---------------------------TG--------G.--...GG----YI----------------------------
B8FIJ2_DESAA/2139-2295---------------------------DG--------S.--...GD----YL----------------------------
B8FIJ2_DESAA/3101-3258---------------------------DG--------S.--...YD----YL----------------------------
B1WQC8_CYAA5/529-689---------------------------DG--------K.--...QD----YI----------------------------
A0L6L9_MAGSM/6883-7036---------------------------DG--------T.--...DD----AA----------------------------
A0L6L9_MAGSM/10297-10458---------------------------ST--------G.--..EAD----TL----------------------------
A0L6L9_MAGSM/11015-11176---------------------------FD--------G.--...DD----QI----------------------------
A0L6L9_MAGSM/7697-7855---------------------------FD--------G.--...VD----DV----------------------------
Q11V34_CYTH3/475-632---------------------------FS--------G.--...TT----YA----------------------------
D1YWM2_METPS/639-793---------------------------FN--------G.--...ST----YI----------------------------
A9AX01_HERA2/2983-3139---------------------------FG--------G.--...SG----AI----------------------------
C5CYC7_VARPS/584-746---------------------------AN--------R.--...TA----GV----------------------------
A9VEK3_MONBE/43-204---------------------------LD--------AG--..TTS----HV----------------------------
A9UYJ6_MONBE/611-770---------------------------NA--------A.--...AR----AL----------------------------
A4CID0_ROBBH/183-344---------------------------GA--------E.--...DS----YL----------------------------
Q01ZJ6_SOLUE/448-593---------------------------NG--------E.--....T----QI----------------------------
Q112U0_TRIEI/322-477---------------------------DG--------V.--...DD----YL----------------------------
A9AVC5_HERA2/53-212---------------------------FD--------G.--...NG----YL----------------------------
C3YCM4_BRAFL/399-559---------------------------FG--------G.--...AG----RL----------------------------
A9AX01_HERA2/3464-3613---------------------------DG--------N.--...ND----NL----------------------------
A9AX01_HERA2/1709-1859---------------------------DG--------L.--...ND----YL----------------------------
A9AX01_HERA2/3687-3839---------------------------DG--------V.--...ND----GL----------------------------
A9AVE2_HERA2/55-206---------------------------FD--------G.--...QS----WV----------------------------
A0ZJ67_NODSP/534-687---------------------------DG--------V.--...ND----YI----------------------------
A9WA06_CHLAA/1561-1710---------------------------FD--------G.--...ND----YL----------------------------
D2GX75_AILME/1328-1494---------------------------FS--------GL--EGAFG----TV----------------------------
GPR98_DANRE/1321-1486---------------------------FS--------GR--PGAYG----SI----------------------------
B3PKP2_CELJU/973-1129---------------------------LD--------G.--...TS----GV----------------------------
Q21FF7_SACD2/1013-1165---------------------------LG--------D.--..AGP----GA----------------------------
Q21FF7_SACD2/697-861---------------------------LN--------G.--...SN----GV----------------------------
B8E3D6_DICTD/93-243---------------------------DG--------N.--...SG----.V----------------------------
C6D6G1_PAESJ/694-843---------------------------DG--------N.--...SG----.V----------------------------
Q9KBP7_BACHD/623-775---------------------------DG--------T.--...TG----.I----------------------------
C7R5J8_JONDD/646-797---------------------------LD--------G.--...TN----GV----------------------------
C7R5J7_JONDD/547-698---------------------------LN--------G.--...SN----GV----------------------------
D4J0Z2_BUTFI/89-242---------------------------LD--------G.--...SY----GL----------------------------
A5GAT0_GEOUR/82-245---------------------------DG--------SY--.NAFD----FI----------------------------
C6W5Q6_DYAFD/72-233---------------------------DG--------I.--...DD----VI----------------------------
D5SQB3_PLAL2/445-615---------------------------NA--------S.--...QP----LI----------------------------
A0C6A9_PARTE/84-241---------------------------SG--------..--...EQ----YS----------------------------
A4HMI3_LEIBR/697-852---------------------------FP--------G.--...DG----YV----------------------------
A5JZZ5_PLAVS/101-250---------------------------RK--------N.--...YI----YI----------------------------
D2W1V6_NAEGR/225-370---------------------------DG--------K.--...KN----GL----------------------------
Q3A7I8_PELCD/471-622---------------------------DE--------Y.--...TD----AF----------------------------
B0R0F2_DANRE/89-248---------------------------TG--------R.--...GD----QL----------------------------
B3RQA7_TRIAD/115-267---------------------------LG--------E.--...YT----NE----------------------------
D3F200_CONWI/289-437---------------------------LD--------G.--...AG----HV----------------------------
C6WK26_ACTMD/261-414---------------------------PT--------A.--...SA----HC----------------------------
A0ZJ64_NODSP/411-564---------------------------FD--------G.--..FND----YV----------------------------
P73139_SYNY3/1330-1483---------------------------FQ--------G.--...G.----GV----------------------------
D3F0R0_CONWI/85-255---------------------------SA--------N.--...TT----PL----------------------------
C1F1C3_ACIC5/51-208---------------------------LE--------G.--...GT----GL----------------------------
B5HK67_STRPR/818-980---------------------------DG--------T.--..SAA----YA----------------------------
D9TDD0_MICAI/805-962---------------------------DG--------T.--..ADA----HL----------------------------
Q82GV4_STRAW/292-440---------------------------DG--------G.--...DQ----AF----------------------------
D2BE74_STRRD/722-881---------------------------DG--------A.--...GG----HA----------------------------
B5I5M1_9ACTO/761-922---------------------------NG--------T.--...SS----YA----------------------------
B1VPR2_STRGG/846-1008---------------------------LA--------N.--...SA----YG----------------------------
B5HSG2_9ACTO/789-950---------------------------NG--------A.--...SA----YL----------------------------
B1VKK7_STRGG/744-905---------------------------FN--------G.--..TTG----YA----------------------------
C6WQK6_ACTMD/756-914---------------------------NG--------T.--...NA----SA----------------------------
C9Z2C7_STRSW/793-953---------------------------NG--------T.--...TD----HA----------------------------
D2PTR0_KRIFD/729-887---------------------------DG--------S.--...GG----TV----------------------------
D2PTR0_KRIFD/514-676---------------------------NG--------T.--..RTA----AV----------------------------
B5H1J2_STRC2/810-972---------------------------DG--------V.--...DD----HA----------------------------
B5H1J2_STRC2/1032-1193---------------------------DG--------K.--...DD----YA----------------------------
C6WL54_ACTMD/905-1058---------------------------TG--------S.--...NQ----YA----------------------------
E6W606_DESIS/780-953---------------------------AG--------G.--...YT----FL----------------------------
C5C072_BEUC1/602-756---------------------------GS--------T.--...NS----YG----------------------------
A0L6L9_MAGSM/10522-10674---------------------------NG--------T.--...NQ----YY----------------------------
D0LH97_HALO1/144-304---------------------------DA--------V.--..EGH----HV----------------------------
Q12UM1_METBU/421-574---------------------------DG--------S.--...ND----HV----------------------------
D3SUF1_NATMM/128-286---------------------------TG--------G.--...FD----RV----------------------------
Q12UM1_METBU/635-797---------------------------DD--------R.--...TE----YV----------------------------
B1Y080_LEPCP/302-473---------------------------SS--------T.--...SA----GV----------------------------
Q025I9_SOLUE/271-426---------------------------GS--------G.--...SQ----WV----------------------------
Q025I9_SOLUE/616-778---------------------------SG--------S.--...AQ----YL----------------------------
C6XUD8_PEDHD/202-348---------------------------NG--------S.--...TD----GM----------------------------
E6W633_DESIS/617-776---------------------------DG--------G.--.....----YI----------------------------
B8FF04_DESAA/2231-2395---------------------------DG--------A.--...SS----YG----------------------------
C7PKJ2_CHIPD/89-251---------------------------SG--------N.--..NNA----FI----------------------------
D2PTT7_KRIFD/1092-1258---------------------------PG--------GS--..NTN----AV----------------------------
D2PTT7_KRIFD/1416-1585---------------------------PG--------GA--AGTGN----QV----------------------------

PF02973

NANA_STRR6/118-309------------------------VETVI--------E------KE----..----------------------------
Q8CWP8_STRR6/42-227------------------------IFQGG--------S------YQ----LN----------------------------
Q8XMG4_CLOPE/50-236------------------------..SLG--------E------YK----DI----------------------------

PF07953

A7GBG3_CLOBL/878-1072---------------N--N---KFIDISG--------Y------GS----NI----------------------------
F4AAX8_CLOBO/847-1023---------------S--N---IIEDISG--------K------NT----LI----------------------------
O87710_9CLOT/811-986---------------K--N---VIGDGSG--------K------NT----LV----------------------------
B1INP6_CLOBK/847-1023---------------N--K---VIEDISG--------K------NT----LV----------------------------
Q8GR96_CLOBO/872-1066---------------D--N---NLIDLSG--------Y------GA----NV----------------------------
BXE_CLOBO/859-1054---------------N--D---KYVDTSG--------Y------DS----NI----------------------------
B1Q6N5_CLOBO/816-992---------------N--N---AIGDASG--------K------NT----SI----------------------------
BXEN_CLOBU/812-988---------------N--N---VIGDTSG--------K------NT----LV----------------------------
Q3ZUA3_9CLOT/40-243---------------N--D---IISDISG--------F------NS----SV----------------------------
O06018_CLOBO/848-1024---------------R--K---VIKDISG--------K------DT----LV----------------------------
Q841S3_CLOBO/880-1071---------------K--N---ALVDTSG--------Y------NA----EV----------------------------
BXA1_CLOBH/885-1079---------------S--N---HLIDLSR--------Y------AS----KI----------------------------
BXG_CLOBO/877-1074---------------G--G---RLIDSSG--------Y------GA----TM----------------------------

PF06439

A3HZT9_9BACT/35-266---------------D--W...QVMF..N........GE..NL.DG....WI...PKIQHHE.TGDNYA...........
A6LBG6_PARD8/26-215---------------K--T...EKLF..N........GK..DL.SN....WN...FV.......VDKNSVP.........
B0T1W6_CAUSK/37-271---------------P--W...RPLF..D........GK..TL.DG....WT...PKVAKHP.AGENYR...........
A4SXW4_POLSQ/31-195---------------G--F...VDLI..D........GV..SL.TD....WN...II.......GTAN............
A6DIW7_9BACT/14-204---------------S--F...KKLF..N........GK..DL.SG....WV...DV.......NTSKA...........
A7LWH3_BACO1/242-448---------------G--W...TLLW..D........GK..TT.DG....WR...GAKLSTFPAKGW.............
A6LFX0_PARD8/51-268---------------E--W...ITMF..D........GK..TL.NG....WR...GYCRQDV.PLGW.............
Q1IP75_KORVE/134-305---------------K--P...IDLF..N........GK..DL.TG....WT...MS.......DPKAT...........
Q01PY8_SOLUE/18-214---------------A--E...IKLW..N........GK..NL.DG....WS...RLTRHEG.EADHAP...........
Q021Z2_SOLUE/148-318---------------K--P...IELF..N........GK..DL.SG....WK...PL.......NPGAE...........
A6C286_9PLAN/26-230---------------G--F...TPLF..N........GK..NL.DG....WV...QHGGKAK.YD...............
A6L9A1_PARD8/27-220---------------K--W...KPLF...........GKNLENANYNPEVWS...ET.......................
Q7UXM1_RHOBA/116-314---------------G--A...ESLL..E........G...NLADS....WE...GSLDDWTLE................
Q7UGT3_RHOBA/50-260---------------G--L...TSIF..N........GK..DL.TG....WS...GDDRLWSVR................
A6DGN3_9BACT/486-705---------------R--V...KALI..P........G......SG....WR...KN.......................
Q026J2_SOLUE/86-285---------------D--A...IVLF..D........GK..DL.SK....WS...AG..GGR.RGAVAAVT.........
A7AJH3_9PORP/62-268---------------G--W...TLLF..N........GK..DF.TG....WR...QCNSTGM.ASNW.............
A4AVD2_MARSH/28-192---------------K--P...AELFKKN........SK..ECFISGDATWN...FI.......................
A6CF10_9PLAN/1565-1736---------------N--L...KLFF..N........GQ..DL.AG....WT...GNSQLWSVE................
A4Z0W7_BRASO/36-203---------------G--W...VTLVDGDKKVEFTEVGK.....AN....WE...AK.......................
Q7URI3_RHOBA/55-252---------------K--W...ETLF..D........GS..NL.DA....WR...EYNRDSV.TSGW.............
Q022Y3_SOLUE/158-351---------------K--A...VVLF..D........GS..NM.NL....WA...KM..KEK.DWLTEDGP.........
A3ZYX9_9PLAN/31-241---------------L--P...KAFI..D........GQ....GDG....WR...ALGEADF.QNVNCFD..........
Q7UYC2_RHOBA/27-225---------------S--F...ENLF..N........GK..DL.SG....WA...GNDSFWSVR................
Q08RB4_STIAD/354-520---------------P--F...SDDF..N........DG..NA.NG....W.............SVYGG...........
B1KP96_SHEWM/43-237---------------G--W...QLLF..N........GK..DM.SQ....WR...NFKQQGV.NPKW.............
Q7ULY5_RHOBA/53-228---------------E--M...QSLF..D........GK..SL.TG....WT...NPYEWGK.TE...............
Q9XAM0_STRCO/521-727---------------G--Y...RTIL..D........GSQESF.AK....WE...QVGGGSF.GL...............
A6LD72_PARD8/35-236---------------G--W...ELLF..D........GE..TL.DG....WR...DYNGTAL.TGPW.............
A5V6S7_SPHWW/38-269---------------A--W...RPLF..N........GH..DL.DG....WV...AKINHHP.LGDNAH...........
A3ZPX1_9PLAN/148-325---------------D--A...RVLF..D........GT..ST.EF....FR...DG..K....L...............
A6E8U4_9SPHI/241-449---------------G--Y...SLLW..D........GR..TT.EG....WR...GAYKSTFPESGW.............
Q7UFF8_RHOBA/54-264---------------V--S...VKIF..D............TNAPG....WR...QLDGDDF.VRV..............
A4SYN3_POLSQ/50-213---------------T--P...IPLF..N........GA..DL.GA....FD...HN.......KDRNGN..........
Q01QD3_SOLUE/67-266---------------D--A...IVLF..D........GK..DL.SR....WM...Q....HG.RGADRGKD.........
Q21G79_SACD2/27-266---------------G--W...QSLF..N........GK..NL.DG....WE...PYVSFQP.ETNEYLLVSKHTPR...
Q15XP9_PSEA6/43-289---------------Q--W...RYLL...........DS..EL.SQ....WN...AWMGVPH.SSVKGLPEG........
A7NM29_ROSCS/68-253---------------L--A...TASF..E........GS..DALNG....WR...IVDLEEA.PAERRA...........
Q02AV5_SOLUE/47-254---------------G--F...KPIF..D........GK..SL.AG....WE...GDPKYWRVE................
Q024T5_SOLUE/20-224---------------D--G...KPLF..N........GK..NL.DG....WE...II.......GDGQ............
A6CH23_9PLAN/11-222---------------D--A...EILL..D........GSREML.DQKWTYWE...GP.......RFSSSLPI........
Q5LID8_BACFN/75-244---------------E--P...VSMD..NFIGFTRCEGV...........WK...LQ.......................
A4AN55_MARSH/13-232---------------G--F...RAIF..N........GT..SL.SD....WE...GNRTYWRVE................
Q7UP53_RHOBA/254-436---------------G--L...KNLL...........AD..GL.EG....WT...VREGMEG.EYR..............
A3HYW7_9BACT/39-258---------------G--F...KSIF..D........GK..SL.DG....WK...GDPTYWSVQ................
Q020M5_SOLUE/283-466---------------G--W...RPLF..N........AK..SL.EG....WQ...PR.......GECL............
A7LZB4_BACO1/60-285---------------G--Y...ITIF..D........GE..TF.NG....WR...GYGKDRV.PTKW.............
A6L8C0_PARD8/23-196---------------G--S...GTLF..D........GK..DS.NK....WK...MTGDVSVQ.................
A4XES2_NOVAD/37-271---------------P--W...RALF..N........GR..DL.DD....WT...IYQDGEG.NRDAHD...........
Q024G0_SOLUE/10-210---------------E--W...RTLF..D........GK..TS.AG....WL...EITGKPF.PATW.............
Q7UP53_RHOBA/88-251---------------G--W...IRLF..D........GH..TL.FG....WV...IG.......GNAN............
Q7UJ71_RHOBA/62-282---------------R--S...RSLF..D........GQ..IL.AG....FE...GDASWFRIE................
A6C9B4_9PLAN/53-240---------------D--A...IVLF..D........GK..NL.DK....WK...NG.......DQW.............
A0ACR9_STRAM/807-998---------------A--R...VALF..D........GTAASQ.EQ....WQ...HT.......................
A6DSM6_9BACT/29-216---------------G--PEGIKNLV..N........EQ..NP.DQ.....K...LS..W....T...............
Q9XBE0_AMYOR/795-985---------------N--R...VTLF..N........GT..NL.DA....WE...TT.......................
A6LB52_PARD8/744-943---------------G--F...VSIF..N........GK..DL.TG....WK...GL.......VENPIARAKMKPAQLA
A0M051_GRAFK/45-249---------------E--W...QELF..N........GE..NL.DG....WK...AFNKDSI.SDQW.............
A6DM12_9BACT/183-370---------------G--W...EDIA..D........AK..AV.GHKLIVTE...EG.......................
A4ASP9_MARSH/24-229---------------G--F...TDLF..N........GK..SL.DG....WH...SYGKDEI.NDGW.............
A4ATY8_MARSH/64-260---------------D--A...IILF..D........GS..NL.DQ....WV...SQ..IDN.TKPAP............
A4ASM0_MARSH/38-261---------------D--W...ITLF..D........GV..ST.EG....WR...AYNGKAL.PPGW.............
Q15XH8_PSEA6/28-257---------------G--W...HTLF..N........GE..NL.DG....WT...VKIHHHE.VGDNVD...........
A6BZI2_9PLAN/34-270---------------G--V...IHLF..N........GK..NL.DGL.YVWN...RDTAYED.PREI.............
A6DJ51_9BACT/30-221---------------G--W...QLLF..D........GK..TT.NG....WV...NYQSDKL.NPLW.............
A3ZYG0_9PLAN/42-220---------------A--W...RSLF..D........GK..TL.GD....WK...SVNFGG...................
A6LFJ8_PARD8/58-253---------------D--A...IILF..D........GK..DL.TK....WE...AA..GKD.GGSAK............
B4SNA4_STRM5/52-245---------------D--A...IVLF..D........GK..DV.SA....WE...SE...Q..GGRVP............
Q021Q3_SOLUE/25-318---------------G--S...ISLF..D........GK..TL.DG....WQ...QIENSAT.SLATGGITDATAFAARL
A6DFB8_9BACT/988-1186---------------G--A...TSLF..N........GK..DL.TG....WA...GDSKLWKVE................
A6CBU4_9PLAN/476-662---------------D--Y...KPLF..N........GH..DL.SG....WTLKRANREGYHVE................
Q7UTD6_RHOBA/106-307---------------G--W...ATLF..N........GK..DL.SG....WH...GQ.......PHFDPYKLAEMSDEER
A4CGG3_ROBBH/26-212---------------P--W...QELF..N........GE..DL.SG....WT...QLGGEAE.YA...............
A4AUV7_MARSH/139-306---------------E--S...KALF..N........GK..NL.DG....WQ...AM.......GVNQ............
B0T1X3_CAUSK/51-253---------------D--A...IVLF..D........GD..DL.DQ....WV...AA..LD..KSPAG............
A6C9Y7_9PLAN/38-232---------------G--Y...KALF..N........GK..DL.TG....WK...GL.......VGSPKTRAKMSPEELA
A3I2W3_9BACT/58-253---------------D--A...IVLF..D........GT..SL.NN....FV...SA..RDG.SSPAE............
A6DGC3_9BACT/39-228---------------G--F...TALF..N........GK..DL.SG....WT...VRNGTGT.YR...............
A6BYQ3_9PLAN/523-721---------------G--F...VSVF..D........GK..SL.RH....WS...GDPQYWSVE................
B8H3I2_CAUCN/42-285---------------P--S...VTLF..N........GR..DL.KD....WD...AWLGYAD.PALTYKRPPVAPLG...
Q01U12_SOLUE/21-204---------------S--....TDLL..P........DA..SL.KG....WT...RI.......PIPPTDGLKPKLQ...
Q7UTD6_RHOBA/325-510---------------N--F...TSVF..D........GK..TL.EG....WI...GAVADYEVT................
A4ARZ0_MARSH/21-221---------------K--S...ISLF..N........GE..DT.SG....WH...IDVPAMD.SIPDAI...........
Q01PI7_SOLUE/133-305---------------A--P...EPIF..N........GK..DL.TG....WE...PT.......DPAAT...........
Q09C00_STIAD/650-816---------------S--F...TETFDAN.......ASR...........W.............TTYGG...........
A3ZT25_9PLAN/28-228---------------G--F...KSIF..D........GK..TL.NG....WR...GKEQFWSVQ................
A4A1V7_9PLAN/150-329---------------G--A...VVLF..D........GS..NL.DA....WM...NA..K....M...............
A0YAF8_9GAMM/30-260---------------K--W...TSLF..N........GE..DL.DG....WI...VKVRYHP.LGENPS...........
A6DSF7_9BACT/22-217---------------N--W...VELF..N........GK..NL.DG....WT...EKTKEGS.FR...............
A4BYH9_9FLAO/26-192---------------T--D...IPMNSSN.....................WK...IH.......................
A0ACX0_STRAM/280-457---------------G--Y...TSLF..D........GS..GT.TG....WQ...QAGPGGF.TL...............
Q01NY0_SOLUE/48-250---------------G--F...QPIF..D........GK..SL.AG....WD...GDPGFWRVE................
A6CCA5_9PLAN/71-236---------------G--W...IALF..D........GH..SL.SG....WK...PN.......NDV.............
A3I170_9BACT/40-240---------------E--T...IKLF..D........GE..SL.EG....WH...MDVPDLE.ADSSLR...........
A7AAJ2_9PORP/957-1147---------------G--F...KVLF..D........GT..NM.HE....WT...GNTVDYTLE................
A5IIW8_THEP1/74-230---------------P--W...KVLE..E........SP..HVEEG..................VQPDKT..........
A7LWH3_BACO1/23-209---------------N--W...EPLF..N........GK..NL.KG....WK...KLNGKAE.YK...............
Q01WT7_SOLUE/22-227---------------G--Y...TALF..N........GK..DL.SG....WR...GR.......QGTYSPHAEALLSKEE
A6DM09_9BACT/22-216---------------E--W...QSLF..N........GQ..DL.QG....WR...NYNSQGI.NGKW.............
A2TQP1_9FLAO/40-242---------------T--E...IVLF..D........GS..SF.DA....WK...GYGTDGM.HENW.............
Q02B64_SOLUE/22-209---------------G--F...TPLF..D........GK..TL.NG....WKLVGGHGPGYVVQ................
A6DTC7_9BACT/37-227---------------E--S...INLIADN............SL.KA....WK...VT.......SSL.............
A6CA29_9PLAN/352-540---------------G--W...KLLF..N........GK..DY.SG....WK...CNNGKPIAAP...............
A6C8Y3_9PLAN/63-235---------------K--D...FEVF..N........AKSKEPVEGK..NWS...ET.......................
A3XPN2_LEEBM/32-218---------------P--W...QSLF..N........GT..SL.DG....WK...QLNGKAA.YR...............
A4A0Q4_9PLAN/26-218---------------G--W...IKPF..N........GK..DL.SG....WT...QKNGTAT.YV...............
A6E8U4_9SPHI/25-211---------------Q--W...QQLF..N........GK..DL.SG....WK...QLNGKAK.YE...............
Q01UN1_SOLUE/9-241---------------G--W...KLLF..D........GK..SY.KN....WE...DPTKKSPPSNAF.............
A3ZQS2_9PLAN/31-212---------------T--A...EKLF..D........GK..SL.AG....WK...IA....E.KGA..............
A6DG40_9BACT/159-340---------------G--A...VVLF..D........GS..NI.EA....FT...KG..R....I...............
A6DLT3_9BACT/234-440---------------G--F...TQLF..N........GK..DL.TN....WK...GL.......LDRPFDRPHKRKTLKA
A6EKV1_9SPHI/655-832---------------T--F...NADF..N.......RGS...L.EG....W.............INYGG...........
A3ZY13_9PLAN/44-228---------------T--H...TRLF..N........ER..DL.QG....WR...PAVCC....................
A6DLT3_9BACT/28-216---------------T--F...TSLF...........EKDADLATN....WI...GNTQGYKVE................
Q1AST8_RUBXD/20-211---------------G--A...RLLL..P.......GGG..GL.EG....WS...GLEWGVV.Y................
A4FDZ7_SACEN/121-335---------------P--Y...EVIF..D........GTPESF.AA....WE...HVGGRGF.AL...............
A7ABK7_9PORP/62-257---------------D--A...IVLF..D........GK..DL.SA....WQ...NA...K..GGPAE............
A6BYS0_9PLAN/54-263---------------G--W...KLLF..D........GK..TT.DG....WR...NYKKEGV.SDGW.............
Q01XX3_SOLUE/25-191---------------G--W...IKMF..D........GK..TL.NG....WK...AN.......EHPE............
Q2Y669_NITMU/16-255---------------G--F...RPLF..E........GTDKTF.KE....WY...LAGPGGG.GML..............
A3ZWI0_9PLAN/615-790---------------D--W...VSVF..N........GR..DM.RG....WS...IQ.......GPTL............
A3ZR79_9PLAN/39-201---------------G--W...LLLF..D........GE..TT.FG....WK...SE.......GKID............
A6CAH6_9PLAN/67-283---------------G--Y...TSLF..N........GE..DF.TG....WK...VP.......EGDNG...........
Q01TF2_SOLUE/30-207---------------Q--W...VQLF..N........GK..DL.SG....WV...NVGHEKWTV................
Q2RZK0_SALRD/15-220---------------G--W...TLLF..D........GE..TA.AG....WR...GYNDEDFPDTGW.............
A6CGD1_9PLAN/671-851---------------G--F...QSLF..N........GK..TF.DG....WH...GNKKIFRIE................
A6C1K2_9PLAN/155-332---------------G--A...TVLF..D........GT..ST.DM....LK...GA..E....I...............
Q7UTX3_RHOBA/29-219---------------G--F...VSLF..N........GS..DL.SG....WV...KRGGSAK.YR...............
Q7UYB9_RHOBA/49-246---------------G--Y...TPLF..N........GK..DL.SG....WR...NPYSHGE.AS...............
A3ZS39_9PLAN/38-281---------------E--T...ISLL..G........DG..DL.SKHFYTWL...TDGGYED.PRGVF............
Q026J8_SOLUE/86-284---------------D--A...IVLF..N........GK..DL.SQ....WV...S....RQ.RGGAQTE..........
A6EFU0_9SPHI/28-228---------------G--F...KALS..D........GK..TT.AG....WH...TYGQATA.GEKW.............
A7AG24_9PORP/243-456---------------G--W...KLLF..D........GK..TS.NG....WR...GAGQETFPENGW.............
A3ZX11_9PLAN/36-237---------------G--F...RALF..N........GH..DL.SG....WY...GL.......NPHLAAKLDGEEKDK.
A6C3G1_9PLAN/151-333---------------G--A...TVLF..D........SD..KA.EQTVKNFE...NG..Q....I...............
Q7UWR3_RHOBA/519-700---------------G--W...KSLF..D........GK..TL.DG....WN...RKNGTAK.YR...............
Q7UZ09_RHOBA/53-231---------------D--F...VELF..D........GK..SF.DG....WE...H.......SGNW.............
A3ZQR2_9PLAN/150-327---------------G--A...TVLF..D........GA..SA.DA....FE...NG..K....I...............
A6C1I1_9PLAN/43-215---------------G--W...IELF..N........GK..DL.TG....WT...VA.......EGGP............
A6C5D8_9PLAN/56-241---------------G--P...EKLL..N........GG..NFWDH....WK...YI.......SEEEKEANRN......
A6DGI4_9BACT/22-219---------------P--A...QDLF..N........GN..NL.AG....WK...GDLSYWSVK................
Q7UKZ1_RHOBA/77-278---------------K--T...VTLF..D........GK..TL.DG....WR...GREDLWSVD................
Q7ULK4_RHOBA/125-306---------------K--A...TVLF..D........GTKESA.DA...NWE...NA..R....V...............
Q2Y774_NITMU/671-893---------------G--F...TYLF..D........GSDAQF.AN....WE...MAGGGSF.SR...............
A6C6K0_9PLAN/64-244---------------K--W...ISLF..N........GK..NL.DG....WK...VPQFGG...................
A6LCM7_PARD8/20-194---------------T--K...ENVS..D........TV..DH.NA....WK...TTGVVVIQN................
Q027F9_SOLUE/8-228---------------G--Y...VSLF..D........GV..SL.KG....WD...GN.......PKF.............
A6DM04_9BACT/25-206---------------E--A...INLL..S........ADELEMNSK....WV...LK.......................
Q024Y0_SOLUE/27-212---------------P--W...IPLF..N........GN..DL.EG....WR...PS.......EHKD............
A6CCA5_9PLAN/239-425---------------R--M...STIF..N........GV..DL.AG....WN...VVPGSQS.TFE..............
A3ZTD9_9PLAN/1170-1342---------------N--A...GELF..N........GQ..DL.NG....WN...GDRNLWSVE................
A3I2B6_9BACT/23-203---------------E--W...VELF..N........GQ..NF.EG....WK...IS.......ENPD............
A4A0D3_9PLAN/28-213---------------G--F...TTLF..N........GK..DL.DG....WV...GAVKGYDVE................
Q7ULY5_RHOBA/234-440---------------E--W...KPLF..D........GK..SL.DG....WE...TVGGGTW.TV...............
A2U0D4_9FLAO/30-260---------------E--W...KSIF..N........GK..NL.DG....WT...PKIAGYA.LGNNYK...........
A3ZSI6_9PLAN/804-979---------------Q--W...ESIF..N........GH..DL.TG....WS...ER.......GAPG............
A4ASP0_MARSH/33-262---------------E--W...ISMF..N........GK..DL.EG....WT...PKVKGYT.YGENFN...........
A6DNR0_9BACT/77-264---------------D--A...TVLF..D........GS..NL.DN....FK............NKK.............
Q7UTX3_RHOBA/225-416---------------Q--W...QSFFVKNDDGEYGLEGARFVLPEE....WS...FTK......................
A4A202_9PLAN/27-207---------------G--W...VSLT..D........GK..SF.DG....WK...IN.......ENEK............
Q7UYD6_RHOBA/61-249---------------G--F...TSLF..N........GK..DL.SG....WT...AK..GG...SCT.............
A6DQD4_9BACT/44-244---------------K--W......................DL.SA....WQ...NIYPHG...................
Q7UYI5_RHOBA/85-260---------------K--W...TTLF..D........GE..SL.EG....WE...KV.......GRDDS...........
A4APB3_MARSH/31-262---------------V--W...QDLF..N........GK..DI.AD....WT...TKIHHYE.TGDNHG...........
A4CHF9_ROBBH/43-248---------------D--W...IVLF..D........GT..SF.DG....WK...GYNQEGV.PDTW.............
A6LD40_PARD8/42-255---------------G--Y...TLLF..N........GK..DF.TG....WK...MFNGGDV..KGW.............
Q2GAA2_NOVAD/60-315---------------A--P...RNLF..N........GR..DL.TG....WD...SWLGVTV.PATTYGTPSSAPIG...
A3ZWI1_9PLAN/266-442---------------G--F...VSLF..N........GK..DL.TG....WQ...FHATPPRKGKPGGISRPEVPQAIA.
A3XQG8_LEEBM/44-246---------------E--W...EVLF..D........GT..NI.DK....WH...AYNGGD..PTQW.............
L7CBW3_RHOBT/40-226---------------G--F...VSLF..D........GE..SL.DG....WK...KS.......TENPD...........
Q7URK6_RHOBA/266-443---------------D--A...LVLF..N........GE..NT.DQ....FT...KA..R....I...............
A6LER8_PARD8/252-428---------------K--E...VNLF..N........GV..DL.TG....WE...PY.......GTEK............
Q7US53_RHOBA/171-350---------------H--P...IALF..N........GK..DL.TG....WV...TH.......EPDKT...........
Q026X4_SOLUE/31-258---------------D--WTFQGSSL...........GAARRLGSA...DWH...AE.......................
A3HX26_9BACT/40-244---------------E--F...TPLF..E........GN..TF.AG....WH...KYGGGEV.GKAW.............
A2TQP0_9FLAO/54-250---------------D--A...VVLF..D........GT..NL.NA....WK...SK..NDG.GAPKW............
A3HS07_9BACT/30-219---------------G--W...VDLF..N........GK..DL.SG....WK...AVAGTAN.FE...............
A3ZR79_9PLAN/204-387---------------G--M...QSIF..N........GK..DL.TG....WK...TYPAMES.EFT..............
A3I0Y0_9BACT/33-262---------------E--W...RELF..N........GN..DL.EN....WV...VKISKHE.VNENFG...........
A3ZT60_9PLAN/22-206---------------D--A...TPIF..D........GE..TL.EG....WE...GKSEWFHVA................
Q01RN4_SOLUE/31-268---------------D--WTFIGSSL...........ASFRMLGAA...EWH...AE.......................
A6C7J3_9PLAN/515-746---------------G--W...RPLF..N........GN..NL.DDVDTILA...TKTPIKD.PDKF.............
A3I2F1_9BACT/51-252---------------G--W...MLLF..D........GS..DP.SG....WR...AFNGDTF.PEGW.............
A4CGG3_ROBBH/243-451---------------G--W...QLLW..D........GE..ST.EG....WH...GARLEDFPDYGW.............
K5D7N6_RHOBT/55-243---------------D--A...TVLF...........GSSDDV.KN....WK...NI.......SN..............
Q7UGD2_RHOBA/163-356---------------D--A...IVLF..D........GS..NT.QA....WQ...NG..K....I...............
Q7UYA4_RHOBA/58-260---------------D--A...AVLF..D........GS..GL.DA....WK...PF.......SWQWINPND.......

PF00337

Q9VPI7_DROME/41-166---------------P--.---.......--------...RP...G----LC----------------------------
Q9VPI7_DROME/226-369---------------P--F---YGKLLKE--------NFLIE...G----SS----------------------------
Q7QF77_ANOGA/4-145---------------T--F---AGTL.SC--------PV.AT...G----HI----------------------------
Q7QF77_ANOGA/165-293---------------Y--F---SNDV.PK--------PF.LP...G----HI----------------------------
Q7PPI9_ANOGA/742-883---------------P--Y---LTAL.HN--------GM.LI...G----SR----------------------------
Q7QHP5_ANOGA/12-144---------------P--F---LGLI.PG--------GL.SP...G----RM----------------------------
Q18813_CAEEL/34-172---------------P--Y---LSRLDGN--------QL.QT...G----QS----------------------------
Q18813_CAEEL/180-310---------------P--Y---TADI.PG--------NF.YV...G----RK----------------------------
LEG8_HUMAN/18-151---------------P--F---VGTI.PD--------QL.DP...G----TL----------------------------
LEG8_HUMAN/186-316---------------P--F---AARL.NT--------PM.GP...G----RT----------------------------
Q9XVD0_CAEEL/131-257---------------P--Y---TIIFPDG--------HF.KL...K----QS----------------------------
B3GTH_ARATH/184-393---------------S--R---ILVL.PC--------GL.TL...G----SH----------------------------
B3GTK_ARATH/190-404---------------N--R---IMLL.PC--------GL.AA...G----SS----------------------------
LEG7_MOUSE/5-135---------------H--H---KTSL.PQ--------GV.RV...G----TV----------------------------
LEG3_MOUSE/131-261---------------P--Y---DLPL.PG--------GV.MP...R----ML----------------------------
LEG4_CHICK/4-134---------------Q--G---PVCT.NL--------GL.KP...G----QR----------------------------
Q7Q2T6_ANOGA/13-143---------------P--C---LGAI.LG--------GL.QP...G----KK----------------------------
Q7PWU9_ANOGA/113-239---------------H--T---VENI..T--------EV.SP...G----LC----------------------------
Q7PWU9_ANOGA/285-422---------------P--Y---TGVL.QE--------PF.TN...G----RK----------------------------
Q18625_CAEEL/13-145---------------P--Y---TSRL.GQ--------PL.DA...G----QT----------------------------
LEG9_HUMAN/16-147---------------P--F---SGTI.QG--------GL.QD...G----LQ----------------------------
LEG4_PIG/18-149---------------P--Y---YKPI.PG--------GL.RV...G----MS----------------------------
LEG9_HUMAN/226-355---------------P--F---ITTI.LG--------GL.YP...S----KS----------------------------
LEG4_PIG/193-323---------------P--Y---KTRL.QG--------GL.VA...R----RT----------------------------
LEC7_CAEEL/10-137---------------P--S---VYQI.EE--------NL.KA...G----VE----------------------------
Q94215_CAEEL/11-140---------------P--L---TTPI.YE--------GM.RE...H----SS----------------------------
Q9VPU6_DROME/164-300---------------A--F---QSDV.PR--------RY.ET...G----TV----------------------------
Q9VPU6_DROME/3-145---------------V--W---KAKV.LT--------EV.PF...G----HV----------------------------
Q7ZZ26_DANRE/9-141---------------F--Y---VGIC.SV--------AL.HSCNFV----HT----------------------------
O01329_CAEEL/100-226---------------T--T---TLPI.PG--------GYWDT...G----KI----------------------------
O62353_CAEEL/138-266---------------P--Y---MSRIPKT--------QF.NE...G----QS----------------------------
Q18625_CAEEL/153-281---------------P--W---ETAF.PA--------GFLEK...G----QR----------------------------
TECPR_DROME/815-954---------------P--Y---YNTL.YN--------GM.PC...G----TE----------------------------
LEG6_CHICK/3-133---------------Q--G---LVVT.QL--------DV.QP...G----EC----------------------------
Q9U2I7_CAEEL/14-147---------------H--F---QMIRFAR--------AM.EV...G----DK----------------------------
GRIFN_RAT/4-132---------------Q--F---EAFC.AG--------GL.AP...G----WS----------------------------
GRIFN_DANRE/4-133---------------R--F---EASC.PD--------GL.CP...G----WS----------------------------
Q6AV44_ORYSJ/145-340---------------G--D---ALAL.PC--------GL.GL...G----SH----------------------------
Q84T07_ORYSJ/162-372---------------G--V---TVEL.PC--------GM.GV...G----SH----------------------------
B3GTI_ARATH/190-391---------------N--K---LMEL.PC--------GL.TL...G----SH----------------------------
B3GTF_ARATH/170-363---------------S--L---KLQI.PC--------GL.TQ...G----SS----------------------------
B3GTG_ARATH/165-343---------------H--V---LLEL.PC--------GL.IE...D----SS----------------------------
Q9VPI6_DROME/339-481---------------P--Y---YGALPPN--------SL.VD...G----RC----------------------------
Q8SXU5_DROME/5-142---------------K--F---FAVL.PT--------NA.STSDRV----TR----------------------------
A1ZBB1_DROME/5-138---------------.--F---AGNL.SH--------PL.EF...G----HV----------------------------
A4IHU8_XENTR/12-143---------------P--F---TLPL.SH--------GL.HD...G----FL----------------------------
E7FEQ1_DANRE/97-223---------------.--.---..PL.QN--------GA.YN...K----ML----------------------------
F1QX26_DANRE/15-145---------------P--F---SGPI.QG--------GL.QD...G----KS----------------------------
F6YWA7_MACMU/6-136---------------.--V---PYTL.PV--------SL.SV...G----SC----------------------------
K1QS74_CRAGI/373-496---------------.--.---.EWL.PG--------RL.QT...G----SW----------------------------
LEG2_HUMAN/7-128---------------.--.---..VK.NM--------DM.KP...G----ST----------------------------
LEG10_HUMAN/11-136---------------.--.---.....AA--------SL.ST...G----ST----------------------------
LEG12_MOUSE/29-158---------------.--.---.TTI.FG--------GL.YA...G----KM----------------------------
W5JM94_ANODA/12-140---------------P--F---LAHL.PA--------GL.GI...Y----RK----------------------------

PF07675

Q7MUZ4_PORGI/41-208F---ESG----.IPAI--WKTID---------------------------------------------------------
HAGA1_PORGI/230-407F---DTQ----TLPNG--WTMID---------------------------------------------------------
F5HGU5_PORGI/47-200F---ENG----PVPNG--WLEID---------------------------------------------------------
Q7MTE2_PORGI/1142-1311S---THG----EAPAE--WTTID---------------------------------------------------------

PF00629

Q176I4_AEDAE/127-298F...EAP....DLC.G--WMNEA---------------------------------------------------------
NRP2_HUMAN/646-802FD.FLEE.....PC.G--WMYDH---------------------------------------------------------
Q7PZL9_ANOGA/167-335F...ETE....SLC.G--WSNDA---------------------------------------------------------
MAMC2_HUMAN/170-329F...EEN....HLC.G--FVNRW---------------------------------------------------------
MAMC2_HUMAN/509-666F...EQD.....EC.T--FTQEK---------------------------------------------------------
ALK_HUMAN/480-636F...EDG.....FC.G--WTQGT---------------------------------------------------------
MEP1B_HUMAN/265-429F...ELE....NVC.G--MIQSS---------------------------------------------------------
PTPRM_HUMAN/27-184F...DEPY...STC.G--YSQSE---------------------------------------------------------
PTPRU_DANRE/26-184F...DEDSD.PSLC.E--FSQGE---------------------------------------------------------
Q28WN9_DROPS/509-695F...EED.....WC.G--WRDSG---------------------------------------------------------
PTPRU_HUMAN/27-188F...EEASDPAVPC.E--YSQAQ---------------------------------------------------------
MEP1A_HUMAN/269-433F...EKA....NIC.G--MIQGT---------------------------------------------------------
AEGP_MOUSE/661-815F...ERD.....SC.S--WHTGH---------------------------------------------------------
AEGP_HUMAN/813-969F...EDS.....DC.G--FSPGG---------------------------------------------------------
AEGP_HUMAN/656-809F...ERD.....TC.S--WYPGH---------------------------------------------------------
AEGP_HUMAN/493-644F...ESP....EAG.G--WEDAS---------------------------------------------------------
AEGP_HUMAN/271-425F...ETG.....LG.P--WNRSE---------------------------------------------------------
AEGP_MOUSE/67-223F...EQD.....SC.G--WQDIS---------------------------------------------------------
Q1RLY9_DANRE/637-804FGWANDP....SFC.G--WISED---------------------------------------------------------
PTPRU_CHICK/27-187FE.EDDDL...NQC.E--YSQGE---------------------------------------------------------
MEP1A_RAT/270-434F...EKT....NIC.G--MIQGT---------------------------------------------------------
ENTK_BOVIN/363-520F...EDG.....FC.F--WIQDL---------------------------------------------------------
A2AJX4_MOUSE/8-171FETTSGDW..TVEC.G--LTQDP---------------------------------------------------------
ZAN_RABIT/152-315FE.DAAH....PFC.D--WLQAS---------------------------------------------------------
Q5TG12_HUMAN/36-194F...DDGP...GAC.D--YHQDL---------------------------------------------------------
MEP1B_RAT/266-430F...ELE....NIC.G--MIQSS---------------------------------------------------------
Q28DN2_XENTR/27-184FE.AHGDI...GPC.E--VTQGT---------------------------------------------------------
NRP1_CHICK/641-801FGWGSHK....TLC.Q--WEHDN---------------------------------------------------------
Q17E33_AEDAE/237-421F...ETN.....WC.G--WQNYG---------------------------------------------------------
AEGP_RAT/273-427F...ETG.....LG.P--WTQLE---------------------------------------------------------
ZAN_PIG/149-312FE.DNAH....PFC.D--WVQAS---------------------------------------------------------
AEGP_MOUSE/494-649F...ESA.....SAGG--WEDIS---------------------------------------------------------
AEGP_MOUSE/979-1144F...ETG.....LC.G--WSHLP---------------------------------------------------------
AEGP_RAT/817-973F...EDS.....DC.G--FSPGD---------------------------------------------------------
Q17E33_AEDAE/18-192F...ETE......C.A--WKADE---------------------------------------------------------
Q176I3_AEDAE/155-323F...EVS....DLC.G--WESEA---------------------------------------------------------
B0S6D0_DANRE/630-787F...EQS.....MC.G--WTHDP---------------------------------------------------------
B4HP69_DROSE/94-269F...ESE....DQC.G--WSAEE---------------------------------------------------------
B4QA49_DROSI/136-311F...ESE....DQC.G--WEAET---------------------------------------------------------
B8JKC0_DANRE/268-432F...EEP....NIC.G--MIQGD---------------------------------------------------------
D2HWA9_AILME/125-297F...EDG....NIC.L--FTQDD---------------------------------------------------------
E1BZ39_CHICK/620-774F...DLPE...DLC.G--WSHDS---------------------------------------------------------
E9PWQ7_MOUSE/217-373F...DTLN...DLC.G--WSWVP---------------------------------------------------------
F1Q7F6_DANRE/345-500F...EKD.....VC.T--WTQLA---------------------------------------------------------
F1QL06_DANRE/266-425F...EKI....NIC.G--MVQSS---------------------------------------------------------
F1R3K1_DANRE/3-159L...EKSY...TDC.G--FSQGK---------------------------------------------------------
F1RDD1_DANRE/748-922F...EED....TIC.M--FTQDK---------------------------------------------------------
F5H0T8_HUMAN/373-535F...EDNA..HPFC.D--WVQTS---------------------------------------------------------
F5H4B5_HUMAN/41-203F...EDDA..KPLC.D--WSQVS---------------------------------------------------------
F6PMK1_XENTR/270-431F...EYI....NIC.G--MVQGT---------------------------------------------------------
F6Q2U5_XENTR/171-329F...EEN....HLC.G--YMNSW---------------------------------------------------------
F6RM13_MACMU/211-367F...DIPN...DLC.D--WTWIP---------------------------------------------------------
F6TDH8_CIOIN/81-235F...NWG.....LCGG--WSASS---------------------------------------------------------
F6ZQ08_XENTR/641-800F...DHSD...DVC.S--WTHDT---------------------------------------------------------
H3BVJ4_TETNG/269-432F...EED....NIC.G--MIRGS---------------------------------------------------------
H3BWX9_TETNG/646-801F...EQS.....LC.G--WSADP---------------------------------------------------------
H3CE92_TETNG/270-435F...ERE....NIC.G--MIQGQ---------------------------------------------------------
H3CJZ0_TETNG/58-219F...DDG.....SC.G--WFELT---------------------------------------------------------
H3CJZ0_TETNG/591-746F...EFD.....MC.S--WRQGQ---------------------------------------------------------
H3CQ93_TETNG/344-500F...EQG.....LC.F--WRQQQ---------------------------------------------------------
H3CU29_TETNG/52-210F...EDG.....DC.S--WKPIA---------------------------------------------------------
H3DMT5_TETNG/350-507F...EAG.....LC.H--YTLDN---------------------------------------------------------
H3DPC5_TETNG/223-385F...EKA....SIC.G--MIQTS---------------------------------------------------------
L9KUF8_TUPCH/628-792F...EDE....KIC.G--YTQDL---------------------------------------------------------
ENTK_MOUSE/392-549F...DDG.....FC.F--WTQDL---------------------------------------------------------
MAMC2_MOUSE/342-497F...EIG.....LC.N--FYQDK---------------------------------------------------------
NRP1_RAT/650-810FGWGSHK....TFC.H--WEHDS---------------------------------------------------------
Q9VQS2_DROME/132-307F...ESE....DMC.G--WTAEL---------------------------------------------------------

PF00457

U5MR46_CLOSA/70-253GYDYE----------L--W..KD-----Y.--------------------------------------------------
XYNB_ASPFU/42-219GYYYS----------F--W..TD-----G.--------------------------------------------------
XYN3_MAGO7/54-234GFYYS----------H--W..TD-----NA--------------------------------------------------
F8DB45_HALXS/87-262GYYYS----------F--W..TD-----S.--------------------------------------------------
F9XDM7_MYCGM/45-223GYYYS----------F--W..TD-----G.--------------------------------------------------
M2QR82_CERS8/44-221GFYYQ----------F--W..TN-----G.--------------------------------------------------
G7XIG9_ASPKW/42-219GYFYS----------F--W..TN-----G.--------------------------------------------------
A9G323_SORC5/221-397GYTFE----------Y--W..KD-----T.--------------------------------------------------
G2QUC8_THITE/35-208GTAFN----------N--W..SE-----G.--------------------------------------------------
E3Q8W7_COLGM/43-217.DYTQ----------N--Y..KT-----S.--------------------------------------------------
A7EQZ6_SCLS1/49-220.NYKQ----------D--Y..TT-----G.--------------------------------------------------
K0J5P9_AMPXN/62-246GYDYE----------F--W..KD-----Y.--------------------------------------------------
G4TKV8_PIRID/43-220GYYYS----------F--W..TD-----G.--------------------------------------------------
S8ATR1_PENO1/29-208IDYVQ----------N--Y...N-----GN--------------------------------------------------
T0MBU2_COLGC/37-214GYYYS----------W--W..TD-----G.--------------------------------------------------
Q2UFR7_ASPOR/71-245GYYYS----------L--Y..ND-----N.--------------------------------------------------
F7PGE0_9EURY/60-235GYFYS----------F--W..TN-----D.--------------------------------------------------
M9LS78_PSEA3/38-220INYVQ----------N--Y...N-----GN--------------------------------------------------
G1X5P3_ARTOA/57-231TNYNQ----------D--Y..TT-----G.--------------------------------------------------
E6UKJ6_RUMA7/55-250DYHHE----------I--W.QAD-----T.--------------------------------------------------
G2XS85_BOTF4/46-225GYYYS----------F--W..TD-----G.--------------------------------------------------
C7Q365_CATAD/61-236GYYYS----------F--W..TE-----G.--------------------------------------------------
S7ZJ07_PENO1/39-216GFYYS----------F--W..TN-----G.--------------------------------------------------
E3QVD0_COLGM/44-216.DYTQ----------N--Y..KT-----G.--------------------------------------------------
G2X5X8_VERDV/37-215GYFYS----------W--W..SD-----G.--------------------------------------------------
C6WIK2_ACTMD/54-231GYYFS----------F--W..TD-----S.--------------------------------------------------
B1ZMX2_OPITP/39-216GYFWS----------L--Y..RE-----GG--------------------------------------------------
A9EQP3_SORC5/210-404GYGYE----------L--W..AE-----G.--------------------------------------------------
F4H710_CELFA/52-228GYFYS----------F--W..TD-----S.--------------------------------------------------
S3E0R3_GLAL2/19-199SYFSS----------W--W..TD-----G.--------------------------------------------------
R0K9J6_SETT2/42-213GFYYQ----------F--W..TD-----GA--------------------------------------------------
M7TVV3_BOTF1/41-218GYYYS----------F--W..TD-----G.--------------------------------------------------
T0KW32_COLGC/75-251GFYYS----------V--Y..SP-----N.--------------------------------------------------
G0S9X3_CHATD/56-233GYFYS----------F--W..TD-----G.--------------------------------------------------
K5X1T9_AGABU/46-223GYFYS----------L--WMQSN-----T.--------------------------------------------------
S3DEM3_GLAL2/50-221.DYTQ----------N--Y..KT-----G.--------------------------------------------------
B8M5E1_TALSN/53-227VNYNQ----------D--Y..VA-----G.--------------------------------------------------
V5FWP5_BYSSN/38-215GYYYS----------F--W..TN-----G.--------------------------------------------------
D9SP57_CLOC7/41-225GYDYE----------Y--W..KD-----N.--------------------------------------------------
A8P4P6_COPC7/104-288GYFYS----------W--W..TD-----G.--------------------------------------------------
Q0UI10_PHANO/28-204FNAIQ----------N--W..AN-----D.--------------------------------------------------
Q47QL8_THEFY/52-227GYFYS----------F--W..TD-----A.--------------------------------------------------
G2QWT6_THITE/50-225PSYTQ----------N--Y..QT-----G.--------------------------------------------------
R6YEV7_9FIRM/39-222GYNYE----------L--W..KD-----Y.--------------------------------------------------
Q21G61_SACD2/43-220GYYYS----------F--W..TD-----S.--------------------------------------------------
F7W2U2_SORMK/27-207NYFWS----------N--W..SD-----G.--------------------------------------------------
R4LPY0_9ACTO/53-232GTYYQ----------M--W..TA-----G.--------------------------------------------------
XYNB_ASPFN/42-219GYYYS----------F--W..TN-----G.--------------------------------------------------
C9RK54_FIBSS/46-247NYSYE----------L--W..AD-----I.--------------------------------------------------
XYNC_STRCO/61-238GMYYS----------F--W..TD-----G.--------------------------------------------------
S7ZVQ9_PENO1/51-226GFYYS----------L--Y..ND-----N.--------------------------------------------------
G4UC47_NEUT9/40-217GFYYS----------F--W..TD-----N.--------------------------------------------------
E3QHP2_COLGM/50-227GYFYS----------F--W..SD-----G.--------------------------------------------------
M1W9A1_CLAP2/39-214GLYSS----------Y--W..AD-----Y.--------------------------------------------------
A8NZY3_COPC7/34-216ASFWT----------N--W..SE-----G.--------------------------------------------------
G2Q4M3_THIHA/47-221.DYNQ----------N--Y..RT-----S.--------------------------------------------------
A8NW94_COPC7/49-232GYFYH----------W--W..SD-----T.--------------------------------------------------
E3S3R6_PYRTT/42-215.EYTQ----------K--Y..KT-----K.--------------------------------------------------
G4TKT5_PIRID/54-231GYYYS----------F--W..TD-----G.--------------------------------------------------
Q2HCI0_CHAGB/40-217GFYYS----------F--W..TD-----N.--------------------------------------------------
I3VTR8_THESW/29-209TNYWQ----------D--W..TD-----G.--------------------------------------------------
B3PIN1_CELJU/38-224GFYYT----------F--W..KD-----S.--------------------------------------------------
K5WVZ1_PHACS/44-221GYFYS----------F--W..TD-----G.--------------------------------------------------
G0SAF9_CHATD/37-199GYYYS----------F--W..TD-----G.--------------------------------------------------
G4TKT3_PIRID/54-231GYYYS----------F--W..SD-----G.--------------------------------------------------
S8AJR6_DACHA/43-221GYYYS----------W--W..TD-----G.--------------------------------------------------
M1LSN7_9CLOT/30-211TDYWQ----------N--W..TD-----G.--------------------------------------------------
F0XC21_GROCL/46-221PNYNQ----------D--Y..TT-----G.--------------------------------------------------
M4GA15_MAGP6/41-223GYYYS----------F--W..SE-----G.--------------------------------------------------
B2A9I4_PODAN/43-221GYYYS----------F--W..TD-----N.--------------------------------------------------
G2X4G1_VERDV/41-216GFFYY----------W--W..SD-----G.--------------------------------------------------
B8MND2_TALSN/59-232TNYKQ----------D--Y..VT-----G.--------------------------------------------------
A9GHF8_SORC5/306-501DFFFT----------H--W..KD-----G.--------------------------------------------------
E5A0Q4_LEPMJ/78-250GGYYS----------F--W..SE-----G.--------------------------------------------------
G4U378_PIRID/48-223YYNYF----------.--W..TD-----G.--------------------------------------------------
C9RLL3_FIBSS/44-238GVGYE----------L--W..YD-----R.--------------------------------------------------
B2WG17_PYRTR/46-223GCFYS----------W--W..TD-----G.--------------------------------------------------
XYNA_BACSU/29-211TDYWQ----------N--W..TD-----G.--------------------------------------------------
XYNA_EMENI/46-223GYYYS----------F--W..TD-----G.--------------------------------------------------
XYN3_ASPKW/29-208INYVQ----------N--Y...N-----GN--------------------------------------------------
E6UBP6_RUMA7/65-254GYDYE----------L--W..KD-----K.--------------------------------------------------
C7YSL3_NECH7/42-220GYYYS----------F--W..TD-----N.--------------------------------------------------
N1PCA4_MYCP1/49-227GYYYS----------F--W..SD-----NS--------------------------------------------------
G0R947_HYPJQ/52-226INYDQ----------N--Y..QT-----G.--------------------------------------------------
G2Q913_THIHA/39-217GFYYS----------F--W..TD-----G.--------------------------------------------------
B2B3J5_PODAN/53-231GYFYS----------Y--W..SD-----G.--------------------------------------------------
Q9KEF3_BACHD/29-208NTYWQ----------Y--W..TD-----G.--------------------------------------------------
Q2GN95_CHAGB/35-214GYFYS----------F--W..TD-----G.--------------------------------------------------
A9EUR0_SORC5/153-329GLTFE----------Y--W..KD-----R.--------------------------------------------------
S8AS02_DACHA/46-242GYFYS----------F--W..SD-----G.--------------------------------------------------
U7Q3B8_SPOS1/53-234SYTSS----------Y--W..ND-----G.--------------------------------------------------
J3NW75_GAGT3/48-227GYYYS----------W--W..TD-----G.--------------------------------------------------
G4TKT1_PIRID/54-222GYYYS----------F--W..TD-----G.--------------------------------------------------
XY11A_USTMA/36-218INYVQ----------N--Y...N-----GN--------------------------------------------------
M7SU57_EUTLA/19-190QSYYS----------F--W..SE-----G.--------------------------------------------------
B6QV47_PENMQ/55-228INYNQ----------D--Y..TT-----G.--------------------------------------------------
M3CYK1_SPHMS/48-225GFFYS----------Y--Y..NS-----G.--------------------------------------------------
K1X7K7_MARBU/40-238GFYYS----------W--W..TD-----N.--------------------------------------------------
G2NBA0_9ACTO/53-228GYYYS----------F--W..TD-----G.--------------------------------------------------
U7PQP8_SPOS1/44-215.DYNQ----------N--Y..KT-----G.--------------------------------------------------
G0RUP7_HYPJQ/43-221GYFYS----------Y--W..ND-----G.--------------------------------------------------
G8LXE2_CLOCD/39-223GYDYE----------Y--W..KD-----T.--------------------------------------------------
T0L8D6_COLGC/39-215GYYYS----------W--W..TD-----G.--------------------------------------------------
G2QV82_THITE/46-224QDYNQ----------N--W..KG-----G.--------------------------------------------------
Q2H5I3_CHAGB/51-228GYYYY----------F--W..TD-----G.--------------------------------------------------
XYN4_MAGO7/51-228GFYYS----------W--W..TD-----N.--------------------------------------------------
G8LXE2_CLOCD/424-608GYNYE----------Y--W..KD-----N.--------------------------------------------------
K1WWU0_MARBU/46-224GFFYS----------W--W..TD-----G.--------------------------------------------------
C7PX63_CATAD/51-229GYYYQ----------M--W..SS-----G.--------------------------------------------------
S8AMN0_PENO1/42-221GYYYS----------F--W..TN-----G.--------------------------------------------------
F4FB94_VERMA/40-218GFFFS----------F--W..KD-----S.--------------------------------------------------
E3S9S5_PYRTT/49-227GFFYS----------F--W..TD-----G.--------------------------------------------------
B8NYB7_ASPFN/69-243GFYYS----------L--Y..NA-----N.--------------------------------------------------
J3NLQ4_GAGT3/38-211..PWQ----------W--W..TE-----G.--------------------------------------------------
L7VQD8_CLOSH/42-225GYDYE----------L--W..KD-----Y.--------------------------------------------------
L0EBB6_THECK/28-208NTYWQ----------Y--W..TD-----G.--------------------------------------------------
A8FE31_BACP2/38-219GYDFE----------L--W..KD-----Y.--------------------------------------------------
G4U379_PIRID/50-216..NYY----------L--W..AD-----N.--------------------------------------------------
E3Q964_COLGM/44-223GYYYS----------W--W..TD-----G.--------------------------------------------------
C5BU21_TERTT/52-237GHYYS----------F--W..KD-----S.--------------------------------------------------
B8I7X1_CLOCE/38-221GYDYE----------L--W..KD-----N.--------------------------------------------------
A8NKZ6_COPC7/44-228GYFYS----------W--W..TD-----N.--------------------------------------------------
Q11SH7_CYTH3/43-226GFFYS----------F--W..ND-----GS--------------------------------------------------
B8I371_CLOCE/30-210TDYWQ----------N--W..TD-----G.--------------------------------------------------
I2FN07_USTH4/36-218IDYVQ----------N--Y...N-----GQ--------------------------------------------------
G4TKT4_PIRID/54-231GYYYF----------F--E..SD-----G.--------------------------------------------------
C9Z2V1_STRSW/53-229GFYYS----------F--W..TD-----A.--------------------------------------------------
S8AP92_PENO1/40-211GFFYQ----------F--W..DD-----GS--------------------------------------------------
T0K1I6_COLGC/42-222GYFYS----------F--W..TD-----G.--------------------------------------------------
C7ZN05_NECH7/1-172..YHY----------W--W..TD-----S.--------------------------------------------------
XYNC_FIBSS/52-240.IGYE----------L--W.DEN-----GH--------------------------------------------------
G1X9B1_ARTOA/43-221GYYFS----------W--W..TD-----G.--------------------------------------------------
A9GEL6_SORC5/142-318GFTYQ----------L--W..VD-----Q.--------------------------------------------------
K2RN85_MACPH/42-220GYYYS----------F--W..TD-----G.--------------------------------------------------
R4LM27_9ACTO/54-231GYFFS----------Y--W..KD-----N.--------------------------------------------------
D5UGI1_CELFN/51-229GWWYS----------F--W..TD-----S.--------------------------------------------------
Q2HI25_CHAGB/36-208GYYFQ----------N--W..SE-----G.--------------------------------------------------
XYNC_FIBSS/327-512PYHYE----------I--W..YQ-----G.--------------------------------------------------
G4N696_MAGO7/47-225..RTQ----------N--W..GN-----E.--------------------------------------------------
G8SKM4_ACTS5/52-226GYYYS----------F--W..KD-----S.--------------------------------------------------
M2TBN8_COCH5/42-219.DYNQ----------N--Y..KT-----G.--------------------------------------------------
N1PGQ5_MYCP1/47-227GWFYS----------W--W..SD-----K.--------------------------------------------------
XYNA_GIBZE/50-227GYFYS----------W--W..SD-----G.--------------------------------------------------
B2WK18_PYRTR/41-214QDYDQ----------N--Y..KT-----S.--------------------------------------------------
S8AF15_DACHA/44-214GYFYQ----------F--W..SD-----G.--------------------------------------------------
C5BMU2_TERTT/37-214GYYYS----------F--W..KD-----S.--------------------------------------------------
B6QNP6_PENMQ/54-227INYNQ----------D--Y..TT-----G.--------------------------------------------------
U7PKR6_SPOS1/52-230GFFYS----------F--W..TD-----G.--------------------------------------------------
G3XY88_ASPNA/57-232GFYYS----------V--Y..ND-----N.--------------------------------------------------
G9NQ12_HYPAI/48-222INYNQ----------D--Y..TT-----G.--------------------------------------------------
F7W777_SORMK/45-222GYYFS----------F--W..TD-----D.--------------------------------------------------
Q0UBJ9_PHANO/41-216NAPWQ----------Y--W..TE-----G.--------------------------------------------------
T0JLP7_COLGC/68-241TNYVQ----------N--Y..QT-----G.--------------------------------------------------
D8PN69_SCHCM/41-226GYYYS----------W--W..TD-----G.--------------------------------------------------
C7ZC92_NECH7/39-216GFYYS----------W--W..TD-----G.--------------------------------------------------
B8E1P4_DICTD/41-222GYYYE----------L--W..KD-----S.--------------------------------------------------
D1BXH1_XYLCX/54-230GYFYS----------F--W..TD-----S.--------------------------------------------------
F0S4T0_PEDSD/87-269GYFWS----------L--W..KD-----DQ--------------------------------------------------
G9MV13_HYPVG/54-228TNYNQ----------D--Y..TT-----G.--------------------------------------------------
Q2HCI7_CHAGB/53-216GYFYS----------F--W..SD-----G.--------------------------------------------------
L0E9J8_THECK/24-202..NWY----------F--W..TN-----G.--------------------------------------------------
E4N0N4_KITSK/54-229GYFYS----------F--W..TE-----G.--------------------------------------------------
J3PC50_GAGT3/50-229GYYYS----------Y--W..TE-----DA--------------------------------------------------
Q0CMZ1_ASPTN/41-218GYYYS----------F--W..TD-----G.--------------------------------------------------
S3D920_GLAL2/48-226GYYYS----------F--W..TD-----G.--------------------------------------------------
E6X8Q5_CELAD/57-241GYWWT----------I--Y..KE-----GG--------------------------------------------------
F9F5R3_FUSOF/43-220GFYYS----------W--W..SD-----G.--------------------------------------------------
XYNB_ASPCL/42-219GYYYS----------F--W..TD-----N.--------------------------------------------------
G2Q4S6_THIHA/47-224GYFYS----------W--W..SD-----G.--------------------------------------------------
Q0UBV5_PHANO/22-194QFFIQ----------N--WGNGE-----K.--------------------------------------------------
G2X8M4_VERDV/40-224GYFYS----------W--W..TD-----G.--------------------------------------------------
H1YIW2_9SPHI/65-249GFFWS----------L--W.KSD-----GA--------------------------------------------------
M7STD0_EUTLA/43-222GFFYS----------F--W..TD-----G.--------------------------------------------------
D4LFB0_RUMC1/42-232GYAYE----------L--W..KD-----N.--------------------------------------------------

PF01670

GUNA_ASPKW/28-239PYSVNQN--------L--WGEYQ-----GT--------------------------------------------------
G0RRG8_HYPJQ/29-234GYTVSNN--------L--WGASA-----GS--------------------------------------------------
Q2UFR8_ASPOR/29-239PYSVNNN--------L--WGQDS-----GT--------------------------------------------------
Q9RJY3_STRCO/54-261RYVVQNN--------R--WGSTA-----TQ--------------------------------------------------
Q9S5X8_THEMA/18-255PLSMELN--------L--WNIKE-----YS--------------------------------------------------

PF00722

XTH8_ARATH/38-224EDNFNI.--------M--WSENH-----FT-----T-S..DD-----.....----------------------------
XTH1_ARATH/36-215DDNYVV.--------T--WGQNN-----VL-----K-L..NQ-----.....----------------------------
Q6BHG8_DEBHA/45-215SPYFDI.--------V--EANGV-----S.-----F-G.DD.-----.....----------------------------
Q6BH77_DEBHA/56-228QENLQV.--------S--SDPPI-----VQ-----Y-Y.DS.-----.....----------------------------
Q6BH39_DEBHA/52-224STQFEV.--------T--STESG-----VS-----F-G.DD.-----.....----------------------------
Q6BRL2_DEBHA/100-275SSETDW.--------L--YTGYI-----D.-----T-H.DD.-----.....----------------------------
Q7CTY9_AGRT5/57-234GAHQNC.--------T--WSKKL-----AT-----V-E.NG.-----.....----------------------------
Q7CSS8_AGRT5/263-456NPAYAG.--------T--TEVNP-----FS-----V-Q.NG.-----.....----------------------------
EXOK_RHIME/58-245GGHQNC.--------T--WSKKQ-----VK-----T-..VD.-----.....----------------------------
BRU1_SOYBN/32-213YQDFDL.--------T--WGGDR-----A.-----K-I.FNG-----.....----------------------------
Q6FNU8_CANGA/147-325LMDYDF.--------I--YSGMT-----QM-----D-P.TT.-----.....----------------------------
XTH10_ARATH/37-218NKDFFV.--------T--WSPTH-----V.-----N-T.SND-----.....----------------------------
CRH2_YEAST/96-273VSEADW.--------L--YTGDV-----LD-----Y-D.DE.-----.....----------------------------
CRR1_ASHGO/155-333LEQYDF.--------I--HSGFI-----SV-----D-G.KS.-----.....----------------------------
XTH13_ARATH/26-207YDNFDI.--------T--WGNGR-----A.-----N-I.VES-----.....----------------------------
Q7XTP9_ORYSJ/31-215TDQLEV.--------L--FGQTQ-----L.-----.-L.NDS-----N...G----------------------------
Q6ES26_ORYSJ/32-215YEECDA.--------T--WEPQN-----C.-----W-S.SDN-----.....----------------------------
XTH31_ARATH/39-223DREFRT.--------L--WGSQH-----QR-----R-E....-----.....----------------------------
Q5AXN2_EMENI/49-224LDDALW.--------N--MTTGT-----PD-----Y-T.SE.-----.....----------------------------
Q6FWX2_CANGA/97-274ASAADW.--------T--YSGYL-----VD-----Y-P.DE.-----.....----------------------------
XTH33_ARATH/43-226ENGFSR.--------R--FGAHN-----IQ-----V-....N-----.....----------------------------
GUB_BACSU/54-238GNMFNC.--------T--WRANN-----VS-----M-T.SL.-----.....----------------------------
Q6ZAN9_ORYSJ/28-212TNDLDI.--------L--WGNSK-----V.-----.-F.YDN-----S...G----------------------------
Q7XNY6_ORYSJ/36-222REEFDV.--------I--WGEDH-----V.-----R-V.TDE-----DDAAT----------------------------
Q6Z2L4_ORYSJ/35-220EEGYTP.--------L--FGFDN-----IL-----R-S...A-----....D----------------------------
Q6RHY1_SOLLC/27-212NKGFSH.--------L--FGDGN-----IL-----H-A...N-----....D----------------------------
Q6CIZ6_KLULA/49-219SSYFER.--------Y--ATNGN-----VS-----Y-G.DD.-----.....----------------------------
Q84T83_ORYSJ/36-221DEGFSP.--------L--FGEDN-----MV-----K-S...A-----....D----------------------------
Q8H7Q1_ORYSJ/3-189GEGYDN.--------L--WGGQH-----QT-----L-S...A-----....D----------------------------
Q8GVQ2_ORYSJ/40-224GDNFEI.--------T--GAEDH-----V.-----K-T.SAD-----.....----------------------------
Q6C4P9_YARLI/48-219SDDFPP.--------S--FKPHR-----IT-----Y-S.ND.-----.....----------------------------
CRH1_YEAST/65-235SKWFTD.--------L--KHAGE-----IK-----Y-G.SD.-----.....----------------------------
XTH17_ARATH/29-211HKDVQI.--------H--WGDGR-----G.-----K-I.HDR-----....D----------------------------
Q6ZAN8_ORYSJ/30-214TDSLDM.--------L--WGNTQ-----V.-----.-L.YDS-----T...G----------------------------
XTH2_ARATH/32-212DVNYVV.--------T--WGQDH-----I.-----L-K.LNQ-----.....----------------------------
Q8GVR3_ORYSJ/46-232SRDYTN.--------K--WGPQH-----QT-----L-S...A-----....D----------------------------
XTH28_ARATH/31-216DEGYTQ.--------L--FGDQN-----LI-----V-H...R-----....D----------------------------
Q7SGL2_NEUCR/50-224PKAWAW.--------E--TTVGT-----VD-----F-D.MD.-----.....----------------------------
Q5KNP5_CRYNJ/97-278ATAYDWV--------V--NTGSL-----VA-----S-S.DN.-----.....----------------------------
Q6YUP5_ORYSJ/36-221DEGYSP.--------L--FGDDN-----LV-----R-S...S-----....D----------------------------
Q9FZ05_SOLLC/27-209DQEFDV.--------T--WGYGR-----V.-----K-I.LEN-----.....----------------------------
Q825L5_STRAW/78-287ERQYYT.--------S--GNNNA-----AL-----D-G.QG.-----.....----------------------------
UTR2_CANAL/100-275STEADW.--------V--YTGWV-----DY-----Y-D..N.-----.....----------------------------
Q7S222_NEUCR/48-222ADSFFK.--------N--MVGTT-----LQ-----Y-D.NK.-----.....----------------------------
Q6Z998_ORYSJ/39-226YDDVEV.--------V--WGGDH-----SF-----F-F.MDG-----....D----------------------------
Q7N1F8_PHOLL/52-255GVRKNC.--------I--NTQSA-----VI-----V-R.NG.-----.....----------------------------
Q97FD3_CLOAB/57-242GNPFNC.--------T--WRASN-----VN-----F-..NN.-----.....----------------------------
CRR1_YEAST/147-325LEDFDF.--------T--HSGYT-----SI-----E-A.SS.-----.....----------------------------
Q7XBU8_ORYSJ/32-215DAAYMP.--------L--FGGDN-----LV-----P-S...P-----....H----------------------------
XTH32_ARATH/43-227YKGFRN.--------L--WGPQH-----QR-----M-D....-----.....----------------------------
XTH26_ARATH/29-208SKNFIV.--------T--WGKDH-----M.-----F-M...N-----.....----------------------------
Q82M60_STRAW/400-624ESQAYV.--------D--S.TDN-----VR-----T-E.NG.-----.....----------------------------
Q6K9X1_ORYSJ/50-242GRDFRS.--------L--WGAEH-----QQ-----Q-E.AAA-----....P----------------------------
XTH21_ARATH/28-209NQDIDI.--------T--WGDGR-----G.-----N-I.LNN-----.....----------------------------
Q7S7D0_NEUCR/61-233QASWTS.--------V--GAGS.-----VI-----Y-T.SQ.-----.....----------------------------
XTH25_ARATH/30-211DTEFDI.--------T--WGDGR-----G.-----K-V.LNN-----.....----------------------------
Q6FSM3_CANGA/48-218SKWFTA.--------E--DNPGK-----IE-----Y-T.SD.-----.....----------------------------
Q6ES25_ORYSJ/25-208RDECDI.--------P--WEPQN-----A.-----R-F.TDD-----.....----------------------------
Q5Z746_ORYSJ/26-208QDQCDI.--------T--WEPQN-----A.-----K-M.TEG-----.....----------------------------
CRH11_CANAL/50-220GPHFES.--------L--KKQGT-----ID-----S-G.SN.-----.....----------------------------
Q5B4L5_EMENI/96-273ATESDW.--------V--YSGKL-----KV-----E-D..G.-----.....----------------------------
Q5Z6H1_ORYSJ/36-217HRDFDA.--------V--WGKGN-----A.-----R-F.RDG-----.....----------------------------
XTH24_ARATH/24-205NTDVNV.--------A--WGNGR-----G.-----K-I.LNN-----.....----------------------------
Q98C78_RHILO/80-268GSHQNC.--------T--WSKGL-----VE-----L-..SD.-----.....----------------------------
Q7SBQ2_NEUCR/99-274PSKADW.--------V--SQGEP-----LS-----Y-N..D.-----.....----------------------------
Q8XNF8_CLOPE/412-635MVNHGA.--------I--YNRGA-----VS-----I-KKDGN-----NSYLA----------------------------
XTH1_SOLLC/33-214WKNYEP.--------S--WASHH-----I.-----K-F.LNG-----.....----------------------------
Q7XTP8_ORYSJ/24-207DEGLEV.--------M--WGDGR-----G.-----.-S.VSP-----....D----------------------------
Q6CL87_KLULA/145-322LRDYHF.--------T--YSGFV-----KY-----D-A.PG.-----.....----------------------------
XTH3_ARATH/35-213GQNYIV.--------T--WGQSH-----V.-----S-T.LHS-----.....----------------------------
GUB_CLOTH/57-238GSVFNC.--------V--WKPSQ-----VT-----F-S.NG.-----.....----------------------------
B9RG34_RICCO/58-238GRNYIP.--------T--WAFDH-----IK-----Y-F.NG.-----.....----------------------------
C5Z8T4_SORBI/33-213YQDVDI.--------T--WGDGR-----GK-----I-L.NN.-----.....----------------------------
D3EBX7_GEOS4/64-257.LQYYT.--------D--.RAQN-----LQ-----V-S.GG.-----.....----------------------------
D7SNC1_VITVI/38-220NQGFRN.--------L--WGSQH-----QT-----I-D.QG.-----.....----------------------------
E7FHE7_PYRFU/86-290...YYT.--------E--NNTY.-----..-----I-V.NG.-----.....----------------------------
F2D903_HORVD/30-212DDQFEV.--------I--GDRDH-----IG-----Y-R.DDG-----N..DK----------------------------
F2DT99_HORVD/27-208YDQFDV.--------V--GSGNN-----VR-----V-N.DDG-----....I----------------------------
F2DUU5_HORVD/27-204...SEM.--------S--WGDGR-----GK-----V-V.DG.-----.....----------------------------
G2XIS4_VERDV/50-220GEDYLY.--------T--LPGTK-----VT-----Y-D.KE.-----.....----------------------------
G4NC59_MAGO7/98-270..KADW.--------V--VTGEP-----L.-----F-S.NG.-----.....----------------------------
K4DD58_SOLLC/24-203YQDATV.--------T--FGDQR-----AQ-----I-Q.DG.-----.....----------------------------
M1AN43_SOLTU/24-201TDVFES.--------S--WAPDH-----IA-----V-V.GD.-----.....----------------------------
M4EZF0_BRARP/17-194EELYRS.--------S--WAMDH-----C.-----V-N.DG.-----.....----------------------------
Q5L861_BACFN/78-272...YYK.--------P--NDTSV-----VW-----C-E.DG.-----.....----------------------------
Q9WXN1_THEMA/253-454.......--------.--YTDEN-----AF-----V-E.NG.-----.....----------------------------
T0UMT6_9STRE/50-231GGMFNC.--------R--WDPAN-----VG-----F-N.NG.-----.....----------------------------
V4IZ43_9ACTO/74-282ESQYYT.--------S--GADNA-----AL-----D-G.NG.-----.....----------------------------
W5I2U1_WHEAT/24-204DKEFDI.--------T--WGDGR-----GK-----I-L.NN.-----.....----------------------------

PF03935

Q6BW61_DEBHA/174-674FQAADLW--------Y--GGTQD-----LE-----Y-YDPDA-----V.TTA----------------------------
Q0UQN1_PHANO/94-573FYAGNFW--------Y--GATQD-----LE-----W-YDPDA-----I.TTR----------------------------
A5DEX4_PICGU/157-655FTAPNFH--------Y--AATHD-----LE-----W-YDPDA-----V.WTE----------------------------
A1C6M7_ASPCL/154-653YQAVDIW--------Y--GVTQD-----LE-----W-YDPDA-----V.TTR----------------------------
Q752M9_ASHGO/153-654WTGPNIH--------Y--AATND-----LE-----W-YTPDA-----A.TTK----------------------------
Q5KJ60_CRYNJ/92-619WTGVDLN--------Y--WPTGD-----LE-----W-YDPSA-----I.TTA----------------------------
Q4P2E5_USTMA/148-679WEAYNGW--------Y--SGTND-----YE-----Y-YSPEA-----INTTD----------------------------
A5DZI8_LODEL/240-745FTAPDLH--------Y--DATKD-----LE-----W-YDPDA-----V.TTA----------------------------
Q4PGA6_USTMA/384-919WTAVDLH--------Y--WGTEN-----YE-----W-YDPSA-----V.TTA----------------------------
Q4P8J4_USTMA/197-732WEASDLH--------Y--WATNN-----YE-----W-YSPEA-----V.TTR----------------------------
YEPB_SCHPO/124-627WEAVNIH--------Y--AATND-----LD-----W-YDPDA-----I.TTV----------------------------
YEOB_SCHPO/134-636WLATDLH--------Y--AATTD-----YE-----Y-YDADT-----P.TTA----------------------------
A7TTP7_VANPO/229-744WTAPDIH--------Y--DATKD-----LE-----W-YSPDA-----V.TTA----------------------------
A5DZ87_LODEL/332-841FTAPDLH--------Y--DATKD-----LE-----W-YDPDA-----V.TTA----------------------------
Q6FUB1_CANGA/183-684WTAPDIH--------Y--DATKD-----LE-----W-YSPDA-----S.TTR----------------------------
A7E6J8_SCLS1/168-668FQAVDIW--------Y--GATQD-----LE-----W-YDPDA-----V.TTG----------------------------
Q5AEC0_CANAL/212-718WTAPDLH--------Y--DATKD-----LE-----W-YDPDA-----A.TTS----------------------------
A3LPW0_PICST/189-695FTAPDLH--------Y--DATKD-----LE-----W-YSPDA-----V.TTE----------------------------
A7EWT0_SCLS1/211-717WTAPNIW--------Y--GATQD-----ME-----W-YDPVA-----V.TTG----------------------------
Q5KHK4_CRYNJ/69-588WTGVDIH--------Y--WPTGD-----FE-----W-YDPAA-----I.TTK----------------------------
Q0UKL9_PHANO/161-653FQAVDIW--------Y--GATQD-----LE-----W-YDPDA-----A.WTQ----------------------------
A3LPU3_PICST/148-653FTAPDLH--------Y--DATKD-----LE-----W-YSPDA-----V.STQ----------------------------
Q6FQ11_CANGA/223-736WTAPDIH--------Y--DATKD-----LE-----W-YSPDA-----T.TTR----------------------------
E7LUU1_YEASV/250-763WTAPDIH--------Y--DATKD-----LE-----W-YSPDA-----V.TTT----------------------------
M7NJX3_PNEMU/194-674WEAVDLH--------Y--WSTLS-----LE-----W-YDPDA-----I.TTN----------------------------
Q5A4H2_CANAL/99-596FTAPDLH--------Y--DATKD-----LE-----W-YDPDA-----V.TTA----------------------------

PF10287

K0KZR6_WICCF/233-464WERVAY---------Y--...SP-----GS-----T-N------------------------------------------
I2H1W8_TETBL/107-341WTRGAY---------Y--D.ADS-----KS-----T-E------------------------------------------
D0N3P2_PHYIT/250-486WPRVSS---------Y--S.SKD-----GT-----V-E------------------------------------------
A7TFI3_VANPO/109-343WDRMAY---------Y--D.ASS-----QT-----S-Q------------------------------------------
N1PMX9_MYCP1/238-461WTRQGY---------Y--N.AES-----GT-----S-S------------------------------------------
G0VAP6_NAUCC/104-338WTRGAY---------Y--D.ASS-----QT-----S-S------------------------------------------
S9W8F8_SCHCR/234-466WVRSSY---------Y--D.SKS-----ST-----S-D------------------------------------------
C5GJ05_AJEDR/167-389WGRQGY---------Y--N.AEA-----GV-----A-D------------------------------------------
K3W690_PYTUL/247-486WTRVSW---------Y--N..RG-----GA-----A-S------------------------------------------
I2GUP8_TETBL/154-386WSRIAY---------Y--...TP-----GT-----S-S------------------------------------------
A5DXV9_LODEL/227-457WTRDSY---------Y--...TP-----GS-----T-D------------------------------------------
C4XY08_CLAL4/110-342WQRKAY---------Y--N.SSS-----QT-----A-D------------------------------------------
M3A440_MYCFI/207-432WTRQGY---------Y--N.AQD-----QT-----S-E------------------------------------------
D0MRW8_PHYIT/313-551WTKVSS---------Y--D.ASS-----GT-----Q-D------------------------------------------
W1QLM9_OGAPD/217-448WSRSSY---------F--...TP-----GS-----K-S------------------------------------------
C5DKG4_LACTC/102-336WNRVAY---------Y--D.ASS-----QT-----A-D------------------------------------------
J7R3E5_KAZNA/106-340WTRQAY---------Y--D.GSA-----QV-----G-E------------------------------------------
G0VBJ0_NAUCC/237-460WQRASY---------F--...TP-----GS-----T-S------------------------------------------
I2H8C5_TETBL/275-505WIRSSY---------F--...TP-----GS-----T-D------------------------------------------
Q75A62_ASHGO/259-490WKRVAH---------Y--...TP-----GS-----T-D------------------------------------------
E3RIT6_PYRTT/99-331WSRVAY---------Y--TSASP-----AK-----A-T------------------------------------------
B6JWV1_SCHJY/233-464WSRASY---------Y--E.ASS-----GT-----A-D------------------------------------------
A5DNR6_PICGU/97-330WDRKAY---------Y--N.GSS-----..-----S-S------------------------------------------
G8Y3C3_PICSO/237-463WERVAY---------Y--...TP-----GS-----T-D------------------------------------------
C5M9J2_CANTT/224-453WTRDSY---------Y--...TP-----GS-----T-D------------------------------------------
G3AKA2_SPAPN/103-336FTRLSF---------Y--D.SAE-----GT-----A-D------------------------------------------
G3ARF7_SPAPN/199-428WVRSSY---------Y--...TP-----GS-----A-D------------------------------------------
G3JJN7_CORMM/201-421WDRTSY---------Y--N.AET-----QQ-----A-E------------------------------------------
C7YIC0_NECH7/221-441WSRTSY---------Y--N.AEQ-----QA-----A-D------------------------------------------
Q0UV14_PHANO/96-328WNRVAY---------Y--TSASP-----AD-----A-T------------------------------------------
K0KM65_WICCF/142-376WTRQGY---------Y--D.GES-----QT-----S-E------------------------------------------
G1XB81_ARTOA/196-429WKRAGF---------Y--D.SGK-----QI-----L-E------------------------------------------
M1W9S2_CLAP2/235-455WDRVAY---------Y--N.AEK-----QI-----A-E------------------------------------------
Q6FJK5_CANGA/212-435WSRVAY---------F--...SP-----GT-----A-S------------------------------------------
R1ESJ6_BOTPV/247-467WKRISY---------Y--N.SEE-----KI-----H-E------------------------------------------
D0N6Y2_PHYIT/175-409WAKVSS---------Y--..ENG-----GA-----A-T------------------------------------------
C5DIE9_LACTC/221-452WNRVSY---------Y--...TP-----GS-----A-T------------------------------------------
G8BET5_CANPC/99-332WTRLSY---------Y--D.ASS-----GT-----A-D------------------------------------------
G8JQC7_ERECY/209-441WKRVSY---------Y--...TP-----GS-----T-D------------------------------------------
E3G0R9_STIAD/153-380WKRVSS---------W--N...R-----CA-----S-T------------------------------------------
C4R9F6_PICPG/189-423WSRSGY---------Y--...KP-----GS-----V-D------------------------------------------
L8G239_PSED2/205-429YTRSGY---------Y--D.AAS-----QT-----L-D------------------------------------------
A7TMJ4_VANPO/222-451WTRSSY---------F--...TP-----GS-----A-D------------------------------------------
C5DXY8_ZYGRC/256-484WSRSAY---------Y--...TP-----GS-----A-D------------------------------------------
G3B3K2_CANTC/207-428WERSAY---------Y--...SS-----GS-----A-D------------------------------------------
G0W356_NAUDC/104-338WSRNAY---------Y--D.ANA-----QT-----G-E------------------------------------------
Q7SG43_NEUCR/112-341YSRKGF---------Y--H.AQS-----QT-----A-E------------------------------------------
K3WLE5_PYTUL/196-423WIKVSA---------Y--SRAND-----NA-----M-Q------------------------------------------
S3DKR2_GLAL2/298-524YQRIGY---------Y--N.SAT-----QT-----L-K------------------------------------------
F2PH39_TRIEC/193-423WGRVAF---------L--S.TDS-----QD-----A-Q------------------------------------------
M2N8D8_BAUCO/220-449WSRDAY---------Y--D.SAS-----GS-----S-D------------------------------------------
Q6BRM6_DEBHA/197-423WERVAY---------Y--...TP-----GS-----T-D------------------------------------------
C5M5H0_CANTT/101-334WNRLSY---------Y--D.ASS-----GT-----S-D------------------------------------------
G8ZNQ8_TORDC/230-458WVRSSY---------F--...QP-----GS-----A-S------------------------------------------
D5GIX3_TUBMM/208-444FKRQAY---------Y--H.SGQ-----GV-----S-E------------------------------------------
A3LP10_PICST/207-435WVRSSY---------Y--...TP-----GS-----A-D------------------------------------------
R4XDU4_TAPDE/242-471WERTSY---------Y--N.AAA-----GV-----M-D------------------------------------------
A7TGR9_VANPO/102-336WTRNAY---------Y--D.SSS-----QT-----S-Q------------------------------------------
H3H0J0_PHYRM/316-553WSRVSS---------Y--S.RQD-----GT-----T-D------------------------------------------
Q757Z0_ASHGO/117-351WQRGAY---------F--D.AAS-----RT-----R-Q------------------------------------------
Q5AJN2_CANAL/226-456WTRDSY---------Y--...TP-----GS-----T-D------------------------------------------
M3D6U8_SPHMS/213-438WNRVGY---------Y--N.SQA-----KT-----S-D------------------------------------------
H3GMI5_PHYRM/341-578WSKVSA---------Y--..SQN-----GT-----Q-D------------------------------------------
I2H9Q2_TETBL/105-339WTRDSY---------Y--N.DAQ-----QT-----A-D------------------------------------------
G8ZYU9_TORDC/104-337WTRRAY---------Y--N.STS-----QT-----G-E------------------------------------------
S0DQ79_GIBF5/217-437WKRTSY---------Y--N.AQR-----RV-----A-D------------------------------------------
M4BGZ3_HYAAE/337-572WTRDSF---------Y--S.RKE-----GL-----V-E------------------------------------------
F9XBT5_MYCGM/245-464WARQAY---------Y--N.SEA-----GI-----A-A------------------------------------------
G8BXS9_TETPH/170-397WNQVAY---------F--...SP-----GS-----C-S------------------------------------------
H2AXG7_KAZAF/104-337WTRGAY---------Y--D.SES-----QT-----T-S------------------------------------------
U4LN65_PYROM/147-371MSRIGY---------Y--N.AGS-----KT-----S-Q------------------------------------------
J7RTK3_KAZNA/245-466WERTSY---------F--...TP-----GS-----T-S------------------------------------------
C5FXD0_ARTOC/196-427WGRVAH---------Y--N.SKD-----NE-----A-D------------------------------------------
Q6CGN1_YARLI/220-451WKRSAF---------Y--S.SSS-----GQ-----S-D------------------------------------------
G2WT64_VERDV/218-439YTRIAH---------Y--D.AEK-----GI-----A-D------------------------------------------
Q6FJ92_CANGA/109-343WNRSAF---------Y--D.ASA-----QT-----A-D------------------------------------------
G4U9Y4_NEUT9/21-245YERKGY---------Y--H.AAS-----QT-----S-E------------------------------------------
E4ZV72_LEPMJ/267-498WSRVAY---------Y--NSAAA-----AQ-----A-T------------------------------------------
G8BU49_TETPH/100-334WSRLAY---------Y--D.SAD-----QI-----S-Q------------------------------------------
W1QLK8_OGAPD/133-365WSRLAY---------Y--N.SDD-----LT-----A-E------------------------------------------
G8JX30_ERECY/121-347WERMAH---------Y--D.SST-----QK-----R-E------------------------------------------
Q6CXP7_KLULA/106-342WSREAY---------Y--D.STS-----QT-----A-E------------------------------------------
C4JID9_UNCRE/192-415WGRQGY---------Y--D.AEK-----GV-----A-D------------------------------------------
Q6CVS7_KLULA/216-447WNRVSY---------F--...TP-----GS-----A-Q------------------------------------------
H2AXG9_KAZAF/107-341WSRQAY---------Y--D.SSS-----QT-----G-E------------------------------------------
A7TQU3_VANPO/143-371WQQSSY---------F--...SP-----GV-----T-S------------------------------------------
K3XBG2_PYTUL/358-594FSRVSS---------Y--A.RDS-----GA-----T-E------------------------------------------
M7SLD2_EUTLA/204-432FERIAY---------Y--N.AAS-----RA-----A-N------------------------------------------
R7YJQ9_CONA1/229-450WSQVAY---------Y--E.ASS-----GT-----A-H------------------------------------------
H6BRJ0_EXODN/215-434WGRQAY---------Y--N.AEQ-----GV-----A-D------------------------------------------
K3X9Z2_PYTUL/110-344WNKVSS---------Y--..AKG-----GS-----A-N------------------------------------------
L2FRA0_COLGN/221-441YSRVAY---------Y--N.ADQ-----GV-----A-D------------------------------------------
Q7SG41_NEUCR/178-394ASRDHY---------Y--N.AAS-----QT-----S-Q------------------------------------------
A5DBA4_PICGU/200-428WERVSY---------Y--...TP-----GN-----A-D------------------------------------------
K2RHU7_MACPH/245-465WKRISY---------Y--N.AET-----KT-----R-E------------------------------------------
Q7SG42_NEUCR/163-390YNRIGE---------Y--H.AAT-----QT-----R-N------------------------------------------
YH6B_SCHPO/264-495WGRSSF---------Y--E.ADS-----GT-----S-D------------------------------------------
J8Q0R9_SACAR/105-339WSRSAY---------Y--N.SSS-----KT-----A-E------------------------------------------
K1XZI2_MARBU/332-545FKRVSY---------Y--N.AES-----QV-----A-D------------------------------------------
F0UMR1_AJEC8/199-421WARQGY---------Y--N.SAE-----GQ-----A-D------------------------------------------
I2H2C5_TETBL/110-343WTRGGY---------Y--N.SVS-----GL-----A-E------------------------------------------
E9EMJ7_METAR/226-457WDRVAY---------Y--N.AVK-----QV-----S-E------------------------------------------
G3AYC4_CANTC/101-337WERLAY---------Y--E.ASS-----QT-----A-D------------------------------------------
H2AVQ7_KAZAF/220-440WERVAY---------Y--...TP-----GS-----A-T------------------------------------------
E4UXS3_ARTGP/195-422WGRVAY---------Y--S.SES-----GE-----S-N------------------------------------------
U1HUX4_ENDPU/201-424WGRQAY---------Y--N.AEQ-----QM-----A-D------------------------------------------
A7F2W5_SCLS1/255-477YSRIGY---------Y--D.SAE-----QT-----L-D------------------------------------------
C4R2B9_PICPG/119-353WERLAY---------Y--N.SET-----QA-----A-E------------------------------------------
F2SIK0_TRIRC/197-428WGRVAY---------F--N.TDT-----KE-----A-E------------------------------------------
C4Y1A3_CLAL4/229-457WTRVSY---------Y--...TP-----GS-----A-D------------------------------------------

PF00840

K1WCU0_MARBU/20-452WRWLHS---------T..TGYTN.CYT.GN...T.W.DATLC...P.DGATC----------------------------
G3XZK9_ASPNA/20-448WRWTHS---------V..NDSTN.CYT.GN...T.W.DATLC...P.DDETC----------------------------
F4PY37_DICFS/22-455WRWVHS---------D..QG.TN.CYT.GN...T.W.NPTIC...P.DDISC----------------------------
G1XV93_ARTOA/22-459WRWLRN---------NEANKYNN.CYT.GN...S.F.DATLC...P.NNAAC----------------------------
L8WSW0_THACA/22-455WRWLHT---------T..SGYTN.CYT.GQ...S.W.DSTLC...S.DPVKC----------------------------
G2QZA7_THITE/22-417ARSLHK---------V..GDPNTSCSVGGD..........LC...S.DAKSC----------------------------
E4ZFU3_LEPMJ/20-452WRWLHV---------K..GGYTN.CYT.GN...E.W.NATAC...P.DNKSC----------------------------
M2UA27_COCH5/21-452WRWAHN---------V..GGYTN.CYT.GN...T.W.STEYC...P.DGDSC----------------------------
E3L6D5_PUCGT/29-447IRPLQV---------L..QGMES.CITDEE...KAW.DRRYC...A.DSERC----------------------------
S3D4J2_GLAL2/21-452WRWLHD---------KTANSYTN.CYT.GN...T.W.DSTLC...P.DNKKC----------------------------
I1FU52_AMPQE/20-456WRWTHI---------V..SGTQN.CYT.GN...K.W.DTSLC...P.DGVTC----------------------------
B6QIG2_PENMQ/28-458WRWVHS---------V..NSSTN.CYT.GN...T.W.NTNIC...D.TDASC----------------------------
G2WXB9_VERDV/20-447WRWVHA---------V..GGYEN.CYD.GN...D.W..TGLC...T.GADDC----------------------------
Q7S390_NEUCR/20-440YRWVH.---------...TDDYTNCKVNGL.......NPAVC...P.DVETC----------------------------
V2WZE7_MONRO/22-456WRWLHS---------T..SGFTN.CYT.GN...T.W.DASLC...P.DNTAC----------------------------
A7EUL3_SCLS1/19-449WRWTHS---------T..TSSTN.CYT.GN...T.W.DATLC...P.DDATC----------------------------
S3CP84_GLAL2/21-459WRWIHE---------K..NSYTT.CFEDGHWLEKGYPNKTLC...P.DDATC----------------------------
N4UZJ1_COLOR/19-440WRWLHD---------S..S.GAN.CYD.GN...K.W..TNKC...S.TAADC----------------------------
G7XKW4_ASPKW/24-460WRWVHS---------T..SSSTN.CYT.GN...E.W.DTSIC...T.DDVTC----------------------------
F7W7F9_SORMK/30-440HRAFHN---------T..AGKIIECS.......A.A.NKTLC...P.DEATC----------------------------
G2YS63_BOTF4/20-452WRWLHS---------T..TGSTN.CYT.GN...T.W.DKTLC...P.DGATC----------------------------
E3K8B1_PUCGT/22-457WRWTHD---------KDQEGQK..CYD.GS...A.W..TQAC...SGTGEEC----------------------------
Q55FE6_DICDI/22-455WRWVHS---------A..QG.QN.CYT.GN...T.W.NPTIC...P.DDETC----------------------------
M2N728_BAUCO/20-450WRWLHS---------T..TGSTN.CYN.GN...T.W.DATLC...P.DPVTC----------------------------
R8BSD2_TOGMI/20-444WRWLHG---------T..SDTNN.CYD.GN...K.W..TSAC...S.TATDC----------------------------
G2Q359_THIHA/20-453WRWTHV---------T..DGYTN.CYT.GN...A.W.NETAC...P.DGVTC----------------------------
G4V088_NEUT9/21-421QRPLHK---------I..GDPSTACTVGGP..........LC...P.DAATC----------------------------
B2AQ71_PODAN/25-431SRHFHS---------V..SDPSVSCASVDF...L.S.NPSLCD.PD.DPASC----------------------------
S7ZRD6_PENO1/28-461WRWVHD---------K..NG.KN.CYT.GN...T.W.DATLC...P.DDKTC----------------------------
CBHB_ASPFU/29-463WRWVHK---------V..GDYTN.CYT.GN...T.W.DTTIC...P.DDATC----------------------------
U4LWF8_PYROM/21-452WRWLHS---------K..SGSNN.CYT.GN...T.W.DTSLC...P.SNSAC----------------------------
F7W4B0_SORMK/24-424QRPLHK---------I..GDPSTPCIVGGP..........LC...P.DAETC----------------------------
G2WQW0_VERDV/20-447WRWAHN---------V..GGYEN.CFD.GN...D.W..TGLC...T.GAEDC----------------------------
B2A8V6_PODAN/19-451WRWTHI---------T..NGYTN.CYT.GN...E.W.NATAC...P.DGATC----------------------------
R8BMF8_TOGMI/19-453WRWTHV---------T..DGYTN.CYT.GN...K.W.NATAC...P.DGKTC----------------------------
L2FC27_COLGN/19-441YRWIHV---------V..DDWHS.CFE.RQ...E.W.QTDYC...N.STQSC----------------------------
H1W5V0_COLHI/19-443WRWIHE---------V..GGYRN.CYE.GN...S.W..TGLC...S.GADDC----------------------------
M4GCD6_MAGP6/30-424AHPLSQ---------R..DNPSRNCGDWGQ...A.A.NSTVC...P.DLATC----------------------------
M2QWB1_CERS8/85-519WRWLHT---------T..TGYTN.CYT.GN...E.W.DTSIC...P.DPTTC----------------------------
D8QBJ3_SCHCM/21-453WRWLHT---------V..EGYDN.CYT.GN...E.W.DESVC...T.DGATC----------------------------
E3KSU8_PUCGT/22-454WRWAYN---------V..DTKKN.CYT.GN...L.W.SNQFC...P.DGDAC----------------------------
U4L139_PYROM/20-454WRWLHN---------N..GGSTN.CYT.GN...A.W.DSTLC...P.DPTTC----------------------------
S3CAD2_OPHP1/20-451YRWIHT---------V..GGYQ.NCNGADG...N.SLDKTLC...P.DAATC----------------------------
G0S477_CHATD/21-451WRWTHT---------V..SGSTN.CYT.GN...E.W.DTSIC...S.DGKSC----------------------------
C7ZHP8_NECH7/23-415QHPIHQ---------A...TNNLSCGNWGE...K.P.NSTVC...P.DAASC----------------------------
R0K7Q4_SETT2/24-451WRWLHS---------V..GGYTN.CYE.GN...Q.W.NTTAC...P.SNSAC----------------------------
M4BUX1_HYAAE/30-470WRWLHK---------D..GGTTN.CYT.GN...T.W.DKTLC...P.DPKTC----------------------------
G2WZP1_VERDV/20-456WRWTHT---------V..SGSTN.CYD.GN...K.W.TAS.C..GT.DGTTC----------------------------
N4UQR7_COLOR/21-445FRWIHV---------V..DDHRS.CFE.RQ...E.W.QTDQC...N.STQSC----------------------------
U7Q8V8_SPOS1/21-424SRALHA---------V..GQPSVACD.......V.A.NKTQC...P.DATTC----------------------------
J3Q1X0_PUCT1/27-447WRAVKD---------S..ASGRKDCLN.GNGTKG.W.DKTLC...P.DPETC----------------------------
M4G9M2_MAGP6/27-444NHNMYW---------D..GDKKKTCESAFN.......TTSECAFNG.DATAC----------------------------
B6HC69_PENCW/20-452WRWLHS---------V..DGSTN.CYT.GN...E.W.DATLC...P.DDKTC----------------------------
Q2GUM4_CHAGB/23-447WRWLHN---------A..D.SKN.CYD.GN...E.W..TDAC...T.SSDDC----------------------------
U7PKV6_SPOS1/26-451WRWVHD---------K..GGYTN.CYT.DN...N.W.NTTAC...A.DATSC----------------------------
K1WM38_MARBU/21-461WRWLHS---------S..TG.TN.CYT.GN...T.W.NAALC...P.NGTAC----------------------------
G0RVK1_HYPJQ/20-446WRWTHA---------T..NSSTN.CYD.GN...T.W.SSTLC...P.DNETC----------------------------
H3G8U1_PHYRM/34-471WRWLHQ---------V..GDYKN.CYN.GN...Q.W.DSTLC...S.TPEAC----------------------------
M7SVI4_EUTLA/21-454WRWAHA---------V..GGYTN.CYD.GN...A.W.NETAC...P.DGATC----------------------------
M4FNF9_MAGP6/20-447WRWVHD---------T..GGYTN.CYE.GN...S.W.NTEIC...S.TNADC----------------------------
R8BQZ2_TOGMI/20-451WRWVHD---------K..GGYTN.CYT.GN...K.W.NETIC...K.DSKTC----------------------------
S3D235_GLAL2/20-454WRWLHS---------S..AGSTN.CYT.GN...T.W.DKTLC...P.NDATC----------------------------
F0XKB1_GROCL/20-444WRWLHK---------T..GSSTN.CYT.GN...T.W.DKSIC...P.DSKTC----------------------------
C7YH34_NECH7/20-451WRWTHS---------T..SSSTN.CYT.GN...T.W.DKTLC...P.DGKTC----------------------------
F9FPS1_FUSOF/20-451WRWTHQ---------T..SGSTN.CYT.GN...K.W.DTSIC...P.DGKTC----------------------------
CBHA_EMENI/20-446WRWTHS---------V..DGYTN.CYT.GN...E.W.DATLC...P.DNESC----------------------------
F4RKA2_MELLP/26-456YRKFHS---------K..EDPSKPCLV.KG...S.W.DPELC...P.NEVEC----------------------------
J3Q4E0_PUCT1/22-425WRWAFS---------T..ESKQN.CYT.GN...T.W.DPKLC...P.TGEDC----------------------------
G4N143_MAGO7/22-445WRWLHD---------A..S.SKN.CYD.GN...R.W..TDSC...R.TASDC----------------------------
E3JU73_PUCGT/29-437WRSVKD---------L..SGRRD.CFN.GT...A.W.DKSLC...P.DPETC----------------------------
L8WJB0_THACA/84-513WRWVHT---------T..TGYTN.CYT.GQ...K.W.DTSIC...T.DAVTC----------------------------
M7TJ66_BOTF1/21-446WRWLHS---------T..SGSTN.CYT.GN...T.W.DTTLC...P.DAATC----------------------------
F4S1M9_MELLP/23-458WRWFHA---------A..NGTQN.CYK.GQ...D.W.DPTLC...K.TGAEC----------------------------
M5BZ75_THACB/20-450WRWVHT---------T..SGYTN.CYT.GN...T.W.DSTLC...P.DPTTC----------------------------
CELB_ASPFN/20-414THFIHK---------K...GTQTSCTNSNG...L...DTAIC...P.DKQTC----------------------------
K5WYE3_AGABU/21-450WRWTHR---------V..NDFTN.CYT.GN...E.W.DTSIC...P.DGATC----------------------------
F4RTE7_MELLP/22-447WRPVHA---------V..NSTKK.CLSDGG...V.W.DPELC...P.DGLTC----------------------------
N1PY93_MYCP1/21-450WRWTHT---------V..DGSTN.CYT.GN...E.W.DASIC...S.SPSVC----------------------------
F0ZJZ1_DICPU/21-454WRWVHS---------E..QG.TN.CYT.GN...T.W.NPTLC...P.DDKTC----------------------------
G4NI68_MAGO7/22-416AHHVFQ---------P..AAPSYGCGGWGE...A.A.NATAC...P.TKEAC----------------------------
H1VQX8_COLHI/20-456WRWTHT---------I..QGSTN.CYT.GN...T.W.NNDYC..AAGQGANC----------------------------
M2SZK0_COCSN/20-452WRWLHT---------K..EGYTN.CYT.GN...T.W.DTKYC...P.DNKSC----------------------------
D0N841_PHYIT/25-462WRWLYK---------E..GTSTN.CYT.GN...K.W.DTSIC...S.DPKTC----------------------------
A8NU36_COPC7/21-457WRWLHV---------T..DGYTN.CYT.GN...A.W.NSSVC...S.DGATC----------------------------
L2FY65_COLGN/20-452WRWTHQ---------T..SGSTN.CYT.GN...K.W.DTSIC...S.TGEDC----------------------------
G4MMG0_MAGO7/20-450WRWTHT---------T..SGYTN.CYT.GN...K.W.DTSIC...S.TNADC----------------------------
I1RVH7_GIBZE/22-419LHGISQ---------A....NGQSCGNWGE...A.A.NSTAC...P.DEATC----------------------------
H3GA97_PHYRM/27-460WRTMNA---------V...GTNNSCNA.DS...K.W.NSTTC...S.SPKEC----------------------------
M3ARV6_MYCFI/20-450WRWTHT---------V..DGSTN.CYT.GN...E.W.DTSIC...T.SPSVC----------------------------
S8A7U8_DACHA/23-453WRWVHN---------N..DGYTN.CYT.GN...T.W.NSEYC...P.DNVSC----------------------------
F4RKA1_MELLP/25-454YREVHS---------R..KDPKKLCLK.DK...R.W.DSRLC...S.NQDEC----------------------------
R1GZN3_BOTPV/19-452WRWVHN---------V..DGYTN.CYT.GN...T.W.NADYC...S.DNEAC----------------------------
S3DFW5_GLAL2/20-452WRWLHN---------K..VGYTN.CYT.GN...E.F.NSTIC...T.SGKTC----------------------------
G4TMW4_PIRID/20-450WRWLHT---------T..SGYTN.CYT.GN...S.W.DTSLC...P.DPTTC----------------------------
CBHA_ASPFU/20-450WRWLHS---------T..KDTTN.CYT.GN...T.W.NTELC...P.DNESC----------------------------
U7Q430_SPOS1/20-452WRWLHD---------K..GGYTN.CYT.GN...E.W.NTTVC...K.DAKSC----------------------------
E9G5J5_DAPPU/22-463WRWAHT---------T..TGYTN.CYT.GN...L.W.DTTLC...P.TPETC----------------------------
F4S1M8_MELLP/21-456WRWLHA---------A..NGTNN.CYT.GQ...T.W.DKTLC...S.DPEKC----------------------------
F4S1N8_MELLP/22-461WRWLRK---------IPGDGMKN.CYT.GQ...T.W.DTEVC...A.DGAKC----------------------------
S7ZJL3_PENO1/20-451WRWVHS---------V..DGYKN.CYT.GN...E.W.DSTLC...P.DDATC----------------------------
K5ULV7_PHACS/21-445WRWLHD---------V..TGYTN.CYT.GN...E.W.DATLC...P.DGTTC----------------------------
N4V9B4_COLOR/24-453WRWLHD---------K..NGYTN.CYT.GN...Q.W.NETIC...S.DGKKC----------------------------
G2QNN8_THIHA/23-447WRWVHD---------E..N.AQN.CYD.GN...Q.W..TNAC...S.SATDC----------------------------
R1EEG3_BOTPV/22-455WRWLHT---------T..EGYTN.CYT.GQ...E.W.DTSIC...S.DPTTC----------------------------
M4BJM4_HYAAE/27-464WRWLHQ---------V..GDSKS.CYS.GN...Q.W.DPTLC...S.SPKAC----------------------------
E3K8C2_PUCGT/23-457WRATYV---------MNQD.QKNYCND.GG...S.W..TSVC...SGSGEEC----------------------------
K3X3U7_PYTUL/24-462WRWTHK---------V..GDYTN.CYT.GN...K.W.DSALC...A.DPATC----------------------------
F9XAF9_MYCGM/21-444WRWLHT---------T..TGYTN.CYT.GN...T.W.DKSIC...T.SSAVC----------------------------
L2FAS8_COLGN/19-444WRWAHN---------V..GGYEN.CYD.GN...Q.W..TDKC...S.GPDDC----------------------------
K5WIZ5_PHACS/21-445WRWLHS---------T..TGYTN.CYT.GN...E.W.DATLC...P.DGATC----------------------------
S8AFI7_DACHA/25-419IHPIYQ---------K..SHPSLGCGDWGS...A.P.NSTVC...P.DAKTC----------------------------
E3QH29_COLGM/20-451WRWTHK---------T..TDSTN.CYT.GN...K.W.DTSIC..SS.TGEDC----------------------------
M1WAR4_CLAP2/22-453WRWTHR---------V..DGSQN.CYT.GN...R.W.DTSIC...S.SEKTC----------------------------
B2ACE0_PODAN/21-453WRWTHT---------L..QGSTN.CYS.GN...E.W.DTSIC...T.TGTKC----------------------------
H3G7U3_PHYRM/13-452WRWLYK---------T..GTSTN.CYT.GN...E.W.DETIC...P.DPKTC----------------------------
G4NIA4_MAGO7/20-446WRWIHN---------I..GGYEN.CYS.GN...K.W..TSVC...S.TNADC----------------------------
G4ULV4_NEUT9/157-586WRWTHI---------T..SGSTN.CYS.GN...E.W.DTSLC...S.TNTDC----------------------------
F9FY42_FUSOF/22-415IHGIHQ---------K....NGAGCGDWGQ...K.P.NATAC...P.DEASC----------------------------
B2ASX1_PODAN/25-450WRWIHT---------S..G.GTN.CYD.GN...A.W.NTAAC...S.TATDC----------------------------
C7ZHU8_NECH7/20-451WRWTHT---------V..EGSTN.CYT.GN...K.W.DTSIC...P.DGKTC----------------------------
D8PLS5_SCHCM/21-454WRWTHI---------T..NGSDN.CYD.GN...E.W.DTSVC...S.DPTEC----------------------------
S8AA61_DACHA/19-434YRWHHV---------K..GGYD.PCVNNGV...F...NAATC...Q.KADDC----------------------------
CBHB_EMENI/26-460WRWLHT---------V..NGYTN.CYT.GN...E.W.DTSIC...T.SNEVC----------------------------
N4V9A4_COLOR/19-434FRFTHL---------A..NSAAS.CFF.NN...R.W.T...C...G.SAEAC----------------------------
B8NIG8_ASPFN/28-463WRWVHQ---------T..GSSSN.CYT.GN...K.W.DTSYC...S.TNDAC----------------------------
G1XLC3_ARTOA/25-418THPIYQ---------K..ANPSLGCGDWGN...A.P.NATVC...P.NEKDC----------------------------
CELB_EMENI/21-427THPIHD---------A..SNPSVSCTTSNG...L...NPALC...P.DKQTC----------------------------
G2QZD9_THITE/20-450WRWTHQ---------V..SSSTN.CYT.GN...E.W.DTSIC...T.DGASC----------------------------
G0RYS9_CHATD/25-449WRWLHD---------S..N.YQN.CYD.GN...R.W..TSAC...S.SATDC----------------------------

PF00139

I1J0Z7_BRADI/24-270------------------------------------------------------------------------------F.
M0UWM0_HORVD/54-310------------------------------------------------------------------------------F.
K3YQI1_SETIT/31-293------------------------------------------------------------------------------LT
D7MX72_ARALL/27-278------------------------------------------------------------------------------K.
I1QF95_ORYGL/9-257------------------------------------------------------------------------------I.
B9SDJ5_RICCO/21-269------------------------------------------------------------------------------Y.
M4EIG5_BRARP/19-266------------------------------------------------------------------------------Y.
I1KL69_SOYBN/32-282------------------------------------------------------------------------------F.
I1GT36_BRADI/22-278------------------------------------------------------------------------------L.
M4DR71_BRARP/23-281------------------------------------------------------------------------------FI
K7UKG6_MAIZE/22-274------------------------------------------------------------------------------L.
C5Z960_SORBI/22-274------------------------------------------------------------------------------L.
J3MID1_ORYBR/697-950------------------------------------------------------------------------------L.
C5YGS5_SORBI/740-993------------------------------------------------------------------------------L.
F6HBM8_VITVI/38-285------------------------------------------------------------------------------F.
M0ZZ78_SOLTU/22-275------------------------------------------------------------------------------Y.
J3MID6_ORYBR/47-299------------------------------------------------------------------------------T.
I1KL68_SOYBN/57-300------------------------------------------------------------------------------F.
B9S3F5_RICCO/21-271------------------------------------------------------------------------------L.
B9SXJ7_RICCO/26-271------------------------------------------------------------------------------F.
M0VXQ0_HORVD/20-275------------------------------------------------------------------------------V.
I1GT33_BRADI/25-286------------------------------------------------------------------------------L.
B9SXJ9_RICCO/25-271------------------------------------------------------------------------------..
M7ZXG6_TRIUA/26-279------------------------------------------------------------------------------L.
B9SDJ4_RICCO/29-277------------------------------------------------------------------------------Y.
B9RKX4_RICCO/32-295------------------------------------------------------------------------------F.
J3MID3_ORYBR/25-284------------------------------------------------------------------------------L.
A9STE4_PHYPA/28-284------------------------------------------------------------------------------..
K7LD59_SOYBN/26-276------------------------------------------------------------------------------L.
F6HW43_VITVI/37-287------------------------------------------------------------------------------F.
B9SPG3_RICCO/28-274------------------------------------------------------------------------------Y.
I1I8J5_BRADI/41-316------------------------------------------------------------------------------V.
C5WQT3_SORBI/3-256------------------------------------------------------------------------------L.
M7Z7K8_TRIUA/24-276------------------------------------------------------------------------------L.
M7Z873_TRIUA/26-278------------------------------------------------------------------------------L.
I1Q9S6_ORYGL/27-278------------------------------------------------------------------------------M.
B9RX67_RICCO/38-289------------------------------------------------------------------------------Y.
Q7XZX1_ORYSJ/59-312------------------------------------------------------------------------------L.
I1H3V1_BRADI/27-275------------------------------------------------------------------------------V.
C5YTD3_SORBI/42-297------------------------------------------------------------------------------F.
C5WZ65_SORBI/40-297------------------------------------------------------------------------------V.
F6HWD4_VITVI/48-292------------------------------------------------------------------------------Y.
M4C9K1_BRARP/30-282------------------------------------------------------------------------------V.
D7L7Q8_ARALL/26-272------------------------------------------------------------------------------F.
I1LMH1_SOYBN/27-284------------------------------------------------------------------------------L.
I1Q7T2_ORYGL/56-310------------------------------------------------------------------------------V.
K7UIK5_MAIZE/47-318------------------------------------------------------------------------------F.
B9S3F7_RICCO/27-283------------------------------------------------------------------------------L.
Q6Z8M4_ORYSJ/40-308------------------------------------------------------------------------------V.
M4F2M7_BRARP/21-273------------------------------------------------------------------------------I.
M0Y8Y9_HORVD/24-281------------------------------------------------------------------------------L.
B9RX81_RICCO/37-286------------------------------------------------------------------------------..
Q7XUC7_ORYSJ/28-274------------------------------------------------------------------------------F.
Q6K8L8_ORYSJ/26-289------------------------------------------------------------------------------L.
I1L3I1_SOYBN/35-302------------------------------------------------------------------------------L.
M4EJC2_BRARP/29-277------------------------------------------------------------------------------F.
F6HWD7_VITVI/37-289------------------------------------------------------------------------------F.
F6HW36_VITVI/35-286------------------------------------------------------------------------------F.
M1DPR0_SOLTU/22-264------------------------------------------------------------------------------Y.
K4D2U1_SOLLC/29-283------------------------------------------------------------------------------T.
I1H2L8_BRADI/27-276------------------------------------------------------------------------------F.
C5XCD6_SORBI/32-291------------------------------------------------------------------------------LN
K3Y5L7_SETIT/33-273------------------------------------------------------------------------------F.
M1BJQ2_SOLTU/21-281------------------------------------------------------------------------------L.
I1LM84_SOYBN/28-267------------------------------------------------------------------------------L.
M4CN93_BRARP/29-292------------------------------------------------------------------------------I.
Q8H4J3_ORYSJ/28-282------------------------------------------------------------------------------V.
B9RX64_RICCO/27-280------------------------------------------------------------------------------T.
J3MPZ5_ORYBR/33-302------------------------------------------------------------------------------L.
Q84ZH8_ORYSJ/24-276------------------------------------------------------------------------------L.
M0YJP2_HORVD/48-317------------------------------------------------------------------------------V.
K3Y3M9_SETIT/30-282------------------------------------------------------------------------------M.
F6HL81_VITVI/33-286------------------------------------------------------------------------------L.
LRK61_ARATH/33-294------------------------------------------------------------------------------T.
B9T8H0_RICCO/20-272------------------------------------------------------------------------------L.
M1AHJ3_SOLTU/28-281------------------------------------------------------------------------------R.
M7YY54_TRIUA/30-272------------------------------------------------------------------------------F.
M4CLT1_BRARP/22-275------------------------------------------------------------------------------L.
B9SML1_RICCO/44-289------------------------------------------------------------------------------Y.
M4DP68_BRARP/19-264------------------------------------------------------------------------------Y.
Q0D8S6_ORYSJ/77-329------------------------------------------------------------------------------V.
M8A5Y7_TRIUA/53-300------------------------------------------------------------------------------F.
C5Z959_SORBI/30-282------------------------------------------------------------------------------L.
LRKS1_ARATH/29-288------------------------------------------------------------------------------L.
M4ESL4_BRARP/22-290------------------------------------------------------------------------------FL
B9SKY8_RICCO/25-281------------------------------------------------------------------------------L.
M4FFA7_BRARP/24-263------------------------------------------------------------------------------L.
J3LWI6_ORYBR/44-294------------------------------------------------------------------------------F.
K7L999_SOYBN/59-308------------------------------------------------------------------------------F.
M7YCL0_TRIUA/32-284------------------------------------------------------------------------------L.
D7MR66_ARALL/26-282------------------------------------------------------------------------------L.
J3MPZ8_ORYBR/32-293------------------------------------------------------------------------------R.
F6GUY7_VITVI/27-280------------------------------------------------------------------------------L.
B9HG10_POPTR/32-282------------------------------------------------------------------------------F.
B9GZH8_POPTR/30-270------------------------------------------------------------------------------Y.
B9HCZ3_POPTR/23-280------------------------------------------------------------------------------L.
I1JFJ9_SOYBN/45-285------------------------------------------------------------------------------L.
I1MX65_SOYBN/42-290------------------------------------------------------------------------------Y.
M7Y9L8_TRIUA/34-283------------------------------------------------------------------------------L.
Q652V6_ORYSJ/38-298------------------------------------------------------------------------------L.
Q6ZFB7_ORYSJ/37-281------------------------------------------------------------------------------L.
Q6ZIQ8_ORYSJ/39-305------------------------------------------------------------------------------F.
Q6ZLL9_ORYSJ/30-291------------------------------------------------------------------------------L.
Q7XUN6_ORYSJ/30-280------------------------------------------------------------------------------F.
Q84ZI0_ORYSJ/31-304------------------------------------------------------------------------------L.
U5G5V7_POPTR/26-278------------------------------------------------------------------------------L.
W5AMW1_WHEAT/26-276------------------------------------------------------------------------------V.
W5AND9_WHEAT/35-289------------------------------------------------------------------------------L.
W5GWA8_WHEAT/27-281------------------------------------------------------------------------------V.
W5H3F4_WHEAT/32-280------------------------------------------------------------------------------L.

PF03388

YQF8_SCHPO/24-250------------------------------------------------------------------------------W-
YOC5_SCHPO/23-229------------------------------------------------------------------------------W-
EMP47_YEAST/36-253------------------------------------------------------------------------------W-
LMAN1_HUMAN/44-269------------------------------------------------------------------------------W-
Q9V3A8_DROME/33-259------------------------------------------------------------------------------W-
Q9VCC2_DROME/33-258------------------------------------------------------------------------------W-
LMAN2_CANFA/52-278------------------------------------------------------------------------------W-
Q22170_CAEEL/43-272------------------------------------------------------------------------------W-

PF02210

CNTP4_HUMAN/821-940------------------------------------------------------------------------------F-
Q9VZ96_DROME/275-414------------------------------------------------------------------------------F-
Q9VZ96_DROME/514-640------------------------------------------------------------------------------F-
Q9VZ96_DROME/698-817------------------------------------------------------------------------------F-
Q9VZ96_DROME/1351-1503------------------------------------------------------------------------------L-
EYS_HUMAN/3007-3141------------------------------------------------------------------------------F-
Q7PH68_ANOGA/3924-4055------------------------------------------------------------------------------F-
Q7PSM9_ANOGA/688-822------------------------------------------------------------------------------F-
Q7PSM9_ANOGA/919-1050------------------------------------------------------------------------------F-
Q7PSM9_ANOGA/1115-1244------------------------------------------------------------------------------F-
CELR1_MOUSE/1734-1864------------------------------------------------------------------------------F-
CNTP1_MOUSE/390-516------------------------------------------------------------------------------F-
Q18291_CAEEL/303-430------------------------------------------------------------------------------F-
Q18291_CAEEL/495-627------------------------------------------------------------------------------F-
Q18291_CAEEL/722-843------------------------------------------------------------------------------F-
Q18291_CAEEL/906-1035------------------------------------------------------------------------------F-
Q18291_CAEEL/1129-1266------------------------------------------------------------------------------F-
LAMA5_MOUSE/2974-3103------------------------------------------------------------------------------L-
LAMA5_MOUSE/3367-3497------------------------------------------------------------------------------V-
LAMA5_MOUSE/3547-3670------------------------------------------------------------------------------M-
NRX3A_MOUSE/475-619------------------------------------------------------------------------------F-
NRX3A_HUMAN/287-413------------------------------------------------------------------------------F-
CNTP4_MOUSE/400-526------------------------------------------------------------------------------F-
CNTP4_MOUSE/1048-1178------------------------------------------------------------------------------F-
CRUM1_MOUSE/513-650------------------------------------------------------------------------------F-
PGBM_HUMAN/4234-4364------------------------------------------------------------------------------V-
LAMA5_HUMAN/2970-3099------------------------------------------------------------------------------L-
LAMA5_HUMAN/3370-3499------------------------------------------------------------------------------V-
LAMA5_HUMAN/3549-3673------------------------------------------------------------------------------V-
FAT1_HUMAN/3859-3985------------------------------------------------------------------------------L-
Q9VJ82_DROME/55-178------------------------------------------------------------------------------F-
Q9VJ82_DROME/238-367------------------------------------------------------------------------------F-
LAMA4_HUMAN/1079-1210------------------------------------------------------------------------------V-
LAMA4_HUMAN/1499-1626------------------------------------------------------------------------------L-
CADH4_CAEEL/3750-3871------------------------------------------------------------------------------L-
CSPG4_HUMAN/55-178------------------------------------------------------------------------------F-
CSPG4_HUMAN/230-363------------------------------------------------------------------------------L-
FAT2_HUMAN/3800-3921------------------------------------------------------------------------------L-
LAMA3_HUMAN/3186-3311------------------------------------------------------------------------------I-
CTP5B_MOUSE/1031-1159------------------------------------------------------------------------------F-
Q8IQH0_DROME/220-342------------------------------------------------------------------------------F-
Q8IQH0_DROME/1032-1156------------------------------------------------------------------------------F-
EYS_DROME/1723-1856------------------------------------------------------------------------------L-
FAT3_HUMAN/3865-3994------------------------------------------------------------------------------L-
CNTP5_HUMAN/819-938------------------------------------------------------------------------------F-
CNTP3_HUMAN/1046-1176------------------------------------------------------------------------------F-
NRX3B_HUMAN/117-236------------------------------------------------------------------------------F-
CELR3_HUMAN/1793-1924------------------------------------------------------------------------------F-
STAN_DROME/1584-1736------------------------------------------------------------------------------F-
STAN_DROME/1826-1946------------------------------------------------------------------------------L-
NRX3A_HUMAN/55-184------------------------------------------------------------------------------F-
NRX3A_HUMAN/899-1027------------------------------------------------------------------------------F-
Q7PQ15_ANOGA/414-542------------------------------------------------------------------------------F-
Q7PQ15_ANOGA/635-761------------------------------------------------------------------------------I-
Q7PQ15_ANOGA/1195-1324------------------------------------------------------------------------------F-
Q7PT06_ANOGA/181-303------------------------------------------------------------------------------F-
Q7PT06_ANOGA/786-905------------------------------------------------------------------------------F-
Q7PT06_ANOGA/994-1118------------------------------------------------------------------------------F-
Q7PT75_ANOGA/1039-1184------------------------------------------------------------------------------L-
Q7Q1N4_ANOGA/1163-1293------------------------------------------------------------------------------F-
Q7Q3I9_ANOGA/259-395------------------------------------------------------------------------------I-
Q7Q3I9_ANOGA/602-734------------------------------------------------------------------------------V-
Q7Q3I9_ANOGA/875-1043------------------------------------------------------------------------------I-
Q7Q5D1_ANOGA/428-553------------------------------------------------------------------------------F-
Q7Q5D1_ANOGA/1025-1153------------------------------------------------------------------------------F-
Q7Q5D1_ANOGA/1257-1408------------------------------------------------------------------------------L-
Q7Q4H3_ANOGA/211-342------------------------------------------------------------------------------F-
EGFLA_MOUSE/641-767------------------------------------------------------------------------------F-
EGFLA_HUMAN/868-996------------------------------------------------------------------------------F-
Q19617_CAEEL/154-276------------------------------------------------------------------------------F-
NRX2A_RAT/949-1077------------------------------------------------------------------------------F-
Q7PPF9_ANOGA/3556-3683------------------------------------------------------------------------------I-
Q7Q1M9_ANOGA/1015-1178------------------------------------------------------------------------------I-
O45000_CAEEL/275-401------------------------------------------------------------------------------F-
Q22574_CAEEL/136-267------------------------------------------------------------------------------F-
Q22574_CAEEL/415-539------------------------------------------------------------------------------F-
NRX1A_MOUSE/753-884------------------------------------------------------------------------------F-
CADN_DROME/2407-2568------------------------------------------------------------------------------F-
CADN_DROME/2661-2796------------------------------------------------------------------------------F-
FAT2_RAT/3802-3923------------------------------------------------------------------------------L-
CELR3_RAT/1534-1693------------------------------------------------------------------------------F-
SLIT2_HUMAN/1188-1316------------------------------------------------------------------------------I-
CRB_DROME/1585-1722------------------------------------------------------------------------------F-
CNTP1_HUMAN/203-332------------------------------------------------------------------------------F-
CNTP1_HUMAN/813-939------------------------------------------------------------------------------F-
CRUM1_HUMAN/514-651------------------------------------------------------------------------------F-
CRUM1_HUMAN/743-860------------------------------------------------------------------------------V-
CRUM1_HUMAN/980-1105------------------------------------------------------------------------------F-
CNTP1_RAT/1089-1219------------------------------------------------------------------------------F-
LAMA4_MOUSE/1258-1374------------------------------------------------------------------------------F-
PROS_RABIT/485-617------------------------------------------------------------------------------I-
LAMA_DROME/2704-2846------------------------------------------------------------------------------F-
LAMA_DROME/2905-3031------------------------------------------------------------------------------F-
LAMA_DROME/3083-3205------------------------------------------------------------------------------F-
LAMA_DROME/3379-3514------------------------------------------------------------------------------F-
LAMA_DROME/3563-3691------------------------------------------------------------------------------F-
Q19350_CAEEL/789-914------------------------------------------------------------------------------M-
CADE_DROME/1153-1296------------------------------------------------------------------------------I-
NRX1A_BOVIN/58-192------------------------------------------------------------------------------L-
GAS6_MOUSE/322-450------------------------------------------------------------------------------F-
NRX2A_RAT/57-187------------------------------------------------------------------------------L-
NRX2B_RAT/119-268------------------------------------------------------------------------------F-
COBA2_MOUSE/90-213------------------------------------------------------------------------------V-
Q7PPF9_ANOGA/2700-2843------------------------------------------------------------------------------F-
Q7PPF9_ANOGA/2902-3028------------------------------------------------------------------------------F-
Q7PPF9_ANOGA/3080-3203------------------------------------------------------------------------------F-
Q7PPU8_ANOGA/1604-1755------------------------------------------------------------------------------F-
Q7PPU8_ANOGA/1846-1967------------------------------------------------------------------------------L-
Q8IP51_DROME/2616-2755------------------------------------------------------------------------------F-
Q8IP51_DROME/2804-2944------------------------------------------------------------------------------F-
Q8MPN3_DROME/3548-3676------------------------------------------------------------------------------F-
Q8MPN3_DROME/4059-4188------------------------------------------------------------------------------F-
CNTP5_HUMAN/209-338------------------------------------------------------------------------------F-
CNTP5_HUMAN/395-521------------------------------------------------------------------------------F-
CNTP5_HUMAN/1044-1173------------------------------------------------------------------------------F-
NRX4_DROME/824-943------------------------------------------------------------------------------F-
HMR1_CAEEL/2312-2461------------------------------------------------------------------------------F-
NRX1A_CHICK/364-508------------------------------------------------------------------------------F-
NRX1A_CHICK/789-917------------------------------------------------------------------------------F-
CELR2_HUMAN/1395-1554------------------------------------------------------------------------------F-
CELR1_HUMAN/1470-1629------------------------------------------------------------------------------F-
CELR1_HUMAN/1719-1849------------------------------------------------------------------------------F-
NRX2A_HUMAN/521-666------------------------------------------------------------------------------F-
NRX2A_HUMAN/760-890------------------------------------------------------------------------------F-
CELR2_RAT/869-995------------------------------------------------------------------------------F-
CNTP2_HUMAN/216-345------------------------------------------------------------------------------F-
CNTP2_HUMAN/401-529------------------------------------------------------------------------------F-
CNTP2_HUMAN/1055-1187------------------------------------------------------------------------------F-
NRX1A_HUMAN/1156-1275------------------------------------------------------------------------------F-
Q9VCZ9_DROME/132-266------------------------------------------------------------------------------F-
Q9VCZ9_DROME/386-520------------------------------------------------------------------------------F-
Q9VCZ9_DROME/582-719------------------------------------------------------------------------------F-
Q9VCZ9_DROME/814-942------------------------------------------------------------------------------F-
B1AM99_HUMAN/398-521------------------------------------------------------------------------------F-
B4NSJ9_DROSI/33-158------------------------------------------------------------------------------.-
B4Q5I2_DROSI/631-761------------------------------------------------------------------------------F-
B4QRF1_DROSI/2162-2287------------------------------------------------------------------------------I-
B7ZC61_MOUSE/681-798------------------------------------------------------------------------------V-
C1P641_CAEEL/3508-3630------------------------------------------------------------------------------M-
C3ZLC2_BRAFL/400-531------------------------------------------------------------------------------F-
E9PDN6_HUMAN/215-343------------------------------------------------------------------------------F-
F1QGG9_DANRE/493-622------------------------------------------------------------------------------L-
F1QQE4_DANRE/1172-1299------------------------------------------------------------------------------.-
F1R9W4_DANRE/32-162------------------------------------------------------------------------------F-
F1RCV3_DANRE/1181-1305------------------------------------------------------------------------------.-
F6X197_CIOIN/154-276------------------------------------------------------------------------------.-
F7ER04_CALJA/128-245------------------------------------------------------------------------------F-
G3HJH2_CRIGR/1596-1721------------------------------------------------------------------------------I-
G3UNZ8_MELGA/755-882------------------------------------------------------------------------------.-
G5E9F8_HUMAN/383-515------------------------------------------------------------------------------I-
H9H2C7_MELGA/307-434------------------------------------------------------------------------------.-
M9NF15_DROME/1112-1240------------------------------------------------------------------------------F-
LAMA3_MOUSE/3183-3307------------------------------------------------------------------------------I-
Q8MPN3_DROME/3806-3929------------------------------------------------------------------------------.-
Q9VCZ9_DROME/1230-1354------------------------------------------------------------------------------F-
CADN2_DROME/1039-1199-------------------------------