Sequence alignment for CL0011

PF07654

F6UY61_MONDO/126-209--------------------------------------------------------------------------------
IGHA1_HUMAN/6-92--------------------------------------------------------------------------------
DQA1_HUMAN/112-195--------------------------------------------------------------------------------
B2MG_DANRE/24-105--------------------------------------------------------------------------------
M3W4D7_FELCA/25-106--------------------------------------------------------------------------------
IGHG1_HUMAN/229-315--------------------------------------------------------------------------------
LAC_RABIT/6-92--------------------------------------------------------------------------------
IGHA_MOUSE/6-91--------------------------------------------------------------------------------
Q90ZJ6_ORYLA/24-106--------------------------------------------------------------------------------
GCAB_MOUSE/234-320--------------------------------------------------------------------------------
M9MM93_DANRE/103-186--------------------------------------------------------------------------------
HB2D_RAT/124-207--------------------------------------------------------------------------------
IGG2B_RAT/232-318--------------------------------------------------------------------------------
IGHG_RABIT/115-204--------------------------------------------------------------------------------
IGG2B_MOUSE/234-320--------------------------------------------------------------------------------
IGHG3_MOUSE/228-314--------------------------------------------------------------------------------
IGHE_RAT/314-403--------------------------------------------------------------------------------
H2MX91_ORYLA/112-193--------------------------------------------------------------------------------
Q8WM94_DANRE/104-187--------------------------------------------------------------------------------
IGHM_HUMAN/329-419--------------------------------------------------------------------------------
HA2J_MOUSE/112-195--------------------------------------------------------------------------------
HB2D_PIG/126-209--------------------------------------------------------------------------------
LAC1_MOUSE/6-92--------------------------------------------------------------------------------
LAC_CHICK/6-91--------------------------------------------------------------------------------
IGHG2_CAVPO/227-315--------------------------------------------------------------------------------
E9QFF8_DANRE/59-142--------------------------------------------------------------------------------
GCAA_MOUSE/122-211--------------------------------------------------------------------------------
IGHM_CHICK/322-413--------------------------------------------------------------------------------
F6W9R2_CALJA/25-107--------------------------------------------------------------------------------
B2MG_CHICK/25-107--------------------------------------------------------------------------------
B2MG_RABIT/5-87--------------------------------------------------------------------------------
W5PE14_SHEEP/113-196--------------------------------------------------------------------------------
O62938_XIPMA/111-194--------------------------------------------------------------------------------
Q1MTC8_DANRE/114-197--------------------------------------------------------------------------------
Q5M8Y9_XENTR/118-201--------------------------------------------------------------------------------
IGKC_HUMAN/5-93--------------------------------------------------------------------------------
F1RBP5_DANRE/133-216--------------------------------------------------------------------------------
A6QQE7_BOVIN/111-194--------------------------------------------------------------------------------
TCB2_MOUSE/9-99--------------------------------------------------------------------------------
IGHA_RABIT/174-266--------------------------------------------------------------------------------
Q70IB5_BOVIN/127-210--------------------------------------------------------------------------------
M3VX36_FELCA/114-197--------------------------------------------------------------------------------
KACB_RAT/5-93--------------------------------------------------------------------------------
IGHD_HUMAN/6-91--------------------------------------------------------------------------------
O35424_MOUSE/123-206--------------------------------------------------------------------------------
IGG2C_RAT/6-88--------------------------------------------------------------------------------
B2MG_BOVIN/25-106--------------------------------------------------------------------------------
GCAA_MOUSE/229-315--------------------------------------------------------------------------------
KAC5_RABIT/5-91--------------------------------------------------------------------------------
LAC_PIG/6-92--------------------------------------------------------------------------------
I3KVH2_ORENI/105-188--------------------------------------------------------------------------------
G1TXW3_RABIT/116-199--------------------------------------------------------------------------------
H0UYJ7_CAVPO/109-192--------------------------------------------------------------------------------
DPA1_HUMAN/118-201--------------------------------------------------------------------------------
R0JJE7_ANAPL/100-182--------------------------------------------------------------------------------
H9GZQ9_HORSE/235-322--------------------------------------------------------------------------------
LAC2_MOUSE/6-91--------------------------------------------------------------------------------
B2MG_CAVPO/5-87--------------------------------------------------------------------------------
IGHG1_HUMAN/6-89--------------------------------------------------------------------------------
DPB1_HUMAN/124-207--------------------------------------------------------------------------------
B2MG_HORSE/25-106--------------------------------------------------------------------------------
IGLL1_MOUSE/110-196--------------------------------------------------------------------------------
DOB_HUMAN/123-206--------------------------------------------------------------------------------
IGHG1_HUMAN/122-211--------------------------------------------------------------------------------
IGHE_HUMAN/324-412--------------------------------------------------------------------------------
GCAA_MOUSE/6-88--------------------------------------------------------------------------------
B2MG_MOUSE/25-107--------------------------------------------------------------------------------
IGHG1_MOUSE/223-309--------------------------------------------------------------------------------
IGHG1_RAT/225-311--------------------------------------------------------------------------------
F1NSZ6_CHICK/127-206--------------------------------------------------------------------------------
IGKC_MOUSE/5-93--------------------------------------------------------------------------------

PF08205

PVRL3_HUMAN/173-257--------------------------------------------------------------------------------
SN_MOUSE/142-229--------------------------------------------------------------------------------
RAGE_HUMAN/124-219--------------------------------------------------------------------------------
NPHN_MOUSE/152-242--------------------------------------------------------------------------------
NPHN_MOUSE/357-442--------------------------------------------------------------------------------
CRTAM_MOUSE/119-205--------------------------------------------------------------------------------
PVRL4_MOUSE/150-233--------------------------------------------------------------------------------
PVRL2_MOUSE/155-240--------------------------------------------------------------------------------
PVRL1_HUMAN/148-237--------------------------------------------------------------------------------
TMM25_HUMAN/26-118--------------------------------------------------------------------------------
SN_HUMAN/142-228--------------------------------------------------------------------------------
CD22_HUMAN/143-230--------------------------------------------------------------------------------
NPHN_HUMAN/138-228--------------------------------------------------------------------------------
CD80_RABIT/140-226--------------------------------------------------------------------------------
MUC18_HUMAN/139-234--------------------------------------------------------------------------------
BCAM_HUMAN/150-248--------------------------------------------------------------------------------
BCAM_BOVIN/150-248--------------------------------------------------------------------------------
CD166_MOUSE/137-231--------------------------------------------------------------------------------
RAGE_MOUSE/123-217--------------------------------------------------------------------------------
FAS3_DROME/126-222--------------------------------------------------------------------------------
B4MCT1_DROVI/186-273--------------------------------------------------------------------------------
E1C6L8_CHICK/151-245--------------------------------------------------------------------------------
F1SPA8_PIG/71-155--------------------------------------------------------------------------------
F7EIQ1_CALJA/148-231--------------------------------------------------------------------------------
G1TJN6_RABIT/203-292--------------------------------------------------------------------------------
G3V671_RAT/147-231--------------------------------------------------------------------------------
G7NXN7_MACFA/142-226--------------------------------------------------------------------------------

PF15028

PTCRA_RAT/20-147--------------------------------------------------------------------------------
G1QXF2_NOMLE/20-146--------------------------------------------------------------------------------
PTCRA_BOVIN/31-157--------------------------------------------------------------------------------
G3WD30_SARHA/20-146--------------------------------------------------------------------------------
M3YPD2_MUSPF/40-162--------------------------------------------------------------------------------
H0VKD6_CAVPO/20-147--------------------------------------------------------------------------------
G1U7X8_RABIT/20-147--------------------------------------------------------------------------------

PF02124

GC_PSHV1/234-457--------------------------------------------------------------------------------
GC_VZVD/379-589--------------------------------------------------------------------------------
GC_HHV11/291-500--------------------------------------------------------------------------------
GC_GAHVM/283-492--------------------------------------------------------------------------------
GC_HHV2H/260-469--------------------------------------------------------------------------------

PF09085

W5PFN9_SHEEP/105-212--------------------------------------------------------------------------------
H0WQ95_OTOGA/112-222--------------------------------------------------------------------------------
G5E838_MOUSE/110-220--------------------------------------------------------------------------------
G1PL68_MYOLU/112-219--------------------------------------------------------------------------------
I3LSA9_PIG/49-158--------------------------------------------------------------------------------
M3W8G7_FELCA/115-224--------------------------------------------------------------------------------
MADCA_HUMAN/113-224--------------------------------------------------------------------------------
F7BUG9_MONDO/130-238--------------------------------------------------------------------------------
I3N840_ICTTR/111-217--------------------------------------------------------------------------------
L8Y2P3_TUPCH/565-674--------------------------------------------------------------------------------
G3HF34_CRIGR/110-220--------------------------------------------------------------------------------

PF09291

G1LKQ4_AILME/1-76--------------------------------------------------------------------------------
H0XHR2_OTOGA/28-106--------------------------------------------------------------------------------
F6YZC0_ORNAN/8-86--------------------------------------------------------------------------------
G1NZZ6_MYOLU/28-107--------------------------------------------------------------------------------
TCA_MOUSE/8-88--------------------------------------------------------------------------------
TCA_HUMAN/8-91--------------------------------------------------------------------------------
W5QDT7_SHEEP/23-107--------------------------------------------------------------------------------
F1MUN5_BOVIN/23-107--------------------------------------------------------------------------------
I3NCH0_ICTTR/13-93--------------------------------------------------------------------------------
E2R820_CANLF/29-106--------------------------------------------------------------------------------
M0R3T1_RAT/30-109--------------------------------------------------------------------------------
F6Q695_CALJA/20-100--------------------------------------------------------------------------------
M3Y7D3_MUSPF/29-107--------------------------------------------------------------------------------
M3WZY2_FELCA/33-111--------------------------------------------------------------------------------
G3U6X3_LOXAF/21-100--------------------------------------------------------------------------------
V8NIA7_OPHHA/48-130--------------------------------------------------------------------------------
G1U8W0_RABIT/33-114--------------------------------------------------------------------------------

PF16681

F1SAK8_PIG/36-116--------------------------------------------------------------------------------
CD3E_SHEEP/30-112--------------------------------------------------------------------------------
CD3E_BOVIN/30-112--------------------------------------------------------------------------------
G3QUY7_GORGO/36-127--------------------------------------------------------------------------------
H0X808_OTOGA/36-118--------------------------------------------------------------------------------
G5BHL3_HETGA/31-112--------------------------------------------------------------------------------
G3T782_LOXAF/29-109--------------------------------------------------------------------------------
I3MMT1_ICTTR/30-113--------------------------------------------------------------------------------
H0UW68_CAVPO/36-115--------------------------------------------------------------------------------
G1SRV6_RABIT/8-90--------------------------------------------------------------------------------
H9GCG3_ANOCA/57-136--------------------------------------------------------------------------------
Q3LRP4_CALJA/36-118--------------------------------------------------------------------------------
L5M0Z4_MYODS/18-99--------------------------------------------------------------------------------
G3WKI6_SARHA/41-122--------------------------------------------------------------------------------
CD3E_CANLF/41-122--------------------------------------------------------------------------------
F7D784_MONDO/33-114--------------------------------------------------------------------------------
M3XJR7_LATCH/37-113--------------------------------------------------------------------------------
F7CSX8_HORSE/40-119--------------------------------------------------------------------------------
L5KKM4_PTEAL/18-99--------------------------------------------------------------------------------
D4A5M2_RAT/24-104--------------------------------------------------------------------------------
G7PP33_MACFA/36-118--------------------------------------------------------------------------------
CD3E_MOUSE/29-109--------------------------------------------------------------------------------

PF16680

W5KJS3_ASTMX/45-112--------------------------------------------------------------------------------
K7GSE2_PIG/39-114--------------------------------------------------------------------------------
CD3D_RAT/30-103--------------------------------------------------------------------------------
H2NFG8_PONAB/39-114--------------------------------------------------------------------------------
CD3E_PIG/42-118--------------------------------------------------------------------------------
G5BHL4_HETGA/19-92--------------------------------------------------------------------------------
G3WJY6_SARHA/44-120--------------------------------------------------------------------------------
F7F8D9_MONDO/35-112--------------------------------------------------------------------------------
F6X8V5_ORNAN/39-109--------------------------------------------------------------------------------
L5KJW9_PTEAL/39-116--------------------------------------------------------------------------------
F7CUQ0_HORSE/39-110--------------------------------------------------------------------------------
E2RHB8_CANLF/39-114--------------------------------------------------------------------------------
M3WFR1_FELCA/39-114--------------------------------------------------------------------------------
U3ISR2_ANAPL/34-103--------------------------------------------------------------------------------
F7F8B6_MONDO/49-121--------------------------------------------------------------------------------
G1M3D4_AILME/39-114--------------------------------------------------------------------------------
J9NXV0_CANLF/30-103--------------------------------------------------------------------------------
CD3G_SHEEP/9-84--------------------------------------------------------------------------------
W5MH99_LEPOC/35-109--------------------------------------------------------------------------------
H0VN41_CAVPO/30-103--------------------------------------------------------------------------------
G3U502_LOXAF/18-89--------------------------------------------------------------------------------
G3IMA2_CRIGR/9-82--------------------------------------------------------------------------------
F7FPX1_CALJA/30-103--------------------------------------------------------------------------------
F1N9E2_CHICK/34-109--------------------------------------------------------------------------------
H3BFR3_LATCH/32-111--------------------------------------------------------------------------------
W5PGT3_SHEEP/36-112--------------------------------------------------------------------------------
I3MVU8_ICTTR/39-109--------------------------------------------------------------------------------
G1SDA6_RABIT/30-103--------------------------------------------------------------------------------
M3XZE1_MUSPF/30-101--------------------------------------------------------------------------------
M3WFR0_FELCA/39-111--------------------------------------------------------------------------------
CD3E_FELCA/47-124--------------------------------------------------------------------------------
G3T784_LOXAF/30-104--------------------------------------------------------------------------------
CD3D_MOUSE/30-103--------------------------------------------------------------------------------
F1M9F8_RAT/39-114--------------------------------------------------------------------------------
L5M0W2_MYODS/39-112--------------------------------------------------------------------------------
B4F6W6_XENTR/31-102--------------------------------------------------------------------------------
W5PHC2_SHEEP/30-99--------------------------------------------------------------------------------
CD3D_BOVIN/30-100--------------------------------------------------------------------------------
I6LI21_MUSPF/32-108--------------------------------------------------------------------------------
H0W6D3_CAVPO/39-114--------------------------------------------------------------------------------
G7NCB9_MACMU/42-120--------------------------------------------------------------------------------
G1STZ2_RABIT/39-114--------------------------------------------------------------------------------
G8JL01_BOVIN/15-90--------------------------------------------------------------------------------
K7GLV9_PIG/30-103--------------------------------------------------------------------------------
F6WI60_MACMU/30-103--------------------------------------------------------------------------------
L5M0S8_MYODS/30-101--------------------------------------------------------------------------------
G1MXZ8_MELGA/33-102--------------------------------------------------------------------------------
H0YPP3_TAEGU/33-105--------------------------------------------------------------------------------
M3ZL37_XIPMA/31-110--------------------------------------------------------------------------------
G3WK56_SARHA/41-113--------------------------------------------------------------------------------
G3T785_LOXAF/39-113--------------------------------------------------------------------------------
G3WKI7_SARHA/39-113--------------------------------------------------------------------------------
CD3G_MOUSE/39-114--------------------------------------------------------------------------------
G1M3E8_AILME/39-111--------------------------------------------------------------------------------
G1R705_NOMLE/42-120--------------------------------------------------------------------------------
H0X0C4_OTOGA/30-103--------------------------------------------------------------------------------
F6QRU0_XENTR/52-121--------------------------------------------------------------------------------
L9KSF6_TUPCH/19-94--------------------------------------------------------------------------------
M3XZF4_MUSPF/39-112--------------------------------------------------------------------------------
I3MMT3_ICTTR/39-114--------------------------------------------------------------------------------
F7CIT2_HORSE/30-97--------------------------------------------------------------------------------
G1M3G6_AILME/47-123--------------------------------------------------------------------------------

PF07679

LRIG1_MOUSE/601-691--------------------------------------------------------------------------------
TITIN_HUMAN/7385-7474--------------------------------------------------------------------------------
PALLD_HUMAN/271-361--------------------------------------------------------------------------------
PALLD_HUMAN/1135-1225--------------------------------------------------------------------------------
HMCN2_HUMAN/4309-4395--------------------------------------------------------------------------------
IGDC3_HUMAN/330-417--------------------------------------------------------------------------------
NCAM2_HUMAN/21-111--------------------------------------------------------------------------------
MYOM1_MOUSE/1555-1645--------------------------------------------------------------------------------
OBSCN_HUMAN/10-99--------------------------------------------------------------------------------
PXDN_HUMAN/433-519--------------------------------------------------------------------------------
Q08476_CHICK/180-269--------------------------------------------------------------------------------
Q08476_CHICK/372-461--------------------------------------------------------------------------------
HMCN1_HUMAN/1171-1258--------------------------------------------------------------------------------
O00557_HUMAN/20-114--------------------------------------------------------------------------------
UNC89_CAEEL/648-737--------------------------------------------------------------------------------
UNC89_CAEEL/3286-3377--------------------------------------------------------------------------------
UNC89_CAEEL/3482-3573--------------------------------------------------------------------------------
UNC89_CAEEL/3920-4010--------------------------------------------------------------------------------
MYLK_SHEEP/331-421--------------------------------------------------------------------------------
MUSK_HUMAN/121-208--------------------------------------------------------------------------------
ROBO1_RAT/262-347--------------------------------------------------------------------------------
O55124_MOUSE/1345-1435--------------------------------------------------------------------------------
O57576_CYNPY/213-301--------------------------------------------------------------------------------
O76281_DROME/1225-1316--------------------------------------------------------------------------------
O76281_DROME/3892-3982--------------------------------------------------------------------------------
O76281_DROME/6357-6446--------------------------------------------------------------------------------
CAVPT_BRALA/59-149--------------------------------------------------------------------------------
MYLK_CHICK/28-118--------------------------------------------------------------------------------
MYLK_CHICK/156-245--------------------------------------------------------------------------------
A4V2I0_DROME/25-135--------------------------------------------------------------------------------
P79757_CHICK/328-417--------------------------------------------------------------------------------
P79757_CHICK/734-823--------------------------------------------------------------------------------
UNC22_CAEEL/4150-4239--------------------------------------------------------------------------------
UNC22_CAEEL/6585-6674--------------------------------------------------------------------------------
UNC22_CAEEL/6863-6953--------------------------------------------------------------------------------
VCAM1_CANLF/25-112--------------------------------------------------------------------------------
Q8BID4_MOUSE/6-97--------------------------------------------------------------------------------
Q8T103_BOMMO/4625-4714--------------------------------------------------------------------------------
Q90X22_DANRE/66-155--------------------------------------------------------------------------------
Q90X22_DANRE/178-268--------------------------------------------------------------------------------
Q90YM0_DANRE/209-296--------------------------------------------------------------------------------
Q90Z41_CHICK/223-308--------------------------------------------------------------------------------
Q95YM1_PROCL/4632-4721--------------------------------------------------------------------------------
Q98918_CHICK/3071-3160--------------------------------------------------------------------------------
SPEG_MOUSE/727-816--------------------------------------------------------------------------------
SPEG_MOUSE/1490-1579--------------------------------------------------------------------------------
Q9GV22_MYTGA/344-433--------------------------------------------------------------------------------
Q9GV22_MYTGA/647-736--------------------------------------------------------------------------------

PF13927

B3LWB5_DROAN/364-444--------------------------------------------------------------------------------
B4MTU0_DROWI/318-387--------------------------------------------------------------------------------
B4MXP8_DROWI/227-304--------------------------------------------------------------------------------
B4MYB0_DROWI/133-207--------------------------------------------------------------------------------
B3MYW1_DROAN/2105-2173--------------------------------------------------------------------------------
F1QVQ2_DANRE/2279-2355--------------------------------------------------------------------------------
B4LDU2_DROVI/238-314--------------------------------------------------------------------------------
E7EY71_DANRE/696-771--------------------------------------------------------------------------------
B3M7Y3_DROAN/238-313--------------------------------------------------------------------------------
B4LFT8_DROVI/229-309--------------------------------------------------------------------------------
B3MYW1_DROAN/2573-2649--------------------------------------------------------------------------------
F1QVQ2_DANRE/1164-1237--------------------------------------------------------------------------------
B4L1X8_DROMO/3293-3369--------------------------------------------------------------------------------
B4N316_DROWI/3137-3217--------------------------------------------------------------------------------
B4N9N3_DROWI/206-283--------------------------------------------------------------------------------
B4NDI1_DROWI/1716-1793--------------------------------------------------------------------------------
B4NDI1_DROWI/1809-1884--------------------------------------------------------------------------------
B4L1X8_DROMO/3205-3277--------------------------------------------------------------------------------
F1M4Q3_RAT/2963-3039--------------------------------------------------------------------------------
F1M4Q3_RAT/3712-3787--------------------------------------------------------------------------------
F1M8T7_RAT/117-190--------------------------------------------------------------------------------
D3ZEF7_RAT/362-431--------------------------------------------------------------------------------
H0ZT69_TAEGU/318-391--------------------------------------------------------------------------------
H3C438_TETNG/442-518--------------------------------------------------------------------------------
G1MAY3_AILME/136-218--------------------------------------------------------------------------------
L8Y5J4_TUPCH/1436-1512--------------------------------------------------------------------------------
E9PV93_MOUSE/156-226--------------------------------------------------------------------------------
F7B6I5_ORNAN/417-504--------------------------------------------------------------------------------
U3J5A4_ANAPL/374-461--------------------------------------------------------------------------------
G3SPQ7_LOXAF/2357-2434--------------------------------------------------------------------------------
D3YXG0_MOUSE/4077-4151--------------------------------------------------------------------------------
M3WKI3_FELCA/292-364--------------------------------------------------------------------------------
W5PG45_SHEEP/1861-1941--------------------------------------------------------------------------------
J9KA37_ACYPI/1676-1753--------------------------------------------------------------------------------
U3JE64_FICAL/339-416--------------------------------------------------------------------------------
M9MMH4_MONDO/719-791--------------------------------------------------------------------------------
K7GSM9_PIG/46-116--------------------------------------------------------------------------------
H0Z181_TAEGU/234-313--------------------------------------------------------------------------------
H2T3G1_TAKRU/77-156--------------------------------------------------------------------------------
H0XAK9_OTOGA/4444-4518--------------------------------------------------------------------------------
H2LQK4_ORYLA/395-479--------------------------------------------------------------------------------
M3VX13_FELCA/252-331--------------------------------------------------------------------------------
F7HG01_MACMU/120-194--------------------------------------------------------------------------------
H3ALI7_LATCH/95-169--------------------------------------------------------------------------------
CD166_CHICK/420-494--------------------------------------------------------------------------------
H3AZ49_LATCH/431-506--------------------------------------------------------------------------------
I1FCT8_AMPQE/154-231--------------------------------------------------------------------------------
A7RGL8_NEMVE/110-187--------------------------------------------------------------------------------
H1A3P1_TAEGU/10-94--------------------------------------------------------------------------------
T1IV67_STRMM/4428-4506--------------------------------------------------------------------------------
U3IRV3_ANAPL/3333-3408--------------------------------------------------------------------------------
H2RMV1_TAKRU/3687-3765--------------------------------------------------------------------------------
G3IGQ1_CRIGR/104-182--------------------------------------------------------------------------------
E2RAY5_CANLF/328-396--------------------------------------------------------------------------------
H0WC62_CAVPO/1023-1101--------------------------------------------------------------------------------
H0WK70_OTOGA/134-197--------------------------------------------------------------------------------
W5M259_LEPOC/3334-3404--------------------------------------------------------------------------------
W4Y7I7_STRPU/1121-1191--------------------------------------------------------------------------------
G3S8K1_GORGO/306-398--------------------------------------------------------------------------------
G7NZL8_MACFA/2427-2506--------------------------------------------------------------------------------
A8XPH1_CAEBR/335-409--------------------------------------------------------------------------------
F6U7N2_MACMU/206-280--------------------------------------------------------------------------------
F6VGW4_XENTR/135-215--------------------------------------------------------------------------------
G5AXX1_HETGA/375-459--------------------------------------------------------------------------------
E1BPL4_BOVIN/226-295--------------------------------------------------------------------------------
H0XXS4_OTOGA/409-487--------------------------------------------------------------------------------
G0MT57_CAEBE/312-390--------------------------------------------------------------------------------
M4A1V3_XIPMA/287-362--------------------------------------------------------------------------------
K1Q203_CRAGI/164-241--------------------------------------------------------------------------------
L9L0Q8_TUPCH/446-524--------------------------------------------------------------------------------
J9LE80_ACYPI/76-155--------------------------------------------------------------------------------
TUTLA_HUMAN/226-305--------------------------------------------------------------------------------
A8XNA1_CAEBR/1384-1460--------------------------------------------------------------------------------
OPCM_BOVIN/135-206--------------------------------------------------------------------------------
H0VAJ3_CAVPO/2443-2518--------------------------------------------------------------------------------
G5ED27_CAEEL/520-594--------------------------------------------------------------------------------
F1QXA6_DANRE/135-209--------------------------------------------------------------------------------
E1BE11_BOVIN/469-544--------------------------------------------------------------------------------
G3WNW6_SARHA/2005-2083--------------------------------------------------------------------------------
G1MVY0_MELGA/205-286--------------------------------------------------------------------------------
B3SCT4_TRIAD/309-386--------------------------------------------------------------------------------
I3KLJ9_ORENI/1511-1587--------------------------------------------------------------------------------
G1KEL6_ANOCA/1747-1827--------------------------------------------------------------------------------
H9IXE0_BOMMO/176-257--------------------------------------------------------------------------------
F1MCF8_BOVIN/134-219--------------------------------------------------------------------------------
I3LQ56_PIG/148-223--------------------------------------------------------------------------------
H3A298_LATCH/269-341--------------------------------------------------------------------------------
E2B5C2_HARSA/1192-1270--------------------------------------------------------------------------------
K1RSV8_CRAGI/535-604--------------------------------------------------------------------------------
F1NLB3_CHICK/211-291--------------------------------------------------------------------------------
F7C3F9_HORSE/1916-1994--------------------------------------------------------------------------------
D7EJQ9_TRICA/242-318--------------------------------------------------------------------------------
G1SPW0_RABIT/1828-1908--------------------------------------------------------------------------------
F7DZU8_HORSE/145-218--------------------------------------------------------------------------------
H3AFQ4_LATCH/197-284--------------------------------------------------------------------------------
H2RMD5_TAKRU/268-350--------------------------------------------------------------------------------
E9H6S4_DAPPU/229-313--------------------------------------------------------------------------------
T1JN10_STRMM/773-858--------------------------------------------------------------------------------
X1WJL2_ACYPI/355-429--------------------------------------------------------------------------------
H0XYV2_OTOGA/208-287--------------------------------------------------------------------------------
LRC24_HUMAN/259-349--------------------------------------------------------------------------------
G3QLT3_GORGO/2730-2812--------------------------------------------------------------------------------
M4A8Z7_XIPMA/92-163--------------------------------------------------------------------------------
B4J1G6_DROGR/182-257--------------------------------------------------------------------------------
G3TDI8_LOXAF/147-221--------------------------------------------------------------------------------
H9IS41_BOMMO/193-283--------------------------------------------------------------------------------
F7DNP8_HORSE/32-111--------------------------------------------------------------------------------
E0VID6_PEDHC/546-621--------------------------------------------------------------------------------
M3ZDA5_XIPMA/3960-4034--------------------------------------------------------------------------------
A7S6L7_NEMVE/1-68--------------------------------------------------------------------------------
W5P5G3_SHEEP/184-260--------------------------------------------------------------------------------
G1NXV5_MYOLU/407-490--------------------------------------------------------------------------------
A7TD83_NEMVE/10-77--------------------------------------------------------------------------------
W4YVT5_STRPU/238-315--------------------------------------------------------------------------------
G1PXT9_MYOLU/104-188--------------------------------------------------------------------------------
H2TNV2_TAKRU/217-293--------------------------------------------------------------------------------
Q9VNP2_DROME/376-456--------------------------------------------------------------------------------
Q7PWJ1_ANOGA/342-413--------------------------------------------------------------------------------
G3PRA1_GASAC/425-503--------------------------------------------------------------------------------
H2T5J3_TAKRU/491-583--------------------------------------------------------------------------------
C9JIE7_HUMAN/28-101--------------------------------------------------------------------------------
G3H7Z1_CRIGR/124-193--------------------------------------------------------------------------------
W5P8R4_SHEEP/200-280--------------------------------------------------------------------------------
H0XMF4_OTOGA/144-224--------------------------------------------------------------------------------
VSIG1_RAT/143-216--------------------------------------------------------------------------------
G1SWE1_RABIT/373-446--------------------------------------------------------------------------------
H2V1A2_TAKRU/42-123--------------------------------------------------------------------------------
H2SGH2_TAKRU/2309-2391--------------------------------------------------------------------------------
Q4PIU9_CAEEL/443-521--------------------------------------------------------------------------------
G1PEU6_MYOLU/1208-1280--------------------------------------------------------------------------------
Q7QJ29_ANOGA/224-300--------------------------------------------------------------------------------
G5AMV7_HETGA/871-949--------------------------------------------------------------------------------
E4XUG8_OIKDI/346-406--------------------------------------------------------------------------------
K1RTW1_CRAGI/484-572--------------------------------------------------------------------------------
M4A3M8_XIPMA/4-79--------------------------------------------------------------------------------
L5KGT4_PTEAL/29-113--------------------------------------------------------------------------------
F6U370_ORNAN/213-295--------------------------------------------------------------------------------
H9H3H6_MACMU/143-216--------------------------------------------------------------------------------
U3J3S7_ANAPL/753-822--------------------------------------------------------------------------------
H0WC62_CAVPO/183-257--------------------------------------------------------------------------------
E3MB14_CAERE/1378-1454--------------------------------------------------------------------------------
M3X7U8_FELCA/877-952--------------------------------------------------------------------------------
F1R062_DANRE/657-736--------------------------------------------------------------------------------
G6D1C5_DANPL/333-410--------------------------------------------------------------------------------
B0S758_DANRE/4279-4356--------------------------------------------------------------------------------
G1PC71_MYOLU/210-286--------------------------------------------------------------------------------
M0R8A3_RAT/28-95--------------------------------------------------------------------------------
I3JX54_ORENI/222-301--------------------------------------------------------------------------------
I3J6L2_ORENI/1513-1595--------------------------------------------------------------------------------
A7T324_NEMVE/168-243--------------------------------------------------------------------------------
F4WMU2_ACREC/245-332--------------------------------------------------------------------------------
A0A0G2KBC4_RAT/202-282--------------------------------------------------------------------------------
E9Q8K5_MOUSE/7768-7845--------------------------------------------------------------------------------
F6WZ71_XENTR/136-210--------------------------------------------------------------------------------
G1Q318_MYOLU/146-219--------------------------------------------------------------------------------
B7PWG0_IXOSC/6-84--------------------------------------------------------------------------------
E1C7J4_CHICK/1446-1521--------------------------------------------------------------------------------
T1HFN4_RHOPR/262-348--------------------------------------------------------------------------------
M3Y4I1_MUSPF/446-525--------------------------------------------------------------------------------
J9K4X0_ACYPI/838-923--------------------------------------------------------------------------------
H2YFC8_CIOSA/6015-6094--------------------------------------------------------------------------------
I1FIK6_AMPQE/905-978--------------------------------------------------------------------------------
H0ZT52_TAEGU/167-243--------------------------------------------------------------------------------
G6D8N4_DANPL/397-471--------------------------------------------------------------------------------
H2S4G7_TAKRU/2233-2312--------------------------------------------------------------------------------
F6RM57_MONDO/221-299--------------------------------------------------------------------------------
A0A068YBC4_ECHMU/128-224--------------------------------------------------------------------------------
H3C0Z0_TETNG/505-582--------------------------------------------------------------------------------
C3YV78_BRAFL/244-318--------------------------------------------------------------------------------
V8NXF3_OPHHA/273-341--------------------------------------------------------------------------------
J9K2T1_ACYPI/4946-5025--------------------------------------------------------------------------------
E2RDP3_CANLF/358-427--------------------------------------------------------------------------------
B8ZZW4_HUMAN/225-316--------------------------------------------------------------------------------
I3KLJ9_ORENI/4172-4250--------------------------------------------------------------------------------
G3QH37_GORGO/2340-2418--------------------------------------------------------------------------------
G3QAT5_GASAC/137-219--------------------------------------------------------------------------------
K7J263_NASVI/311-384--------------------------------------------------------------------------------
H2P041_PONAB/28-99--------------------------------------------------------------------------------
G5BSW9_HETGA/22-89--------------------------------------------------------------------------------
E1C0J7_CHICK/329-404--------------------------------------------------------------------------------
H3AY43_LATCH/449-523--------------------------------------------------------------------------------
F1P3U6_CHICK/31-104--------------------------------------------------------------------------------
U3IRV3_ANAPL/1559-1634--------------------------------------------------------------------------------
G3RF50_GORGO/154-227--------------------------------------------------------------------------------
H3CQ92_TETNG/191-272--------------------------------------------------------------------------------
T1G0T0_HELRO/315-390--------------------------------------------------------------------------------
UNC22_CAEEL/5532-5609--------------------------------------------------------------------------------
H2QGH1_PANTR/148-221--------------------------------------------------------------------------------
F1QPV1_DANRE/763-842--------------------------------------------------------------------------------
G5AXW3_HETGA/404-504--------------------------------------------------------------------------------
M3XII6_LATCH/175-270--------------------------------------------------------------------------------
GPA33_MOUSE/143-215--------------------------------------------------------------------------------
M3WCL1_FELCA/378-451--------------------------------------------------------------------------------
H2ZY75_LATCH/19-96--------------------------------------------------------------------------------
E7FDK2_DANRE/164-242--------------------------------------------------------------------------------
G0MH24_CAEBE/2578-2658--------------------------------------------------------------------------------
G1T2S8_RABIT/208-285--------------------------------------------------------------------------------
T1HBT4_RHOPR/41-120--------------------------------------------------------------------------------
E5T119_TRISP/222-297--------------------------------------------------------------------------------
J9EAV2_WUCBA/64-138--------------------------------------------------------------------------------
E0VBQ8_PEDHC/2584-2656--------------------------------------------------------------------------------
F6U0Z2_MONDO/399-469--------------------------------------------------------------------------------
SDK_CAEBR/27-98--------------------------------------------------------------------------------
W5JFQ9_ANODA/3228-3303--------------------------------------------------------------------------------
K7J1P5_NASVI/335-411--------------------------------------------------------------------------------
H2RMV3_TAKRU/3258-3334--------------------------------------------------------------------------------
H2RTG6_TAKRU/104-167--------------------------------------------------------------------------------
A7RHA1_NEMVE/223-323--------------------------------------------------------------------------------
F7EZJ4_ORNAN/47-119--------------------------------------------------------------------------------
H0VZZ7_CAVPO/13147-13224--------------------------------------------------------------------------------
U3IRV3_ANAPL/1933-2011--------------------------------------------------------------------------------
G1M2L3_AILME/258-331--------------------------------------------------------------------------------
H2SGH5_TAKRU/458-536--------------------------------------------------------------------------------
U3JRE7_FICAL/2504-2582--------------------------------------------------------------------------------
Q7KUK9_DROME/1117-1203--------------------------------------------------------------------------------
T1JQ42_TETUR/2317-2395--------------------------------------------------------------------------------
L5K5L3_PTEAL/239-309--------------------------------------------------------------------------------
A7SFR8_NEMVE/46-114--------------------------------------------------------------------------------
C3YE96_BRAFL/11-88--------------------------------------------------------------------------------
G1L1P3_AILME/31591-31669--------------------------------------------------------------------------------
E9ICY3_SOLIN/192-269--------------------------------------------------------------------------------
H3BA40_LATCH/431-504--------------------------------------------------------------------------------
H9H6P4_MONDO/149-222--------------------------------------------------------------------------------
F1N757_BOVIN/19142-19222--------------------------------------------------------------------------------
B8A5X4_DANRE/249-328--------------------------------------------------------------------------------
G5ED27_CAEEL/3765-3842--------------------------------------------------------------------------------
G3IA17_CRIGR/26-98--------------------------------------------------------------------------------
LIGO3_HUMAN/406-484--------------------------------------------------------------------------------
B3DHL7_DANRE/396-486--------------------------------------------------------------------------------
F6PCI7_DANRE/123-187--------------------------------------------------------------------------------
Q0E9I7_DROME/618-698--------------------------------------------------------------------------------
F6RH77_XENTR/792-871--------------------------------------------------------------------------------
F6RHB6_XENTR/521-596--------------------------------------------------------------------------------
C3YI92_BRAFL/240-314--------------------------------------------------------------------------------
K1QDZ3_CRAGI/330-408--------------------------------------------------------------------------------
G5AZS1_HETGA/225-297--------------------------------------------------------------------------------
H2RAR7_PANTR/241-318--------------------------------------------------------------------------------
G3SKZ8_LOXAF/2514-2589--------------------------------------------------------------------------------
I3K298_ORENI/241-338--------------------------------------------------------------------------------
K7EG05_ORNAN/40-109--------------------------------------------------------------------------------
F7ALJ3_MONDO/573-647--------------------------------------------------------------------------------
A0A068XUD2_HYMMI/23-102--------------------------------------------------------------------------------
G1RTX9_NOMLE/362-430--------------------------------------------------------------------------------
K7J3K2_NASVI/230-325--------------------------------------------------------------------------------
T1K8T5_TETUR/700-780--------------------------------------------------------------------------------
A7T347_NEMVE/207-273--------------------------------------------------------------------------------
G3HU05_CRIGR/156-238--------------------------------------------------------------------------------
C3XTR2_BRAFL/407-496--------------------------------------------------------------------------------
Q16PL9_AEDAE/1970-2042--------------------------------------------------------------------------------
G1MRA1_MELGA/3214-3292--------------------------------------------------------------------------------
C3ZMB7_BRAFL/142-212--------------------------------------------------------------------------------
L9LAX3_TUPCH/95-167--------------------------------------------------------------------------------
H9ITP2_BOMMO/3557-3636--------------------------------------------------------------------------------
W5NKB1_LEPOC/185-258--------------------------------------------------------------------------------
A8X5T7_CAEBR/262-333--------------------------------------------------------------------------------
F6WH01_ORNAN/522-603--------------------------------------------------------------------------------
B7QLJ5_IXOSC/4-82--------------------------------------------------------------------------------
W4ZEX8_STRPU/110-190--------------------------------------------------------------------------------
H2W626_CAEJA/1269-1345--------------------------------------------------------------------------------
G3SWG4_LOXAF/126-199--------------------------------------------------------------------------------
L5MGE5_MYODS/777-852--------------------------------------------------------------------------------
W5K8G9_ASTMX/18-102--------------------------------------------------------------------------------
F7BFG5_XENTR/276-363--------------------------------------------------------------------------------
CEAM5_HUMAN/502-575--------------------------------------------------------------------------------
G1LNF0_AILME/259-344--------------------------------------------------------------------------------
G3NWN1_GASAC/3143-3221--------------------------------------------------------------------------------
B0WQT6_CULQU/2315-2388--------------------------------------------------------------------------------
F1QAV8_DANRE/242-317--------------------------------------------------------------------------------
H2UIH8_TAKRU/1-84--------------------------------------------------------------------------------
W5KN69_ASTMX/239-306--------------------------------------------------------------------------------
E3MB14_CAERE/2695-2773--------------------------------------------------------------------------------
L5MIN9_MYODS/127-196--------------------------------------------------------------------------------
B0S6Y0_DANRE/5046-5124--------------------------------------------------------------------------------
H3BWN1_TETNG/120-194--------------------------------------------------------------------------------
Q7QCH7_ANOGA/112-186--------------------------------------------------------------------------------
U3K448_FICAL/135-215--------------------------------------------------------------------------------
Q63116_RAT/211-296--------------------------------------------------------------------------------
T1JAP3_STRMM/8-82--------------------------------------------------------------------------------
G4VHL0_SCHMA/34-117--------------------------------------------------------------------------------
H2SMR3_TAKRU/295-377--------------------------------------------------------------------------------
H3CVA2_TETNG/320-393--------------------------------------------------------------------------------
KIT_FELCA/413-496--------------------------------------------------------------------------------
T1J767_STRMM/86-168--------------------------------------------------------------------------------
W5MH34_LEPOC/5091-5168--------------------------------------------------------------------------------
I3KJA7_ORENI/452-528--------------------------------------------------------------------------------
H2TYY0_TAKRU/252-331--------------------------------------------------------------------------------
E2BGQ9_HARSA/550-635--------------------------------------------------------------------------------
B4R2G8_DROSI/333-408--------------------------------------------------------------------------------
H2UZ60_TAKRU/136-218--------------------------------------------------------------------------------
A0A068XP72_HYMMI/1181-1259--------------------------------------------------------------------------------
H2W626_CAEJA/2096-2171--------------------------------------------------------------------------------
E9FRF0_DAPPU/341-417--------------------------------------------------------------------------------
T1JWQ7_TETUR/141-219--------------------------------------------------------------------------------
G7PXR7_MACFA/146-219--------------------------------------------------------------------------------
D3ZEF7_RAT/157-227--------------------------------------------------------------------------------
T1G0N8_HELRO/356-442--------------------------------------------------------------------------------
F4WXQ5_ACREC/40-119--------------------------------------------------------------------------------
G3WK71_SARHA/132-205--------------------------------------------------------------------------------
H2YX49_CIOSA/39-117--------------------------------------------------------------------------------
M3ZF48_XIPMA/1530-1611--------------------------------------------------------------------------------
B4IEG8_DROSE/277-377--------------------------------------------------------------------------------
C3YXV4_BRAFL/434-522--------------------------------------------------------------------------------
T1L0G5_TETUR/1227-1307--------------------------------------------------------------------------------
A7T5G7_NEMVE/176-254--------------------------------------------------------------------------------
H2W3A3_CAEJA/124-200--------------------------------------------------------------------------------
H3B9Q7_LATCH/92-171--------------------------------------------------------------------------------
W4WPS4_ATTCE/2117-2185--------------------------------------------------------------------------------
T1FSI9_HELRO/3-79--------------------------------------------------------------------------------
V8P4F9_OPHHA/1279-1354--------------------------------------------------------------------------------
E1B9K4_BOVIN/696-768--------------------------------------------------------------------------------
G1PQB8_MYOLU/91-165--------------------------------------------------------------------------------
M4A3M8_XIPMA/201-278--------------------------------------------------------------------------------
W5MXI9_LEPOC/240-335--------------------------------------------------------------------------------
Q7QH01_ANOGA/200-274--------------------------------------------------------------------------------
A0A068XVM9_HYMMI/160-251--------------------------------------------------------------------------------
W4VTQ7_ATTCE/336-427--------------------------------------------------------------------------------
U1MB61_ASCSU/233-309--------------------------------------------------------------------------------
I3JK65_ORENI/1643-1723--------------------------------------------------------------------------------
G1PE98_MYOLU/142-224--------------------------------------------------------------------------------
G1NPM8_MELGA/231-326--------------------------------------------------------------------------------
I3J3G4_ORENI/208-291--------------------------------------------------------------------------------
A8WZ25_CAEBR/71-139--------------------------------------------------------------------------------
M4AZI7_XIPMA/409-487--------------------------------------------------------------------------------
H3AR10_LATCH/182-255--------------------------------------------------------------------------------
I1FMM2_AMPQE/133-214--------------------------------------------------------------------------------
B4QNK1_DROSI/552-632--------------------------------------------------------------------------------
B0WQS2_CULQU/395-476--------------------------------------------------------------------------------
W4ZIA3_STRPU/27-102--------------------------------------------------------------------------------
W5MUL9_LEPOC/261-337--------------------------------------------------------------------------------
R7L6X0_9BACT/143-212--------------------------------------------------------------------------------
F7AMC7_ORNAN/100-173--------------------------------------------------------------------------------
G3X1Y5_SARHA/77-149--------------------------------------------------------------------------------
W5KA48_ASTMX/94-164--------------------------------------------------------------------------------
C3XQC8_BRAFL/319-401--------------------------------------------------------------------------------
T1K8T5_TETUR/506-594--------------------------------------------------------------------------------
F4X807_ACREC/2585-2662--------------------------------------------------------------------------------
B7PCC8_IXOSC/372-452--------------------------------------------------------------------------------
Q7QGT8_ANOGA/598-679--------------------------------------------------------------------------------
G3VWI5_SARHA/240-311--------------------------------------------------------------------------------
G3VC29_SARHA/140-213--------------------------------------------------------------------------------
W5L0Z5_ASTMX/61-138--------------------------------------------------------------------------------
W5NCC6_LEPOC/388-463--------------------------------------------------------------------------------
L9L2E3_TUPCH/225-305--------------------------------------------------------------------------------
R4GLP6_CHICK/4237-4314--------------------------------------------------------------------------------
E4WVK0_OIKDI/201-279--------------------------------------------------------------------------------
VCAM1_RAT/513-583--------------------------------------------------------------------------------
W4XB08_STRPU/529-608--------------------------------------------------------------------------------
J9JQ41_ACYPI/68-152--------------------------------------------------------------------------------
H2TCX5_TAKRU/496-570--------------------------------------------------------------------------------
G3P8R0_GASAC/105-178--------------------------------------------------------------------------------
G3VSL9_SARHA/171-243--------------------------------------------------------------------------------
W4XQ21_STRPU/745-820--------------------------------------------------------------------------------
E4WSA8_OIKDI/267-346--------------------------------------------------------------------------------
H3BZV8_TETNG/385-454--------------------------------------------------------------------------------
E0V9F8_PEDHC/17-97--------------------------------------------------------------------------------
G3TMS7_LOXAF/360-429--------------------------------------------------------------------------------
F6RH77_XENTR/4441-4515--------------------------------------------------------------------------------
F1NH95_CHICK/294-384--------------------------------------------------------------------------------
T1JY23_TETUR/776-864--------------------------------------------------------------------------------
A0A0H5S2B2_BRUMA/626-704--------------------------------------------------------------------------------
G1Q228_MYOLU/133-202--------------------------------------------------------------------------------
G1Q3U7_MYOLU/323-399--------------------------------------------------------------------------------
F6WT52_MONDO/207-289--------------------------------------------------------------------------------
T1IX56_STRMM/587-667--------------------------------------------------------------------------------
Q16SD7_AEDAE/410-492--------------------------------------------------------------------------------
E0VQ49_PEDHC/218-299--------------------------------------------------------------------------------
Q66I72_DANRE/124-206--------------------------------------------------------------------------------
I3JXY4_ORENI/2312-2391--------------------------------------------------------------------------------
A7RTK9_NEMVE/67-134--------------------------------------------------------------------------------
K1QFM1_CRAGI/129-198--------------------------------------------------------------------------------
H9G4V2_ANOCA/202-277--------------------------------------------------------------------------------
H2RMU8_TAKRU/898-975--------------------------------------------------------------------------------
W5KK86_ASTMX/483-559--------------------------------------------------------------------------------
E0W000_PEDHC/1395-1475--------------------------------------------------------------------------------
H2SGH4_TAKRU/1376-1465--------------------------------------------------------------------------------
F6ZYW4_XENTR/207-287--------------------------------------------------------------------------------
G6D925_DANPL/189-262--------------------------------------------------------------------------------
F6Q1C2_CIOIN/116-186--------------------------------------------------------------------------------
B7QMC6_IXOSC/434-517--------------------------------------------------------------------------------
T1KEF4_TETUR/154-239--------------------------------------------------------------------------------
G1MCJ0_AILME/480-554--------------------------------------------------------------------------------
B0WMB0_CULQU/375-448--------------------------------------------------------------------------------
E5SCK7_TRISP/564-642--------------------------------------------------------------------------------
G3PML3_GASAC/244-323--------------------------------------------------------------------------------
H2ZZ57_LATCH/1323-1400--------------------------------------------------------------------------------
H2YGJ8_CIOSA/150-222--------------------------------------------------------------------------------
B0W5X0_CULQU/123-198--------------------------------------------------------------------------------
T1K1V6_TETUR/2849-2928--------------------------------------------------------------------------------
G1Q8Z3_MYOLU/108-177--------------------------------------------------------------------------------
H9JRT0_BOMMO/2553-2626--------------------------------------------------------------------------------
H3ADQ7_LATCH/3302-3380--------------------------------------------------------------------------------
T1HEN7_RHOPR/1933-2009--------------------------------------------------------------------------------
E0VFM7_PEDHC/451-528--------------------------------------------------------------------------------
T1F8I6_HELRO/427-506--------------------------------------------------------------------------------
I1GIL2_AMPQE/402-472--------------------------------------------------------------------------------
H3AZ49_LATCH/1367-1445--------------------------------------------------------------------------------
K7J0L1_NASVI/142-216--------------------------------------------------------------------------------
T1HQ02_RHOPR/313-388--------------------------------------------------------------------------------
G3VD55_SARHA/119-195--------------------------------------------------------------------------------
B0W4B4_CULQU/435-508--------------------------------------------------------------------------------
B1ZNU7_OPITP/131-199--------------------------------------------------------------------------------
H3DK40_TETNG/293-367--------------------------------------------------------------------------------
G1U9S3_RABIT/4153-4230--------------------------------------------------------------------------------
W5PAY5_SHEEP/299-372--------------------------------------------------------------------------------
H2S7R9_TAKRU/215-288--------------------------------------------------------------------------------
H8KUV5_SOLCM/39-113--------------------------------------------------------------------------------
W5K1E8_ASTMX/169-243--------------------------------------------------------------------------------
T1IT85_STRMM/2042-2120--------------------------------------------------------------------------------
E5S3T5_TRISP/194-270--------------------------------------------------------------------------------
G6CQX9_DANPL/337-406--------------------------------------------------------------------------------
B0S758_DANRE/6448-6525--------------------------------------------------------------------------------
K7H008_CAEJA/3858-3932--------------------------------------------------------------------------------
F6Y6T8_CANLF/460-547--------------------------------------------------------------------------------
B4MQT4_DROWI/1523-1602--------------------------------------------------------------------------------
D6WVT0_TRICA/130-205--------------------------------------------------------------------------------
G1QBE9_MYOLU/236-323--------------------------------------------------------------------------------
A0A0J9XYL2_BRUMA/287-363--------------------------------------------------------------------------------
F6R9N9_ORNAN/703-782--------------------------------------------------------------------------------
Q7PN36_ANOGA/318-399--------------------------------------------------------------------------------
D6WIF5_TRICA/225-302--------------------------------------------------------------------------------
H3BAW7_LATCH/116-187--------------------------------------------------------------------------------
C3YXQ6_BRAFL/634-705--------------------------------------------------------------------------------
M4A8Z7_XIPMA/1-72--------------------------------------------------------------------------------
T1JW82_TETUR/357-428--------------------------------------------------------------------------------
H2YT91_CIOSA/45-118--------------------------------------------------------------------------------
H0V9V0_CAVPO/324-397--------------------------------------------------------------------------------
M3ZDA5_XIPMA/2944-3017--------------------------------------------------------------------------------
F1QHX4_DANRE/2356-2435--------------------------------------------------------------------------------
F1MRU1_BOVIN/214-310--------------------------------------------------------------------------------
D6WVT0_TRICA/222-299--------------------------------------------------------------------------------
K7I7M9_CAEJA/97-171--------------------------------------------------------------------------------
B4JGM2_DROGR/141-215--------------------------------------------------------------------------------
H9IS41_BOMMO/56-136--------------------------------------------------------------------------------
H3B115_LATCH/871-950--------------------------------------------------------------------------------
C3YAA7_BRAFL/933-1017--------------------------------------------------------------------------------
E9G8I6_DAPPU/1013-1100--------------------------------------------------------------------------------
H3BF77_LATCH/100-172--------------------------------------------------------------------------------
W4XM75_STRPU/242-322--------------------------------------------------------------------------------
F4WZW8_ACREC/365-443--------------------------------------------------------------------------------
Q1MT63_DANRE/117-185--------------------------------------------------------------------------------
K1Q0W8_CRAGI/685-763--------------------------------------------------------------------------------
M3ZLD4_XIPMA/214-293--------------------------------------------------------------------------------
Q178V3_AEDAE/124-202--------------------------------------------------------------------------------
W5MUK1_LEPOC/22-96--------------------------------------------------------------------------------
W5JY76_ASTMX/329-403--------------------------------------------------------------------------------
M3XGP0_LATCH/200-282--------------------------------------------------------------------------------
H2ZZ03_LATCH/91-169--------------------------------------------------------------------------------
A0A068Y1P8_ECHMU/1274-1348--------------------------------------------------------------------------------
W5LCY5_ASTMX/2471-2548--------------------------------------------------------------------------------
H3ANM9_LATCH/143-224--------------------------------------------------------------------------------
J9JL89_ACYPI/218-297--------------------------------------------------------------------------------
C3ZAB6_BRAFL/505-591--------------------------------------------------------------------------------
F6WFL2_MONDO/295-370--------------------------------------------------------------------------------
W5M0S1_LEPOC/4119-4194--------------------------------------------------------------------------------
F6S0V2_MONDO/291-365--------------------------------------------------------------------------------
H9JF49_BOMMO/162-238--------------------------------------------------------------------------------
W5KDQ7_ASTMX/6-85--------------------------------------------------------------------------------
W5NE83_LEPOC/2521-2603--------------------------------------------------------------------------------
G3P7F4_GASAC/2423-2505--------------------------------------------------------------------------------
W5M8G0_LEPOC/824-911--------------------------------------------------------------------------------
J0DZ27_LOALO/1386-1467--------------------------------------------------------------------------------
B7PZR6_IXOSC/2264-2335--------------------------------------------------------------------------------
M3ZVE1_XIPMA/10-94--------------------------------------------------------------------------------
A0A087ZZ96_APIME/242-324--------------------------------------------------------------------------------
H0VAJ3_CAVPO/747-825--------------------------------------------------------------------------------
G3WAP0_SARHA/391-475--------------------------------------------------------------------------------
R4GA37_ANOCA/247-325--------------------------------------------------------------------------------
C3ZM68_BRAFL/329-400--------------------------------------------------------------------------------
M3ZJI9_XIPMA/1437-1515--------------------------------------------------------------------------------
X1XGE4_ACYPI/2-81--------------------------------------------------------------------------------
E2AQW8_CAMFO/122-201--------------------------------------------------------------------------------
J9EEP1_WUCBA/29-106--------------------------------------------------------------------------------
I3IUL2_ORENI/135-202--------------------------------------------------------------------------------
H2SHQ3_TAKRU/12-78--------------------------------------------------------------------------------
L5M2Z7_MYODS/4159-4236--------------------------------------------------------------------------------
U1NSC7_ASCSU/65-133--------------------------------------------------------------------------------
F6ZIS0_CIOIN/2550-2629--------------------------------------------------------------------------------
T1KRW2_TETUR/30-116--------------------------------------------------------------------------------
M4AN26_XIPMA/2400-2482--------------------------------------------------------------------------------
E2R9V7_CANLF/302-375--------------------------------------------------------------------------------
D6W7B4_TRICA/124-199--------------------------------------------------------------------------------
Q16PP3_AEDAE/1974-2041--------------------------------------------------------------------------------
H2M0W7_ORYLA/521-594--------------------------------------------------------------------------------
WFKN1_HUMAN/185-267--------------------------------------------------------------------------------
F6X9K9_CIOIN/228-307--------------------------------------------------------------------------------
K1QVT8_CRAGI/14-89--------------------------------------------------------------------------------
K1QD41_CRAGI/27-103--------------------------------------------------------------------------------
G4VNR9_SCHMA/2657-2735--------------------------------------------------------------------------------
I3J5F7_ORENI/255-332--------------------------------------------------------------------------------
W0JC77_9BACT/402-470--------------------------------------------------------------------------------
T1F313_HELRO/1059-1137--------------------------------------------------------------------------------
G3Q4I8_GASAC/2429-2507--------------------------------------------------------------------------------
T1I1E7_RHOPR/199-276--------------------------------------------------------------------------------
W5M0S1_LEPOC/4029-4103--------------------------------------------------------------------------------
C3XX67_BRAFL/249-323--------------------------------------------------------------------------------
G3WMC9_SARHA/242-335--------------------------------------------------------------------------------
F6ZNR9_XENTR/40-122--------------------------------------------------------------------------------
W5L6K7_ASTMX/12-90--------------------------------------------------------------------------------
G3PR28_GASAC/2218-2297--------------------------------------------------------------------------------
L5JVK8_PTEAL/102-169--------------------------------------------------------------------------------
K1R6E6_CRAGI/3602-3673--------------------------------------------------------------------------------
K7EE84_ORNAN/7-89--------------------------------------------------------------------------------
G3WAZ9_SARHA/211-292--------------------------------------------------------------------------------
W5MSU1_LEPOC/252-346--------------------------------------------------------------------------------
T1FGA0_HELRO/153-227--------------------------------------------------------------------------------
B7PZR6_IXOSC/790-866--------------------------------------------------------------------------------
G0MYL1_CAEBE/160-231--------------------------------------------------------------------------------
F6RH77_XENTR/611-685--------------------------------------------------------------------------------
W5MSM2_LEPOC/111-192--------------------------------------------------------------------------------
E3MB14_CAERE/2599-2679--------------------------------------------------------------------------------
W5MVU4_LEPOC/2357-2436--------------------------------------------------------------------------------
B4J8M6_DROGR/130-203--------------------------------------------------------------------------------
E9GAQ5_DAPPU/119-203--------------------------------------------------------------------------------
K1QVW7_CRAGI/597-675--------------------------------------------------------------------------------
J9K856_ACYPI/327-400--------------------------------------------------------------------------------
T1I3G6_RHOPR/230-303--------------------------------------------------------------------------------
J9KA37_ACYPI/1145-1221--------------------------------------------------------------------------------
B0WMI5_CULQU/96-169--------------------------------------------------------------------------------
H2SHA3_TAKRU/41-112--------------------------------------------------------------------------------
T1KP14_TETUR/654-736--------------------------------------------------------------------------------
G6DLT7_DANPL/240-317--------------------------------------------------------------------------------
M3ZJI9_XIPMA/3791-3868--------------------------------------------------------------------------------
I3MQM5_ICTTR/242-321--------------------------------------------------------------------------------
G3UP82_MELGA/243-320--------------------------------------------------------------------------------
T1IRS7_STRMM/262-342--------------------------------------------------------------------------------
I3K8L1_ORENI/148-221--------------------------------------------------------------------------------
T1F6A1_HELRO/162-244--------------------------------------------------------------------------------
G3PTV5_GASAC/187-271--------------------------------------------------------------------------------
E3MB16_CAERE/446-520--------------------------------------------------------------------------------
U3JKT4_FICAL/3786-3860--------------------------------------------------------------------------------
H2MBW3_ORYLA/191-272--------------------------------------------------------------------------------
G5C6C4_HETGA/2123-2201--------------------------------------------------------------------------------
W5J457_ANODA/546-621--------------------------------------------------------------------------------
A7SZF1_NEMVE/152-219--------------------------------------------------------------------------------
F1QHX4_DANRE/2261-2340--------------------------------------------------------------------------------
B4H7E0_DROPE/283-392--------------------------------------------------------------------------------
Q17HV8_AEDAE/443-519--------------------------------------------------------------------------------
E0VTY5_PEDHC/221-298--------------------------------------------------------------------------------
C3Z263_BRAFL/527-604--------------------------------------------------------------------------------
Q2KHZ6_BOVIN/130-196--------------------------------------------------------------------------------
CSF1R_MOUSE/399-487--------------------------------------------------------------------------------
I3JFY2_ORENI/153-227--------------------------------------------------------------------------------
M3Y4D4_MUSPF/109-196--------------------------------------------------------------------------------
B4JJ90_DROGR/433-514--------------------------------------------------------------------------------
T1IKD2_STRMM/3892-3963--------------------------------------------------------------------------------
F1MPQ4_BOVIN/247-315--------------------------------------------------------------------------------
W5KAY9_ASTMX/2363-2442--------------------------------------------------------------------------------
I3JQA4_ORENI/414-501--------------------------------------------------------------------------------
M3ZDA5_XIPMA/2848-2924--------------------------------------------------------------------------------
H0XI36_OTOGA/389-463--------------------------------------------------------------------------------
F1PAW2_CANLF/395-467--------------------------------------------------------------------------------
K7GUB9_CAEJA/659-747--------------------------------------------------------------------------------
G1KKG2_ANOCA/1292-1369--------------------------------------------------------------------------------
F4W8E7_ACREC/709-796--------------------------------------------------------------------------------
D6WFM0_TRICA/741-827--------------------------------------------------------------------------------
E5S3T6_TRISP/102-185--------------------------------------------------------------------------------
J9KSY0_ACYPI/411-495--------------------------------------------------------------------------------
C3ZA32_BRAFL/1951-2024--------------------------------------------------------------------------------
T1HID6_RHOPR/383-466--------------------------------------------------------------------------------
E1FMD8_LOALO/559-635--------------------------------------------------------------------------------
H0Z2M2_TAEGU/103-176--------------------------------------------------------------------------------
F6ZIS0_CIOIN/1986-2065--------------------------------------------------------------------------------
A7SQE0_NEMVE/88-161--------------------------------------------------------------------------------
B0XGP5_CULQU/1294-1360--------------------------------------------------------------------------------
F6RH77_XENTR/2475-2551--------------------------------------------------------------------------------
B7PAM8_IXOSC/380-463--------------------------------------------------------------------------------
W4XRM4_STRPU/912-985--------------------------------------------------------------------------------
W5KIY7_ASTMX/466-542--------------------------------------------------------------------------------
J9LBC5_ACYPI/62-145--------------------------------------------------------------------------------
A0A0H5S739_BRUMA/198-273--------------------------------------------------------------------------------
G4VNR9_SCHMA/1012-1091--------------------------------------------------------------------------------
E4XJ18_OIKDI/3647-3721--------------------------------------------------------------------------------
B0TDQ1_HELMI/975-1049--------------------------------------------------------------------------------
E1FJE7_LOALO/1270-1347--------------------------------------------------------------------------------
W5LW67_LEPOC/107-174--------------------------------------------------------------------------------
B4JKX6_DROGR/2483-2556--------------------------------------------------------------------------------
H3CMV4_TETNG/857-934--------------------------------------------------------------------------------
H0ZHW9_TAEGU/184-279--------------------------------------------------------------------------------
G7Y4Z3_CLOSI/2627-2720--------------------------------------------------------------------------------
H2KQX3_CLOSI/90-173--------------------------------------------------------------------------------
E4XJ18_OIKDI/4194-4261--------------------------------------------------------------------------------
Q0IE99_AEDAE/2-80--------------------------------------------------------------------------------
E4XAC9_OIKDI/140-228--------------------------------------------------------------------------------
W5PA51_SHEEP/377-450--------------------------------------------------------------------------------
G6D7M4_DANPL/314-398--------------------------------------------------------------------------------
M3YML2_MUSPF/376-449--------------------------------------------------------------------------------
G3RU01_GORGO/64-137--------------------------------------------------------------------------------
H9JRT0_BOMMO/2462-2537--------------------------------------------------------------------------------
W5MVU4_LEPOC/2262-2341--------------------------------------------------------------------------------
Q16PP3_AEDAE/932-1022--------------------------------------------------------------------------------
H2UGD5_TAKRU/574-651--------------------------------------------------------------------------------
G6D9Q8_DANPL/119-190--------------------------------------------------------------------------------
G1T5K0_RABIT/86-161--------------------------------------------------------------------------------
E9FR26_DAPPU/616-692--------------------------------------------------------------------------------
H3E0H5_PRIPA/252-327--------------------------------------------------------------------------------
U3IV84_ANAPL/3163-3238--------------------------------------------------------------------------------
E1FMD7_LOALO/132-208--------------------------------------------------------------------------------
G3MXB5_BOVIN/114-198--------------------------------------------------------------------------------
M4AZ01_XIPMA/16-83--------------------------------------------------------------------------------
I3KMS8_ORENI/203-284--------------------------------------------------------------------------------
CD48_MOUSE/130-197--------------------------------------------------------------------------------
G6D925_DANPL/279-358--------------------------------------------------------------------------------
F6ZIS0_CIOIN/1705-1780--------------------------------------------------------------------------------
C3ZMD0_BRAFL/209-280--------------------------------------------------------------------------------
Q17AE7_AEDAE/114-191--------------------------------------------------------------------------------
H9JMA6_BOMMO/261-347--------------------------------------------------------------------------------
G3WKG1_SARHA/170-256--------------------------------------------------------------------------------
B0W823_CULQU/203-284--------------------------------------------------------------------------------
G3TMS7_LOXAF/155-224--------------------------------------------------------------------------------
E9GRB9_DAPPU/217-295--------------------------------------------------------------------------------
A7SDB2_NEMVE/305-377--------------------------------------------------------------------------------
R4GKL3_CHICK/104-172--------------------------------------------------------------------------------
C3XTR1_BRAFL/68-139--------------------------------------------------------------------------------
W5L176_ASTMX/149-222--------------------------------------------------------------------------------
E2BH42_HARSA/257-346--------------------------------------------------------------------------------
F6V5H1_HORSE/2-88--------------------------------------------------------------------------------
G5C5W1_HETGA/214-299--------------------------------------------------------------------------------
G6DKG1_DANPL/42-127--------------------------------------------------------------------------------
R4G959_ANOCA/385-467--------------------------------------------------------------------------------
W5PR72_SHEEP/404-501--------------------------------------------------------------------------------
W5M0S1_LEPOC/3938-4013--------------------------------------------------------------------------------
B0WAZ0_CULQU/89-163--------------------------------------------------------------------------------
F4WYU8_ACREC/5120-5192--------------------------------------------------------------------------------
F7EI49_XENTR/201-271--------------------------------------------------------------------------------
G3UCU3_LOXAF/24-87--------------------------------------------------------------------------------
F7B359_HORSE/474-547--------------------------------------------------------------------------------
F1MYJ5_BOVIN/112-185--------------------------------------------------------------------------------
E5SCK7_TRISP/943-1011--------------------------------------------------------------------------------
L9L7I2_TUPCH/578-652--------------------------------------------------------------------------------
H9JF36_BOMMO/227-305--------------------------------------------------------------------------------
I1FA73_AMPQE/139-217--------------------------------------------------------------------------------
H9JLG2_BOMMO/434-516--------------------------------------------------------------------------------
I1FMF7_AMPQE/1385-1475--------------------------------------------------------------------------------
G1KIU8_ANOCA/239-312--------------------------------------------------------------------------------
H2M9X3_ORYLA/71-150--------------------------------------------------------------------------------
E2BUG1_HARSA/323-401--------------------------------------------------------------------------------
E9IXQ1_SOLIN/94-171--------------------------------------------------------------------------------
F6RH77_XENTR/4079-4153--------------------------------------------------------------------------------
F4C0V0_METCG/1785-1853--------------------------------------------------------------------------------
H2ZZW2_LATCH/63-137--------------------------------------------------------------------------------
H0WPD4_OTOGA/398-489--------------------------------------------------------------------------------
C3ZMZ2_BRAFL/240-316--------------------------------------------------------------------------------
E1FJS4_LOALO/417-493--------------------------------------------------------------------------------
W5NAA9_LEPOC/139-219--------------------------------------------------------------------------------
T1G7B8_HELRO/226-303--------------------------------------------------------------------------------
G6D453_DANPL/281-350--------------------------------------------------------------------------------
I3KU66_ORENI/203-286--------------------------------------------------------------------------------
W5M153_LEPOC/2152-2229--------------------------------------------------------------------------------
K7E183_MONDO/335-409--------------------------------------------------------------------------------
D6WUX6_TRICA/1036-1122--------------------------------------------------------------------------------
H9JIU0_BOMMO/441-511--------------------------------------------------------------------------------
T1JY17_TETUR/289-359--------------------------------------------------------------------------------
H3ECZ2_PRIPA/106-182--------------------------------------------------------------------------------
T1JFS9_STRMM/113-185--------------------------------------------------------------------------------
K1PMJ2_CRAGI/222-290--------------------------------------------------------------------------------
W5LBA6_ASTMX/1097-1174--------------------------------------------------------------------------------
B7PZR6_IXOSC/1264-1340--------------------------------------------------------------------------------
I1EDT6_AMPQE/278-356--------------------------------------------------------------------------------
W5M0S1_LEPOC/2162-2241--------------------------------------------------------------------------------
B7PGA6_IXOSC/2036-2116--------------------------------------------------------------------------------
E9FVQ7_DAPPU/235-322--------------------------------------------------------------------------------
K1PPU7_CRAGI/4542-4621--------------------------------------------------------------------------------
G4VB40_SCHMA/199-282--------------------------------------------------------------------------------
G6DIT1_DANPL/2751-2824--------------------------------------------------------------------------------
G4LZT5_SCHMA/152-230--------------------------------------------------------------------------------
F7ACV2_XENTR/75-150--------------------------------------------------------------------------------
F6UN68_CALJA/155-225--------------------------------------------------------------------------------
T1FD50_HELRO/342-429--------------------------------------------------------------------------------
E1BMI5_BOVIN/143-216--------------------------------------------------------------------------------
G3UI37_LOXAF/149-218--------------------------------------------------------------------------------
F6XJC4_XENTR/348-421--------------------------------------------------------------------------------
W5M0S1_LEPOC/2931-3007--------------------------------------------------------------------------------
F1PEU6_CANLF/3803-3880--------------------------------------------------------------------------------
H9JVG8_BOMMO/1263-1341--------------------------------------------------------------------------------
W5KF42_ASTMX/1168-1234--------------------------------------------------------------------------------
C3Z8U0_BRAFL/167-235--------------------------------------------------------------------------------
T1EIZ2_HELRO/95-168--------------------------------------------------------------------------------
F1Q4R3_DANRE/135-207--------------------------------------------------------------------------------
H2RMR3_TAKRU/406-477--------------------------------------------------------------------------------
H2RSI2_TAKRU/314-387--------------------------------------------------------------------------------
F6ZIS0_CIOIN/3211-3286--------------------------------------------------------------------------------
T1J836_STRMM/109-187--------------------------------------------------------------------------------
W5KED2_ASTMX/163-249--------------------------------------------------------------------------------
E1BYQ7_CHICK/2719-2798--------------------------------------------------------------------------------
C3YXP9_BRAFL/407-496--------------------------------------------------------------------------------
T1K8C5_TETUR/449-535--------------------------------------------------------------------------------
F6TLZ2_HORSE/375-448--------------------------------------------------------------------------------
V8NQ86_OPHHA/292-379--------------------------------------------------------------------------------
E2C0D1_HARSA/52-119--------------------------------------------------------------------------------
W5KFF2_ASTMX/142-227--------------------------------------------------------------------------------
G6CIK0_DANPL/333-413--------------------------------------------------------------------------------
W5L7U0_ASTMX/252-331--------------------------------------------------------------------------------
G6CY01_DANPL/72-161--------------------------------------------------------------------------------
T1FRR3_HELRO/64-144--------------------------------------------------------------------------------
I1FMM8_AMPQE/1023-1104--------------------------------------------------------------------------------
F6UVS1_ORNAN/1900-1980--------------------------------------------------------------------------------
X1WX65_ACYPI/14-108--------------------------------------------------------------------------------
V8P7Z0_OPHHA/288-365--------------------------------------------------------------------------------
E0VDC0_PEDHC/501-572--------------------------------------------------------------------------------
G3IMA0_CRIGR/236-308--------------------------------------------------------------------------------
Q0E9H8_DROME/246-327--------------------------------------------------------------------------------
H2N299_ORYLA/2348-2426--------------------------------------------------------------------------------
B7QG16_IXOSC/472-551--------------------------------------------------------------------------------
H3AVP4_LATCH/357-433--------------------------------------------------------------------------------
C3ZUH1_BRAFL/228-299--------------------------------------------------------------------------------
G1N5Z4_MELGA/1555-1629--------------------------------------------------------------------------------
U3JNU8_FICAL/142-213--------------------------------------------------------------------------------
B7QG14_IXOSC/22-101--------------------------------------------------------------------------------
D6WKD8_TRICA/1040-1116--------------------------------------------------------------------------------
T1GUI0_MEGSC/964-1046--------------------------------------------------------------------------------
H9KZA3_CHICK/519-594--------------------------------------------------------------------------------
E2AJZ4_CAMFO/103-176--------------------------------------------------------------------------------
T1FPW8_HELRO/408-484--------------------------------------------------------------------------------
H3CPR0_TETNG/17-88--------------------------------------------------------------------------------
L9LBG8_TUPCH/85-158--------------------------------------------------------------------------------
G1T5L9_RABIT/136-203--------------------------------------------------------------------------------
B7PTR3_IXOSC/179-258--------------------------------------------------------------------------------
E0VLF8_PEDHC/208-290--------------------------------------------------------------------------------
H9JRT0_BOMMO/2182-2254--------------------------------------------------------------------------------
T1KG58_TETUR/4-82--------------------------------------------------------------------------------
G4VTL1_SCHMA/2296-2370--------------------------------------------------------------------------------
G8NZI3_GRAMM/861-930--------------------------------------------------------------------------------
I3MFI4_ICTTR/4078-4152--------------------------------------------------------------------------------
T1EE45_HELRO/592-667--------------------------------------------------------------------------------
I1GBN4_AMPQE/455-539--------------------------------------------------------------------------------
K1PHQ7_CRAGI/384-465--------------------------------------------------------------------------------
G3GT78_CRIGR/242-336--------------------------------------------------------------------------------
E2ACI8_CAMFO/258-341--------------------------------------------------------------------------------
J9KTT8_ACYPI/27-111--------------------------------------------------------------------------------
H2MVA6_ORYLA/3476-3554--------------------------------------------------------------------------------
A0A068YAL3_ECHMU/5182-5262--------------------------------------------------------------------------------
F5HLD4_ANOGA/2744-2821--------------------------------------------------------------------------------
L9L8V9_TUPCH/591-661--------------------------------------------------------------------------------
F7EAV6_XENTR/1634-1711--------------------------------------------------------------------------------
T1I8U8_RHOPR/202-281--------------------------------------------------------------------------------
G6CNA5_DANPL/356-441--------------------------------------------------------------------------------
T1IT85_STRMM/3332-3409--------------------------------------------------------------------------------
H9GNS4_ANOCA/9-84--------------------------------------------------------------------------------
I3J4E4_ORENI/202-287--------------------------------------------------------------------------------
W5L708_ASTMX/11776-11853--------------------------------------------------------------------------------
F6V7S7_XENTR/23-92--------------------------------------------------------------------------------
G8NZI3_GRAMM/1037-1118--------------------------------------------------------------------------------
U3J705_ANAPL/135-215--------------------------------------------------------------------------------
Q5HZT7_XENTR/192-263--------------------------------------------------------------------------------
H9GRW9_ANOCA/222-299--------------------------------------------------------------------------------
E0VID6_PEDHC/441-517--------------------------------------------------------------------------------
B7QEV0_IXOSC/380-460--------------------------------------------------------------------------------
M3ZPM7_XIPMA/213-275--------------------------------------------------------------------------------
W5LWV7_LEPOC/123-197--------------------------------------------------------------------------------
W5MDW3_LEPOC/94-164--------------------------------------------------------------------------------
A4IHA8_XENTR/241-318--------------------------------------------------------------------------------
T1JCN0_STRMM/244-322--------------------------------------------------------------------------------
H2MNH7_ORYLA/1958-2038--------------------------------------------------------------------------------
K1QUM5_CRAGI/1472-1556--------------------------------------------------------------------------------
W5MAR0_LEPOC/224-298--------------------------------------------------------------------------------
W5K1J5_ASTMX/1701-1781--------------------------------------------------------------------------------
G3QCN7_GASAC/218-299--------------------------------------------------------------------------------
F7CCL4_XENTR/518-592--------------------------------------------------------------------------------
W5MHI8_LEPOC/218-290--------------------------------------------------------------------------------
T1K775_TETUR/221-298--------------------------------------------------------------------------------
E2AWE3_CAMFO/1589-1660--------------------------------------------------------------------------------
I1EUK9_AMPQE/107-173--------------------------------------------------------------------------------
F7DQG0_ORNAN/295-375--------------------------------------------------------------------------------
H8KUV5_SOLCM/135-222--------------------------------------------------------------------------------
J9K8R8_ACYPI/2483-2554--------------------------------------------------------------------------------
D6W7B4_TRICA/746-823--------------------------------------------------------------------------------
H9G942_ANOCA/310-381--------------------------------------------------------------------------------
I1F668_AMPQE/78-157--------------------------------------------------------------------------------
C3ZLK5_BRAFL/108-179--------------------------------------------------------------------------------
E5SMS4_TRISP/87-165--------------------------------------------------------------------------------
G1KJ63_ANOCA/148-223--------------------------------------------------------------------------------
B7PCC7_IXOSC/59-142--------------------------------------------------------------------------------
G6CLL7_DANPL/1693-1775--------------------------------------------------------------------------------
Q7Q1P7_ANOGA/394-478--------------------------------------------------------------------------------
T1JH06_STRMM/2083-2160--------------------------------------------------------------------------------
T1K7L7_TETUR/147-226--------------------------------------------------------------------------------
I1G414_AMPQE/3855-3940--------------------------------------------------------------------------------
H3B413_LATCH/246-318--------------------------------------------------------------------------------
C3YDS8_BRAFL/342-413--------------------------------------------------------------------------------
B7QKN8_IXOSC/208-290--------------------------------------------------------------------------------
K9J7I5_XENTR/316-389--------------------------------------------------------------------------------
F6UXF9_CANLF/1172-1248--------------------------------------------------------------------------------
W5M1J2_LEPOC/1180-1257--------------------------------------------------------------------------------
W5NCC6_LEPOC/202-279--------------------------------------------------------------------------------
W5KK86_ASTMX/392-467--------------------------------------------------------------------------------
W5M0S1_LEPOC/2351-2429--------------------------------------------------------------------------------
B3SB71_TRIAD/103-185--------------------------------------------------------------------------------
G4V6Y5_SCHMA/414-494--------------------------------------------------------------------------------
W5KJR4_ASTMX/2201-2279--------------------------------------------------------------------------------
B7QLF1_IXOSC/480-560--------------------------------------------------------------------------------
W5JP69_ANODA/328-432--------------------------------------------------------------------------------
E4XJ18_OIKDI/2225-2302--------------------------------------------------------------------------------
H2LYU8_ORYLA/1716-1796--------------------------------------------------------------------------------
B7PZA3_IXOSC/295-377--------------------------------------------------------------------------------
B0WFY4_CULQU/360-439--------------------------------------------------------------------------------
W5M081_LEPOC/308-380--------------------------------------------------------------------------------
E4XZR9_OIKDI/8-89--------------------------------------------------------------------------------
B3RXE3_TRIAD/79-153--------------------------------------------------------------------------------
C3YXR0_BRAFL/167-242--------------------------------------------------------------------------------
H3AL76_LATCH/295-386--------------------------------------------------------------------------------
C3XTK7_BRAFL/438-526--------------------------------------------------------------------------------
T1K8A2_TETUR/540-621--------------------------------------------------------------------------------
E3MB16_CAERE/160-235--------------------------------------------------------------------------------
H2M2I2_ORYLA/222-298--------------------------------------------------------------------------------
L5JX10_PTEAL/13-92--------------------------------------------------------------------------------
M4ACS4_XIPMA/507-581--------------------------------------------------------------------------------
J9K4X0_ACYPI/654-728--------------------------------------------------------------------------------
H2SEP9_TAKRU/419-493--------------------------------------------------------------------------------
F6U8N8_MONDO/388-479--------------------------------------------------------------------------------
G3VCI8_SARHA/56-131--------------------------------------------------------------------------------
Q17J18_AEDAE/403-485--------------------------------------------------------------------------------
E5S0Y3_TRISP/360-446--------------------------------------------------------------------------------
L5LCY1_MYODS/209-288--------------------------------------------------------------------------------
H2LJX6_ORYLA/45-125--------------------------------------------------------------------------------
B3RXE3_TRIAD/359-437--------------------------------------------------------------------------------
A0A068XX77_ECHMU/675-759--------------------------------------------------------------------------------
U3J4T8_ANAPL/404-505--------------------------------------------------------------------------------
G3SP45_LOXAF/30-95--------------------------------------------------------------------------------
E5T119_TRISP/414-491--------------------------------------------------------------------------------
B7PP06_IXOSC/326-407--------------------------------------------------------------------------------
T1G5D4_HELRO/283-360--------------------------------------------------------------------------------
F6VRV4_ORNAN/899-976--------------------------------------------------------------------------------
W5MDC5_LEPOC/210-287--------------------------------------------------------------------------------
A0A0K0J5D6_BRUMA/298-374--------------------------------------------------------------------------------
B7P248_IXOSC/242-325--------------------------------------------------------------------------------
A7RTK0_NEMVE/1-69--------------------------------------------------------------------------------
K1PLS6_CRAGI/155-230--------------------------------------------------------------------------------
W0J8I4_9BACT/142-211--------------------------------------------------------------------------------
G1LZW4_AILME/22-89--------------------------------------------------------------------------------
F1N2U9_BOVIN/258-329--------------------------------------------------------------------------------
C3XUV8_BRAFL/447-536--------------------------------------------------------------------------------
M3XL55_LATCH/136-218--------------------------------------------------------------------------------
E9HQ16_DAPPU/466-542--------------------------------------------------------------------------------
A0A0R4ICM3_DANRE/121-184--------------------------------------------------------------------------------
H2KQX2_CLOSI/34-117--------------------------------------------------------------------------------
A7RGL5_NEMVE/39-125--------------------------------------------------------------------------------
F6ZIH2_CIOIN/1610-1687--------------------------------------------------------------------------------
W0JC77_9BACT/661-730--------------------------------------------------------------------------------
A7SM80_NEMVE/331-409--------------------------------------------------------------------------------
E9HA86_DAPPU/251-351--------------------------------------------------------------------------------
G0PAG5_CAEBE/10-90--------------------------------------------------------------------------------
W4Y7I7_STRPU/821-894--------------------------------------------------------------------------------
G1KJS1_ANOCA/217-304--------------------------------------------------------------------------------
U1MCJ1_ASCSU/181-256--------------------------------------------------------------------------------
H3B7Z3_LATCH/100-168--------------------------------------------------------------------------------
G3WCD5_SARHA/148-228--------------------------------------------------------------------------------
F6X3H7_MONDO/253-326--------------------------------------------------------------------------------
D6WDF5_TRICA/1187-1265--------------------------------------------------------------------------------
F1Q990_DANRE/17-80--------------------------------------------------------------------------------
H9JSP1_BOMMO/135-217--------------------------------------------------------------------------------
G0MSS0_CAEBE/343-409--------------------------------------------------------------------------------
Q7PRJ5_ANOGA/232-309--------------------------------------------------------------------------------
I3M9C7_ICTTR/133-200--------------------------------------------------------------------------------
F6ZIH2_CIOIN/4114-4189--------------------------------------------------------------------------------
CNTN3_MOUSE/226-301--------------------------------------------------------------------------------
T1IKD2_STRMM/4014-4085--------------------------------------------------------------------------------
G3PKQ2_GASAC/261-326--------------------------------------------------------------------------------
C3XX56_BRAFL/47-126--------------------------------------------------------------------------------
G3VIH6_SARHA/137-205--------------------------------------------------------------------------------
F7EK98_ORNAN/32-101--------------------------------------------------------------------------------
E5SV26_TRISP/61-146--------------------------------------------------------------------------------
A7SC07_NEMVE/298-371--------------------------------------------------------------------------------
D6W6I2_TRICA/424-502--------------------------------------------------------------------------------
A7SM30_NEMVE/5-88--------------------------------------------------------------------------------
G7Y541_CLOSI/473-571--------------------------------------------------------------------------------
E9HXQ8_DAPPU/828-897--------------------------------------------------------------------------------
A7RTJ3_NEMVE/14-85--------------------------------------------------------------------------------
F4C0V0_METCG/1275-1343--------------------------------------------------------------------------------
I3KF22_ORENI/33-135--------------------------------------------------------------------------------
W4XD41_STRPU/227-300--------------------------------------------------------------------------------
G3H8W7_CRIGR/502-582--------------------------------------------------------------------------------
A7RK32_NEMVE/535-622--------------------------------------------------------------------------------
B4R3I9_DROSI/2489-2560--------------------------------------------------------------------------------
B7PZA3_IXOSC/482-563--------------------------------------------------------------------------------
C3Z2E6_BRAFL/201-280--------------------------------------------------------------------------------
K7E4G5_MONDO/151-223--------------------------------------------------------------------------------
K1QG34_CRAGI/1277-1359--------------------------------------------------------------------------------
D1ZZM3_TRICA/258-339--------------------------------------------------------------------------------
H2NZ13_PONAB/328-401--------------------------------------------------------------------------------
E0VFB0_PEDHC/422-519--------------------------------------------------------------------------------
A0A068XWB2_ECHMU/170-257--------------------------------------------------------------------------------
E9IXQ1_SOLIN/187-276--------------------------------------------------------------------------------
K1Q231_CRAGI/36-115--------------------------------------------------------------------------------
G4VTL1_SCHMA/808-886--------------------------------------------------------------------------------
A7RTK2_NEMVE/210-279--------------------------------------------------------------------------------
M4AH78_XIPMA/124-206--------------------------------------------------------------------------------
F6PRZ7_PIG/22-87--------------------------------------------------------------------------------
T1HS47_RHOPR/189-273--------------------------------------------------------------------------------
T1EPX6_HELRO/284-366--------------------------------------------------------------------------------
G6D6E0_DANPL/25-101--------------------------------------------------------------------------------
G1MB33_AILME/156-226--------------------------------------------------------------------------------
V8P9I2_OPHHA/300-401--------------------------------------------------------------------------------
G4VTL1_SCHMA/1250-1326--------------------------------------------------------------------------------
H2SLF1_TAKRU/3235-3314--------------------------------------------------------------------------------
B7QFW9_IXOSC/245-331--------------------------------------------------------------------------------
W5NBM8_LEPOC/100-168--------------------------------------------------------------------------------
G0N7L5_CAEBE/373-461--------------------------------------------------------------------------------
K1PWJ2_CRAGI/432-504--------------------------------------------------------------------------------
H3ESK0_PRIPA/55-129--------------------------------------------------------------------------------
I1FDC0_AMPQE/238-314--------------------------------------------------------------------------------
R4GA01_ANOCA/88-159--------------------------------------------------------------------------------
G1MCG3_AILME/310-392--------------------------------------------------------------------------------
K1QUM5_CRAGI/1371-1455--------------------------------------------------------------------------------
E9H2Z4_DAPPU/26-103--------------------------------------------------------------------------------
G7NVA5_MACFA/379-452--------------------------------------------------------------------------------
C3Z0D1_BRAFL/22979-23058--------------------------------------------------------------------------------
H0YZQ8_TAEGU/431-506--------------------------------------------------------------------------------
C3ZLK7_BRAFL/234-324--------------------------------------------------------------------------------
Q7QEY7_ANOGA/436-522--------------------------------------------------------------------------------
H2SLF1_TAKRU/611-685--------------------------------------------------------------------------------
F6YUF9_MONDO/177-249--------------------------------------------------------------------------------
U3JNR6_FICAL/230-301--------------------------------------------------------------------------------
F7IRU1_CALJA/5-77--------------------------------------------------------------------------------
C3ZLK8_BRAFL/486-576--------------------------------------------------------------------------------
J9AZ69_WUCBA/100-185--------------------------------------------------------------------------------
F7EZJ4_ORNAN/1002-1073--------------------------------------------------------------------------------
C3YXQ8_BRAFL/96-167--------------------------------------------------------------------------------
I3MHN4_ICTTR/103-176--------------------------------------------------------------------------------
K1R6E6_CRAGI/3080-3155--------------------------------------------------------------------------------
T1KYV0_TETUR/25-112--------------------------------------------------------------------------------
F6R7K8_XENTR/390-462--------------------------------------------------------------------------------
F6QG81_MONDO/189-262--------------------------------------------------------------------------------
K7IMB5_NASVI/327-416--------------------------------------------------------------------------------
T1JY17_TETUR/461-546--------------------------------------------------------------------------------
W5KF42_ASTMX/1440-1519--------------------------------------------------------------------------------
T1G0N8_HELRO/163-238--------------------------------------------------------------------------------
K1RR44_CRAGI/119-206--------------------------------------------------------------------------------
G3VNL4_SARHA/21-85--------------------------------------------------------------------------------
C3ZN37_BRAFL/121-187--------------------------------------------------------------------------------
E4XJ18_OIKDI/1536-1612--------------------------------------------------------------------------------
G3N8U3_GASAC/217-308--------------------------------------------------------------------------------
A0A068YCC0_ECHMU/283-367--------------------------------------------------------------------------------
E0VRV3_PEDHC/1213-1286--------------------------------------------------------------------------------
B7PP06_IXOSC/801-873--------------------------------------------------------------------------------
A7SFR7_NEMVE/253-323--------------------------------------------------------------------------------
H3BAI8_LATCH/287-362--------------------------------------------------------------------------------
C3Y1E9_BRAFL/344-426--------------------------------------------------------------------------------
H0ZFG4_TAEGU/86-168--------------------------------------------------------------------------------
W4YB68_STRPU/783-864--------------------------------------------------------------------------------
G6DLT7_DANPL/13012-13087--------------------------------------------------------------------------------
H2LE04_ORYLA/41-122--------------------------------------------------------------------------------
B1ZVP5_OPITP/590-660--------------------------------------------------------------------------------
T1ILZ8_STRMM/140-215--------------------------------------------------------------------------------
T1KU72_TETUR/1169-1256--------------------------------------------------------------------------------
H0Z2N0_TAEGU/381-453--------------------------------------------------------------------------------
W5M1P7_LEPOC/1755-1835--------------------------------------------------------------------------------
W4Y286_STRPU/107-184--------------------------------------------------------------------------------
G1LXN2_AILME/203-283--------------------------------------------------------------------------------
W4Y7I7_STRPU/3060-3136--------------------------------------------------------------------------------
B4MQT4_DROWI/1713-1793--------------------------------------------------------------------------------
A7S2I3_NEMVE/413-494--------------------------------------------------------------------------------
E9HF28_DAPPU/210-287--------------------------------------------------------------------------------
T1IB90_RHOPR/155-237--------------------------------------------------------------------------------
H8KUV5_SOLCM/425-492--------------------------------------------------------------------------------
I1EDT6_AMPQE/179-262--------------------------------------------------------------------------------
L9JDM5_TUPCH/1203-1276--------------------------------------------------------------------------------
H3AD53_LATCH/167-244--------------------------------------------------------------------------------
T1HGX0_RHOPR/371-448--------------------------------------------------------------------------------
T1IYV4_STRMM/278-359--------------------------------------------------------------------------------
W4Z4T9_STRPU/3645-3725--------------------------------------------------------------------------------
H2YDX9_CIOSA/35-129--------------------------------------------------------------------------------
B3S5W2_TRIAD/308-390--------------------------------------------------------------------------------
H2ZSB0_LATCH/266-348--------------------------------------------------------------------------------
H2RG18_PANTR/241-314--------------------------------------------------------------------------------
H3A7J1_LATCH/331-399--------------------------------------------------------------------------------
A8XPY0_CAEBR/43-134--------------------------------------------------------------------------------
E2RJV2_CANLF/399-486--------------------------------------------------------------------------------
H9JF77_BOMMO/163-238--------------------------------------------------------------------------------
M4A8L5_XIPMA/745-808--------------------------------------------------------------------------------
T1FRE6_HELRO/209-293--------------------------------------------------------------------------------
A4IHA8_XENTR/39-120--------------------------------------------------------------------------------
K1R6E6_CRAGI/3171-3249--------------------------------------------------------------------------------
Q17AE6_AEDAE/1232-1311--------------------------------------------------------------------------------
H3FMD2_PRIPA/16-100--------------------------------------------------------------------------------
H9GCQ6_ANOCA/235-330--------------------------------------------------------------------------------
W5KY85_ASTMX/255-334--------------------------------------------------------------------------------
M4ATB1_XIPMA/211-295--------------------------------------------------------------------------------
K1R2P7_CRAGI/2522-2597--------------------------------------------------------------------------------
G6CPY1_DANPL/598-684--------------------------------------------------------------------------------
H1A1C4_TAEGU/273-355--------------------------------------------------------------------------------
F6UF30_XENTR/102-171--------------------------------------------------------------------------------
D6WF33_TRICA/249-326--------------------------------------------------------------------------------
H3ADQ7_LATCH/479-555--------------------------------------------------------------------------------
T1JQ42_TETUR/2020-2100--------------------------------------------------------------------------------
F6U6Y7_CIOIN/285-367--------------------------------------------------------------------------------
E9HAJ5_DAPPU/201-279--------------------------------------------------------------------------------
L9LBG8_TUPCH/272-345--------------------------------------------------------------------------------
M3WCL1_FELCA/287-358--------------------------------------------------------------------------------
B1ZZE2_OPITP/13037-13105--------------------------------------------------------------------------------
E5ST68_TRISP/3557-3636--------------------------------------------------------------------------------
C3YVN4_BRAFL/419-498--------------------------------------------------------------------------------
J9JKL8_ACYPI/527-605--------------------------------------------------------------------------------
F6UEX7_XENTR/226-295--------------------------------------------------------------------------------
E0VJT8_PEDHC/162-240--------------------------------------------------------------------------------
T1FHE5_HELRO/126-207--------------------------------------------------------------------------------
A7RGM0_NEMVE/524-603--------------------------------------------------------------------------------
E9GND8_DAPPU/74-150--------------------------------------------------------------------------------
J9K5G9_ACYPI/343-417--------------------------------------------------------------------------------
E5ST68_TRISP/1585-1665--------------------------------------------------------------------------------
I3JBE4_ORENI/189-261--------------------------------------------------------------------------------
E9GRE9_DAPPU/3117-3197--------------------------------------------------------------------------------
G3UCU3_LOXAF/453-525--------------------------------------------------------------------------------
K9J7I5_XENTR/409-511--------------------------------------------------------------------------------
E9GRE9_DAPPU/197-274--------------------------------------------------------------------------------
W5JYD2_ASTMX/58-126--------------------------------------------------------------------------------
W5N938_LEPOC/257-346--------------------------------------------------------------------------------
C3ZUH1_BRAFL/401-489--------------------------------------------------------------------------------
E0W006_PEDHC/4478-4556--------------------------------------------------------------------------------
M3ZL70_XIPMA/213-289--------------------------------------------------------------------------------
K1R7L4_CRAGI/219-295--------------------------------------------------------------------------------
T1I5X2_RHOPR/2826-2898--------------------------------------------------------------------------------
Q98173_MCV1/178-253--------------------------------------------------------------------------------
G1MRA1_MELGA/3119-3198--------------------------------------------------------------------------------
I1F9U0_AMPQE/322-405--------------------------------------------------------------------------------
I1FMN0_AMPQE/2116-2202--------------------------------------------------------------------------------
D6W6K8_TRICA/382-467--------------------------------------------------------------------------------
C3Z2E6_BRAFL/392-465--------------------------------------------------------------------------------
D6WF34_TRICA/180-257--------------------------------------------------------------------------------
E4XJ18_OIKDI/803-877--------------------------------------------------------------------------------
H3BH87_LATCH/233-307--------------------------------------------------------------------------------
F6U172_XENTR/290-362--------------------------------------------------------------------------------
F6ZIS0_CIOIN/3857-3932--------------------------------------------------------------------------------
J9JSF2_ACYPI/2135-2210--------------------------------------------------------------------------------
J9K2X1_ACYPI/146-236--------------------------------------------------------------------------------
K1QUM5_CRAGI/1069-1152--------------------------------------------------------------------------------
CXAR_DANRE/147-220--------------------------------------------------------------------------------
G6CML9_DANPL/388-476--------------------------------------------------------------------------------
C3YBK6_BRAFL/146-221--------------------------------------------------------------------------------
F7CT64_XENTR/2365-2444--------------------------------------------------------------------------------
G7YDY5_CLOSI/58-135--------------------------------------------------------------------------------
W4ZEX8_STRPU/302-375--------------------------------------------------------------------------------
W5JL02_ANODA/259-351--------------------------------------------------------------------------------
K1QS90_CRAGI/218-292--------------------------------------------------------------------------------
G4VHK7_SCHMA/549-632--------------------------------------------------------------------------------
K7IX75_NASVI/225-311--------------------------------------------------------------------------------
BASI_CHICK/228-310--------------------------------------------------------------------------------
C3YWU2_BRAFL/443-520--------------------------------------------------------------------------------
W4XLP9_STRPU/324-399--------------------------------------------------------------------------------
D2A0P9_TRICA/372-458--------------------------------------------------------------------------------
X1WJL2_ACYPI/445-520--------------------------------------------------------------------------------
T1L3Z1_TETUR/940-1025--------------------------------------------------------------------------------
H3ACF0_LATCH/2225-2302--------------------------------------------------------------------------------
G3GWW1_CRIGR/399-472--------------------------------------------------------------------------------
G6D136_DANPL/590-663--------------------------------------------------------------------------------
K1R2P7_CRAGI/597-670--------------------------------------------------------------------------------
M3YRV3_MUSPF/155-225--------------------------------------------------------------------------------
J9AER1_WUCBA/39-114--------------------------------------------------------------------------------
H2M9R6_ORYLA/398-471--------------------------------------------------------------------------------
H3ADQ7_LATCH/1408-1488--------------------------------------------------------------------------------
I3IXH5_ORENI/241-338--------------------------------------------------------------------------------
I1FER7_AMPQE/107-184--------------------------------------------------------------------------------

PF00047

FLT3_MOUSE/256-346--------------------------------------------------------------------------------
OX2G_RAT/34-136--------------------------------------------------------------------------------
CEAM1_HUMAN/331-411--------------------------------------------------------------------------------
IGHM_CHICK/220-311--------------------------------------------------------------------------------
IL6RA_MOUSE/30-107--------------------------------------------------------------------------------
KI2S5_HUMAN/132-213--------------------------------------------------------------------------------
NRG_DROME/525-609--------------------------------------------------------------------------------
TIE1_MOUSE/127-208--------------------------------------------------------------------------------
KI2S5_HUMAN/32-115--------------------------------------------------------------------------------
IGHE_MOUSE/209-300--------------------------------------------------------------------------------
CSF1R_FELCA/207-293--------------------------------------------------------------------------------
TIE1_MOUSE/353-439--------------------------------------------------------------------------------
NTRK3_HUMAN/214-299--------------------------------------------------------------------------------
MUCM_RABIT/11-105--------------------------------------------------------------------------------
KIT_HUMAN/216-305--------------------------------------------------------------------------------
SEM3E_MOUSE/585-669--------------------------------------------------------------------------------
FCGR1_MOUSE/204-284--------------------------------------------------------------------------------
FGFR1_CHICK/37-115--------------------------------------------------------------------------------
PGFRB_HUMAN/37-115--------------------------------------------------------------------------------
PTPRM_HUMAN/189-275--------------------------------------------------------------------------------
CD4_MOUSE/25-127--------------------------------------------------------------------------------
OPCM_RAT/227-311--------------------------------------------------------------------------------
IGHD_HUMAN/173-264--------------------------------------------------------------------------------
V055_FOWPN/31-121--------------------------------------------------------------------------------
DIG1_CAEEL/310-389--------------------------------------------------------------------------------
CD33_HUMAN/146-227--------------------------------------------------------------------------------
NRG_DROME/251-332--------------------------------------------------------------------------------
DIG1_CAEEL/1822-1903--------------------------------------------------------------------------------
IL1R2_HUMAN/241-341--------------------------------------------------------------------------------
VCAM1_HUMAN/229-306--------------------------------------------------------------------------------
OX2G_MOUSE/143-229--------------------------------------------------------------------------------
KI3L1_HUMAN/32-110--------------------------------------------------------------------------------
THY1_HUMAN/21-119--------------------------------------------------------------------------------
IL1BP_VACCW/228-322--------------------------------------------------------------------------------

PF13895

NILR1_RAT/28-118--------------------------------------------------------------------------------
F1R1B9_DANRE/305-383--------------------------------------------------------------------------------
M0RCJ0_RAT/127-205--------------------------------------------------------------------------------
IRPL2_HUMAN/143-231--------------------------------------------------------------------------------
CD86_HUMAN/138-236--------------------------------------------------------------------------------
A1BG_HUMAN/209-301--------------------------------------------------------------------------------
PECA1_PIG/327-405--------------------------------------------------------------------------------
PECA1_MOUSE/316-393--------------------------------------------------------------------------------
VS10L_MOUSE/388-477--------------------------------------------------------------------------------
A7T6F1_NEMVE/26-106--------------------------------------------------------------------------------
A7RUN6_NEMVE/106-186--------------------------------------------------------------------------------
A1BG_RAT/218-314--------------------------------------------------------------------------------
D3ZRM2_RAT/20-112--------------------------------------------------------------------------------
Q11VY4_CYTH3/701-789--------------------------------------------------------------------------------
A6GXG9_FLAPJ/1010-1093--------------------------------------------------------------------------------
FCRLB_HUMAN/22-100--------------------------------------------------------------------------------
IL1R1_RAT/122-217--------------------------------------------------------------------------------
GP42_RAT/22-108--------------------------------------------------------------------------------
A6QQQ4_BOVIN/113-195--------------------------------------------------------------------------------
ILRL2_RAT/126-220--------------------------------------------------------------------------------
A7SZF2_NEMVE/222-298--------------------------------------------------------------------------------
A1SP19_NOCSJ/451-536--------------------------------------------------------------------------------
C3XPD2_BRAFL/8-98--------------------------------------------------------------------------------
B7Q9Q6_IXOSC/51-137--------------------------------------------------------------------------------
B3RLN9_TRIAD/257-344--------------------------------------------------------------------------------
A7SRI5_NEMVE/63-151--------------------------------------------------------------------------------
E9PD35_HUMAN/138-224--------------------------------------------------------------------------------
E9PX73_MOUSE/46-128--------------------------------------------------------------------------------
F1P3W0_CHICK/181-268--------------------------------------------------------------------------------
F6QPE0_BOVIN/327-404--------------------------------------------------------------------------------
F7DLW8_HORSE/326-403--------------------------------------------------------------------------------
G1L4E1_AILME/105-189--------------------------------------------------------------------------------
G1L7T4_AILME/329-410--------------------------------------------------------------------------------
G1M3E0_AILME/129-211--------------------------------------------------------------------------------
G1M8A4_AILME/973-1063--------------------------------------------------------------------------------
H2NXI9_PONAB/312-389--------------------------------------------------------------------------------
H2RC57_PANTR/28-117--------------------------------------------------------------------------------
H3CGE1_TETNG/471-557--------------------------------------------------------------------------------
M3XWI6_MUSPF/119-204--------------------------------------------------------------------------------
LIRB5_HUMAN/28-115--------------------------------------------------------------------------------
PECA1_HUMAN/327-404--------------------------------------------------------------------------------

PF07686

TVB8_MOUSE/25-130--------------------------------------------------------------------------------
MPZL2_HUMAN/30-143--------------------------------------------------------------------------------
IGS11_HUMAN/27-141--------------------------------------------------------------------------------
TVB1_MOUSE/25-132--------------------------------------------------------------------------------
CD2_HORSE/25-122--------------------------------------------------------------------------------
CLM2_MOUSE/19-124--------------------------------------------------------------------------------
GPA33_HUMAN/25-138--------------------------------------------------------------------------------
TVA2_MOUSE/26-132--------------------------------------------------------------------------------
TVB1_HUMAN/25-135--------------------------------------------------------------------------------
HVM07_MOUSE/24-138--------------------------------------------------------------------------------
LV603_HUMAN/5-110--------------------------------------------------------------------------------
Q9UEL6_HUMAN/15-129--------------------------------------------------------------------------------
MO2R1_MOUSE/42-147--------------------------------------------------------------------------------
SHPS1_BOVIN/38-145--------------------------------------------------------------------------------
CD2_MOUSE/23-121--------------------------------------------------------------------------------
TIMD4_HUMAN/23-128--------------------------------------------------------------------------------
TVC_HUMAN/24-136--------------------------------------------------------------------------------
FAIM3_HUMAN/19-123--------------------------------------------------------------------------------
TVA2_HUMAN/32-138--------------------------------------------------------------------------------
HV108_HUMAN/5-119--------------------------------------------------------------------------------
CEA21_HUMAN/38-141--------------------------------------------------------------------------------
CSPG2_MOUSE/27-148--------------------------------------------------------------------------------
SIGL5_HUMAN/24-140--------------------------------------------------------------------------------
VSIG1_CHICK/26-136--------------------------------------------------------------------------------
HV107_HUMAN/5-115--------------------------------------------------------------------------------
TVB5_MOUSE/14-122--------------------------------------------------------------------------------
CXAR_DANRE/28-142--------------------------------------------------------------------------------
CEAM4_HUMAN/38-141--------------------------------------------------------------------------------
HHLA2_HUMAN/226-330--------------------------------------------------------------------------------
PVRL4_HUMAN/35-146--------------------------------------------------------------------------------
CD8B_FELCA/24-135--------------------------------------------------------------------------------
SKIT3_MOUSE/32-141--------------------------------------------------------------------------------
PDCD1_MOUSE/37-145--------------------------------------------------------------------------------
KV123_HUMAN/28-129--------------------------------------------------------------------------------
SCN2B_HUMAN/33-147--------------------------------------------------------------------------------
VSIG2_HUMAN/27-142--------------------------------------------------------------------------------
FCAMR_HUMAN/65-171--------------------------------------------------------------------------------
LV1B_MOUSE/24-128--------------------------------------------------------------------------------
CD8A_MOUSE/36-148--------------------------------------------------------------------------------
CLM5_MOUSE/23-126--------------------------------------------------------------------------------
JAML1_HUMAN/25-136--------------------------------------------------------------------------------
BTNLA_MOUSE/37-146--------------------------------------------------------------------------------
TVB6_MOUSE/27-136--------------------------------------------------------------------------------
CD7_HUMAN/31-132--------------------------------------------------------------------------------
TVA1_HUMAN/25-131--------------------------------------------------------------------------------
CD2_HUMAN/28-127--------------------------------------------------------------------------------
TVA1_MOUSE/25-130--------------------------------------------------------------------------------
CD2_RAT/23-120--------------------------------------------------------------------------------
SCN3B_MOUSE/28-143--------------------------------------------------------------------------------
VPREB_HUMAN/24-134--------------------------------------------------------------------------------
TREM1_MOUSE/25-134--------------------------------------------------------------------------------
SCN1B_HUMAN/23-139--------------------------------------------------------------------------------
Q9R121_RAT/32-135--------------------------------------------------------------------------------
SIRPD_HUMAN/34-140--------------------------------------------------------------------------------
MXRA8_HUMAN/168-292--------------------------------------------------------------------------------
A2BGB5_DANRE/30-142--------------------------------------------------------------------------------
B8ZZZ4_HUMAN/29-130--------------------------------------------------------------------------------
F1NMT9_CHICK/44-146--------------------------------------------------------------------------------
F1P992_CANLF/18-131--------------------------------------------------------------------------------
F6RFK3_CHICK/32-139--------------------------------------------------------------------------------
A0A096MJE4_RAT/42-151--------------------------------------------------------------------------------
L8YBJ5_TUPCH/164-276--------------------------------------------------------------------------------
M0QX98_HUMAN/6-107--------------------------------------------------------------------------------
CD8B_RAT/24-134--------------------------------------------------------------------------------
Q3LFS9_MOUSE/42-141--------------------------------------------------------------------------------
Q8BNV8_MOUSE/24-121--------------------------------------------------------------------------------
Q8K094_MOUSE/37-141--------------------------------------------------------------------------------
Q9JHL7_RAT/42-140--------------------------------------------------------------------------------

PF16706

G1TVX5_RABIT/169-255--------------------------------------------------------------------------------
F6YE25_HORSE/168-255--------------------------------------------------------------------------------
H0UTJ7_CAVPO/168-255--------------------------------------------------------------------------------
F6UM65_CANLF/166-252--------------------------------------------------------------------------------
M3W7L5_FELCA/169-256--------------------------------------------------------------------------------
H9H653_MONDO/206-293--------------------------------------------------------------------------------
V8PHR1_OPHHA/159-245--------------------------------------------------------------------------------
L5LHN8_MYODS/162-249--------------------------------------------------------------------------------
H0WN21_OTOGA/168-255--------------------------------------------------------------------------------
IZUM1_MOUSE/168-255--------------------------------------------------------------------------------
G3TPD8_LOXAF/168-255--------------------------------------------------------------------------------
IZUM1_RAT/168-255--------------------------------------------------------------------------------
I3MLV0_ICTTR/170-257--------------------------------------------------------------------------------
G1M882_AILME/167-254--------------------------------------------------------------------------------
G1QXF7_NOMLE/168-255--------------------------------------------------------------------------------
W5PRD0_SHEEP/169-256--------------------------------------------------------------------------------
H3DD44_TETNG/58-151--------------------------------------------------------------------------------

PF11465

CD244_HUMAN/22-127--------------------------------------------------------------------------------
CD244_RAT/22-128--------------------------------------------------------------------------------
CD244_MOUSE/22-129--------------------------------------------------------------------------------

PF08204

O57240_9POXV/2-124--------------------------------------------------------------------------------
CD47_BOVIN/8-140--------------------------------------------------------------------------------
Q9DHI5_YLDV/7-104--------------------------------------------------------------------------------
CD47_HUMAN/8-142--------------------------------------------------------------------------------
Q8JTQ3_LSDV/14-122--------------------------------------------------------------------------------
Q5ZL65_CHICK/8-141--------------------------------------------------------------------------------
Q9Q8V0_RFVKA/10-120--------------------------------------------------------------------------------
Q9D9W5_MOUSE/8-139--------------------------------------------------------------------------------
Q8V3H1_SWPV1/6-113--------------------------------------------------------------------------------
Q6TUP1_YMTV5/1-98--------------------------------------------------------------------------------
A8VKH9_PIG/8-140--------------------------------------------------------------------------------
B2CWN5_9POXV/1-111--------------------------------------------------------------------------------

PF16758

UL14_HCMVM/48-234--------------------------------------------------------------------------------
UL141_HCMVM/51-241--------------------------------------------------------------------------------

PF05790

CD2_HUMAN/135-205--------------------------------------------------------------------------------
Q8K0X1_MOUSE/133-221--------------------------------------------------------------------------------
CD4_RAT/316-390--------------------------------------------------------------------------------
CD4_SAISC/125-202--------------------------------------------------------------------------------
VCAM1_HUMAN/133-221--------------------------------------------------------------------------------
CD4_RABIT/318-390--------------------------------------------------------------------------------
CD2_RAT/128-198--------------------------------------------------------------------------------
VCAM1_CANLF/133-221--------------------------------------------------------------------------------
CD4_RAT/127-206--------------------------------------------------------------------------------
Q9GKR2_BOVIN/134-222--------------------------------------------------------------------------------
CD4_RABIT/129-208--------------------------------------------------------------------------------
CD2_MOUSE/129-199--------------------------------------------------------------------------------
VCAM1_CANLF/421-509--------------------------------------------------------------------------------
VCAM1_RAT/133-221--------------------------------------------------------------------------------
CD4_CANLF/133-211--------------------------------------------------------------------------------
Q9GKR2_BOVIN/422-510--------------------------------------------------------------------------------
O55054_MOUSE/104-183--------------------------------------------------------------------------------
P79355_FELCA/332-405--------------------------------------------------------------------------------
CD4_CANLF/321-392--------------------------------------------------------------------------------
VCAM1_RAT/421-509--------------------------------------------------------------------------------
CD4_DELLE/314-387--------------------------------------------------------------------------------
Q28939_PIG/134-219--------------------------------------------------------------------------------
O88650_MARMO/10-83--------------------------------------------------------------------------------
P70443_MOUSE/8-81--------------------------------------------------------------------------------
CD2_HORSE/130-201--------------------------------------------------------------------------------
CD4_DELLE/125-203--------------------------------------------------------------------------------
P79355_FELCA/144-222--------------------------------------------------------------------------------

PF02440

Q4KSJ0_9ADEN/110-200--------------------------------------------------------------------------------
Q91CB8_ADE08/236-321--------------------------------------------------------------------------------
Q80IV8_ADE08/252-335--------------------------------------------------------------------------------
Q91PL0_9ADEN/13-104--------------------------------------------------------------------------------
Q6QPD0_9ADEN/15-113--------------------------------------------------------------------------------
Q6H1B4_9ADEN/16-113--------------------------------------------------------------------------------
Q3ZKT4_9ADEN/13-104--------------------------------------------------------------------------------
Q76C87_ADE08/128-219--------------------------------------------------------------------------------
E3TMR2_ADE16/13-100--------------------------------------------------------------------------------
Q8JZH7_ADE17/110-200--------------------------------------------------------------------------------
E321_ADE35/14-100--------------------------------------------------------------------------------
Q7TBH0_ADE08/34-124--------------------------------------------------------------------------------
B9A5V9_9ADEN/260-345--------------------------------------------------------------------------------
Q8JZH7_ADE17/15-105--------------------------------------------------------------------------------
Q6QP93_9ADEN/15-105--------------------------------------------------------------------------------
Q8UY72_9ADEN/16-114--------------------------------------------------------------------------------
B9A5V9_9ADEN/110-200--------------------------------------------------------------------------------
Q4KSJ0_9ADEN/254-339--------------------------------------------------------------------------------
Q6QPD1_9ADEN/15-112--------------------------------------------------------------------------------
Q91CB6_ADE09/110-200--------------------------------------------------------------------------------

PF15910

F1NL21_CHICK/43-155--------------------------------------------------------------------------------
G1L868_AILME/23-135--------------------------------------------------------------------------------
F6ZKL5_HORSE/23-134--------------------------------------------------------------------------------
G5BKP1_HETGA/16-127--------------------------------------------------------------------------------
H0VT36_CAVPO/23-134--------------------------------------------------------------------------------
I3LV71_PIG/23-135--------------------------------------------------------------------------------
ICOS_MOUSE/23-135--------------------------------------------------------------------------------
ICOS_HUMAN/23-134--------------------------------------------------------------------------------

PF02480

GE_PSHV1/44-516SLRRTLPAGGTFKWVLVLSDPC....APKPTEICVSVGHCFYDLVSSDNDSECANKDRRVLTLALLTKSKTGELRVIGPM
GE_HHV2H/57-501PLDACGPLRPS..WVALWPPRR..................VLETVVD...AAC....MRAPEP.......LAIAYSPPFP
GE_HHV11/59-506PLDGCGPLHPS..WVSLMPPKQ..................VPETVVD...AAC....MRAPVP.......LAMAYAPPAP
GE_VZVD/193-615....GVRYTET..WSFLPSLTCTGDAAPAIQHICLKHTTCFQDVVVD...VDCAENTKEDQLA.........EISYRFQG
GE_GAHVM/41-479PVVDGTLYTET..WTWIPNHCN....ETATGYVCLESAHCFTDLILG...VSCMRYADEIVLR.......TDKFIVDAGS

PF01688

GI_HHV2H/8-165--------------------------------------------------------------------------------
GI_GAHVM/2-157--------------------------------------------------------------------------------
GI_PSHV1/10-157--------------------------------------------------------------------------------
GI_VZVD/7-164--------------------------------------------------------------------------------
GI_HHV11/8-165--------------------------------------------------------------------------------

PF01537

K4P3S4_9ALPH/66-190--------------------------------------------------------------------------------
Q86788_FHV1/60-176--------------------------------------------------------------------------------
Q67644_ILTV/108-239--------------------------------------------------------------------------------
GD_SUHVR/56-181--------------------------------------------------------------------------------
GD_EHV1D/129-252--------------------------------------------------------------------------------
Q89634_FHV1/69-193--------------------------------------------------------------------------------
O41524_9ALPH/49-174--------------------------------------------------------------------------------
GD_HHV1P/82-206--------------------------------------------------------------------------------
GD_CHV1/81-206--------------------------------------------------------------------------------
Q67648_9ALPH/79-203--------------------------------------------------------------------------------
Q77L58_MEHV1/64-188--------------------------------------------------------------------------------
O90421_9ALPH/53-169--------------------------------------------------------------------------------
Q5FBC8_9ALPH/54-170--------------------------------------------------------------------------------
O39306_EHV4/54-170--------------------------------------------------------------------------------
Q91E41_9ALPH/52-168--------------------------------------------------------------------------------
O41523_9ALPH/53-168--------------------------------------------------------------------------------
O39504_9ALPH/64-183--------------------------------------------------------------------------------
Q6X201_9ALPH/66-185--------------------------------------------------------------------------------
Q87093_CHV1/74-190--------------------------------------------------------------------------------
Q69367_9ALPH/73-189--------------------------------------------------------------------------------
A7U885_HHV2/81-195--------------------------------------------------------------------------------
Q9QPU9_9ALPH/70-184--------------------------------------------------------------------------------

PF10430

F8W3C8_DANRE/7-103--------------------------------------------------------------------------------
W5M5U9_LEPOC/23-114--------------------------------------------------------------------------------
W5KIA3_ASTMX/20-110--------------------------------------------------------------------------------
Q80YS4_MOUSE/24-118--------------------------------------------------------------------------------
G1KU09_ANOCA/38-132--------------------------------------------------------------------------------
F7EC20_XENTR/25-118--------------------------------------------------------------------------------
H0YT27_TAEGU/25-119--------------------------------------------------------------------------------

PF03921

ICAM3_HUMAN/30-119--------------------------------------------------------------------------------
ICAM2_HUMAN/24-114--------------------------------------------------------------------------------
ICAM2_MOUSE/22-114--------------------------------------------------------------------------------
ICAM1_HUMAN/24-115--------------------------------------------------------------------------------
ICAM1_MOUSE/24-114--------------------------------------------------------------------------------

PF02960

K1_HHV8P/160-279--------------------------------------------------------------------------------

PF05326

Q99N75_MOUSE/3-124--------------------------------------------------------------------------------
Q9D2X6_MOUSE/3-124--------------------------------------------------------------------------------
Q76I99_MOUSE/3-123--------------------------------------------------------------------------------
PIP_RAT/1-126--------------------------------------------------------------------------------
PIP_RABIT/3-126--------------------------------------------------------------------------------
PIP_CAVPO/3-126--------------------------------------------------------------------------------
PIP_BOVIN/3-127--------------------------------------------------------------------------------
E9PX96_MOUSE/10-142--------------------------------------------------------------------------------
G1QRT8_NOMLE/4-126--------------------------------------------------------------------------------
G7P1H3_MACFA/4-126--------------------------------------------------------------------------------
PIP_MOUSE/2-126--------------------------------------------------------------------------------

PF00207

Q29N18_DROPS/678-769--------------------------------------------------------------------------------
CO4A_HUMAN/781-869--------------------------------------------------------------------------------
Q9VIT8_DROME/562-654--------------------------------------------------------------------------------
CO3_MOUSE/770-866--------------------------------------------------------------------------------
CO4B_MOUSE/779-867--------------------------------------------------------------------------------
Q7Q7T0_ANOGA/634-725--------------------------------------------------------------------------------
Q7Q4F0_ANOGA/564-653--------------------------------------------------------------------------------
MUG2_MOUSE/740-830--------------------------------------------------------------------------------
Q7Q4I0_ANOGA/955-1046--------------------------------------------------------------------------------
A2MG_MOUSE/738-828--------------------------------------------------------------------------------
PZP_MOUSE/750-840--------------------------------------------------------------------------------
A2ML1_HUMAN/736-826--------------------------------------------------------------------------------
C3P1_HUMAN/10-104--------------------------------------------------------------------------------
CPMD8_HUMAN/750-841--------------------------------------------------------------------------------
OVOS2_HUMAN/726-816--------------------------------------------------------------------------------
Q0C7A6_AEDAE/183-274--------------------------------------------------------------------------------
A2MG_PONAB/738-828--------------------------------------------------------------------------------
Q16YC2_AEDAE/682-773--------------------------------------------------------------------------------
Q17K56_AEDAE/533-625--------------------------------------------------------------------------------
A7SDN3_NEMVE/771-861--------------------------------------------------------------------------------
CD109_HUMAN/693-784--------------------------------------------------------------------------------
Y3030_RALSO/871-965--------------------------------------------------------------------------------
A5PMP6_DANRE/779-875--------------------------------------------------------------------------------
Q12VC6_METBU/707-796--------------------------------------------------------------------------------
Q3A743_PELCD/1262-1354--------------------------------------------------------------------------------
A7MNC2_CROS8/849-939--------------------------------------------------------------------------------
Q17M04_AEDAE/556-648--------------------------------------------------------------------------------
Q08R52_STIAD/712-804--------------------------------------------------------------------------------
Q1DE47_MYXXD/137-227--------------------------------------------------------------------------------
Q11S66_CYTH3/1263-1352--------------------------------------------------------------------------------
Q025N0_SOLUE/854-944--------------------------------------------------------------------------------
A7SSC0_NEMVE/10-101--------------------------------------------------------------------------------
Q2JJS1_SYNJB/901-991--------------------------------------------------------------------------------
Q7ULY0_RHOBA/1286-1375--------------------------------------------------------------------------------
Q2IJH5_ANADE/1222-1312--------------------------------------------------------------------------------
Q1D840_MYXXD/1246-1336--------------------------------------------------------------------------------
Q1IT69_KORVE/868-958--------------------------------------------------------------------------------
Q7MT05_PORGI/1146-1236--------------------------------------------------------------------------------
OVOS_CHICK/748-838--------------------------------------------------------------------------------
Y984_THEMA/714-802--------------------------------------------------------------------------------
A6LJB2_THEM4/653-737--------------------------------------------------------------------------------
Q9VLT3_DROME/939-1030--------------------------------------------------------------------------------
Q7QGN1_ANOGA/635-726--------------------------------------------------------------------------------
A6L1P0_BACV8/1146-1235--------------------------------------------------------------------------------
A8F825_PSELT/720-808--------------------------------------------------------------------------------
A5UX85_ROSS1/1485-1575--------------------------------------------------------------------------------
Q73KT0_TREDE/1174-1262--------------------------------------------------------------------------------
A6LIC0_PARD8/1134-1223--------------------------------------------------------------------------------
CD109_MOUSE/695-786--------------------------------------------------------------------------------
B4Q6W4_DROSI/635-727--------------------------------------------------------------------------------
B4QA08_DROSI/759-850--------------------------------------------------------------------------------
C3XSF4_BRAFL/154-244--------------------------------------------------------------------------------
E3FS79_STIAD/1202-1290--------------------------------------------------------------------------------
F1QX13_DANRE/768-861--------------------------------------------------------------------------------
F1R8N2_DANRE/735-823--------------------------------------------------------------------------------
F1RQW2_PIG/780-867--------------------------------------------------------------------------------
F6TCT8_XENTR/740-830--------------------------------------------------------------------------------
F7CSP0_XENTR/773-869--------------------------------------------------------------------------------
F7CVI9_XENTR/767-856--------------------------------------------------------------------------------
H2LRL9_ORYLA/415-503--------------------------------------------------------------------------------
H2M6N3_ORYLA/762-861--------------------------------------------------------------------------------
H2UUU6_TAKRU/643-731--------------------------------------------------------------------------------
H3CLD7_TETNG/732-828--------------------------------------------------------------------------------
H3D959_TETNG/731-828--------------------------------------------------------------------------------
H3DA42_TETNG/714-803--------------------------------------------------------------------------------
H3DA56_TETNG/728-816--------------------------------------------------------------------------------
H3DDC7_TETNG/573-663--------------------------------------------------------------------------------
H3DHK0_TETNG/619-707--------------------------------------------------------------------------------
H3DL28_TETNG/714-814--------------------------------------------------------------------------------
CO5_HUMAN/772-859--------------------------------------------------------------------------------
Q5LHC2_BACFN/1165-1253--------------------------------------------------------------------------------
Q5ZUX7_LEGPH/1263-1351--------------------------------------------------------------------------------
Q7PMK4_ANOGA/645-736--------------------------------------------------------------------------------
Y4489_PSEAE/857-944--------------------------------------------------------------------------------
Q9VLY7_DROME/697-787--------------------------------------------------------------------------------
R4GGS2_CHICK/726-814--------------------------------------------------------------------------------
R5UFN1_9BACE/1152-1240--------------------------------------------------------------------------------
R6X5P5_9PORP/1138-1223--------------------------------------------------------------------------------
R7EM63_9BACE/1203-1287--------------------------------------------------------------------------------

PF07654

F6UY61_MONDO/126-209--------------------------------------------------------------------------------
IGHA1_HUMAN/6-92--------------------------------------------------------------------------------
DQA1_HUMAN/112-195--------------------------------------------------------------------------------
B2MG_DANRE/24-105--------------------------------------------------------------------------------
M3W4D7_FELCA/25-106--------------------------------------------------------------------------------
IGHG1_HUMAN/229-315--------------------------------------------------------------------------------
LAC_RABIT/6-92--------------------------------------------------------------------------------
IGHA_MOUSE/6-91--------------------------------------------------------------------------------
Q90ZJ6_ORYLA/24-106--------------------------------------------------------------------------------
GCAB_MOUSE/234-320--------------------------------------------------------------------------------
M9MM93_DANRE/103-186--------------------------------------------------------------------------------
HB2D_RAT/124-207--------------------------------------------------------------------------------
IGG2B_RAT/232-318--------------------------------------------------------------------------------
IGHG_RABIT/115-204--------------------------------------------------------------------------------
IGG2B_MOUSE/234-320--------------------------------------------------------------------------------
IGHG3_MOUSE/228-314--------------------------------------------------------------------------------
IGHE_RAT/314-403--------------------------------------------------------------------------------
H2MX91_ORYLA/112-193--------------------------------------------------------------------------------
Q8WM94_DANRE/104-187--------------------------------------------------------------------------------
IGHM_HUMAN/329-419--------------------------------------------------------------------------------
HA2J_MOUSE/112-195--------------------------------------------------------------------------------
HB2D_PIG/126-209--------------------------------------------------------------------------------
LAC1_MOUSE/6-92--------------------------------------------------------------------------------
LAC_CHICK/6-91--------------------------------------------------------------------------------
IGHG2_CAVPO/227-315--------------------------------------------------------------------------------
E9QFF8_DANRE/59-142--------------------------------------------------------------------------------
GCAA_MOUSE/122-211--------------------------------------------------------------------------------
IGHM_CHICK/322-413--------------------------------------------------------------------------------
F6W9R2_CALJA/25-107--------------------------------------------------------------------------------
B2MG_CHICK/25-107--------------------------------------------------------------------------------
B2MG_RABIT/5-87--------------------------------------------------------------------------------
W5PE14_SHEEP/113-196--------------------------------------------------------------------------------
O62938_XIPMA/111-194--------------------------------------------------------------------------------
Q1MTC8_DANRE/114-197--------------------------------------------------------------------------------
Q5M8Y9_XENTR/118-201--------------------------------------------------------------------------------
IGKC_HUMAN/5-93--------------------------------------------------------------------------------
F1RBP5_DANRE/133-216--------------------------------------------------------------------------------
A6QQE7_BOVIN/111-194--------------------------------------------------------------------------------
TCB2_MOUSE/9-99--------------------------------------------------------------------------------
IGHA_RABIT/174-266--------------------------------------------------------------------------------
Q70IB5_BOVIN/127-210--------------------------------------------------------------------------------
M3VX36_FELCA/114-197--------------------------------------------------------------------------------
KACB_RAT/5-93--------------------------------------------------------------------------------
IGHD_HUMAN/6-91--------------------------------------------------------------------------------
O35424_MOUSE/123-206--------------------------------------------------------------------------------
IGG2C_RAT/6-88--------------------------------------------------------------------------------
B2MG_BOVIN/25-106--------------------------------------------------------------------------------
GCAA_MOUSE/229-315--------------------------------------------------------------------------------
KAC5_RABIT/5-91--------------------------------------------------------------------------------
LAC_PIG/6-92--------------------------------------------------------------------------------
I3KVH2_ORENI/105-188--------------------------------------------------------------------------------
G1TXW3_RABIT/116-199--------------------------------------------------------------------------------
H0UYJ7_CAVPO/109-192--------------------------------------------------------------------------------
DPA1_HUMAN/118-201--------------------------------------------------------------------------------
R0JJE7_ANAPL/100-182--------------------------------------------------------------------------------
H9GZQ9_HORSE/235-322--------------------------------------------------------------------------------
LAC2_MOUSE/6-91--------------------------------------------------------------------------------
B2MG_CAVPO/5-87--------------------------------------------------------------------------------
IGHG1_HUMAN/6-89--------------------------------------------------------------------------------
DPB1_HUMAN/124-207--------------------------------------------------------------------------------
B2MG_HORSE/25-106--------------------------------------------------------------------------------
IGLL1_MOUSE/110-196--------------------------------------------------------------------------------
DOB_HUMAN/123-206--------------------------------------------------------------------------------
IGHG1_HUMAN/122-211--------------------------------------------------------------------------------
IGHE_HUMAN/324-412--------------------------------------------------------------------------------
GCAA_MOUSE/6-88--------------------------------------------------------------------------------
B2MG_MOUSE/25-107--------------------------------------------------------------------------------
IGHG1_MOUSE/223-309--------------------------------------------------------------------------------
IGHG1_RAT/225-311--------------------------------------------------------------------------------
F1NSZ6_CHICK/127-206--------------------------------------------------------------------------------
IGKC_MOUSE/5-93--------------------------------------------------------------------------------

PF08205

PVRL3_HUMAN/173-257--------------------------------------------------------------------------------
SN_MOUSE/142-229--------------------------------------------------------------------------------
RAGE_HUMAN/124-219--------------------------------------------------------------------------------
NPHN_MOUSE/152-242--------------------------------------------------------------------------------
NPHN_MOUSE/357-442--------------------------------------------------------------------------------
CRTAM_MOUSE/119-205--------------------------------------------------------------------------------
PVRL4_MOUSE/150-233--------------------------------------------------------------------------------
PVRL2_MOUSE/155-240--------------------------------------------------------------------------------
PVRL1_HUMAN/148-237--------------------------------------------------------------------------------
TMM25_HUMAN/26-118--------------------------------------------------------------------------------
SN_HUMAN/142-228--------------------------------------------------------------------------------
CD22_HUMAN/143-230--------------------------------------------------------------------------------
NPHN_HUMAN/138-228--------------------------------------------------------------------------------
CD80_RABIT/140-226--------------------------------------------------------------------------------
MUC18_HUMAN/139-234--------------------------------------------------------------------------------
BCAM_HUMAN/150-248--------------------------------------------------------------------------------
BCAM_BOVIN/150-248--------------------------------------------------------------------------------
CD166_MOUSE/137-231--------------------------------------------------------------------------------
RAGE_MOUSE/123-217--------------------------------------------------------------------------------
FAS3_DROME/126-222--------------------------------------------------------------------------------
B4MCT1_DROVI/186-273--------------------------------------------------------------------------------
E1C6L8_CHICK/151-245--------------------------------------------------------------------------------
F1SPA8_PIG/71-155--------------------------------------------------------------------------------
F7EIQ1_CALJA/148-231--------------------------------------------------------------------------------
G1TJN6_RABIT/203-292--------------------------------------------------------------------------------
G3V671_RAT/147-231--------------------------------------------------------------------------------
G7NXN7_MACFA/142-226--------------------------------------------------------------------------------

PF15028

PTCRA_RAT/20-147--------------------------------------------------------------------------------
G1QXF2_NOMLE/20-146--------------------------------------------------------------------------------
PTCRA_BOVIN/31-157--------------------------------------------------------------------------------
G3WD30_SARHA/20-146--------------------------------------------------------------------------------
M3YPD2_MUSPF/40-162--------------------------------------------------------------------------------
H0VKD6_CAVPO/20-147--------------------------------------------------------------------------------
G1U7X8_RABIT/20-147--------------------------------------------------------------------------------

PF02124

GC_PSHV1/234-457---------------------------------------------------AYPPSTLTGAWFIDGNRSAESAGFATNVR
GC_VZVD/379-589---------------------------------------------------YYPPHSVRVRWTSRFG.NIG.KNFITDAI
GC_HHV11/291-500---------------------------------------------------YYPRNPVEFVWFEDDH.QVFNPGQIDTQT
GC_GAHVM/283-492---------------------------------------------------FYPPGSVYVSWRQNGN.IAT.PRKDRDGS
GC_HHV2H/260-469---------------------------------------------------YYPGNRAEFVWFEDGR.RVFDPAQIHTQT

PF09085

W5PFN9_SHEEP/105-212--------------------------------------------------------------------------------
H0WQ95_OTOGA/112-222--------------------------------------------------------------------------------
G5E838_MOUSE/110-220--------------------------------------------------------------------------------
G1PL68_MYOLU/112-219--------------------------------------------------------------------------------
I3LSA9_PIG/49-158--------------------------------------------------------------------------------
M3W8G7_FELCA/115-224--------------------------------------------------------------------------------
MADCA_HUMAN/113-224--------------------------------------------------------------------------------
F7BUG9_MONDO/130-238--------------------------------------------------------------------------------
I3N840_ICTTR/111-217--------------------------------------------------------------------------------
L8Y2P3_TUPCH/565-674--------------------------------------------------------------------------------
G3HF34_CRIGR/110-220--------------------------------------------------------------------------------

PF09291

G1LKQ4_AILME/1-76--------------------------------------------------------------------------------
H0XHR2_OTOGA/28-106--------------------------------------------------------------------------------
F6YZC0_ORNAN/8-86--------------------------------------------------------------------------------
G1NZZ6_MYOLU/28-107--------------------------------------------------------------------------------
TCA_MOUSE/8-88--------------------------------------------------------------------------------
TCA_HUMAN/8-91--------------------------------------------------------------------------------
W5QDT7_SHEEP/23-107--------------------------------------------------------------------------------
F1MUN5_BOVIN/23-107--------------------------------------------------------------------------------
I3NCH0_ICTTR/13-93--------------------------------------------------------------------------------
E2R820_CANLF/29-106--------------------------------------------------------------------------------
M0R3T1_RAT/30-109--------------------------------------------------------------------------------
F6Q695_CALJA/20-100--------------------------------------------------------------------------------
M3Y7D3_MUSPF/29-107--------------------------------------------------------------------------------
M3WZY2_FELCA/33-111--------------------------------------------------------------------------------
G3U6X3_LOXAF/21-100--------------------------------------------------------------------------------
V8NIA7_OPHHA/48-130--------------------------------------------------------------------------------
G1U8W0_RABIT/33-114--------------------------------------------------------------------------------

PF16681

F1SAK8_PIG/36-116--------------------------------------------------------------------------------
CD3E_SHEEP/30-112--------------------------------------------------------------------------------
CD3E_BOVIN/30-112--------------------------------------------------------------------------------
G3QUY7_GORGO/36-127--------------------------------------------------------------------------------
H0X808_OTOGA/36-118--------------------------------------------------------------------------------
G5BHL3_HETGA/31-112--------------------------------------------------------------------------------
G3T782_LOXAF/29-109--------------------------------------------------------------------------------
I3MMT1_ICTTR/30-113--------------------------------------------------------------------------------
H0UW68_CAVPO/36-115--------------------------------------------------------------------------------
G1SRV6_RABIT/8-90--------------------------------------------------------------------------------
H9GCG3_ANOCA/57-136--------------------------------------------------------------------------------
Q3LRP4_CALJA/36-118--------------------------------------------------------------------------------
L5M0Z4_MYODS/18-99--------------------------------------------------------------------------------
G3WKI6_SARHA/41-122--------------------------------------------------------------------------------
CD3E_CANLF/41-122--------------------------------------------------------------------------------
F7D784_MONDO/33-114--------------------------------------------------------------------------------
M3XJR7_LATCH/37-113--------------------------------------------------------------------------------
F7CSX8_HORSE/40-119--------------------------------------------------------------------------------
L5KKM4_PTEAL/18-99--------------------------------------------------------------------------------
D4A5M2_RAT/24-104--------------------------------------------------------------------------------
G7PP33_MACFA/36-118--------------------------------------------------------------------------------
CD3E_MOUSE/29-109--------------------------------------------------------------------------------

PF16680

W5KJS3_ASTMX/45-112--------------------------------------------------------------------------------
K7GSE2_PIG/39-114--------------------------------------------------------------------------------
CD3D_RAT/30-103--------------------------------------------------------------------------------
H2NFG8_PONAB/39-114--------------------------------------------------------------------------------
CD3E_PIG/42-118--------------------------------------------------------------------------------
G5BHL4_HETGA/19-92--------------------------------------------------------------------------------
G3WJY6_SARHA/44-120--------------------------------------------------------------------------------
F7F8D9_MONDO/35-112--------------------------------------------------------------------------------
F6X8V5_ORNAN/39-109--------------------------------------------------------------------------------
L5KJW9_PTEAL/39-116--------------------------------------------------------------------------------
F7CUQ0_HORSE/39-110--------------------------------------------------------------------------------
E2RHB8_CANLF/39-114--------------------------------------------------------------------------------
M3WFR1_FELCA/39-114--------------------------------------------------------------------------------
U3ISR2_ANAPL/34-103--------------------------------------------------------------------------------
F7F8B6_MONDO/49-121--------------------------------------------------------------------------------
G1M3D4_AILME/39-114--------------------------------------------------------------------------------
J9NXV0_CANLF/30-103--------------------------------------------------------------------------------
CD3G_SHEEP/9-84--------------------------------------------------------------------------------
W5MH99_LEPOC/35-109--------------------------------------------------------------------------------
H0VN41_CAVPO/30-103--------------------------------------------------------------------------------
G3U502_LOXAF/18-89--------------------------------------------------------------------------------
G3IMA2_CRIGR/9-82--------------------------------------------------------------------------------
F7FPX1_CALJA/30-103--------------------------------------------------------------------------------
F1N9E2_CHICK/34-109--------------------------------------------------------------------------------
H3BFR3_LATCH/32-111--------------------------------------------------------------------------------
W5PGT3_SHEEP/36-112--------------------------------------------------------------------------------
I3MVU8_ICTTR/39-109--------------------------------------------------------------------------------
G1SDA6_RABIT/30-103--------------------------------------------------------------------------------
M3XZE1_MUSPF/30-101--------------------------------------------------------------------------------
M3WFR0_FELCA/39-111--------------------------------------------------------------------------------
CD3E_FELCA/47-124--------------------------------------------------------------------------------
G3T784_LOXAF/30-104--------------------------------------------------------------------------------
CD3D_MOUSE/30-103--------------------------------------------------------------------------------
F1M9F8_RAT/39-114--------------------------------------------------------------------------------
L5M0W2_MYODS/39-112--------------------------------------------------------------------------------
B4F6W6_XENTR/31-102--------------------------------------------------------------------------------
W5PHC2_SHEEP/30-99--------------------------------------------------------------------------------
CD3D_BOVIN/30-100--------------------------------------------------------------------------------
I6LI21_MUSPF/32-108--------------------------------------------------------------------------------
H0W6D3_CAVPO/39-114--------------------------------------------------------------------------------
G7NCB9_MACMU/42-120--------------------------------------------------------------------------------
G1STZ2_RABIT/39-114--------------------------------------------------------------------------------
G8JL01_BOVIN/15-90--------------------------------------------------------------------------------
K7GLV9_PIG/30-103--------------------------------------------------------------------------------
F6WI60_MACMU/30-103--------------------------------------------------------------------------------
L5M0S8_MYODS/30-101--------------------------------------------------------------------------------
G1MXZ8_MELGA/33-102--------------------------------------------------------------------------------
H0YPP3_TAEGU/33-105--------------------------------------------------------------------------------
M3ZL37_XIPMA/31-110--------------------------------------------------------------------------------
G3WK56_SARHA/41-113--------------------------------------------------------------------------------
G3T785_LOXAF/39-113--------------------------------------------------------------------------------
G3WKI7_SARHA/39-113--------------------------------------------------------------------------------
CD3G_MOUSE/39-114--------------------------------------------------------------------------------
G1M3E8_AILME/39-111--------------------------------------------------------------------------------
G1R705_NOMLE/42-120--------------------------------------------------------------------------------
H0X0C4_OTOGA/30-103--------------------------------------------------------------------------------
F6QRU0_XENTR/52-121--------------------------------------------------------------------------------
L9KSF6_TUPCH/19-94--------------------------------------------------------------------------------
M3XZF4_MUSPF/39-112--------------------------------------------------------------------------------
I3MMT3_ICTTR/39-114--------------------------------------------------------------------------------
F7CIT2_HORSE/30-97--------------------------------------------------------------------------------
G1M3G6_AILME/47-123--------------------------------------------------------------------------------

PF07679

LRIG1_MOUSE/601-691--------------------------------------------------------------------------------
TITIN_HUMAN/7385-7474--------------------------------------------------------------------------------
PALLD_HUMAN/271-361--------------------------------------------------------------------------------
PALLD_HUMAN/1135-1225--------------------------------------------------------------------------------
HMCN2_HUMAN/4309-4395--------------------------------------------------------------------------------
IGDC3_HUMAN/330-417--------------------------------------------------------------------------------
NCAM2_HUMAN/21-111--------------------------------------------------------------------------------
MYOM1_MOUSE/1555-1645--------------------------------------------------------------------------------
OBSCN_HUMAN/10-99--------------------------------------------------------------------------------
PXDN_HUMAN/433-519--------------------------------------------------------------------------------
Q08476_CHICK/180-269--------------------------------------------------------------------------------
Q08476_CHICK/372-461--------------------------------------------------------------------------------
HMCN1_HUMAN/1171-1258--------------------------------------------------------------------------------
O00557_HUMAN/20-114--------------------------------------------------------------------------------
UNC89_CAEEL/648-737--------------------------------------------------------------------------------
UNC89_CAEEL/3286-3377--------------------------------------------------------------------------------
UNC89_CAEEL/3482-3573--------------------------------------------------------------------------------
UNC89_CAEEL/3920-4010--------------------------------------------------------------------------------
MYLK_SHEEP/331-421--------------------------------------------------------------------------------
MUSK_HUMAN/121-208--------------------------------------------------------------------------------
ROBO1_RAT/262-347--------------------------------------------------------------------------------
O55124_MOUSE/1345-1435--------------------------------------------------------------------------------
O57576_CYNPY/213-301--------------------------------------------------------------------------------
O76281_DROME/1225-1316--------------------------------------------------------------------------------
O76281_DROME/3892-3982--------------------------------------------------------------------------------
O76281_DROME/6357-6446--------------------------------------------------------------------------------
CAVPT_BRALA/59-149--------------------------------------------------------------------------------
MYLK_CHICK/28-118--------------------------------------------------------------------------------
MYLK_CHICK/156-245--------------------------------------------------------------------------------
A4V2I0_DROME/25-135--------------------------------------------------------------------------------
P79757_CHICK/328-417--------------------------------------------------------------------------------
P79757_CHICK/734-823--------------------------------------------------------------------------------
UNC22_CAEEL/4150-4239--------------------------------------------------------------------------------
UNC22_CAEEL/6585-6674--------------------------------------------------------------------------------
UNC22_CAEEL/6863-6953--------------------------------------------------------------------------------
VCAM1_CANLF/25-112--------------------------------------------------------------------------------
Q8BID4_MOUSE/6-97--------------------------------------------------------------------------------
Q8T103_BOMMO/4625-4714--------------------------------------------------------------------------------
Q90X22_DANRE/66-155--------------------------------------------------------------------------------
Q90X22_DANRE/178-268--------------------------------------------------------------------------------
Q90YM0_DANRE/209-296--------------------------------------------------------------------------------
Q90Z41_CHICK/223-308--------------------------------------------------------------------------------
Q95YM1_PROCL/4632-4721--------------------------------------------------------------------------------
Q98918_CHICK/3071-3160--------------------------------------------------------------------------------
SPEG_MOUSE/727-816--------------------------------------------------------------------------------
SPEG_MOUSE/1490-1579--------------------------------------------------------------------------------
Q9GV22_MYTGA/344-433--------------------------------------------------------------------------------
Q9GV22_MYTGA/647-736--------------------------------------------------------------------------------

PF13927

B3LWB5_DROAN/364-444--------------------------------------------------------------------------------
B4MTU0_DROWI/318-387--------------------------------------------------------------------------------
B4MXP8_DROWI/227-304--------------------------------------------------------------------------------
B4MYB0_DROWI/133-207--------------------------------------------------------------------------------
B3MYW1_DROAN/2105-2173--------------------------------------------------------------------------------
F1QVQ2_DANRE/2279-2355--------------------------------------------------------------------------------
B4LDU2_DROVI/238-314--------------------------------------------------------------------------------
E7EY71_DANRE/696-771--------------------------------------------------------------------------------
B3M7Y3_DROAN/238-313--------------------------------------------------------------------------------
B4LFT8_DROVI/229-309--------------------------------------------------------------------------------
B3MYW1_DROAN/2573-2649--------------------------------------------------------------------------------
F1QVQ2_DANRE/1164-1237--------------------------------------------------------------------------------
B4L1X8_DROMO/3293-3369--------------------------------------------------------------------------------
B4N316_DROWI/3137-3217--------------------------------------------------------------------------------
B4N9N3_DROWI/206-283--------------------------------------------------------------------------------
B4NDI1_DROWI/1716-1793--------------------------------------------------------------------------------
B4NDI1_DROWI/1809-1884--------------------------------------------------------------------------------
B4L1X8_DROMO/3205-3277--------------------------------------------------------------------------------
F1M4Q3_RAT/2963-3039--------------------------------------------------------------------------------
F1M4Q3_RAT/3712-3787--------------------------------------------------------------------------------
F1M8T7_RAT/117-190--------------------------------------------------------------------------------
D3ZEF7_RAT/362-431--------------------------------------------------------------------------------
H0ZT69_TAEGU/318-391--------------------------------------------------------------------------------
H3C438_TETNG/442-518--------------------------------------------------------------------------------
G1MAY3_AILME/136-218--------------------------------------------------------------------------------
L8Y5J4_TUPCH/1436-1512--------------------------------------------------------------------------------
E9PV93_MOUSE/156-226--------------------------------------------------------------------------------
F7B6I5_ORNAN/417-504--------------------------------------------------------------------------------
U3J5A4_ANAPL/374-461--------------------------------------------------------------------------------
G3SPQ7_LOXAF/2357-2434--------------------------------------------------------------------------------
D3YXG0_MOUSE/4077-4151--------------------------------------------------------------------------------
M3WKI3_FELCA/292-364--------------------------------------------------------------------------------
W5PG45_SHEEP/1861-1941--------------------------------------------------------------------------------
J9KA37_ACYPI/1676-1753--------------------------------------------------------------------------------
U3JE64_FICAL/339-416--------------------------------------------------------------------------------
M9MMH4_MONDO/719-791--------------------------------------------------------------------------------
K7GSM9_PIG/46-116--------------------------------------------------------------------------------
H0Z181_TAEGU/234-313--------------------------------------------------------------------------------
H2T3G1_TAKRU/77-156--------------------------------------------------------------------------------
H0XAK9_OTOGA/4444-4518--------------------------------------------------------------------------------
H2LQK4_ORYLA/395-479--------------------------------------------------------------------------------
M3VX13_FELCA/252-331--------------------------------------------------------------------------------
F7HG01_MACMU/120-194--------------------------------------------------------------------------------
H3ALI7_LATCH/95-169--------------------------------------------------------------------------------
CD166_CHICK/420-494--------------------------------------------------------------------------------
H3AZ49_LATCH/431-506--------------------------------------------------------------------------------
I1FCT8_AMPQE/154-231--------------------------------------------------------------------------------
A7RGL8_NEMVE/110-187--------------------------------------------------------------------------------
H1A3P1_TAEGU/10-94--------------------------------------------------------------------------------
T1IV67_STRMM/4428-4506--------------------------------------------------------------------------------
U3IRV3_ANAPL/3333-3408--------------------------------------------------------------------------------
H2RMV1_TAKRU/3687-3765--------------------------------------------------------------------------------
G3IGQ1_CRIGR/104-182--------------------------------------------------------------------------------
E2RAY5_CANLF/328-396--------------------------------------------------------------------------------
H0WC62_CAVPO/1023-1101--------------------------------------------------------------------------------
H0WK70_OTOGA/134-197--------------------------------------------------------------------------------
W5M259_LEPOC/3334-3404--------------------------------------------------------------------------------
W4Y7I7_STRPU/1121-1191--------------------------------------------------------------------------------
G3S8K1_GORGO/306-398--------------------------------------------------------------------------------
G7NZL8_MACFA/2427-2506--------------------------------------------------------------------------------
A8XPH1_CAEBR/335-409--------------------------------------------------------------------------------
F6U7N2_MACMU/206-280--------------------------------------------------------------------------------
F6VGW4_XENTR/135-215--------------------------------------------------------------------------------
G5AXX1_HETGA/375-459--------------------------------------------------------------------------------
E1BPL4_BOVIN/226-295--------------------------------------------------------------------------------
H0XXS4_OTOGA/409-487--------------------------------------------------------------------------------
G0MT57_CAEBE/312-390--------------------------------------------------------------------------------
M4A1V3_XIPMA/287-362--------------------------------------------------------------------------------
K1Q203_CRAGI/164-241--------------------------------------------------------------------------------
L9L0Q8_TUPCH/446-524--------------------------------------------------------------------------------
J9LE80_ACYPI/76-155--------------------------------------------------------------------------------
TUTLA_HUMAN/226-305--------------------------------------------------------------------------------
A8XNA1_CAEBR/1384-1460--------------------------------------------------------------------------------
OPCM_BOVIN/135-206--------------------------------------------------------------------------------
H0VAJ3_CAVPO/2443-2518--------------------------------------------------------------------------------
G5ED27_CAEEL/520-594--------------------------------------------------------------------------------
F1QXA6_DANRE/135-209--------------------------------------------------------------------------------
E1BE11_BOVIN/469-544--------------------------------------------------------------------------------
G3WNW6_SARHA/2005-2083--------------------------------------------------------------------------------
G1MVY0_MELGA/205-286--------------------------------------------------------------------------------
B3SCT4_TRIAD/309-386--------------------------------------------------------------------------------
I3KLJ9_ORENI/1511-1587--------------------------------------------------------------------------------
G1KEL6_ANOCA/1747-1827--------------------------------------------------------------------------------
H9IXE0_BOMMO/176-257--------------------------------------------------------------------------------
F1MCF8_BOVIN/134-219--------------------------------------------------------------------------------
I3LQ56_PIG/148-223--------------------------------------------------------------------------------
H3A298_LATCH/269-341--------------------------------------------------------------------------------
E2B5C2_HARSA/1192-1270--------------------------------------------------------------------------------
K1RSV8_CRAGI/535-604--------------------------------------------------------------------------------
F1NLB3_CHICK/211-291--------------------------------------------------------------------------------
F7C3F9_HORSE/1916-1994--------------------------------------------------------------------------------
D7EJQ9_TRICA/242-318--------------------------------------------------------------------------------
G1SPW0_RABIT/1828-1908--------------------------------------------------------------------------------
F7DZU8_HORSE/145-218--------------------------------------------------------------------------------
H3AFQ4_LATCH/197-284--------------------------------------------------------------------------------
H2RMD5_TAKRU/268-350--------------------------------------------------------------------------------
E9H6S4_DAPPU/229-313--------------------------------------------------------------------------------
T1JN10_STRMM/773-858--------------------------------------------------------------------------------
X1WJL2_ACYPI/355-429--------------------------------------------------------------------------------
H0XYV2_OTOGA/208-287--------------------------------------------------------------------------------
LRC24_HUMAN/259-349--------------------------------------------------------------------------------
G3QLT3_GORGO/2730-2812--------------------------------------------------------------------------------
M4A8Z7_XIPMA/92-163--------------------------------------------------------------------------------
B4J1G6_DROGR/182-257--------------------------------------------------------------------------------
G3TDI8_LOXAF/147-221--------------------------------------------------------------------------------
H9IS41_BOMMO/193-283--------------------------------------------------------------------------------
F7DNP8_HORSE/32-111--------------------------------------------------------------------------------
E0VID6_PEDHC/546-621--------------------------------------------------------------------------------
M3ZDA5_XIPMA/3960-4034--------------------------------------------------------------------------------
A7S6L7_NEMVE/1-68--------------------------------------------------------------------------------
W5P5G3_SHEEP/184-260--------------------------------------------------------------------------------
G1NXV5_MYOLU/407-490--------------------------------------------------------------------------------
A7TD83_NEMVE/10-77--------------------------------------------------------------------------------
W4YVT5_STRPU/238-315--------------------------------------------------------------------------------
G1PXT9_MYOLU/104-188--------------------------------------------------------------------------------
H2TNV2_TAKRU/217-293--------------------------------------------------------------------------------
Q9VNP2_DROME/376-456--------------------------------------------------------------------------------
Q7PWJ1_ANOGA/342-413--------------------------------------------------------------------------------
G3PRA1_GASAC/425-503--------------------------------------------------------------------------------
H2T5J3_TAKRU/491-583--------------------------------------------------------------------------------
C9JIE7_HUMAN/28-101--------------------------------------------------------------------------------
G3H7Z1_CRIGR/124-193--------------------------------------------------------------------------------
W5P8R4_SHEEP/200-280--------------------------------------------------------------------------------
H0XMF4_OTOGA/144-224--------------------------------------------------------------------------------
VSIG1_RAT/143-216--------------------------------------------------------------------------------
G1SWE1_RABIT/373-446--------------------------------------------------------------------------------
H2V1A2_TAKRU/42-123--------------------------------------------------------------------------------
H2SGH2_TAKRU/2309-2391--------------------------------------------------------------------------------
Q4PIU9_CAEEL/443-521--------------------------------------------------------------------------------
G1PEU6_MYOLU/1208-1280--------------------------------------------------------------------------------
Q7QJ29_ANOGA/224-300--------------------------------------------------------------------------------
G5AMV7_HETGA/871-949--------------------------------------------------------------------------------
E4XUG8_OIKDI/346-406--------------------------------------------------------------------------------
K1RTW1_CRAGI/484-572--------------------------------------------------------------------------------
M4A3M8_XIPMA/4-79--------------------------------------------------------------------------------
L5KGT4_PTEAL/29-113--------------------------------------------------------------------------------
F6U370_ORNAN/213-295--------------------------------------------------------------------------------
H9H3H6_MACMU/143-216--------------------------------------------------------------------------------
U3J3S7_ANAPL/753-822--------------------------------------------------------------------------------
H0WC62_CAVPO/183-257--------------------------------------------------------------------------------
E3MB14_CAERE/1378-1454--------------------------------------------------------------------------------
M3X7U8_FELCA/877-952--------------------------------------------------------------------------------
F1R062_DANRE/657-736--------------------------------------------------------------------------------
G6D1C5_DANPL/333-410--------------------------------------------------------------------------------
B0S758_DANRE/4279-4356--------------------------------------------------------------------------------
G1PC71_MYOLU/210-286--------------------------------------------------------------------------------
M0R8A3_RAT/28-95--------------------------------------------------------------------------------
I3JX54_ORENI/222-301--------------------------------------------------------------------------------
I3J6L2_ORENI/1513-1595--------------------------------------------------------------------------------
A7T324_NEMVE/168-243--------------------------------------------------------------------------------
F4WMU2_ACREC/245-332--------------------------------------------------------------------------------
A0A0G2KBC4_RAT/202-282--------------------------------------------------------------------------------
E9Q8K5_MOUSE/7768-7845--------------------------------------------------------------------------------
F6WZ71_XENTR/136-210--------------------------------------------------------------------------------
G1Q318_MYOLU/146-219--------------------------------------------------------------------------------
B7PWG0_IXOSC/6-84--------------------------------------------------------------------------------
E1C7J4_CHICK/1446-1521--------------------------------------------------------------------------------
T1HFN4_RHOPR/262-348--------------------------------------------------------------------------------
M3Y4I1_MUSPF/446-525--------------------------------------------------------------------------------
J9K4X0_ACYPI/838-923--------------------------------------------------------------------------------
H2YFC8_CIOSA/6015-6094--------------------------------------------------------------------------------
I1FIK6_AMPQE/905-978--------------------------------------------------------------------------------
H0ZT52_TAEGU/167-243--------------------------------------------------------------------------------
G6D8N4_DANPL/397-471--------------------------------------------------------------------------------
H2S4G7_TAKRU/2233-2312--------------------------------------------------------------------------------
F6RM57_MONDO/221-299--------------------------------------------------------------------------------
A0A068YBC4_ECHMU/128-224--------------------------------------------------------------------------------
H3C0Z0_TETNG/505-582--------------------------------------------------------------------------------
C3YV78_BRAFL/244-318--------------------------------------------------------------------------------
V8NXF3_OPHHA/273-341--------------------------------------------------------------------------------
J9K2T1_ACYPI/4946-5025--------------------------------------------------------------------------------
E2RDP3_CANLF/358-427--------------------------------------------------------------------------------
B8ZZW4_HUMAN/225-316--------------------------------------------------------------------------------
I3KLJ9_ORENI/4172-4250--------------------------------------------------------------------------------
G3QH37_GORGO/2340-2418--------------------------------------------------------------------------------
G3QAT5_GASAC/137-219--------------------------------------------------------------------------------
K7J263_NASVI/311-384--------------------------------------------------------------------------------
H2P041_PONAB/28-99--------------------------------------------------------------------------------
G5BSW9_HETGA/22-89--------------------------------------------------------------------------------
E1C0J7_CHICK/329-404--------------------------------------------------------------------------------
H3AY43_LATCH/449-523--------------------------------------------------------------------------------
F1P3U6_CHICK/31-104--------------------------------------------------------------------------------
U3IRV3_ANAPL/1559-1634--------------------------------------------------------------------------------
G3RF50_GORGO/154-227--------------------------------------------------------------------------------
H3CQ92_TETNG/191-272--------------------------------------------------------------------------------
T1G0T0_HELRO/315-390--------------------------------------------------------------------------------
UNC22_CAEEL/5532-5609--------------------------------------------------------------------------------
H2QGH1_PANTR/148-221--------------------------------------------------------------------------------
F1QPV1_DANRE/763-842--------------------------------------------------------------------------------
G5AXW3_HETGA/404-504--------------------------------------------------------------------------------
M3XII6_LATCH/175-270--------------------------------------------------------------------------------
GPA33_MOUSE/143-215--------------------------------------------------------------------------------
M3WCL1_FELCA/378-451--------------------------------------------------------------------------------
H2ZY75_LATCH/19-96--------------------------------------------------------------------------------
E7FDK2_DANRE/164-242--------------------------------------------------------------------------------
G0MH24_CAEBE/2578-2658--------------------------------------------------------------------------------
G1T2S8_RABIT/208-285--------------------------------------------------------------------------------
T1HBT4_RHOPR/41-120--------------------------------------------------------------------------------
E5T119_TRISP/222-297--------------------------------------------------------------------------------
J9EAV2_WUCBA/64-138--------------------------------------------------------------------------------
E0VBQ8_PEDHC/2584-2656--------------------------------------------------------------------------------
F6U0Z2_MONDO/399-469--------------------------------------------------------------------------------
SDK_CAEBR/27-98--------------------------------------------------------------------------------
W5JFQ9_ANODA/3228-3303--------------------------------------------------------------------------------
K7J1P5_NASVI/335-411--------------------------------------------------------------------------------
H2RMV3_TAKRU/3258-3334--------------------------------------------------------------------------------
H2RTG6_TAKRU/104-167--------------------------------------------------------------------------------
A7RHA1_NEMVE/223-323--------------------------------------------------------------------------------
F7EZJ4_ORNAN/47-119--------------------------------------------------------------------------------
H0VZZ7_CAVPO/13147-13224--------------------------------------------------------------------------------
U3IRV3_ANAPL/1933-2011--------------------------------------------------------------------------------
G1M2L3_AILME/258-331--------------------------------------------------------------------------------
H2SGH5_TAKRU/458-536--------------------------------------------------------------------------------
U3JRE7_FICAL/2504-2582--------------------------------------------------------------------------------
Q7KUK9_DROME/1117-1203--------------------------------------------------------------------------------
T1JQ42_TETUR/2317-2395--------------------------------------------------------------------------------
L5K5L3_PTEAL/239-309--------------------------------------------------------------------------------
A7SFR8_NEMVE/46-114--------------------------------------------------------------------------------
C3YE96_BRAFL/11-88--------------------------------------------------------------------------------
G1L1P3_AILME/31591-31669--------------------------------------------------------------------------------
E9ICY3_SOLIN/192-269--------------------------------------------------------------------------------
H3BA40_LATCH/431-504--------------------------------------------------------------------------------
H9H6P4_MONDO/149-222--------------------------------------------------------------------------------
F1N757_BOVIN/19142-19222--------------------------------------------------------------------------------
B8A5X4_DANRE/249-328--------------------------------------------------------------------------------
G5ED27_CAEEL/3765-3842--------------------------------------------------------------------------------
G3IA17_CRIGR/26-98--------------------------------------------------------------------------------
LIGO3_HUMAN/406-484--------------------------------------------------------------------------------
B3DHL7_DANRE/396-486--------------------------------------------------------------------------------
F6PCI7_DANRE/123-187--------------------------------------------------------------------------------
Q0E9I7_DROME/618-698--------------------------------------------------------------------------------
F6RH77_XENTR/792-871--------------------------------------------------------------------------------
F6RHB6_XENTR/521-596--------------------------------------------------------------------------------
C3YI92_BRAFL/240-314--------------------------------------------------------------------------------
K1QDZ3_CRAGI/330-408--------------------------------------------------------------------------------
G5AZS1_HETGA/225-297--------------------------------------------------------------------------------
H2RAR7_PANTR/241-318--------------------------------------------------------------------------------
G3SKZ8_LOXAF/2514-2589--------------------------------------------------------------------------------
I3K298_ORENI/241-338--------------------------------------------------------------------------------
K7EG05_ORNAN/40-109--------------------------------------------------------------------------------
F7ALJ3_MONDO/573-647--------------------------------------------------------------------------------
A0A068XUD2_HYMMI/23-102--------------------------------------------------------------------------------
G1RTX9_NOMLE/362-430--------------------------------------------------------------------------------
K7J3K2_NASVI/230-325--------------------------------------------------------------------------------
T1K8T5_TETUR/700-780--------------------------------------------------------------------------------
A7T347_NEMVE/207-273--------------------------------------------------------------------------------
G3HU05_CRIGR/156-238--------------------------------------------------------------------------------
C3XTR2_BRAFL/407-496--------------------------------------------------------------------------------
Q16PL9_AEDAE/1970-2042--------------------------------------------------------------------------------
G1MRA1_MELGA/3214-3292--------------------------------------------------------------------------------
C3ZMB7_BRAFL/142-212--------------------------------------------------------------------------------
L9LAX3_TUPCH/95-167--------------------------------------------------------------------------------
H9ITP2_BOMMO/3557-3636--------------------------------------------------------------------------------
W5NKB1_LEPOC/185-258--------------------------------------------------------------------------------
A8X5T7_CAEBR/262-333--------------------------------------------------------------------------------
F6WH01_ORNAN/522-603--------------------------------------------------------------------------------
B7QLJ5_IXOSC/4-82--------------------------------------------------------------------------------
W4ZEX8_STRPU/110-190--------------------------------------------------------------------------------
H2W626_CAEJA/1269-1345--------------------------------------------------------------------------------
G3SWG4_LOXAF/126-199--------------------------------------------------------------------------------
L5MGE5_MYODS/777-852--------------------------------------------------------------------------------
W5K8G9_ASTMX/18-102--------------------------------------------------------------------------------
F7BFG5_XENTR/276-363--------------------------------------------------------------------------------
CEAM5_HUMAN/502-575--------------------------------------------------------------------------------
G1LNF0_AILME/259-344--------------------------------------------------------------------------------
G3NWN1_GASAC/3143-3221--------------------------------------------------------------------------------
B0WQT6_CULQU/2315-2388--------------------------------------------------------------------------------
F1QAV8_DANRE/242-317--------------------------------------------------------------------------------
H2UIH8_TAKRU/1-84--------------------------------------------------------------------------------
W5KN69_ASTMX/239-306--------------------------------------------------------------------------------
E3MB14_CAERE/2695-2773--------------------------------------------------------------------------------
L5MIN9_MYODS/127-196--------------------------------------------------------------------------------
B0S6Y0_DANRE/5046-5124--------------------------------------------------------------------------------
H3BWN1_TETNG/120-194--------------------------------------------------------------------------------
Q7QCH7_ANOGA/112-186--------------------------------------------------------------------------------
U3K448_FICAL/135-215--------------------------------------------------------------------------------
Q63116_RAT/211-296--------------------------------------------------------------------------------
T1JAP3_STRMM/8-82--------------------------------------------------------------------------------
G4VHL0_SCHMA/34-117--------------------------------------------------------------------------------
H2SMR3_TAKRU/295-377--------------------------------------------------------------------------------
H3CVA2_TETNG/320-393--------------------------------------------------------------------------------
KIT_FELCA/413-496--------------------------------------------------------------------------------
T1J767_STRMM/86-168--------------------------------------------------------------------------------
W5MH34_LEPOC/5091-5168--------------------------------------------------------------------------------
I3KJA7_ORENI/452-528--------------------------------------------------------------------------------
H2TYY0_TAKRU/252-331--------------------------------------------------------------------------------
E2BGQ9_HARSA/550-635--------------------------------------------------------------------------------
B4R2G8_DROSI/333-408--------------------------------------------------------------------------------
H2UZ60_TAKRU/136-218--------------------------------------------------------------------------------
A0A068XP72_HYMMI/1181-1259--------------------------------------------------------------------------------
H2W626_CAEJA/2096-2171--------------------------------------------------------------------------------
E9FRF0_DAPPU/341-417--------------------------------------------------------------------------------
T1JWQ7_TETUR/141-219--------------------------------------------------------------------------------
G7PXR7_MACFA/146-219--------------------------------------------------------------------------------
D3ZEF7_RAT/157-227--------------------------------------------------------------------------------
T1G0N8_HELRO/356-442--------------------------------------------------------------------------------
F4WXQ5_ACREC/40-119--------------------------------------------------------------------------------
G3WK71_SARHA/132-205--------------------------------------------------------------------------------
H2YX49_CIOSA/39-117--------------------------------------------------------------------------------
M3ZF48_XIPMA/1530-1611--------------------------------------------------------------------------------
B4IEG8_DROSE/277-377--------------------------------------------------------------------------------
C3YXV4_BRAFL/434-522--------------------------------------------------------------------------------
T1L0G5_TETUR/1227-1307--------------------------------------------------------------------------------
A7T5G7_NEMVE/176-254--------------------------------------------------------------------------------
H2W3A3_CAEJA/124-200--------------------------------------------------------------------------------
H3B9Q7_LATCH/92-171--------------------------------------------------------------------------------
W4WPS4_ATTCE/2117-2185--------------------------------------------------------------------------------
T1FSI9_HELRO/3-79--------------------------------------------------------------------------------
V8P4F9_OPHHA/1279-1354--------------------------------------------------------------------------------
E1B9K4_BOVIN/696-768--------------------------------------------------------------------------------
G1PQB8_MYOLU/91-165--------------------------------------------------------------------------------
M4A3M8_XIPMA/201-278--------------------------------------------------------------------------------
W5MXI9_LEPOC/240-335--------------------------------------------------------------------------------
Q7QH01_ANOGA/200-274--------------------------------------------------------------------------------
A0A068XVM9_HYMMI/160-251--------------------------------------------------------------------------------
W4VTQ7_ATTCE/336-427--------------------------------------------------------------------------------
U1MB61_ASCSU/233-309--------------------------------------------------------------------------------
I3JK65_ORENI/1643-1723--------------------------------------------------------------------------------
G1PE98_MYOLU/142-224--------------------------------------------------------------------------------
G1NPM8_MELGA/231-326--------------------------------------------------------------------------------
I3J3G4_ORENI/208-291--------------------------------------------------------------------------------
A8WZ25_CAEBR/71-139--------------------------------------------------------------------------------
M4AZI7_XIPMA/409-487--------------------------------------------------------------------------------
H3AR10_LATCH/182-255--------------------------------------------------------------------------------
I1FMM2_AMPQE/133-214--------------------------------------------------------------------------------
B4QNK1_DROSI/552-632--------------------------------------------------------------------------------
B0WQS2_CULQU/395-476--------------------------------------------------------------------------------
W4ZIA3_STRPU/27-102--------------------------------------------------------------------------------
W5MUL9_LEPOC/261-337--------------------------------------------------------------------------------
R7L6X0_9BACT/143-212--------------------------------------------------------------------------------
F7AMC7_ORNAN/100-173--------------------------------------------------------------------------------
G3X1Y5_SARHA/77-149--------------------------------------------------------------------------------
W5KA48_ASTMX/94-164--------------------------------------------------------------------------------
C3XQC8_BRAFL/319-401--------------------------------------------------------------------------------
T1K8T5_TETUR/506-594--------------------------------------------------------------------------------
F4X807_ACREC/2585-2662--------------------------------------------------------------------------------
B7PCC8_IXOSC/372-452--------------------------------------------------------------------------------
Q7QGT8_ANOGA/598-679--------------------------------------------------------------------------------
G3VWI5_SARHA/240-311--------------------------------------------------------------------------------
G3VC29_SARHA/140-213--------------------------------------------------------------------------------
W5L0Z5_ASTMX/61-138--------------------------------------------------------------------------------
W5NCC6_LEPOC/388-463--------------------------------------------------------------------------------
L9L2E3_TUPCH/225-305--------------------------------------------------------------------------------
R4GLP6_CHICK/4237-4314--------------------------------------------------------------------------------
E4WVK0_OIKDI/201-279--------------------------------------------------------------------------------
VCAM1_RAT/513-583--------------------------------------------------------------------------------
W4XB08_STRPU/529-608--------------------------------------------------------------------------------
J9JQ41_ACYPI/68-152--------------------------------------------------------------------------------
H2TCX5_TAKRU/496-570--------------------------------------------------------------------------------
G3P8R0_GASAC/105-178--------------------------------------------------------------------------------
G3VSL9_SARHA/171-243--------------------------------------------------------------------------------
W4XQ21_STRPU/745-820--------------------------------------------------------------------------------
E4WSA8_OIKDI/267-346--------------------------------------------------------------------------------
H3BZV8_TETNG/385-454--------------------------------------------------------------------------------
E0V9F8_PEDHC/17-97--------------------------------------------------------------------------------
G3TMS7_LOXAF/360-429--------------------------------------------------------------------------------
F6RH77_XENTR/4441-4515--------------------------------------------------------------------------------
F1NH95_CHICK/294-384--------------------------------------------------------------------------------
T1JY23_TETUR/776-864--------------------------------------------------------------------------------
A0A0H5S2B2_BRUMA/626-704--------------------------------------------------------------------------------
G1Q228_MYOLU/133-202--------------------------------------------------------------------------------
G1Q3U7_MYOLU/323-399--------------------------------------------------------------------------------
F6WT52_MONDO/207-289--------------------------------------------------------------------------------
T1IX56_STRMM/587-667--------------------------------------------------------------------------------
Q16SD7_AEDAE/410-492--------------------------------------------------------------------------------
E0VQ49_PEDHC/218-299--------------------------------------------------------------------------------
Q66I72_DANRE/124-206--------------------------------------------------------------------------------
I3JXY4_ORENI/2312-2391--------------------------------------------------------------------------------
A7RTK9_NEMVE/67-134--------------------------------------------------------------------------------
K1QFM1_CRAGI/129-198--------------------------------------------------------------------------------
H9G4V2_ANOCA/202-277--------------------------------------------------------------------------------
H2RMU8_TAKRU/898-975--------------------------------------------------------------------------------
W5KK86_ASTMX/483-559--------------------------------------------------------------------------------
E0W000_PEDHC/1395-1475--------------------------------------------------------------------------------
H2SGH4_TAKRU/1376-1465--------------------------------------------------------------------------------
F6ZYW4_XENTR/207-287--------------------------------------------------------------------------------
G6D925_DANPL/189-262--------------------------------------------------------------------------------
F6Q1C2_CIOIN/116-186--------------------------------------------------------------------------------
B7QMC6_IXOSC/434-517--------------------------------------------------------------------------------
T1KEF4_TETUR/154-239--------------------------------------------------------------------------------
G1MCJ0_AILME/480-554--------------------------------------------------------------------------------
B0WMB0_CULQU/375-448--------------------------------------------------------------------------------
E5SCK7_TRISP/564-642--------------------------------------------------------------------------------
G3PML3_GASAC/244-323--------------------------------------------------------------------------------
H2ZZ57_LATCH/1323-1400--------------------------------------------------------------------------------
H2YGJ8_CIOSA/150-222--------------------------------------------------------------------------------
B0W5X0_CULQU/123-198--------------------------------------------------------------------------------
T1K1V6_TETUR/2849-2928--------------------------------------------------------------------------------
G1Q8Z3_MYOLU/108-177--------------------------------------------------------------------------------
H9JRT0_BOMMO/2553-2626--------------------------------------------------------------------------------
H3ADQ7_LATCH/3302-3380--------------------------------------------------------------------------------
T1HEN7_RHOPR/1933-2009--------------------------------------------------------------------------------
E0VFM7_PEDHC/451-528--------------------------------------------------------------------------------
T1F8I6_HELRO/427-506--------------------------------------------------------------------------------
I1GIL2_AMPQE/402-472--------------------------------------------------------------------------------
H3AZ49_LATCH/1367-1445--------------------------------------------------------------------------------
K7J0L1_NASVI/142-216--------------------------------------------------------------------------------
T1HQ02_RHOPR/313-388--------------------------------------------------------------------------------
G3VD55_SARHA/119-195--------------------------------------------------------------------------------
B0W4B4_CULQU/435-508--------------------------------------------------------------------------------
B1ZNU7_OPITP/131-199--------------------------------------------------------------------------------
H3DK40_TETNG/293-367--------------------------------------------------------------------------------
G1U9S3_RABIT/4153-4230--------------------------------------------------------------------------------
W5PAY5_SHEEP/299-372--------------------------------------------------------------------------------
H2S7R9_TAKRU/215-288--------------------------------------------------------------------------------
H8KUV5_SOLCM/39-113--------------------------------------------------------------------------------
W5K1E8_ASTMX/169-243--------------------------------------------------------------------------------
T1IT85_STRMM/2042-2120--------------------------------------------------------------------------------
E5S3T5_TRISP/194-270--------------------------------------------------------------------------------
G6CQX9_DANPL/337-406--------------------------------------------------------------------------------
B0S758_DANRE/6448-6525--------------------------------------------------------------------------------
K7H008_CAEJA/3858-3932--------------------------------------------------------------------------------
F6Y6T8_CANLF/460-547--------------------------------------------------------------------------------
B4MQT4_DROWI/1523-1602--------------------------------------------------------------------------------
D6WVT0_TRICA/130-205--------------------------------------------------------------------------------
G1QBE9_MYOLU/236-323--------------------------------------------------------------------------------
A0A0J9XYL2_BRUMA/287-363--------------------------------------------------------------------------------
F6R9N9_ORNAN/703-782--------------------------------------------------------------------------------
Q7PN36_ANOGA/318-399--------------------------------------------------------------------------------
D6WIF5_TRICA/225-302--------------------------------------------------------------------------------
H3BAW7_LATCH/116-187--------------------------------------------------------------------------------
C3YXQ6_BRAFL/634-705--------------------------------------------------------------------------------
M4A8Z7_XIPMA/1-72--------------------------------------------------------------------------------
T1JW82_TETUR/357-428--------------------------------------------------------------------------------
H2YT91_CIOSA/45-118--------------------------------------------------------------------------------
H0V9V0_CAVPO/324-397--------------------------------------------------------------------------------
M3ZDA5_XIPMA/2944-3017--------------------------------------------------------------------------------
F1QHX4_DANRE/2356-2435--------------------------------------------------------------------------------
F1MRU1_BOVIN/214-310--------------------------------------------------------------------------------
D6WVT0_TRICA/222-299--------------------------------------------------------------------------------
K7I7M9_CAEJA/97-171--------------------------------------------------------------------------------
B4JGM2_DROGR/141-215--------------------------------------------------------------------------------
H9IS41_BOMMO/56-136--------------------------------------------------------------------------------
H3B115_LATCH/871-950--------------------------------------------------------------------------------
C3YAA7_BRAFL/933-1017--------------------------------------------------------------------------------
E9G8I6_DAPPU/1013-1100--------------------------------------------------------------------------------
H3BF77_LATCH/100-172--------------------------------------------------------------------------------
W4XM75_STRPU/242-322--------------------------------------------------------------------------------
F4WZW8_ACREC/365-443--------------------------------------------------------------------------------
Q1MT63_DANRE/117-185--------------------------------------------------------------------------------
K1Q0W8_CRAGI/685-763--------------------------------------------------------------------------------
M3ZLD4_XIPMA/214-293--------------------------------------------------------------------------------
Q178V3_AEDAE/124-202--------------------------------------------------------------------------------
W5MUK1_LEPOC/22-96--------------------------------------------------------------------------------
W5JY76_ASTMX/329-403--------------------------------------------------------------------------------
M3XGP0_LATCH/200-282--------------------------------------------------------------------------------
H2ZZ03_LATCH/91-169--------------------------------------------------------------------------------
A0A068Y1P8_ECHMU/1274-1348--------------------------------------------------------------------------------
W5LCY5_ASTMX/2471-2548--------------------------------------------------------------------------------
H3ANM9_LATCH/143-224--------------------------------------------------------------------------------
J9JL89_ACYPI/218-297--------------------------------------------------------------------------------
C3ZAB6_BRAFL/505-591--------------------------------------------------------------------------------
F6WFL2_MONDO/295-370--------------------------------------------------------------------------------
W5M0S1_LEPOC/4119-4194--------------------------------------------------------------------------------
F6S0V2_MONDO/291-365--------------------------------------------------------------------------------
H9JF49_BOMMO/162-238--------------------------------------------------------------------------------
W5KDQ7_ASTMX/6-85--------------------------------------------------------------------------------
W5NE83_LEPOC/2521-2603--------------------------------------------------------------------------------
G3P7F4_GASAC/2423-2505--------------------------------------------------------------------------------
W5M8G0_LEPOC/824-911--------------------------------------------------------------------------------
J0DZ27_LOALO/1386-1467--------------------------------------------------------------------------------
B7PZR6_IXOSC/2264-2335--------------------------------------------------------------------------------
M3ZVE1_XIPMA/10-94--------------------------------------------------------------------------------
A0A087ZZ96_APIME/242-324--------------------------------------------------------------------------------
H0VAJ3_CAVPO/747-825--------------------------------------------------------------------------------
G3WAP0_SARHA/391-475--------------------------------------------------------------------------------
R4GA37_ANOCA/247-325--------------------------------------------------------------------------------
C3ZM68_BRAFL/329-400--------------------------------------------------------------------------------
M3ZJI9_XIPMA/1437-1515--------------------------------------------------------------------------------
X1XGE4_ACYPI/2-81--------------------------------------------------------------------------------
E2AQW8_CAMFO/122-201--------------------------------------------------------------------------------
J9EEP1_WUCBA/29-106--------------------------------------------------------------------------------
I3IUL2_ORENI/135-202--------------------------------------------------------------------------------
H2SHQ3_TAKRU/12-78--------------------------------------------------------------------------------
L5M2Z7_MYODS/4159-4236--------------------------------------------------------------------------------
U1NSC7_ASCSU/65-133--------------------------------------------------------------------------------
F6ZIS0_CIOIN/2550-2629--------------------------------------------------------------------------------
T1KRW2_TETUR/30-116--------------------------------------------------------------------------------
M4AN26_XIPMA/2400-2482--------------------------------------------------------------------------------
E2R9V7_CANLF/302-375--------------------------------------------------------------------------------
D6W7B4_TRICA/124-199--------------------------------------------------------------------------------
Q16PP3_AEDAE/1974-2041--------------------------------------------------------------------------------
H2M0W7_ORYLA/521-594--------------------------------------------------------------------------------
WFKN1_HUMAN/185-267--------------------------------------------------------------------------------
F6X9K9_CIOIN/228-307--------------------------------------------------------------------------------
K1QVT8_CRAGI/14-89--------------------------------------------------------------------------------
K1QD41_CRAGI/27-103--------------------------------------------------------------------------------
G4VNR9_SCHMA/2657-2735--------------------------------------------------------------------------------
I3J5F7_ORENI/255-332--------------------------------------------------------------------------------
W0JC77_9BACT/402-470--------------------------------------------------------------------------------
T1F313_HELRO/1059-1137--------------------------------------------------------------------------------
G3Q4I8_GASAC/2429-2507--------------------------------------------------------------------------------
T1I1E7_RHOPR/199-276--------------------------------------------------------------------------------
W5M0S1_LEPOC/4029-4103--------------------------------------------------------------------------------
C3XX67_BRAFL/249-323--------------------------------------------------------------------------------
G3WMC9_SARHA/242-335--------------------------------------------------------------------------------
F6ZNR9_XENTR/40-122--------------------------------------------------------------------------------
W5L6K7_ASTMX/12-90--------------------------------------------------------------------------------
G3PR28_GASAC/2218-2297--------------------------------------------------------------------------------
L5JVK8_PTEAL/102-169--------------------------------------------------------------------------------
K1R6E6_CRAGI/3602-3673--------------------------------------------------------------------------------
K7EE84_ORNAN/7-89--------------------------------------------------------------------------------
G3WAZ9_SARHA/211-292--------------------------------------------------------------------------------
W5MSU1_LEPOC/252-346--------------------------------------------------------------------------------
T1FGA0_HELRO/153-227--------------------------------------------------------------------------------
B7PZR6_IXOSC/790-866--------------------------------------------------------------------------------
G0MYL1_CAEBE/160-231--------------------------------------------------------------------------------
F6RH77_XENTR/611-685--------------------------------------------------------------------------------
W5MSM2_LEPOC/111-192--------------------------------------------------------------------------------
E3MB14_CAERE/2599-2679--------------------------------------------------------------------------------
W5MVU4_LEPOC/2357-2436--------------------------------------------------------------------------------
B4J8M6_DROGR/130-203--------------------------------------------------------------------------------
E9GAQ5_DAPPU/119-203--------------------------------------------------------------------------------
K1QVW7_CRAGI/597-675--------------------------------------------------------------------------------
J9K856_ACYPI/327-400--------------------------------------------------------------------------------
T1I3G6_RHOPR/230-303--------------------------------------------------------------------------------
J9KA37_ACYPI/1145-1221--------------------------------------------------------------------------------
B0WMI5_CULQU/96-169--------------------------------------------------------------------------------
H2SHA3_TAKRU/41-112--------------------------------------------------------------------------------
T1KP14_TETUR/654-736--------------------------------------------------------------------------------
G6DLT7_DANPL/240-317--------------------------------------------------------------------------------
M3ZJI9_XIPMA/3791-3868--------------------------------------------------------------------------------
I3MQM5_ICTTR/242-321--------------------------------------------------------------------------------
G3UP82_MELGA/243-320--------------------------------------------------------------------------------
T1IRS7_STRMM/262-342--------------------------------------------------------------------------------
I3K8L1_ORENI/148-221--------------------------------------------------------------------------------
T1F6A1_HELRO/162-244--------------------------------------------------------------------------------
G3PTV5_GASAC/187-271--------------------------------------------------------------------------------
E3MB16_CAERE/446-520--------------------------------------------------------------------------------
U3JKT4_FICAL/3786-3860--------------------------------------------------------------------------------
H2MBW3_ORYLA/191-272--------------------------------------------------------------------------------
G5C6C4_HETGA/2123-2201--------------------------------------------------------------------------------
W5J457_ANODA/546-621--------------------------------------------------------------------------------
A7SZF1_NEMVE/152-219--------------------------------------------------------------------------------
F1QHX4_DANRE/2261-2340--------------------------------------------------------------------------------
B4H7E0_DROPE/283-392--------------------------------------------------------------------------------
Q17HV8_AEDAE/443-519--------------------------------------------------------------------------------
E0VTY5_PEDHC/221-298--------------------------------------------------------------------------------
C3Z263_BRAFL/527-604--------------------------------------------------------------------------------
Q2KHZ6_BOVIN/130-196--------------------------------------------------------------------------------
CSF1R_MOUSE/399-487--------------------------------------------------------------------------------
I3JFY2_ORENI/153-227--------------------------------------------------------------------------------
M3Y4D4_MUSPF/109-196--------------------------------------------------------------------------------
B4JJ90_DROGR/433-514--------------------------------------------------------------------------------
T1IKD2_STRMM/3892-3963--------------------------------------------------------------------------------
F1MPQ4_BOVIN/247-315--------------------------------------------------------------------------------
W5KAY9_ASTMX/2363-2442--------------------------------------------------------------------------------
I3JQA4_ORENI/414-501--------------------------------------------------------------------------------
M3ZDA5_XIPMA/2848-2924--------------------------------------------------------------------------------
H0XI36_OTOGA/389-463--------------------------------------------------------------------------------
F1PAW2_CANLF/395-467--------------------------------------------------------------------------------
K7GUB9_CAEJA/659-747--------------------------------------------------------------------------------
G1KKG2_ANOCA/1292-1369--------------------------------------------------------------------------------
F4W8E7_ACREC/709-796--------------------------------------------------------------------------------
D6WFM0_TRICA/741-827--------------------------------------------------------------------------------
E5S3T6_TRISP/102-185--------------------------------------------------------------------------------
J9KSY0_ACYPI/411-495--------------------------------------------------------------------------------
C3ZA32_BRAFL/1951-2024--------------------------------------------------------------------------------
T1HID6_RHOPR/383-466--------------------------------------------------------------------------------
E1FMD8_LOALO/559-635--------------------------------------------------------------------------------
H0Z2M2_TAEGU/103-176--------------------------------------------------------------------------------
F6ZIS0_CIOIN/1986-2065--------------------------------------------------------------------------------
A7SQE0_NEMVE/88-161--------------------------------------------------------------------------------
B0XGP5_CULQU/1294-1360--------------------------------------------------------------------------------
F6RH77_XENTR/2475-2551--------------------------------------------------------------------------------
B7PAM8_IXOSC/380-463--------------------------------------------------------------------------------
W4XRM4_STRPU/912-985--------------------------------------------------------------------------------
W5KIY7_ASTMX/466-542--------------------------------------------------------------------------------
J9LBC5_ACYPI/62-145--------------------------------------------------------------------------------
A0A0H5S739_BRUMA/198-273--------------------------------------------------------------------------------
G4VNR9_SCHMA/1012-1091--------------------------------------------------------------------------------
E4XJ18_OIKDI/3647-3721--------------------------------------------------------------------------------
B0TDQ1_HELMI/975-1049--------------------------------------------------------------------------------
E1FJE7_LOALO/1270-1347--------------------------------------------------------------------------------
W5LW67_LEPOC/107-174--------------------------------------------------------------------------------
B4JKX6_DROGR/2483-2556--------------------------------------------------------------------------------
H3CMV4_TETNG/857-934--------------------------------------------------------------------------------
H0ZHW9_TAEGU/184-279--------------------------------------------------------------------------------
G7Y4Z3_CLOSI/2627-2720--------------------------------------------------------------------------------
H2KQX3_CLOSI/90-173--------------------------------------------------------------------------------
E4XJ18_OIKDI/4194-4261--------------------------------------------------------------------------------
Q0IE99_AEDAE/2-80--------------------------------------------------------------------------------
E4XAC9_OIKDI/140-228--------------------------------------------------------------------------------
W5PA51_SHEEP/377-450--------------------------------------------------------------------------------
G6D7M4_DANPL/314-398--------------------------------------------------------------------------------
M3YML2_MUSPF/376-449--------------------------------------------------------------------------------
G3RU01_GORGO/64-137--------------------------------------------------------------------------------
H9JRT0_BOMMO/2462-2537--------------------------------------------------------------------------------
W5MVU4_LEPOC/2262-2341--------------------------------------------------------------------------------
Q16PP3_AEDAE/932-1022--------------------------------------------------------------------------------
H2UGD5_TAKRU/574-651--------------------------------------------------------------------------------
G6D9Q8_DANPL/119-190--------------------------------------------------------------------------------
G1T5K0_RABIT/86-161--------------------------------------------------------------------------------
E9FR26_DAPPU/616-692--------------------------------------------------------------------------------
H3E0H5_PRIPA/252-327--------------------------------------------------------------------------------
U3IV84_ANAPL/3163-3238--------------------------------------------------------------------------------
E1FMD7_LOALO/132-208--------------------------------------------------------------------------------
G3MXB5_BOVIN/114-198--------------------------------------------------------------------------------
M4AZ01_XIPMA/16-83--------------------------------------------------------------------------------
I3KMS8_ORENI/203-284--------------------------------------------------------------------------------
CD48_MOUSE/130-197--------------------------------------------------------------------------------
G6D925_DANPL/279-358--------------------------------------------------------------------------------
F6ZIS0_CIOIN/1705-1780--------------------------------------------------------------------------------
C3ZMD0_BRAFL/209-280--------------------------------------------------------------------------------
Q17AE7_AEDAE/114-191--------------------------------------------------------------------------------
H9JMA6_BOMMO/261-347--------------------------------------------------------------------------------
G3WKG1_SARHA/170-256--------------------------------------------------------------------------------
B0W823_CULQU/203-284--------------------------------------------------------------------------------
G3TMS7_LOXAF/155-224--------------------------------------------------------------------------------
E9GRB9_DAPPU/217-295--------------------------------------------------------------------------------
A7SDB2_NEMVE/305-377--------------------------------------------------------------------------------
R4GKL3_CHICK/104-172--------------------------------------------------------------------------------
C3XTR1_BRAFL/68-139--------------------------------------------------------------------------------
W5L176_ASTMX/149-222--------------------------------------------------------------------------------
E2BH42_HARSA/257-346--------------------------------------------------------------------------------
F6V5H1_HORSE/2-88--------------------------------------------------------------------------------
G5C5W1_HETGA/214-299--------------------------------------------------------------------------------
G6DKG1_DANPL/42-127--------------------------------------------------------------------------------
R4G959_ANOCA/385-467--------------------------------------------------------------------------------
W5PR72_SHEEP/404-501--------------------------------------------------------------------------------
W5M0S1_LEPOC/3938-4013--------------------------------------------------------------------------------
B0WAZ0_CULQU/89-163--------------------------------------------------------------------------------
F4WYU8_ACREC/5120-5192--------------------------------------------------------------------------------
F7EI49_XENTR/201-271--------------------------------------------------------------------------------
G3UCU3_LOXAF/24-87--------------------------------------------------------------------------------
F7B359_HORSE/474-547--------------------------------------------------------------------------------
F1MYJ5_BOVIN/112-185--------------------------------------------------------------------------------
E5SCK7_TRISP/943-1011--------------------------------------------------------------------------------
L9L7I2_TUPCH/578-652--------------------------------------------------------------------------------
H9JF36_BOMMO/227-305--------------------------------------------------------------------------------
I1FA73_AMPQE/139-217--------------------------------------------------------------------------------
H9JLG2_BOMMO/434-516--------------------------------------------------------------------------------
I1FMF7_AMPQE/1385-1475--------------------------------------------------------------------------------
G1KIU8_ANOCA/239-312--------------------------------------------------------------------------------
H2M9X3_ORYLA/71-150--------------------------------------------------------------------------------
E2BUG1_HARSA/323-401--------------------------------------------------------------------------------
E9IXQ1_SOLIN/94-171--------------------------------------------------------------------------------
F6RH77_XENTR/4079-4153--------------------------------------------------------------------------------
F4C0V0_METCG/1785-1853--------------------------------------------------------------------------------
H2ZZW2_LATCH/63-137--------------------------------------------------------------------------------
H0WPD4_OTOGA/398-489--------------------------------------------------------------------------------
C3ZMZ2_BRAFL/240-316--------------------------------------------------------------------------------
E1FJS4_LOALO/417-493--------------------------------------------------------------------------------
W5NAA9_LEPOC/139-219--------------------------------------------------------------------------------
T1G7B8_HELRO/226-303--------------------------------------------------------------------------------
G6D453_DANPL/281-350--------------------------------------------------------------------------------
I3KU66_ORENI/203-286--------------------------------------------------------------------------------
W5M153_LEPOC/2152-2229--------------------------------------------------------------------------------
K7E183_MONDO/335-409--------------------------------------------------------------------------------
D6WUX6_TRICA/1036-1122--------------------------------------------------------------------------------
H9JIU0_BOMMO/441-511--------------------------------------------------------------------------------
T1JY17_TETUR/289-359--------------------------------------------------------------------------------
H3ECZ2_PRIPA/106-182--------------------------------------------------------------------------------
T1JFS9_STRMM/113-185--------------------------------------------------------------------------------
K1PMJ2_CRAGI/222-290--------------------------------------------------------------------------------
W5LBA6_ASTMX/1097-1174--------------------------------------------------------------------------------
B7PZR6_IXOSC/1264-1340--------------------------------------------------------------------------------
I1EDT6_AMPQE/278-356--------------------------------------------------------------------------------
W5M0S1_LEPOC/2162-2241--------------------------------------------------------------------------------
B7PGA6_IXOSC/2036-2116--------------------------------------------------------------------------------
E9FVQ7_DAPPU/235-322--------------------------------------------------------------------------------
K1PPU7_CRAGI/4542-4621--------------------------------------------------------------------------------
G4VB40_SCHMA/199-282--------------------------------------------------------------------------------
G6DIT1_DANPL/2751-2824--------------------------------------------------------------------------------
G4LZT5_SCHMA/152-230--------------------------------------------------------------------------------
F7ACV2_XENTR/75-150--------------------------------------------------------------------------------
F6UN68_CALJA/155-225--------------------------------------------------------------------------------
T1FD50_HELRO/342-429--------------------------------------------------------------------------------
E1BMI5_BOVIN/143-216--------------------------------------------------------------------------------
G3UI37_LOXAF/149-218--------------------------------------------------------------------------------
F6XJC4_XENTR/348-421--------------------------------------------------------------------------------
W5M0S1_LEPOC/2931-3007--------------------------------------------------------------------------------
F1PEU6_CANLF/3803-3880--------------------------------------------------------------------------------
H9JVG8_BOMMO/1263-1341--------------------------------------------------------------------------------
W5KF42_ASTMX/1168-1234--------------------------------------------------------------------------------
C3Z8U0_BRAFL/167-235--------------------------------------------------------------------------------
T1EIZ2_HELRO/95-168--------------------------------------------------------------------------------
F1Q4R3_DANRE/135-207--------------------------------------------------------------------------------
H2RMR3_TAKRU/406-477--------------------------------------------------------------------------------
H2RSI2_TAKRU/314-387--------------------------------------------------------------------------------
F6ZIS0_CIOIN/3211-3286--------------------------------------------------------------------------------
T1J836_STRMM/109-187--------------------------------------------------------------------------------
W5KED2_ASTMX/163-249--------------------------------------------------------------------------------
E1BYQ7_CHICK/2719-2798--------------------------------------------------------------------------------
C3YXP9_BRAFL/407-496--------------------------------------------------------------------------------
T1K8C5_TETUR/449-535--------------------------------------------------------------------------------
F6TLZ2_HORSE/375-448--------------------------------------------------------------------------------
V8NQ86_OPHHA/292-379--------------------------------------------------------------------------------
E2C0D1_HARSA/52-119--------------------------------------------------------------------------------
W5KFF2_ASTMX/142-227--------------------------------------------------------------------------------
G6CIK0_DANPL/333-413--------------------------------------------------------------------------------
W5L7U0_ASTMX/252-331--------------------------------------------------------------------------------
G6CY01_DANPL/72-161--------------------------------------------------------------------------------
T1FRR3_HELRO/64-144--------------------------------------------------------------------------------
I1FMM8_AMPQE/1023-1104--------------------------------------------------------------------------------
F6UVS1_ORNAN/1900-1980--------------------------------------------------------------------------------
X1WX65_ACYPI/14-108--------------------------------------------------------------------------------
V8P7Z0_OPHHA/288-365--------------------------------------------------------------------------------
E0VDC0_PEDHC/501-572--------------------------------------------------------------------------------
G3IMA0_CRIGR/236-308--------------------------------------------------------------------------------
Q0E9H8_DROME/246-327--------------------------------------------------------------------------------
H2N299_ORYLA/2348-2426--------------------------------------------------------------------------------
B7QG16_IXOSC/472-551--------------------------------------------------------------------------------
H3AVP4_LATCH/357-433--------------------------------------------------------------------------------
C3ZUH1_BRAFL/228-299--------------------------------------------------------------------------------
G1N5Z4_MELGA/1555-1629--------------------------------------------------------------------------------
U3JNU8_FICAL/142-213--------------------------------------------------------------------------------
B7QG14_IXOSC/22-101--------------------------------------------------------------------------------
D6WKD8_TRICA/1040-1116--------------------------------------------------------------------------------
T1GUI0_MEGSC/964-1046--------------------------------------------------------------------------------
H9KZA3_CHICK/519-594--------------------------------------------------------------------------------
E2AJZ4_CAMFO/103-176--------------------------------------------------------------------------------
T1FPW8_HELRO/408-484--------------------------------------------------------------------------------
H3CPR0_TETNG/17-88--------------------------------------------------------------------------------
L9LBG8_TUPCH/85-158--------------------------------------------------------------------------------
G1T5L9_RABIT/136-203--------------------------------------------------------------------------------
B7PTR3_IXOSC/179-258--------------------------------------------------------------------------------
E0VLF8_PEDHC/208-290--------------------------------------------------------------------------------
H9JRT0_BOMMO/2182-2254--------------------------------------------------------------------------------
T1KG58_TETUR/4-82--------------------------------------------------------------------------------
G4VTL1_SCHMA/2296-2370--------------------------------------------------------------------------------
G8NZI3_GRAMM/861-930--------------------------------------------------------------------------------
I3MFI4_ICTTR/4078-4152--------------------------------------------------------------------------------
T1EE45_HELRO/592-667--------------------------------------------------------------------------------
I1GBN4_AMPQE/455-539--------------------------------------------------------------------------------
K1PHQ7_CRAGI/384-465--------------------------------------------------------------------------------
G3GT78_CRIGR/242-336--------------------------------------------------------------------------------
E2ACI8_CAMFO/258-341--------------------------------------------------------------------------------
J9KTT8_ACYPI/27-111--------------------------------------------------------------------------------
H2MVA6_ORYLA/3476-3554--------------------------------------------------------------------------------
A0A068YAL3_ECHMU/5182-5262--------------------------------------------------------------------------------
F5HLD4_ANOGA/2744-2821--------------------------------------------------------------------------------
L9L8V9_TUPCH/591-661--------------------------------------------------------------------------------
F7EAV6_XENTR/1634-1711--------------------------------------------------------------------------------
T1I8U8_RHOPR/202-281--------------------------------------------------------------------------------
G6CNA5_DANPL/356-441--------------------------------------------------------------------------------
T1IT85_STRMM/3332-3409--------------------------------------------------------------------------------
H9GNS4_ANOCA/9-84--------------------------------------------------------------------------------
I3J4E4_ORENI/202-287--------------------------------------------------------------------------------
W5L708_ASTMX/11776-11853--------------------------------------------------------------------------------
F6V7S7_XENTR/23-92--------------------------------------------------------------------------------
G8NZI3_GRAMM/1037-1118--------------------------------------------------------------------------------
U3J705_ANAPL/135-215--------------------------------------------------------------------------------
Q5HZT7_XENTR/192-263--------------------------------------------------------------------------------
H9GRW9_ANOCA/222-299--------------------------------------------------------------------------------
E0VID6_PEDHC/441-517--------------------------------------------------------------------------------
B7QEV0_IXOSC/380-460--------------------------------------------------------------------------------
M3ZPM7_XIPMA/213-275--------------------------------------------------------------------------------
W5LWV7_LEPOC/123-197--------------------------------------------------------------------------------
W5MDW3_LEPOC/94-164--------------------------------------------------------------------------------
A4IHA8_XENTR/241-318--------------------------------------------------------------------------------
T1JCN0_STRMM/244-322--------------------------------------------------------------------------------
H2MNH7_ORYLA/1958-2038--------------------------------------------------------------------------------
K1QUM5_CRAGI/1472-1556--------------------------------------------------------------------------------
W5MAR0_LEPOC/224-298--------------------------------------------------------------------------------
W5K1J5_ASTMX/1701-1781--------------------------------------------------------------------------------
G3QCN7_GASAC/218-299--------------------------------------------------------------------------------
F7CCL4_XENTR/518-592--------------------------------------------------------------------------------
W5MHI8_LEPOC/218-290--------------------------------------------------------------------------------
T1K775_TETUR/221-298--------------------------------------------------------------------------------
E2AWE3_CAMFO/1589-1660--------------------------------------------------------------------------------
I1EUK9_AMPQE/107-173--------------------------------------------------------------------------------
F7DQG0_ORNAN/295-375--------------------------------------------------------------------------------
H8KUV5_SOLCM/135-222--------------------------------------------------------------------------------
J9K8R8_ACYPI/2483-2554--------------------------------------------------------------------------------
D6W7B4_TRICA/746-823--------------------------------------------------------------------------------
H9G942_ANOCA/310-381--------------------------------------------------------------------------------
I1F668_AMPQE/78-157--------------------------------------------------------------------------------
C3ZLK5_BRAFL/108-179--------------------------------------------------------------------------------
E5SMS4_TRISP/87-165--------------------------------------------------------------------------------
G1KJ63_ANOCA/148-223--------------------------------------------------------------------------------
B7PCC7_IXOSC/59-142--------------------------------------------------------------------------------
G6CLL7_DANPL/1693-1775--------------------------------------------------------------------------------
Q7Q1P7_ANOGA/394-478--------------------------------------------------------------------------------
T1JH06_STRMM/2083-2160--------------------------------------------------------------------------------
T1K7L7_TETUR/147-226--------------------------------------------------------------------------------
I1G414_AMPQE/3855-3940--------------------------------------------------------------------------------
H3B413_LATCH/246-318--------------------------------------------------------------------------------
C3YDS8_BRAFL/342-413--------------------------------------------------------------------------------
B7QKN8_IXOSC/208-290--------------------------------------------------------------------------------
K9J7I5_XENTR/316-389--------------------------------------------------------------------------------
F6UXF9_CANLF/1172-1248--------------------------------------------------------------------------------
W5M1J2_LEPOC/1180-1257--------------------------------------------------------------------------------
W5NCC6_LEPOC/202-279--------------------------------------------------------------------------------
W5KK86_ASTMX/392-467--------------------------------------------------------------------------------
W5M0S1_LEPOC/2351-2429--------------------------------------------------------------------------------
B3SB71_TRIAD/103-185--------------------------------------------------------------------------------
G4V6Y5_SCHMA/414-494--------------------------------------------------------------------------------
W5KJR4_ASTMX/2201-2279--------------------------------------------------------------------------------
B7QLF1_IXOSC/480-560--------------------------------------------------------------------------------
W5JP69_ANODA/328-432--------------------------------------------------------------------------------
E4XJ18_OIKDI/2225-2302--------------------------------------------------------------------------------
H2LYU8_ORYLA/1716-1796--------------------------------------------------------------------------------
B7PZA3_IXOSC/295-377--------------------------------------------------------------------------------
B0WFY4_CULQU/360-439--------------------------------------------------------------------------------
W5M081_LEPOC/308-380--------------------------------------------------------------------------------
E4XZR9_OIKDI/8-89--------------------------------------------------------------------------------
B3RXE3_TRIAD/79-153--------------------------------------------------------------------------------
C3YXR0_BRAFL/167-242--------------------------------------------------------------------------------
H3AL76_LATCH/295-386--------------------------------------------------------------------------------
C3XTK7_BRAFL/438-526--------------------------------------------------------------------------------
T1K8A2_TETUR/540-621--------------------------------------------------------------------------------
E3MB16_CAERE/160-235--------------------------------------------------------------------------------
H2M2I2_ORYLA/222-298--------------------------------------------------------------------------------
L5JX10_PTEAL/13-92--------------------------------------------------------------------------------
M4ACS4_XIPMA/507-581--------------------------------------------------------------------------------
J9K4X0_ACYPI/654-728--------------------------------------------------------------------------------
H2SEP9_TAKRU/419-493--------------------------------------------------------------------------------
F6U8N8_MONDO/388-479--------------------------------------------------------------------------------
G3VCI8_SARHA/56-131--------------------------------------------------------------------------------
Q17J18_AEDAE/403-485--------------------------------------------------------------------------------
E5S0Y3_TRISP/360-446--------------------------------------------------------------------------------
L5LCY1_MYODS/209-288--------------------------------------------------------------------------------
H2LJX6_ORYLA/45-125--------------------------------------------------------------------------------
B3RXE3_TRIAD/359-437--------------------------------------------------------------------------------
A0A068XX77_ECHMU/675-759--------------------------------------------------------------------------------
U3J4T8_ANAPL/404-505--------------------------------------------------------------------------------
G3SP45_LOXAF/30-95--------------------------------------------------------------------------------
E5T119_TRISP/414-491--------------------------------------------------------------------------------
B7PP06_IXOSC/326-407--------------------------------------------------------------------------------
T1G5D4_HELRO/283-360--------------------------------------------------------------------------------
F6VRV4_ORNAN/899-976--------------------------------------------------------------------------------
W5MDC5_LEPOC/210-287--------------------------------------------------------------------------------
A0A0K0J5D6_BRUMA/298-374--------------------------------------------------------------------------------
B7P248_IXOSC/242-325--------------------------------------------------------------------------------
A7RTK0_NEMVE/1-69--------------------------------------------------------------------------------
K1PLS6_CRAGI/155-230--------------------------------------------------------------------------------
W0J8I4_9BACT/142-211--------------------------------------------------------------------------------
G1LZW4_AILME/22-89--------------------------------------------------------------------------------
F1N2U9_BOVIN/258-329--------------------------------------------------------------------------------
C3XUV8_BRAFL/447-536--------------------------------------------------------------------------------
M3XL55_LATCH/136-218--------------------------------------------------------------------------------
E9HQ16_DAPPU/466-542--------------------------------------------------------------------------------
A0A0R4ICM3_DANRE/121-184--------------------------------------------------------------------------------
H2KQX2_CLOSI/34-117--------------------------------------------------------------------------------
A7RGL5_NEMVE/39-125--------------------------------------------------------------------------------
F6ZIH2_CIOIN/1610-1687--------------------------------------------------------------------------------
W0JC77_9BACT/661-730--------------------------------------------------------------------------------
A7SM80_NEMVE/331-409--------------------------------------------------------------------------------
E9HA86_DAPPU/251-351--------------------------------------------------------------------------------
G0PAG5_CAEBE/10-90--------------------------------------------------------------------------------
W4Y7I7_STRPU/821-894--------------------------------------------------------------------------------
G1KJS1_ANOCA/217-304--------------------------------------------------------------------------------
U1MCJ1_ASCSU/181-256--------------------------------------------------------------------------------
H3B7Z3_LATCH/100-168--------------------------------------------------------------------------------
G3WCD5_SARHA/148-228--------------------------------------------------------------------------------
F6X3H7_MONDO/253-326--------------------------------------------------------------------------------
D6WDF5_TRICA/1187-1265--------------------------------------------------------------------------------
F1Q990_DANRE/17-80--------------------------------------------------------------------------------
H9JSP1_BOMMO/135-217--------------------------------------------------------------------------------
G0MSS0_CAEBE/343-409--------------------------------------------------------------------------------
Q7PRJ5_ANOGA/232-309--------------------------------------------------------------------------------
I3M9C7_ICTTR/133-200--------------------------------------------------------------------------------
F6ZIH2_CIOIN/4114-4189--------------------------------------------------------------------------------
CNTN3_MOUSE/226-301--------------------------------------------------------------------------------
T1IKD2_STRMM/4014-4085--------------------------------------------------------------------------------
G3PKQ2_GASAC/261-326--------------------------------------------------------------------------------
C3XX56_BRAFL/47-126--------------------------------------------------------------------------------
G3VIH6_SARHA/137-205--------------------------------------------------------------------------------
F7EK98_ORNAN/32-101--------------------------------------------------------------------------------
E5SV26_TRISP/61-146--------------------------------------------------------------------------------
A7SC07_NEMVE/298-371--------------------------------------------------------------------------------
D6W6I2_TRICA/424-502--------------------------------------------------------------------------------
A7SM30_NEMVE/5-88--------------------------------------------------------------------------------
G7Y541_CLOSI/473-571--------------------------------------------------------------------------------
E9HXQ8_DAPPU/828-897--------------------------------------------------------------------------------
A7RTJ3_NEMVE/14-85--------------------------------------------------------------------------------
F4C0V0_METCG/1275-1343--------------------------------------------------------------------------------
I3KF22_ORENI/33-135--------------------------------------------------------------------------------
W4XD41_STRPU/227-300--------------------------------------------------------------------------------
G3H8W7_CRIGR/502-582--------------------------------------------------------------------------------
A7RK32_NEMVE/535-622--------------------------------------------------------------------------------
B4R3I9_DROSI/2489-2560--------------------------------------------------------------------------------
B7PZA3_IXOSC/482-563--------------------------------------------------------------------------------
C3Z2E6_BRAFL/201-280--------------------------------------------------------------------------------
K7E4G5_MONDO/151-223--------------------------------------------------------------------------------
K1QG34_CRAGI/1277-1359--------------------------------------------------------------------------------
D1ZZM3_TRICA/258-339--------------------------------------------------------------------------------
H2NZ13_PONAB/328-401--------------------------------------------------------------------------------
E0VFB0_PEDHC/422-519--------------------------------------------------------------------------------
A0A068XWB2_ECHMU/170-257--------------------------------------------------------------------------------
E9IXQ1_SOLIN/187-276--------------------------------------------------------------------------------
K1Q231_CRAGI/36-115--------------------------------------------------------------------------------
G4VTL1_SCHMA/808-886--------------------------------------------------------------------------------
A7RTK2_NEMVE/210-279--------------------------------------------------------------------------------
M4AH78_XIPMA/124-206--------------------------------------------------------------------------------
F6PRZ7_PIG/22-87--------------------------------------------------------------------------------
T1HS47_RHOPR/189-273--------------------------------------------------------------------------------
T1EPX6_HELRO/284-366--------------------------------------------------------------------------------
G6D6E0_DANPL/25-101--------------------------------------------------------------------------------
G1MB33_AILME/156-226--------------------------------------------------------------------------------
V8P9I2_OPHHA/300-401--------------------------------------------------------------------------------
G4VTL1_SCHMA/1250-1326--------------------------------------------------------------------------------
H2SLF1_TAKRU/3235-3314--------------------------------------------------------------------------------
B7QFW9_IXOSC/245-331--------------------------------------------------------------------------------
W5NBM8_LEPOC/100-168--------------------------------------------------------------------------------
G0N7L5_CAEBE/373-461--------------------------------------------------------------------------------
K1PWJ2_CRAGI/432-504--------------------------------------------------------------------------------
H3ESK0_PRIPA/55-129--------------------------------------------------------------------------------
I1FDC0_AMPQE/238-314--------------------------------------------------------------------------------
R4GA01_ANOCA/88-159--------------------------------------------------------------------------------
G1MCG3_AILME/310-392--------------------------------------------------------------------------------
K1QUM5_CRAGI/1371-1455--------------------------------------------------------------------------------
E9H2Z4_DAPPU/26-103--------------------------------------------------------------------------------
G7NVA5_MACFA/379-452--------------------------------------------------------------------------------
C3Z0D1_BRAFL/22979-23058--------------------------------------------------------------------------------
H0YZQ8_TAEGU/431-506--------------------------------------------------------------------------------
C3ZLK7_BRAFL/234-324--------------------------------------------------------------------------------
Q7QEY7_ANOGA/436-522--------------------------------------------------------------------------------
H2SLF1_TAKRU/611-685--------------------------------------------------------------------------------
F6YUF9_MONDO/177-249--------------------------------------------------------------------------------
U3JNR6_FICAL/230-301--------------------------------------------------------------------------------
F7IRU1_CALJA/5-77--------------------------------------------------------------------------------
C3ZLK8_BRAFL/486-576--------------------------------------------------------------------------------
J9AZ69_WUCBA/100-185--------------------------------------------------------------------------------
F7EZJ4_ORNAN/1002-1073--------------------------------------------------------------------------------
C3YXQ8_BRAFL/96-167--------------------------------------------------------------------------------
I3MHN4_ICTTR/103-176--------------------------------------------------------------------------------
K1R6E6_CRAGI/3080-3155--------------------------------------------------------------------------------
T1KYV0_TETUR/25-112--------------------------------------------------------------------------------
F6R7K8_XENTR/390-462--------------------------------------------------------------------------------
F6QG81_MONDO/189-262--------------------------------------------------------------------------------
K7IMB5_NASVI/327-416--------------------------------------------------------------------------------
T1JY17_TETUR/461-546--------------------------------------------------------------------------------
W5KF42_ASTMX/1440-1519--------------------------------------------------------------------------------
T1G0N8_HELRO/163-238--------------------------------------------------------------------------------
K1RR44_CRAGI/119-206--------------------------------------------------------------------------------
G3VNL4_SARHA/21-85--------------------------------------------------------------------------------
C3ZN37_BRAFL/121-187--------------------------------------------------------------------------------
E4XJ18_OIKDI/1536-1612--------------------------------------------------------------------------------
G3N8U3_GASAC/217-308--------------------------------------------------------------------------------
A0A068YCC0_ECHMU/283-367--------------------------------------------------------------------------------
E0VRV3_PEDHC/1213-1286--------------------------------------------------------------------------------
B7PP06_IXOSC/801-873--------------------------------------------------------------------------------
A7SFR7_NEMVE/253-323--------------------------------------------------------------------------------
H3BAI8_LATCH/287-362--------------------------------------------------------------------------------
C3Y1E9_BRAFL/344-426--------------------------------------------------------------------------------
H0ZFG4_TAEGU/86-168--------------------------------------------------------------------------------
W4YB68_STRPU/783-864--------------------------------------------------------------------------------
G6DLT7_DANPL/13012-13087--------------------------------------------------------------------------------
H2LE04_ORYLA/41-122--------------------------------------------------------------------------------
B1ZVP5_OPITP/590-660--------------------------------------------------------------------------------
T1ILZ8_STRMM/140-215--------------------------------------------------------------------------------
T1KU72_TETUR/1169-1256--------------------------------------------------------------------------------
H0Z2N0_TAEGU/381-453--------------------------------------------------------------------------------
W5M1P7_LEPOC/1755-1835--------------------------------------------------------------------------------
W4Y286_STRPU/107-184--------------------------------------------------------------------------------
G1LXN2_AILME/203-283--------------------------------------------------------------------------------
W4Y7I7_STRPU/3060-3136--------------------------------------------------------------------------------
B4MQT4_DROWI/1713-1793--------------------------------------------------------------------------------
A7S2I3_NEMVE/413-494--------------------------------------------------------------------------------
E9HF28_DAPPU/210-287--------------------------------------------------------------------------------
T1IB90_RHOPR/155-237--------------------------------------------------------------------------------
H8KUV5_SOLCM/425-492--------------------------------------------------------------------------------
I1EDT6_AMPQE/179-262--------------------------------------------------------------------------------
L9JDM5_TUPCH/1203-1276--------------------------------------------------------------------------------
H3AD53_LATCH/167-244--------------------------------------------------------------------------------
T1HGX0_RHOPR/371-448--------------------------------------------------------------------------------
T1IYV4_STRMM/278-359--------------------------------------------------------------------------------
W4Z4T9_STRPU/3645-3725--------------------------------------------------------------------------------
H2YDX9_CIOSA/35-129--------------------------------------------------------------------------------
B3S5W2_TRIAD/308-390--------------------------------------------------------------------------------
H2ZSB0_LATCH/266-348--------------------------------------------------------------------------------
H2RG18_PANTR/241-314--------------------------------------------------------------------------------
H3A7J1_LATCH/331-399--------------------------------------------------------------------------------
A8XPY0_CAEBR/43-134--------------------------------------------------------------------------------
E2RJV2_CANLF/399-486--------------------------------------------------------------------------------
H9JF77_BOMMO/163-238--------------------------------------------------------------------------------
M4A8L5_XIPMA/745-808--------------------------------------------------------------------------------
T1FRE6_HELRO/209-293--------------------------------------------------------------------------------
A4IHA8_XENTR/39-120--------------------------------------------------------------------------------
K1R6E6_CRAGI/3171-3249--------------------------------------------------------------------------------
Q17AE6_AEDAE/1232-1311--------------------------------------------------------------------------------
H3FMD2_PRIPA/16-100--------------------------------------------------------------------------------
H9GCQ6_ANOCA/235-330--------------------------------------------------------------------------------
W5KY85_ASTMX/255-334--------------------------------------------------------------------------------
M4ATB1_XIPMA/211-295--------------------------------------------------------------------------------
K1R2P7_CRAGI/2522-2597--------------------------------------------------------------------------------
G6CPY1_DANPL/598-684--------------------------------------------------------------------------------
H1A1C4_TAEGU/273-355--------------------------------------------------------------------------------
F6UF30_XENTR/102-171--------------------------------------------------------------------------------
D6WF33_TRICA/249-326--------------------------------------------------------------------------------
H3ADQ7_LATCH/479-555--------------------------------------------------------------------------------
T1JQ42_TETUR/2020-2100--------------------------------------------------------------------------------
F6U6Y7_CIOIN/285-367--------------------------------------------------------------------------------
E9HAJ5_DAPPU/201-279--------------------------------------------------------------------------------
L9LBG8_TUPCH/272-345--------------------------------------------------------------------------------
M3WCL1_FELCA/287-358--------------------------------------------------------------------------------
B1ZZE2_OPITP/13037-13105--------------------------------------------------------------------------------
E5ST68_TRISP/3557-3636--------------------------------------------------------------------------------
C3YVN4_BRAFL/419-498--------------------------------------------------------------------------------
J9JKL8_ACYPI/527-605--------------------------------------------------------------------------------
F6UEX7_XENTR/226-295--------------------------------------------------------------------------------
E0VJT8_PEDHC/162-240--------------------------------------------------------------------------------
T1FHE5_HELRO/126-207--------------------------------------------------------------------------------
A7RGM0_NEMVE/524-603--------------------------------------------------------------------------------
E9GND8_DAPPU/74-150--------------------------------------------------------------------------------
J9K5G9_ACYPI/343-417--------------------------------------------------------------------------------
E5ST68_TRISP/1585-1665--------------------------------------------------------------------------------
I3JBE4_ORENI/189-261--------------------------------------------------------------------------------
E9GRE9_DAPPU/3117-3197--------------------------------------------------------------------------------
G3UCU3_LOXAF/453-525--------------------------------------------------------------------------------
K9J7I5_XENTR/409-511--------------------------------------------------------------------------------
E9GRE9_DAPPU/197-274--------------------------------------------------------------------------------
W5JYD2_ASTMX/58-126--------------------------------------------------------------------------------
W5N938_LEPOC/257-346--------------------------------------------------------------------------------
C3ZUH1_BRAFL/401-489--------------------------------------------------------------------------------
E0W006_PEDHC/4478-4556--------------------------------------------------------------------------------
M3ZL70_XIPMA/213-289--------------------------------------------------------------------------------
K1R7L4_CRAGI/219-295--------------------------------------------------------------------------------
T1I5X2_RHOPR/2826-2898--------------------------------------------------------------------------------
Q98173_MCV1/178-253--------------------------------------------------------------------------------
G1MRA1_MELGA/3119-3198--------------------------------------------------------------------------------
I1F9U0_AMPQE/322-405--------------------------------------------------------------------------------
I1FMN0_AMPQE/2116-2202--------------------------------------------------------------------------------
D6W6K8_TRICA/382-467--------------------------------------------------------------------------------
C3Z2E6_BRAFL/392-465--------------------------------------------------------------------------------
D6WF34_TRICA/180-257--------------------------------------------------------------------------------
E4XJ18_OIKDI/803-877--------------------------------------------------------------------------------
H3BH87_LATCH/233-307--------------------------------------------------------------------------------
F6U172_XENTR/290-362--------------------------------------------------------------------------------
F6ZIS0_CIOIN/3857-3932--------------------------------------------------------------------------------
J9JSF2_ACYPI/2135-2210--------------------------------------------------------------------------------
J9K2X1_ACYPI/146-236--------------------------------------------------------------------------------
K1QUM5_CRAGI/1069-1152--------------------------------------------------------------------------------
CXAR_DANRE/147-220--------------------------------------------------------------------------------
G6CML9_DANPL/388-476--------------------------------------------------------------------------------
C3YBK6_BRAFL/146-221--------------------------------------------------------------------------------
F7CT64_XENTR/2365-2444--------------------------------------------------------------------------------
G7YDY5_CLOSI/58-135--------------------------------------------------------------------------------
W4ZEX8_STRPU/302-375--------------------------------------------------------------------------------
W5JL02_ANODA/259-351--------------------------------------------------------------------------------
K1QS90_CRAGI/218-292--------------------------------------------------------------------------------
G4VHK7_SCHMA/549-632--------------------------------------------------------------------------------
K7IX75_NASVI/225-311--------------------------------------------------------------------------------
BASI_CHICK/228-310--------------------------------------------------------------------------------
C3YWU2_BRAFL/443-520--------------------------------------------------------------------------------
W4XLP9_STRPU/324-399--------------------------------------------------------------------------------
D2A0P9_TRICA/372-458--------------------------------------------------------------------------------
X1WJL2_ACYPI/445-520--------------------------------------------------------------------------------
T1L3Z1_TETUR/940-1025--------------------------------------------------------------------------------
H3ACF0_LATCH/2225-2302--------------------------------------------------------------------------------
G3GWW1_CRIGR/399-472--------------------------------------------------------------------------------
G6D136_DANPL/590-663--------------------------------------------------------------------------------
K1R2P7_CRAGI/597-670--------------------------------------------------------------------------------
M3YRV3_MUSPF/155-225--------------------------------------------------------------------------------
J9AER1_WUCBA/39-114--------------------------------------------------------------------------------
H2M9R6_ORYLA/398-471--------------------------------------------------------------------------------
H3ADQ7_LATCH/1408-1488--------------------------------------------------------------------------------
I3IXH5_ORENI/241-338--------------------------------------------------------------------------------
I1FER7_AMPQE/107-184--------------------------------------------------------------------------------

PF00047

FLT3_MOUSE/256-346--------------------------------------------------------------------------------
OX2G_RAT/34-136--------------------------------------------------------------------------------
CEAM1_HUMAN/331-411--------------------------------------------------------------------------------
IGHM_CHICK/220-311--------------------------------------------------------------------------------
IL6RA_MOUSE/30-107--------------------------------------------------------------------------------
KI2S5_HUMAN/132-213--------------------------------------------------------------------------------
NRG_DROME/525-609--------------------------------------------------------------------------------
TIE1_MOUSE/127-208--------------------------------------------------------------------------------
KI2S5_HUMAN/32-115--------------------------------------------------------------------------------
IGHE_MOUSE/209-300--------------------------------------------------------------------------------
CSF1R_FELCA/207-293--------------------------------------------------------------------------------
TIE1_MOUSE/353-439--------------------------------------------------------------------------------
NTRK3_HUMAN/214-299--------------------------------------------------------------------------------
MUCM_RABIT/11-105--------------------------------------------------------------------------------
KIT_HUMAN/216-305--------------------------------------------------------------------------------
SEM3E_MOUSE/585-669--------------------------------------------------------------------------------
FCGR1_MOUSE/204-284--------------------------------------------------------------------------------
FGFR1_CHICK/37-115--------------------------------------------------------------------------------
PGFRB_HUMAN/37-115--------------------------------------------------------------------------------
PTPRM_HUMAN/189-275--------------------------------------------------------------------------------
CD4_MOUSE/25-127--------------------------------------------------------------------------------
OPCM_RAT/227-311--------------------------------------------------------------------------------
IGHD_HUMAN/173-264--------------------------------------------------------------------------------
V055_FOWPN/31-121--------------------------------------------------------------------------------
DIG1_CAEEL/310-389--------------------------------------------------------------------------------
CD33_HUMAN/146-227--------------------------------------------------------------------------------
NRG_DROME/251-332--------------------------------------------------------------------------------
DIG1_CAEEL/1822-1903--------------------------------------------------------------------------------
IL1R2_HUMAN/241-341--------------------------------------------------------------------------------
VCAM1_HUMAN/229-306--------------------------------------------------------------------------------
OX2G_MOUSE/143-229--------------------------------------------------------------------------------
KI3L1_HUMAN/32-110--------------------------------------------------------------------------------
THY1_HUMAN/21-119--------------------------------------------------------------------------------
IL1BP_VACCW/228-322--------------------------------------------------------------------------------

PF13895

NILR1_RAT/28-118--------------------------------------------------------------------------------
F1R1B9_DANRE/305-383--------------------------------------------------------------------------------
M0RCJ0_RAT/127-205--------------------------------------------------------------------------------
IRPL2_HUMAN/143-231--------------------------------------------------------------------------------
CD86_HUMAN/138-236--------------------------------------------------------------------------------
A1BG_HUMAN/209-301--------------------------------------------------------------------------------
PECA1_PIG/327-405--------------------------------------------------------------------------------
PECA1_MOUSE/316-393--------------------------------------------------------------------------------
VS10L_MOUSE/388-477--------------------------------------------------------------------------------
A7T6F1_NEMVE/26-106--------------------------------------------------------------------------------
A7RUN6_NEMVE/106-186--------------------------------------------------------------------------------
A1BG_RAT/218-314--------------------------------------------------------------------------------
D3ZRM2_RAT/20-112--------------------------------------------------------------------------------
Q11VY4_CYTH3/701-789--------------------------------------------------------------------------------
A6GXG9_FLAPJ/1010-1093--------------------------------------------------------------------------------
FCRLB_HUMAN/22-100--------------------------------------------------------------------------------
IL1R1_RAT/122-217--------------------------------------------------------------------------------
GP42_RAT/22-108--------------------------------------------------------------------------------
A6QQQ4_BOVIN/113-195--------------------------------------------------------------------------------
ILRL2_RAT/126-220--------------------------------------------------------------------------------
A7SZF2_NEMVE/222-298--------------------------------------------------------------------------------
A1SP19_NOCSJ/451-536--------------------------------------------------------------------------------
C3XPD2_BRAFL/8-98--------------------------------------------------------------------------------
B7Q9Q6_IXOSC/51-137--------------------------------------------------------------------------------
B3RLN9_TRIAD/257-344--------------------------------------------------------------------------------
A7SRI5_NEMVE/63-151--------------------------------------------------------------------------------
E9PD35_HUMAN/138-224--------------------------------------------------------------------------------
E9PX73_MOUSE/46-128--------------------------------------------------------------------------------
F1P3W0_CHICK/181-268--------------------------------------------------------------------------------
F6QPE0_BOVIN/327-404--------------------------------------------------------------------------------
F7DLW8_HORSE/326-403--------------------------------------------------------------------------------
G1L4E1_AILME/105-189--------------------------------------------------------------------------------
G1L7T4_AILME/329-410--------------------------------------------------------------------------------
G1M3E0_AILME/129-211--------------------------------------------------------------------------------
G1M8A4_AILME/973-1063--------------------------------------------------------------------------------
H2NXI9_PONAB/312-389--------------------------------------------------------------------------------
H2RC57_PANTR/28-117--------------------------------------------------------------------------------
H3CGE1_TETNG/471-557--------------------------------------------------------------------------------
M3XWI6_MUSPF/119-204--------------------------------------------------------------------------------
LIRB5_HUMAN/28-115--------------------------------------------------------------------------------
PECA1_HUMAN/327-404--------------------------------------------------------------------------------

PF07686

TVB8_MOUSE/25-130--------------------------------------------------------------------------------
MPZL2_HUMAN/30-143--------------------------------------------------------------------------------
IGS11_HUMAN/27-141--------------------------------------------------------------------------------
TVB1_MOUSE/25-132--------------------------------------------------------------------------------
CD2_HORSE/25-122--------------------------------------------------------------------------------
CLM2_MOUSE/19-124--------------------------------------------------------------------------------
GPA33_HUMAN/25-138--------------------------------------------------------------------------------
TVA2_MOUSE/26-132--------------------------------------------------------------------------------
TVB1_HUMAN/25-135--------------------------------------------------------------------------------
HVM07_MOUSE/24-138--------------------------------------------------------------------------------
LV603_HUMAN/5-110--------------------------------------------------------------------------------
Q9UEL6_HUMAN/15-129--------------------------------------------------------------------------------
MO2R1_MOUSE/42-147--------------------------------------------------------------------------------
SHPS1_BOVIN/38-145--------------------------------------------------------------------------------
CD2_MOUSE/23-121--------------------------------------------------------------------------------
TIMD4_HUMAN/23-128--------------------------------------------------------------------------------
TVC_HUMAN/24-136--------------------------------------------------------------------------------
FAIM3_HUMAN/19-123--------------------------------------------------------------------------------
TVA2_HUMAN/32-138--------------------------------------------------------------------------------
HV108_HUMAN/5-119--------------------------------------------------------------------------------
CEA21_HUMAN/38-141--------------------------------------------------------------------------------
CSPG2_MOUSE/27-148--------------------------------------------------------------------------------
SIGL5_HUMAN/24-140--------------------------------------------------------------------------------
VSIG1_CHICK/26-136--------------------------------------------------------------------------------
HV107_HUMAN/5-115--------------------------------------------------------------------------------
TVB5_MOUSE/14-122--------------------------------------------------------------------------------
CXAR_DANRE/28-142--------------------------------------------------------------------------------
CEAM4_HUMAN/38-141--------------------------------------------------------------------------------
HHLA2_HUMAN/226-330--------------------------------------------------------------------------------
PVRL4_HUMAN/35-146--------------------------------------------------------------------------------
CD8B_FELCA/24-135--------------------------------------------------------------------------------
SKIT3_MOUSE/32-141--------------------------------------------------------------------------------
PDCD1_MOUSE/37-145--------------------------------------------------------------------------------
KV123_HUMAN/28-129--------------------------------------------------------------------------------
SCN2B_HUMAN/33-147--------------------------------------------------------------------------------
VSIG2_HUMAN/27-142--------------------------------------------------------------------------------
FCAMR_HUMAN/65-171--------------------------------------------------------------------------------
LV1B_MOUSE/24-128--------------------------------------------------------------------------------
CD8A_MOUSE/36-148--------------------------------------------------------------------------------
CLM5_MOUSE/23-126--------------------------------------------------------------------------------
JAML1_HUMAN/25-136--------------------------------------------------------------------------------
BTNLA_MOUSE/37-146--------------------------------------------------------------------------------
TVB6_MOUSE/27-136--------------------------------------------------------------------------------
CD7_HUMAN/31-132--------------------------------------------------------------------------------
TVA1_HUMAN/25-131--------------------------------------------------------------------------------
CD2_HUMAN/28-127--------------------------------------------------------------------------------
TVA1_MOUSE/25-130--------------------------------------------------------------------------------
CD2_RAT/23-120--------------------------------------------------------------------------------
SCN3B_MOUSE/28-143--------------------------------------------------------------------------------
VPREB_HUMAN/24-134--------------------------------------------------------------------------------
TREM1_MOUSE/25-134--------------------------------------------------------------------------------
SCN1B_HUMAN/23-139--------------------------------------------------------------------------------
Q9R121_RAT/32-135--------------------------------------------------------------------------------
SIRPD_HUMAN/34-140--------------------------------------------------------------------------------
MXRA8_HUMAN/168-292--------------------------------------------------------------------------------
A2BGB5_DANRE/30-142--------------------------------------------------------------------------------
B8ZZZ4_HUMAN/29-130--------------------------------------------------------------------------------
F1NMT9_CHICK/44-146--------------------------------------------------------------------------------
F1P992_CANLF/18-131--------------------------------------------------------------------------------
F6RFK3_CHICK/32-139--------------------------------------------------------------------------------
A0A096MJE4_RAT/42-151--------------------------------------------------------------------------------
L8YBJ5_TUPCH/164-276--------------------------------------------------------------------------------
M0QX98_HUMAN/6-107--------------------------------------------------------------------------------
CD8B_RAT/24-134--------------------------------------------------------------------------------
Q3LFS9_MOUSE/42-141--------------------------------------------------------------------------------
Q8BNV8_MOUSE/24-121--------------------------------------------------------------------------------
Q8K094_MOUSE/37-141--------------------------------------------------------------------------------
Q9JHL7_RAT/42-140--------------------------------------------------------------------------------

PF16706

G1TVX5_RABIT/169-255--------------------------------------------------------------------------------
F6YE25_HORSE/168-255--------------------------------------------------------------------------------
H0UTJ7_CAVPO/168-255--------------------------------------------------------------------------------
F6UM65_CANLF/166-252--------------------------------------------------------------------------------
M3W7L5_FELCA/169-256--------------------------------------------------------------------------------
H9H653_MONDO/206-293--------------------------------------------------------------------------------
V8PHR1_OPHHA/159-245--------------------------------------------------------------------------------
L5LHN8_MYODS/162-249--------------------------------------------------------------------------------
H0WN21_OTOGA/168-255--------------------------------------------------------------------------------
IZUM1_MOUSE/168-255--------------------------------------------------------------------------------
G3TPD8_LOXAF/168-255--------------------------------------------------------------------------------
IZUM1_RAT/168-255--------------------------------------------------------------------------------
I3MLV0_ICTTR/170-257--------------------------------------------------------------------------------
G1M882_AILME/167-254--------------------------------------------------------------------------------
G1QXF7_NOMLE/168-255--------------------------------------------------------------------------------
W5PRD0_SHEEP/169-256--------------------------------------------------------------------------------
H3DD44_TETNG/58-151--------------------------------------------------------------------------------

PF11465

CD244_HUMAN/22-127--------------------------------------------------------------------------------
CD244_RAT/22-128--------------------------------------------------------------------------------
CD244_MOUSE/22-129--------------------------------------------------------------------------------

PF08204

O57240_9POXV/2-124--------------------------------------------------------------------------------
CD47_BOVIN/8-140--------------------------------------------------------------------------------
Q9DHI5_YLDV/7-104--------------------------------------------------------------------------------
CD47_HUMAN/8-142--------------------------------------------------------------------------------
Q8JTQ3_LSDV/14-122--------------------------------------------------------------------------------
Q5ZL65_CHICK/8-141--------------------------------------------------------------------------------
Q9Q8V0_RFVKA/10-120--------------------------------------------------------------------------------
Q9D9W5_MOUSE/8-139--------------------------------------------------------------------------------
Q8V3H1_SWPV1/6-113--------------------------------------------------------------------------------
Q6TUP1_YMTV5/1-98--------------------------------------------------------------------------------
A8VKH9_PIG/8-140--------------------------------------------------------------------------------
B2CWN5_9POXV/1-111--------------------------------------------------------------------------------

PF16758

UL14_HCMVM/48-234--------------------------------------------------------------------------------
UL141_HCMVM/51-241--------------------------------------------------------------------------------

PF05790

CD2_HUMAN/135-205--------------------------------------------------------------------------------
Q8K0X1_MOUSE/133-221--------------------------------------------------------------------------------
CD4_RAT/316-390--------------------------------------------------------------------------------
CD4_SAISC/125-202--------------------------------------------------------------------------------
VCAM1_HUMAN/133-221--------------------------------------------------------------------------------
CD4_RABIT/318-390--------------------------------------------------------------------------------
CD2_RAT/128-198--------------------------------------------------------------------------------
VCAM1_CANLF/133-221--------------------------------------------------------------------------------
CD4_RAT/127-206--------------------------------------------------------------------------------
Q9GKR2_BOVIN/134-222--------------------------------------------------------------------------------
CD4_RABIT/129-208--------------------------------------------------------------------------------
CD2_MOUSE/129-199--------------------------------------------------------------------------------
VCAM1_CANLF/421-509--------------------------------------------------------------------------------
VCAM1_RAT/133-221--------------------------------------------------------------------------------
CD4_CANLF/133-211--------------------------------------------------------------------------------
Q9GKR2_BOVIN/422-510--------------------------------------------------------------------------------
O55054_MOUSE/104-183--------------------------------------------------------------------------------
P79355_FELCA/332-405--------------------------------------------------------------------------------
CD4_CANLF/321-392--------------------------------------------------------------------------------
VCAM1_RAT/421-509--------------------------------------------------------------------------------
CD4_DELLE/314-387--------------------------------------------------------------------------------
Q28939_PIG/134-219--------------------------------------------------------------------------------
O88650_MARMO/10-83--------------------------------------------------------------------------------
P70443_MOUSE/8-81--------------------------------------------------------------------------------
CD2_HORSE/130-201--------------------------------------------------------------------------------
CD4_DELLE/125-203--------------------------------------------------------------------------------
P79355_FELCA/144-222--------------------------------------------------------------------------------

PF02440

Q4KSJ0_9ADEN/110-200--------------------------------------------------------------------------------
Q91CB8_ADE08/236-321--------------------------------------------------------------------------------
Q80IV8_ADE08/252-335--------------------------------------------------------------------------------
Q91PL0_9ADEN/13-104--------------------------------------------------------------------------------
Q6QPD0_9ADEN/15-113--------------------------------------------------------------------------------
Q6H1B4_9ADEN/16-113--------------------------------------------------------------------------------
Q3ZKT4_9ADEN/13-104--------------------------------------------------------------------------------
Q76C87_ADE08/128-219--------------------------------------------------------------------------------
E3TMR2_ADE16/13-100--------------------------------------------------------------------------------
Q8JZH7_ADE17/110-200--------------------------------------------------------------------------------
E321_ADE35/14-100--------------------------------------------------------------------------------
Q7TBH0_ADE08/34-124--------------------------------------------------------------------------------
B9A5V9_9ADEN/260-345--------------------------------------------------------------------------------
Q8JZH7_ADE17/15-105--------------------------------------------------------------------------------
Q6QP93_9ADEN/15-105--------------------------------------------------------------------------------
Q8UY72_9ADEN/16-114--------------------------------------------------------------------------------
B9A5V9_9ADEN/110-200--------------------------------------------------------------------------------
Q4KSJ0_9ADEN/254-339--------------------------------------------------------------------------------
Q6QPD1_9ADEN/15-112--------------------------------------------------------------------------------
Q91CB6_ADE09/110-200--------------------------------------------------------------------------------

PF15910

F1NL21_CHICK/43-155--------------------------------------------------------------------------------
G1L868_AILME/23-135--------------------------------------------------------------------------------
F6ZKL5_HORSE/23-134--------------------------------------------------------------------------------
G5BKP1_HETGA/16-127--------------------------------------------------------------------------------
H0VT36_CAVPO/23-134--------------------------------------------------------------------------------
I3LV71_PIG/23-135--------------------------------------------------------------------------------
ICOS_MOUSE/23-135--------------------------------------------------------------------------------
ICOS_HUMAN/23-134--------------------------------------------------------------------------------

PF02480

GE_PSHV1/44-516AASSALVGDAGELEQLRRRVSAGMGLTDDGDISFAAADKVNEGLYGVRVMGSGDSYTFFNVTVATETAGDDR........
GE_HHV2H/57-501AGDEGLYS....ELAWRDRVAVVN.....ESLVIYGALETDSGLYTLSVVGLSDEARQVASVVLVVEPAPVPTPTPDDYD
GE_HHV11/59-506SATGGLRT....DFVWQERAAVVN.....RSLVIHGVRETDSGLYTLSVGDIKDPARQVASVVLVVQPAPVPTPPPTPAD
GE_VZVD/193-615KKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKT.........
GE_GAHVM/41-479IKQIESLSLNGVPNIFLSTKASNK.......LEILNASLQNAGIYIRYSRNGTRTAKLDVVVVGVLGQARD.........

PF01688

GI_HHV2H/8-165--------------------------------------------------------------------------------
GI_GAHVM/2-157--------------------------------------------------------------------------------
GI_PSHV1/10-157--------------------------------------------------------------------------------
GI_VZVD/7-164--------------------------------------------------------------------------------
GI_HHV11/8-165--------------------------------------------------------------------------------

PF01537

K4P3S4_9ALPH/66-190--------------------------------------------------------------------------------
Q86788_FHV1/60-176--------------------------------------------------------------------------------
Q67644_ILTV/108-239--------------------------------------------------------------------------------
GD_SUHVR/56-181--------------------------------------------------------------------------------
GD_EHV1D/129-252--------------------------------------------------------------------------------
Q89634_FHV1/69-193--------------------------------------------------------------------------------
O41524_9ALPH/49-174--------------------------------------------------------------------------------
GD_HHV1P/82-206--------------------------------------------------------------------------------
GD_CHV1/81-206--------------------------------------------------------------------------------
Q67648_9ALPH/79-203--------------------------------------------------------------------------------
Q77L58_MEHV1/64-188--------------------------------------------------------------------------------
O90421_9ALPH/53-169--------------------------------------------------------------------------------
Q5FBC8_9ALPH/54-170--------------------------------------------------------------------------------
O39306_EHV4/54-170--------------------------------------------------------------------------------
Q91E41_9ALPH/52-168--------------------------------------------------------------------------------
O41523_9ALPH/53-168--------------------------------------------------------------------------------
O39504_9ALPH/64-183--------------------------------------------------------------------------------
Q6X201_9ALPH/66-185--------------------------------------------------------------------------------
Q87093_CHV1/74-190--------------------------------------------------------------------------------
Q69367_9ALPH/73-189--------------------------------------------------------------------------------
A7U885_HHV2/81-195--------------------------------------------------------------------------------
Q9QPU9_9ALPH/70-184--------------------------------------------------------------------------------

PF10430

F8W3C8_DANRE/7-103--------------------------------------------------------------------------------
W5M5U9_LEPOC/23-114--------------------------------------------------------------------------------
W5KIA3_ASTMX/20-110--------------------------------------------------------------------------------
Q80YS4_MOUSE/24-118--------------------------------------------------------------------------------
G1KU09_ANOCA/38-132--------------------------------------------------------------------------------
F7EC20_XENTR/25-118--------------------------------------------------------------------------------
H0YT27_TAEGU/25-119--------------------------------------------------------------------------------

PF03921

ICAM3_HUMAN/30-119--------------------------------------------------------------------------------
ICAM2_HUMAN/24-114--------------------------------------------------------------------------------
ICAM2_MOUSE/22-114--------------------------------------------------------------------------------
ICAM1_HUMAN/24-115--------------------------------------------------------------------------------
ICAM1_MOUSE/24-114--------------------------------------------------------------------------------

PF02960

K1_HHV8P/160-279--------------------------------------------------------------------------------

PF05326

Q99N75_MOUSE/3-124--------------------------------------------------------------------------------
Q9D2X6_MOUSE/3-124--------------------------------------------------------------------------------
Q76I99_MOUSE/3-123--------------------------------------------------------------------------------
PIP_RAT/1-126--------------------------------------------------------------------------------
PIP_RABIT/3-126--------------------------------------------------------------------------------
PIP_CAVPO/3-126--------------------------------------------------------------------------------
PIP_BOVIN/3-127--------------------------------------------------------------------------------
E9PX96_MOUSE/10-142--------------------------------------------------------------------------------
G1QRT8_NOMLE/4-126--------------------------------------------------------------------------------
G7P1H3_MACFA/4-126--------------------------------------------------------------------------------
PIP_MOUSE/2-126--------------------------------------------------------------------------------

PF00207

Q29N18_DROPS/678-769--------------------------------------------------------------------------------
CO4A_HUMAN/781-869--------------------------------------------------------------------------------
Q9VIT8_DROME/562-654--------------------------------------------------------------------------------
CO3_MOUSE/770-866--------------------------------------------------------------------------------
CO4B_MOUSE/779-867--------------------------------------------------------------------------------
Q7Q7T0_ANOGA/634-725--------------------------------------------------------------------------------
Q7Q4F0_ANOGA/564-653--------------------------------------------------------------------------------
MUG2_MOUSE/740-830--------------------------------------------------------------------------------
Q7Q4I0_ANOGA/955-1046--------------------------------------------------------------------------------
A2MG_MOUSE/738-828--------------------------------------------------------------------------------
PZP_MOUSE/750-840--------------------------------------------------------------------------------
A2ML1_HUMAN/736-826--------------------------------------------------------------------------------
C3P1_HUMAN/10-104--------------------------------------------------------------------------------
CPMD8_HUMAN/750-841--------------------------------------------------------------------------------
OVOS2_HUMAN/726-816--------------------------------------------------------------------------------
Q0C7A6_AEDAE/183-274--------------------------------------------------------------------------------
A2MG_PONAB/738-828--------------------------------------------------------------------------------
Q16YC2_AEDAE/682-773--------------------------------------------------------------------------------
Q17K56_AEDAE/533-625--------------------------------------------------------------------------------
A7SDN3_NEMVE/771-861--------------------------------------------------------------------------------
CD109_HUMAN/693-784--------------------------------------------------------------------------------
Y3030_RALSO/871-965--------------------------------------------------------------------------------
A5PMP6_DANRE/779-875--------------------------------------------------------------------------------
Q12VC6_METBU/707-796--------------------------------------------------------------------------------
Q3A743_PELCD/1262-1354--------------------------------------------------------------------------------
A7MNC2_CROS8/849-939--------------------------------------------------------------------------------
Q17M04_AEDAE/556-648--------------------------------------------------------------------------------
Q08R52_STIAD/712-804--------------------------------------------------------------------------------
Q1DE47_MYXXD/137-227--------------------------------------------------------------------------------
Q11S66_CYTH3/1263-1352--------------------------------------------------------------------------------
Q025N0_SOLUE/854-944--------------------------------------------------------------------------------
A7SSC0_NEMVE/10-101--------------------------------------------------------------------------------
Q2JJS1_SYNJB/901-991--------------------------------------------------------------------------------
Q7ULY0_RHOBA/1286-1375--------------------------------------------------------------------------------
Q2IJH5_ANADE/1222-1312--------------------------------------------------------------------------------
Q1D840_MYXXD/1246-1336--------------------------------------------------------------------------------
Q1IT69_KORVE/868-958--------------------------------------------------------------------------------
Q7MT05_PORGI/1146-1236--------------------------------------------------------------------------------
OVOS_CHICK/748-838--------------------------------------------------------------------------------
Y984_THEMA/714-802--------------------------------------------------------------------------------
A6LJB2_THEM4/653-737--------------------------------------------------------------------------------
Q9VLT3_DROME/939-1030--------------------------------------------------------------------------------
Q7QGN1_ANOGA/635-726--------------------------------------------------------------------------------
A6L1P0_BACV8/1146-1235--------------------------------------------------------------------------------
A8F825_PSELT/720-808--------------------------------------------------------------------------------
A5UX85_ROSS1/1485-1575--------------------------------------------------------------------------------
Q73KT0_TREDE/1174-1262--------------------------------------------------------------------------------
A6LIC0_PARD8/1134-1223--------------------------------------------------------------------------------
CD109_MOUSE/695-786--------------------------------------------------------------------------------
B4Q6W4_DROSI/635-727--------------------------------------------------------------------------------
B4QA08_DROSI/759-850--------------------------------------------------------------------------------
C3XSF4_BRAFL/154-244--------------------------------------------------------------------------------
E3FS79_STIAD/1202-1290--------------------------------------------------------------------------------
F1QX13_DANRE/768-861--------------------------------------------------------------------------------
F1R8N2_DANRE/735-823--------------------------------------------------------------------------------
F1RQW2_PIG/780-867--------------------------------------------------------------------------------
F6TCT8_XENTR/740-830--------------------------------------------------------------------------------
F7CSP0_XENTR/773-869--------------------------------------------------------------------------------
F7CVI9_XENTR/767-856--------------------------------------------------------------------------------
H2LRL9_ORYLA/415-503--------------------------------------------------------------------------------
H2M6N3_ORYLA/762-861--------------------------------------------------------------------------------
H2UUU6_TAKRU/643-731--------------------------------------------------------------------------------
H3CLD7_TETNG/732-828--------------------------------------------------------------------------------
H3D959_TETNG/731-828--------------------------------------------------------------------------------
H3DA42_TETNG/714-803--------------------------------------------------------------------------------
H3DA56_TETNG/728-816--------------------------------------------------------------------------------
H3DDC7_TETNG/573-663--------------------------------------------------------------------------------
H3DHK0_TETNG/619-707--------------------------------------------------------------------------------
H3DL28_TETNG/714-814--------------------------------------------------------------------------------
CO5_HUMAN/772-859--------------------------------------------------------------------------------
Q5LHC2_BACFN/1165-1253--------------------------------------------------------------------------------
Q5ZUX7_LEGPH/1263-1351--------------------------------------------------------------------------------
Q7PMK4_ANOGA/645-736--------------------------------------------------------------------------------
Y4489_PSEAE/857-944--------------------------------------------------------------------------------
Q9VLY7_DROME/697-787--------------------------------------------------------------------------------
R4GGS2_CHICK/726-814--------------------------------------------------------------------------------
R5UFN1_9BACE/1152-1240--------------------------------------------------------------------------------
R6X5P5_9PORP/1138-1223--------------------------------------------------------------------------------
R7EM63_9BACE/1203-1287--------------------------------------------------------------------------------

PF07654

F6UY61_MONDO/126-209----------------------------PEVL------VY----------------------------------...PSK
IGHA1_HUMAN/6-92----------------------------PKVF------PL----------------------------------...SLC
DQA1_HUMAN/112-195----------------------------PEVT------VF----------------------------------...SKS
B2MG_DANRE/24-105----------------------------PKVH------VY----------------------------------...SHF
M3W4D7_FELCA/25-106----------------------------PDTR------V.----------------------------------...TRH
IGHG1_HUMAN/229-315----------------------------PQVY------TL----------------------------------PP.SRD
LAC_RABIT/6-92----------------------------PSVI------LF----------------------------------PP.SSE
IGHA_MOUSE/6-91----------------------------PTIY------PL----------------------------------...TLP
Q90ZJ6_ORYLA/24-106----------------------------PTVQ------VY----------------------------------...SRD
GCAB_MOUSE/234-320----------------------------PQVY------VL----------------------------------PP.PAE
M9MM93_DANRE/103-186----------------------------PWSS------IY----------------------------------...PKS
HB2D_RAT/124-207----------------------------PKVT------VY----------------------------------...PSK
IGG2B_RAT/232-318----------------------------PQVY------VM----------------------------------GP.PTE
IGHG_RABIT/115-204----------------------------.SVF------IF----------------------------------PPKPKD
IGG2B_MOUSE/234-320----------------------------PQVY------IL----------------------------------PP.PAE
IGHG3_MOUSE/228-314----------------------------PQVY------TI----------------------------------PP.PRE
IGHE_RAT/314-403----------------------------PEVY------VF----------------------------------LP.PEE
H2MX91_ORYLA/112-193----------------------------..VR------VQ----------------------------------...SLA
Q8WM94_DANRE/104-187----------------------------PQTS------IY----------------------------------...PKD
IGHM_HUMAN/329-419----------------------------PDVY------LL----------------------------------PP.ARE
HA2J_MOUSE/112-195----------------------------PQAT------VF----------------------------------...PKS
HB2D_PIG/126-209----------------------------PTVT------IS----------------------------------...PSK
LAC1_MOUSE/6-92----------------------------PSVT------LF----------------------------------PP.SSE
LAC_CHICK/6-91----------------------------PTIT------LF----------------------------------PP.SKE
IGHG2_CAVPO/227-315----------------------------PDVY------TL----------------------------------PP.SRD
E9QFF8_DANRE/59-142----------------------------PHSS------VY----------------------------------...PKD
GCAA_MOUSE/122-211----------------------------.SVF------IF----------------------------------PPKIKD
IGHM_CHICK/322-413----------------------------PSVY------VF----------------------------------PP.PTE
F6W9R2_CALJA/25-107----------------------------PKIQ------VY----------------------------------...SRH
B2MG_CHICK/25-107----------------------------PKVQ------VY----------------------------------...SRF
B2MG_RABIT/5-87----------------------------PNVQ------VY----------------------------------...SRH
W5PE14_SHEEP/113-196----------------------------PRVA------VL----------------------------------...PKS
O62938_XIPMA/111-194----------------------------PYVQ------LR----------------------------------...LEK
Q1MTC8_DANRE/114-197----------------------------PEVT------IK----------------------------------...SVR
Q5M8Y9_XENTR/118-201----------------------------PNVK------IV----------------------------------...NSK
IGKC_HUMAN/5-93----------------------------PSVF------IF----------------------------------PP.SDE
F1RBP5_DANRE/133-216----------------------------PKVK------LT----------------------------------...LVK
A6QQE7_BOVIN/111-194----------------------------PEVA------VF----------------------------------...PKS
TCB2_MOUSE/9-99----------------------------PKVS------LF----------------------------------EP.SKA
IGHA_RABIT/174-266----------------------------PQVH------LL----------------------------------PP.PSE
Q70IB5_BOVIN/127-210----------------------------PTVT------VS----------------------------------...PAS
M3VX36_FELCA/114-197----------------------------PEVT------VL----------------------------------...SNS
KACB_RAT/5-93----------------------------PTVS------IF----------------------------------PP.STE
IGHD_HUMAN/6-91----------------------------PDVF------PI----------------------------------ISGCRH
O35424_MOUSE/123-206----------------------------PEVT------VY----------------------------------...PER
IGG2C_RAT/6-88----------------------------PSVY------PL----------------------------------VP.GCS
B2MG_BOVIN/25-106----------------------------PKIQ------VY----------------------------------...SRH
GCAA_MOUSE/229-315----------------------------PQVY------VL----------------------------------PP.PEE
KAC5_RABIT/5-91----------------------------PTVL------IF----------------------------------PP.APA
LAC_PIG/6-92----------------------------PTVN------LF----------------------------------PP.SSE
I3KVH2_ORENI/105-188----------------------------SAVM------IY----------------------------------...TRD
G1TXW3_RABIT/116-199----------------------------.TVQ------VA----------------------------------...ETT
H0UYJ7_CAVPO/109-192----------------------------PEVT------VF----------------------------------...PKE
DPA1_HUMAN/118-201----------------------------PEVT------VF----------------------------------...PKE
R0JJE7_ANAPL/100-182----------------------------.KVR------VS----------------------------------...PMQ
H9GZQ9_HORSE/235-322----------------------------.QVY------VL----------------------------------AP.HPD
LAC2_MOUSE/6-91----------------------------PTLT------VF----------------------------------PP.SSE
B2MG_CAVPO/5-87----------------------------PRVQ------VY----------------------------------...SRH
IGHG1_HUMAN/6-89----------------------------PSVF------PL----------------------------------AP.SSK
DPB1_HUMAN/124-207----------------------------PRVN------VS----------------------------------...PSK
B2MG_HORSE/25-106----------------------------PKVQ------VY----------------------------------...SRH
IGLL1_MOUSE/110-196----------------------------PLVT------LF----------------------------------LP.SLK
DOB_HUMAN/123-206----------------------------PEVT------VY----------------------------------...PER
IGHG1_HUMAN/122-211----------------------------.SVF------LF----------------------------------PPKPKD
IGHE_HUMAN/324-412----------------------------PEVY------AF----------------------------------AT.PEW
GCAA_MOUSE/6-88----------------------------PSVY------PL----------------------------------AP.VCG
B2MG_MOUSE/25-107----------------------------PQIQ------VY----------------------------------...SRH
IGHG1_MOUSE/223-309----------------------------PQVY------TI----------------------------------PP.PKE
IGHG1_RAT/225-311----------------------------PHVY------TM----------------------------------SP.TKE
F1NSZ6_CHICK/127-206----------------------------....------VS----------------------------------...ALQ
IGKC_MOUSE/5-93----------------------------PTVS------IF----------------------------------PP.SSE

PF08205

PVRL3_HUMAN/173-257----------------------------SLIK------GP----------------------------------D.-SLI
SN_MOUSE/142-229----------------------------PTIT------IP----------------------------------E.-ELR
RAGE_HUMAN/124-219----------------------------PEIV------DS----------------------------------A.-SEL
NPHN_MOUSE/152-242----------------------------LQLT------PE----------------------------------AG-STV
NPHN_MOUSE/357-442----------------------------VTIL------GS----------------------------------T.-SQS
CRTAM_MOUSE/119-205----------------------------PTVE------AL----------------------------------VL-RRQ
PVRL4_MOUSE/150-233----------------------------PSLN------PG----------------------------------P.-PLE
PVRL2_MOUSE/155-240----------------------------NHAE------AQ----------------------------------E.-VTI
PVRL1_HUMAN/148-237----------------------------NWIE------GT----------------------------------Q.-AVL
TMM25_HUMAN/26-118----------------------------GELE------PQ----------------------------------ID-GQT
SN_HUMAN/142-228----------------------------PTIA------SP----------------------------------V.-ELL
CD22_HUMAN/143-230----------------------------PHIQ------LP----------------------------------P.-EIQ
NPHN_HUMAN/138-228----------------------------LLLT------PE----------------------------------AG-TMV
CD80_RABIT/140-226----------------------------DFPV------PS----------------------------------I.-TDI
MUC18_HUMAN/139-234----------------------------PNIQ------VN----------------------------------P.-LGI
BCAM_HUMAN/150-248----------------------------TEVS------PN----------------------------------K.-GTL
BCAM_BOVIN/150-248----------------------------PEVS------PN----------------------------------K.-GIL
CD166_MOUSE/137-231----------------------------PEIV------NK----------------------------------A.-PFL
RAGE_MOUSE/123-217----------------------------PEIV------DP----------------------------------A.-SEL
FAS3_DROME/126-222----------------------------PIIE------LL----------------------------------..-SRP
B4MCT1_DROVI/186-273----------------------------PKIQ------QG----------------------------------D.-YLV
E1C6L8_CHICK/151-245----------------------------PEIT------PN----------------------------------S.-AGI
F1SPA8_PIG/71-155----------------------------.FPV------PS----------------------------------I.-TAL
F7EIQ1_CALJA/148-231----------------------------.TAE------AQ----------------------------------K.-VQL
G1TJN6_RABIT/203-292----------------------------.MVE------PR----------------------------------E.-VLL
G3V671_RAT/147-231----------------------------.FPT------PN----------------------------------I.-TES
G7NXN7_MACFA/142-226----------------------------.FPT------PS----------------------------------I.-TDF

PF15028

PTCRA_RAT/20-147----------------------------GIAG------TP----------------------------------FPSLAP
G1QXF2_NOMLE/20-146----------------------------GVGG------TL----------------------------------FPSLAP
PTCRA_BOVIN/31-157----------------------------GMGS------TP----------------------------------FPSLAP
G3WD30_SARHA/20-146----------------------------GMCT------AP----------------------------------FPSMAP
M3YPD2_MUSPF/40-162----------------------------GVGG------TP----------------------------------FPSLAP
H0VKD6_CAVPO/20-147----------------------------GAVT------AA----------------------------------FPSLAP
G1U7X8_RABIT/20-147----------------------------GVGH------TP----------------------------------FPSLAP

PF02124

GC_PSHV1/234-457QIITSDGEVDVKWFLINT....KDSP.PPSVT------PQTTVTFVATWTPPKGFETVFPDGKVTLTKVLRPLWLRKPIV
GC_VZVD/379-589QEYAN.G.LFSYVSAVRIPQQKQMDYPPPAIQ------CN......VLWIRDGVSNMKY.......SAVVTPDVYPFPNV
GC_HHV11/291-500HEHPD.G..FTTVSTVTSEAVGGQVP.PRTFT------CQ......MTWHRDSVTFSRR.......NATGLALVLPRPTI
GC_GAHVM/283-492FWWFESGRGATLVSTITL.GNSGIDF.PPKIS------CL......VAWKQGDMISTT........NATAIPTVYHHPRL
GC_HHV2H/260-469QENPD.G..FSTVSTVTSAAVGGQGP.PRTFT------CQ......LTWHRDSVSFSRR.......NASGTASVLPRPTI

PF09085

W5PFN9_SHEEP/105-212-------------------------.FPDQLS------VS-------------------------------------PEA
H0WQ95_OTOGA/112-222-------------------------AFPDQLT------VS-------------------------------------PAT
G5E838_MOUSE/110-220-------------------------AFPDQLV------VS-------------------------------------PEF
G1PL68_MYOLU/112-219-------------------------AFPNQLT------VS-------------------------------------PVD
I3LSA9_PIG/49-158-------------------------AFPDQLT------VS-------------------------------------PES
M3W8G7_FELCA/115-224-------------------------AFPAQLT------VS-------------------------------------PVA
MADCA_HUMAN/113-224-------------------------AFPDQLT------VS-------------------------------------PAA
F7BUG9_MONDO/130-238-------------------------AFPDKLE------VS-------------------------------------PST
I3N840_ICTTR/111-217-------------------------AFPDQLA------VS-------------------------------------PAT
L8Y2P3_TUPCH/565-674-------------------------AFPDQLT------VS-------------------------------------PVV
G3HF34_CRIGR/110-220-------------------------AFPDQLV------VS-------------------------------------PKF

PF09291

G1LKQ4_AILME/1-76----------------------------..VY------QL--------------------------------------KS
H0XHR2_OTOGA/28-106----------------------------PAVY------QL--------------------------------------KS
F6YZC0_ORNAN/8-86----------------------------PRMY------HL--------------------------------------KK
G1NZZ6_MYOLU/28-107----------------------------PAVY------QL--------------------------------------RS
TCA_MOUSE/8-88----------------------------PAVY------QL--------------------------------------KD
TCA_HUMAN/8-91----------------------------PAVY------QL--------------------------------------RD
W5QDT7_SHEEP/23-107----------------------------PTVY------QL--------------------------------------RS
F1MUN5_BOVIN/23-107----------------------------PTVY------QL--------------------------------------RS
I3NCH0_ICTTR/13-93----------------------------PTVY------QL--------------------------------------RN
E2R820_CANLF/29-106----------------------------PSVY------QM--------------------------------------RS
M0R3T1_RAT/30-109----------------------------PAVY------QL--------------------------------------KD
F6Q695_CALJA/20-100----------------------------PAVY------QL--------------------------------------RD
M3Y7D3_MUSPF/29-107----------------------------PAVY------QL--------------------------------------RS
M3WZY2_FELCA/33-111----------------------------PAVY------QL--------------------------------------KS
G3U6X3_LOXAF/21-100----------------------------PSVY------QL--------------------------------------RG
V8NIA7_OPHHA/48-130----------------------------PSVY------QL--------------------------------------ES
G1U8W0_RABIT/33-114----------------------------PAVY------QL--------------------------------------RS

PF16681

F1SAK8_PIG/36-116--------------------------------------FK----------------------------------VSIS--
CD3E_SHEEP/30-112--------------------------------------YE----------------------------------VSIS--
CD3E_BOVIN/30-112--------------------------------------YE----------------------------------VSIS--
G3QUY7_GORGO/36-127--------------------------------------YK----------------------------------VSIS--
H0X808_OTOGA/36-118--------------------------------------YK----------------------------------VSIS--
G5BHL3_HETGA/31-112--------------------------------------YR----------------------------------VSIS--
G3T782_LOXAF/29-109--------------------------------------YK----------------------------------VSIS--
I3MMT1_ICTTR/30-113--------------------------------------YK----------------------------------VSIS--
H0UW68_CAVPO/36-115--------------------------------------YE----------------------------------VSIS--
G1SRV6_RABIT/8-90--------------------------------------FA----------------------------------VSIS--
H9GCG3_ANOCA/57-136--------------------------------------IK----------------------------------VKQN--
Q3LRP4_CALJA/36-118--------------------------------------YK----------------------------------VSIS--
L5M0Z4_MYODS/18-99--------------------------------------FK----------------------------------VSIS--
G3WKI6_SARHA/41-122--------------------------------------FG----------------------------------VYIS--
CD3E_CANLF/41-122--------------------------------------FK----------------------------------VSIS--
F7D784_MONDO/33-114--------------------------------------FG----------------------------------VSIS--
M3XJR7_LATCH/37-113--------------------------------------VK----------------------------------VEVS--
F7CSX8_HORSE/40-119--------------------------------------YE----------------------------------VSIS--
L5KKM4_PTEAL/18-99--------------------------------------YK----------------------------------VSIS--
D4A5M2_RAT/24-104--------------------------------------YE----------------------------------VSIS--
G7PP33_MACFA/36-118--------------------------------------YQ----------------------------------VSIS--
CD3E_MOUSE/29-109--------------------------------------YK----------------------------------VSIS--

PF16680

W5KJS3_ASTMX/45-112--------------------------------------------------------------------------------
K7GSE2_PIG/39-114--------------------------------------------------------------------------------
CD3D_RAT/30-103--------------------------------------------------------------------------------
H2NFG8_PONAB/39-114--------------------------------------------------------------------------------
CD3E_PIG/42-118--------------------------------------------------------------------------------
G5BHL4_HETGA/19-92--------------------------------------------------------------------------------
G3WJY6_SARHA/44-120--------------------------------------------------------------------------------
F7F8D9_MONDO/35-112--------------------------------------------------------------------------------
F6X8V5_ORNAN/39-109--------------------------------------------------------------------------------
L5KJW9_PTEAL/39-116--------------------------------------------------------------------------------
F7CUQ0_HORSE/39-110--------------------------------------------------------------------------------
E2RHB8_CANLF/39-114--------------------------------------------------------------------------------
M3WFR1_FELCA/39-114--------------------------------------------------------------------------------
U3ISR2_ANAPL/34-103--------------------------------------------------------------------------------
F7F8B6_MONDO/49-121--------------------------------------------------------------------------------
G1M3D4_AILME/39-114--------------------------------------------------------------------------------
J9NXV0_CANLF/30-103--------------------------------------------------------------------------------
CD3G_SHEEP/9-84--------------------------------------------------------------------------------
W5MH99_LEPOC/35-109--------------------------------------------------------------------------------
H0VN41_CAVPO/30-103--------------------------------------------------------------------------------
G3U502_LOXAF/18-89--------------------------------------------------------------------------------
G3IMA2_CRIGR/9-82--------------------------------------------------------------------------------
F7FPX1_CALJA/30-103--------------------------------------------------------------------------------
F1N9E2_CHICK/34-109--------------------------------------------------------------------------------
H3BFR3_LATCH/32-111--------------------------------------------------------------------------------
W5PGT3_SHEEP/36-112--------------------------------------------------------------------------------
I3MVU8_ICTTR/39-109--------------------------------------------------------------------------------
G1SDA6_RABIT/30-103--------------------------------------------------------------------------------
M3XZE1_MUSPF/30-101--------------------------------------------------------------------------------
M3WFR0_FELCA/39-111--------------------------------------------------------------------------------
CD3E_FELCA/47-124--------------------------------------------------------------------------------
G3T784_LOXAF/30-104--------------------------------------------------------------------------------
CD3D_MOUSE/30-103--------------------------------------------------------------------------------
F1M9F8_RAT/39-114--------------------------------------------------------------------------------
L5M0W2_MYODS/39-112--------------------------------------------------------------------------------
B4F6W6_XENTR/31-102--------------------------------------------------------------------------------
W5PHC2_SHEEP/30-99--------------------------------------------------------------------------------
CD3D_BOVIN/30-100--------------------------------------------------------------------------------
I6LI21_MUSPF/32-108--------------------------------------------------------------------------------
H0W6D3_CAVPO/39-114--------------------------------------------------------------------------------
G7NCB9_MACMU/42-120--------------------------------------------------------------------------------
G1STZ2_RABIT/39-114--------------------------------------------------------------------------------
G8JL01_BOVIN/15-90--------------------------------------------------------------------------------
K7GLV9_PIG/30-103--------------------------------------------------------------------------------
F6WI60_MACMU/30-103--------------------------------------------------------------------------------
L5M0S8_MYODS/30-101--------------------------------------------------------------------------------
G1MXZ8_MELGA/33-102--------------------------------------------------------------------------------
H0YPP3_TAEGU/33-105--------------------------------------------------------------------------------
M3ZL37_XIPMA/31-110--------------------------------------------------------------------------------
G3WK56_SARHA/41-113--------------------------------------------------------------------------------
G3T785_LOXAF/39-113--------------------------------------------------------------------------------
G3WKI7_SARHA/39-113--------------------------------------------------------------------------------
CD3G_MOUSE/39-114--------------------------------------------------------------------------------
G1M3E8_AILME/39-111--------------------------------------------------------------------------------
G1R705_NOMLE/42-120--------------------------------------------------------------------------------
H0X0C4_OTOGA/30-103--------------------------------------------------------------------------------
F6QRU0_XENTR/52-121--------------------------------------------------------------------------------
L9KSF6_TUPCH/19-94--------------------------------------------------------------------------------
M3XZF4_MUSPF/39-112--------------------------------------------------------------------------------
I3MMT3_ICTTR/39-114--------------------------------------------------------------------------------
F7CIT2_HORSE/30-97--------------------------------------------------------------------------------
G1M3G6_AILME/47-123--------------------------------------------------------------------------------

PF07679

LRIG1_MOUSE/601-691----------------------------PSFT------KI-------------------------------------P.H
TITIN_HUMAN/7385-7474----------------------------PVFT------QK-------------------------------------P.S
PALLD_HUMAN/271-361----------------------------PRFI------QK-------------------------------------L.R
PALLD_HUMAN/1135-1225----------------------------PHFL------QA-------------------------------------P.G
HMCN2_HUMAN/4309-4395----------------------------PVFQ------VE-------------------------------------P.Q
IGDC3_HUMAN/330-417----------------------------AEFV------QH-------------------------------------P.Q
NCAM2_HUMAN/21-111----------------------------LQVT------IS-------------------------------------L.S
MYOM1_MOUSE/1555-1645----------------------------RVLG------GL-------------------------------------P.D
OBSCN_HUMAN/10-99----------------------------PRFL------TR-------------------------------------P.K
PXDN_HUMAN/433-519----------------------------PQFT------VT-------------------------------------P.Q
Q08476_CHICK/180-269----------------------------PYFV------TP-------------------------------------L.E
Q08476_CHICK/372-461----------------------------PFFD------TP-------------------------------------I.T
HMCN1_HUMAN/1171-1258----------------------------PKIQ------RG-------------------------------------P.K
O00557_HUMAN/20-114----------------------------LQVD------IV-------------------------------------P.S
UNC89_CAEEL/648-737----------------------------PAFV------TK-------------------------------------L.R
UNC89_CAEEL/3286-3377----------------------------PTFV------RE-------------------------------------L.V
UNC89_CAEEL/3482-3573----------------------------PEFT------QK-------------------------------------L.R
UNC89_CAEEL/3920-4010----------------------------PDFL------QP-------------------------------------V.K
MYLK_SHEEP/331-421----------------------------PYFS------KT-------------------------------------I.R
MUSK_HUMAN/121-208----------------------------PKIT------RP-------------------------------------P.I
ROBO1_RAT/262-347----------------------------PSFV------KR-------------------------------------P.S
O55124_MOUSE/1345-1435----------------------------KVIG------GL-------------------------------------P.D
O57576_CYNPY/213-301----------------------------VRAR------QT-------------------------------------T.V
O76281_DROME/1225-1316----------------------------PHID------RV-------------------------------------NLK
O76281_DROME/3892-3982----------------------------FYFD------GL-------------------------------------IGK
O76281_DROME/6357-6446----------------------------PEFT------KP-------------------------------------L.H
CAVPT_BRALA/59-149----------------------------PKFS------QV-------------------------------------L.K
MYLK_CHICK/28-118----------------------------PAFT------LP-------------------------------------P.R
MYLK_CHICK/156-245----------------------------PKFA------TK-------------------------------------P.N
A4V2I0_DROME/25-135----------------------------PVIS------QI-------------------------------------S.K
P79757_CHICK/328-417----------------------------ATIL------TK-------------------------------------P.R
P79757_CHICK/734-823----------------------------PAFI------TQ-------------------------------------P.K
UNC22_CAEEL/4150-4239----------------------------PKIL------TA-------------------------------------S.R
UNC22_CAEEL/6585-6674----------------------------PRFI------VK-------------------------------------P.Y
UNC22_CAEEL/6863-6953----------------------------PSFT------AQ-------------------------------------L.S
VCAM1_CANLF/25-112----------------------------SKME------IF-------------------------------------LEP
Q8BID4_MOUSE/6-97----------------------------PMFT------QP-------------------------------------L.Q
Q8T103_BOMMO/4625-4714----------------------------PEII------EP-------------------------------------L.K
Q90X22_DANRE/66-155----------------------------PVFE------SK-------------------------------------L.T
Q90X22_DANRE/178-268----------------------------PCFT------TQ-------------------------------------I.Q
Q90YM0_DANRE/209-296----------------------------VSVP------QQ-------------------------------------S.F
Q90Z41_CHICK/223-308----------------------------PTFL------RR-------------------------------------P.I
Q95YM1_PROCL/4632-4721----------------------------PKIV------QK-------------------------------------L.K
Q98918_CHICK/3071-3160----------------------------PPAV------IV-------------------------------------PLR
SPEG_MOUSE/727-816----------------------------PVFE------IP-------------------------------------L.Q
SPEG_MOUSE/1490-1579----------------------------PRFE------SI-------------------------------------M.E
Q9GV22_MYTGA/344-433----------------------------PRFI------RK-------------------------------------P.R
Q9GV22_MYTGA/647-736----------------------------PEFT------TQ-------------------------------------L.S

PF13927

B3LWB5_DROAN/364-444---------------------------PPQVT......LS-------------------------------------L-G
B4MTU0_DROWI/318-387---------------------------PPTVV......IE-------------------------------------R-K
B4MXP8_DROWI/227-304---------------------------PPEIT......VE-------------------------------------K-S
B4MYB0_DROWI/133-207---------------------------PPVIS.....DNS-------------------------------------T-Q
B3MYW1_DROAN/2105-2173---------------------------KPQIT......II-------------------------------------P-.
F1QVQ2_DANRE/2279-2355---------------------------RPSIS......SS-------------------------------------A-Q
B4LDU2_DROVI/238-314---------------------------KPQLL......VG-------------------------------------P-Q
E7EY71_DANRE/696-771---------------------------PPSIS......VV-------------------------------------Q-Q
B3M7Y3_DROAN/238-313---------------------------KPQFL......VI-------------------------------------P-Q
B4LFT8_DROVI/229-309---------------------------PPKIR......LP-------------------------------------R-T
B3MYW1_DROAN/2573-2649---------------------------PPIVQ......IT-------------------------------------P-S
F1QVQ2_DANRE/1164-1237---------------------------PPSIS......AG-------------------------------------P-R
B4L1X8_DROMO/3293-3369---------------------------PPVIE......LE-------------------------------------P-N
B4N316_DROWI/3137-3217---------------------------KPRFT......SH-------------------------------------P-Q
B4N9N3_DROWI/206-283---------------------------PPDIQ......VE-------------------------------------K-S
B4NDI1_DROWI/1716-1793---------------------------PPSIE......IS-------------------------------------P-R
B4NDI1_DROWI/1809-1884---------------------------IPVIS......VT-------------------------------------P-D
B4L1X8_DROMO/3205-3277---------------------------RPSVE......IE-------------------------------------P-I
F1M4Q3_RAT/2963-3039---------------------------PPSVI......GP-------------------------------------N-H
F1M4Q3_RAT/3712-3787---------------------------PPSIS......GG-------------------------------------P-Q
F1M8T7_RAT/117-190---------------------------RPVLT......FV-------------------------------------D-T
D3ZEF7_RAT/362-431---------------------------KPNVT......QS-------------------------------------P-V
H0ZT69_TAEGU/318-391---------------------------PPEVT......ME-------------------------------------L-S
H3C438_TETNG/442-518---------------------------PPQIL......TE-------------------------------------D-G
G1MAY3_AILME/136-218---------------------------KPTVN......VP-------------------------------------S-S
L8Y5J4_TUPCH/1436-1512---------------------------PPSIS......GS-------------------------------------N-N
E9PV93_MOUSE/156-226---------------------------KPQII......VE-------------------------------------S-V
F7B6I5_ORNAN/417-504---------------------------KPQIR......TH-------------------------------------P-E
U3J5A4_ANAPL/374-461---------------------------KPQII......IQ-------------------------------------P-E
G3SPQ7_LOXAF/2357-2434---------------------------PPSVS.....VLP-------------------------------------E-G
D3YXG0_MOUSE/4077-4151---------------------------PPVIS......SH-------------------------------------Q-K
M3WKI3_FELCA/292-364---------------------------KPYLV......KH-------------------------------------P-E
W5PG45_SHEEP/1861-1941---------------------------KPQIV.....TKS-------------------------------------P-Q
J9KA37_ACYPI/1676-1753---------------------------KPSFT.....ETF-------------------------------------P-S
U3JE64_FICAL/339-416---------------------------PPVIR......VY-------------------------------------P-E
M9MMH4_MONDO/719-791---------------------------KPTIV......TS-------------------------------------N-I
K7GSM9_PIG/46-116---------------------------EPQVT......MK-------------------------------------S-V
H0Z181_TAEGU/234-313---------------------------KPSVMT....SAT-------------------------------------K-.
H2T3G1_TAKRU/77-156---------------------------PPYIV......SP-------------------------------------P-E
H0XAK9_OTOGA/4444-4518---------------------------PPIIT......LE-------------------------------------P-V
H2LQK4_ORYLA/395-479---------------------------PPIIT......AD-------------------------------------A-T
M3VX13_FELCA/252-331---------------------------KPQIS......TS-------------------------------------N-A
F7HG01_MACMU/120-194---------------------------KPKIT......RP-------------------------------------P-I
H3ALI7_LATCH/95-169---------------------------EPKIE......VH-------------------------------------F-L
CD166_CHICK/420-494---------------------------KPQIK.....MTK-------------------------------------K-T
H3AZ49_LATCH/431-506---------------------------PPTIN......VP-------------------------------------N-N
I1FCT8_AMPQE/154-231---------------------------PPVIE......KS-------------------------------------P-T
A7RGL8_NEMVE/110-187---------------------------KPQIVG...EIKD-------------------------------------A-E
H1A3P1_TAEGU/10-94---------------------------PPRIV......EH-------------------------------------P-S
T1IV67_STRMM/4428-4506---------------------------PPKII......FS-------------------------------------N-S
U3IRV3_ANAPL/3333-3408---------------------------PPVLE......SP-------------------------------------E-S
H2RMV1_TAKRU/3687-3765---------------------------PPSFV......VP-------------------------------------P-Q
G3IGQ1_CRIGR/104-182---------------------------KPKCE......LE-------------------------------------G-E
E2RAY5_CANLF/328-396---------------------------KPTVN......GT-------------------------------------M-V
H0WC62_CAVPO/1023-1101---------------------------PPSII......GT-------------------------------------S-S
H0WK70_OTOGA/134-197---------------------------KPKIT......QS-------------------------------------L-M
W5M259_LEPOC/3334-3404---------------------------PPKIL......AS-------------------------------------G-S
W4Y7I7_STRPU/1121-1191---------------------------PPSIS......GT-------------------------------------E-T
G3S8K1_GORGO/306-398---------------------------KPKIT......YV-------------------------------------E-N
G7NZL8_MACFA/2427-2506---------------------------KPVIL......TY-------------------------------------A-P
A8XPH1_CAEBR/335-409---------------------------PPKIY......IE-------------------------------------P-Q
F6U7N2_MACMU/206-280---------------------------RPVLT......LH-------------------------------------H-G
F6VGW4_XENTR/135-215---------------------------KPTLH......LE-------------------------------------P-S
G5AXX1_HETGA/375-459---------------------------PPIIS......ST-------------------------------------Q-T
E1BPL4_BOVIN/226-295---------------------------PPVVT......LS-------------------------------------A-E
H0XXS4_OTOGA/409-487---------------------------KPKIR......EK-------------------------------------K-L
G0MT57_CAEBE/312-390---------------------------KPIIR......TP-------------------------------------L-R
M4A1V3_XIPMA/287-362---------------------------PPVLT.....RKS-------------------------------------P-H
K1Q203_CRAGI/164-241---------------------------KPQIL......VR-------------------------------------P-R
L9L0Q8_TUPCH/446-524---------------------------PPQVV......TP-------------------------------------P-Q
J9LE80_ACYPI/76-155---------------------------PPEIT.....PFY-------------------------------------F-S
TUTLA_HUMAN/226-305---------------------------PPVIV......VP-------------------------------------P-K
A8XNA1_CAEBR/1384-1460---------------------------PPKVS......VH-------------------------------------S-E
OPCM_BOVIN/135-206---------------------------PPQIM.....NIS-------------------------------------S-D
H0VAJ3_CAVPO/2443-2518---------------------------PPVIQ......PQ-------------------------------------P-S
G5ED27_CAEEL/520-594---------------------------PPEIF......GV-------------------------------------R-N
F1QXA6_DANRE/135-209---------------------------PPVLT.....ETS-------------------------------------P-P
E1BE11_BOVIN/469-544---------------------------PPVIQ......VP-------------------------------------S-N
G3WNW6_SARHA/2005-2083---------------------------PPEFS......LW-------------------------------------E-S
G1MVY0_MELGA/205-286---------------------------KPQVV......AY-------------------------------------K-K
B3SCT4_TRIAD/309-386---------------------------PPEII......AA-------------------------------------P-Q
I3KLJ9_ORENI/1511-1587---------------------------KPDIV......LL-------------------------------------P-E
G1KEL6_ANOCA/1747-1827---------------------------RPKII......VK-------------------------------------T-S
H9IXE0_BOMMO/176-257---------------------------KPRVS......VE-------------------------------------Q-R
F1MCF8_BOVIN/134-219---------------------------PPSVT......LF-------------------------------------P-P
I3LQ56_PIG/148-223---------------------------KPVVQ......TQ-------------------------------------P-S
H3A298_LATCH/269-341---------------------------KPYIV......KH-------------------------------------P-E
E2B5C2_HARSA/1192-1270---------------------------KPKLQ......TE-------------------------------------S-K
K1RSV8_CRAGI/535-604---------------------------KPEII......NK-------------------------------------N-Q
F1NLB3_CHICK/211-291---------------------------PPSVR......AR-------------------------------------Q-S
F7C3F9_HORSE/1916-1994---------------------------PPRIT......LP-------------------------------------P-S
D7EJQ9_TRICA/242-318---------------------------EPVLQ.....YVS-------------------------------------R-K
G1SPW0_RABIT/1828-1908---------------------------PPVIL......EQ-------------------------------------K-R
F7DZU8_HORSE/145-218---------------------------KPNIT......CN-------------------------------------S-S
H3AFQ4_LATCH/197-284---------------------------PPKVS......IF-------------------------------------P-L
H2RMD5_TAKRU/268-350---------------------------PPVVQ......LE-------------------------------------P-S
E9H6S4_DAPPU/229-313---------------------------EPEIE......VE-------------------------------------L-N
T1JN10_STRMM/773-858---------------------------KPYVV......VD-------------------------------------T-S
X1WJL2_ACYPI/355-429---------------------------PPEII......ME-------------------------------------P-G
H0XYV2_OTOGA/208-287---------------------------KPSVM......TS-------------------------------------A-T
LRC24_HUMAN/259-349---------------------------PPSVH......VQ-------------------------------------P-L
G3QLT3_GORGO/2730-2812---------------------------PPRIT......SE-------------------------------------P-T
M4A8Z7_XIPMA/92-163---------------------------EPQIN.....VIP-------------------------------------F-R
B4J1G6_DROGR/182-257---------------------------KPRII......YT-------------------------------------E-K
G3TDI8_LOXAF/147-221---------------------------RPQVV......VA-------------------------------------S-T
H9IS41_BOMMO/193-283---------------------------KPQVRL...TMSS-------------------------------------P-S
F7DNP8_HORSE/32-111---------------------------KPVFV.....KVP-------------------------------------E-D
E0VID6_PEDHC/546-621---------------------------KPRI.........-------------------------------------.-.
M3ZDA5_XIPMA/3960-4034---------------------------PPVLS......VP-------------------------------------R-I
A7S6L7_NEMVE/1-68---------------------------PPTIT......FA-------------------------------------P-T
W5P5G3_SHEEP/184-260---------------------------RPRIT......SE-------------------------------------P-Q
G1NXV5_MYOLU/407-490---------------------------KPEIL......TS-------------------------------------E-R
A7TD83_NEMVE/10-77---------------------------KPSII.....SSY-------------------------------------P-G
W4YVT5_STRPU/238-315---------------------------KPRIT......VF-------------------------------------P-A
G1PXT9_MYOLU/104-188---------------------------PPKIK......AV-------------------------------------K-K
H2TNV2_TAKRU/217-293---------------------------RPSIM......TP-------------------------------------P-G
Q9VNP2_DROME/376-456---------------------------PPVVK......VS-------------------------------------P-S
Q7PWJ1_ANOGA/342-413---------------------------KPKLV........-------------------------------------.-.
G3PRA1_GASAC/425-503---------------------------KPKIR......NR-------------------------------------K-L
H2T5J3_TAKRU/491-583---------------------------KPQIT......VQ-------------------------------------P-E
C9JIE7_HUMAN/28-101---------------------------PPSCR......LQ-------------------------------------G-V
G3H7Z1_CRIGR/124-193---------------------------KPHIT......VN-------------------------------------F-R
W5P8R4_SHEEP/200-280---------------------------PPTLT......LE-------------------------------------P-A
H0XMF4_OTOGA/144-224---------------------------KPSMT......LE-------------------------------------P-N
VSIG1_RAT/143-216---------------------------KPFCS......IQ-------------------------------------G-R
G1SWE1_RABIT/373-446---------------------------RPVLT......FR-------------------------------------A-S
H2V1A2_TAKRU/42-123---------------------------PPTIT......LQ-------------------------------------S-P
H2SGH2_TAKRU/2309-2391---------------------------PPKITS....SLP-------------------------------------S-V
Q4PIU9_CAEEL/443-521---------------------------KPQLL......ID-------------------------------------P-G
G1PEU6_MYOLU/1208-1280---------------------------EPAIT......VD-------------------------------------I-G
Q7QJ29_ANOGA/224-300---------------------------KPEIV......VQ-------------------------------------P-R
G5AMV7_HETGA/871-949---------------------------PPQIS......GP-------------------------------------R-E
E4XUG8_OIKDI/346-406---------------------------EPVVV........-------------------------------------.-.
K1RTW1_CRAGI/484-572---------------------------KPYIL......SH-------------------------------------P-K
M4A3M8_XIPMA/4-79---------------------------PPKLT......VV-------------------------------------P-R
L5KGT4_PTEAL/29-113---------------------------PPVIT.....DQS-------------------------------------P-R
F6U370_ORNAN/213-295---------------------------PPVVI......LP-------------------------------------R-T
H9H3H6_MACMU/143-216---------------------------KPSIN......SS-------------------------------------N-L
U3J3S7_ANAPL/753-822---------------------------KPHVV........-------------------------------------.-.
H0WC62_CAVPO/183-257---------------------------PPKVT......VM-------------------------------------P-K
E3MB14_CAERE/1378-1454---------------------------PPVISP....STQ-------------------------------------T-N
M3X7U8_FELCA/877-952---------------------------PPQIA......SS-------------------------------------A-S
F1R062_DANRE/657-736---------------------------KPKLK......SP-------------------------------------K-M
G6D1C5_DANPL/333-410---------------------------PPALV......VR-------------------------------------P-L
B0S758_DANRE/4279-4356---------------------------KPSFV......KS-------------------------------------F-E
G1PC71_MYOLU/210-286---------------------------KPSLS......AQ-------------------------------------P-G
M0R8A3_RAT/28-95---------------------------KPSLQ......AQ-------------------------------------P-S
I3JX54_ORENI/222-301---------------------------PPIIL......IS-------------------------------------P-E
I3J6L2_ORENI/1513-1595---------------------------KPKIVGG..NAAS-------------------------------------F-T
A7T324_NEMVE/168-243---------------------------KPEMV......SS-------------------------------------T-I
F4WMU2_ACREC/245-332---------------------------RPILT......IA-------------------------------------P-R
A0A0G2KBC4_RAT/202-282---------------------------PPHII......LE-------------------------------------P-T
E9Q8K5_MOUSE/7768-7845---------------------------PPSFV......QK-------------------------------------P-D
F6WZ71_XENTR/136-210---------------------------KPTIS......IQ-------------------------------------P-P
G1Q318_MYOLU/146-219---------------------------KPSIR......AS-------------------------------------N-A
B7PWG0_IXOSC/6-84---------------------------KPKIS......LQ-------------------------------------L-G
E1C7J4_CHICK/1446-1521---------------------------PPSVL......TS-------------------------------------P-S
T1HFN4_RHOPR/262-348---------------------------RPEIR......LD-------------------------------------S-R
M3Y4I1_MUSPF/446-525---------------------------PPQLSA...EETQ-------------------------------------P-Q
J9K4X0_ACYPI/838-923---------------------------KPEIL......TM-------------------------------------E-N
H2YFC8_CIOSA/6015-6094---------------------------KPVIV......ET-------------------------------------L-Q
I1FIK6_AMPQE/905-978---------------------------RPVIT......IQ-------------------------------------P-Q
H0ZT52_TAEGU/167-243---------------------------PPTIT......ES-------------------------------------K-S
G6D8N4_DANPL/397-471---------------------------PPKIT......LK-------------------------------------P-E
H2S4G7_TAKRU/2233-2312---------------------------KPYIL......TR-------------------------------------P-R
F6RM57_MONDO/221-299---------------------------PPTITD....VTS-------------------------------------A-R
A0A068YBC4_ECHMU/128-224---------------------------PPRIT......KA-------------------------------------P-G
H3C0Z0_TETNG/505-582---------------------------PPSFT......KV-------------------------------------P-E
C3YV78_BRAFL/244-318---------------------------KPRIT......TN-------------------------------------M-E
V8NXF3_OPHHA/273-341---------------------------KPVVN......RS-------------------------------------L-V
J9K2T1_ACYPI/4946-5025---------------------------KPAII......VS-------------------------------------R-P
E2RDP3_CANLF/358-427---------------------------KPKIT......WS-------------------------------------L-E
B8ZZW4_HUMAN/225-316---------------------------RPVIV......SP-------------------------------------A-N
I3KLJ9_ORENI/4172-4250---------------------------PPVFT......KK-------------------------------------P-S
G3QH37_GORGO/2340-2418---------------------------PPSII.....GNH-------------------------------------R-S
G3QAT5_GASAC/137-219---------------------------EPVVR......VP-------------------------------------S-S
K7J263_NASVI/311-384---------------------------PPKIV.....QAP-------------------------------------K-L
H2P041_PONAB/28-99---------------------------KPFLS......AW-------------------------------------P-S
G5BSW9_HETGA/22-89---------------------------KPVIS......LY-------------------------------------P-P
E1C0J7_CHICK/329-404---------------------------KPTFV......IQ-------------------------------------P-Q
H3AY43_LATCH/449-523---------------------------KPEIEE...MPYS-------------------------------------S-R
F1P3U6_CHICK/31-104---------------------------EPSSV......IF-------------------------------------P-L
U3IRV3_ANAPL/1559-1634---------------------------PPTIS......SE-------------------------------------G-R
G3RF50_GORGO/154-227---------------------------KPSFV......IQ-------------------------------------P-Q
H3CQ92_TETNG/191-272---------------------------PPSVF......IH-------------------------------------Q-N
T1G0T0_HELRO/315-390---------------------------KPSII......QP-------------------------------------P-Q
UNC22_CAEEL/5532-5609---------------------------RPQIV......VK-------------------------------------P-E
H2QGH1_PANTR/148-221---------------------------KPSIS......SS-------------------------------------N-L
F1QPV1_DANRE/763-842---------------------------KPEFS......KT-------------------------------------P-S
G5AXW3_HETGA/404-504---------------------------KPVII......TA-------------------------------------P-T
M3XII6_LATCH/175-270---------------------------PPSIL......NP-------------------------------------N-N
GPA33_MOUSE/143-215---------------------------KPDCS......IQ-------------------------------------G-E
M3WCL1_FELCA/378-451---------------------------RPVLT......LS-------------------------------------P-R
H2ZY75_LATCH/19-96---------------------------PPVIS......VP-------------------------------------Q-K
E7FDK2_DANRE/164-242---------------------------KPPVF......KQ-------------------------------------P-L
G0MH24_CAEBE/2578-2658---------------------------PPEIQ......GE-------------------------------------P-R
G1T2S8_RABIT/208-285---------------------------PPVITM...PQKS-------------------------------------F-N
T1HBT4_RHOPR/41-120---------------------------PPKIT......EP-------------------------------------P-R
E5T119_TRISP/222-297---------------------------KPEIT.....FIS-------------------------------------P-S
J9EAV2_WUCBA/64-138---------------------------PPKIR......VI-------------------------------------R-D
E0VBQ8_PEDHC/2584-2656---------------------------RPQVT......IH-------------------------------------P-R
F6U0Z2_MONDO/399-469---------------------------KPKIF.....HNS-------------------------------------A-S
SDK_CAEBR/27-98---------------------------KPPIF......QN-------------------------------------T-G
W5JFQ9_ANODA/3228-3303---------------------------RPVLE......LY-------------------------------------P-S
K7J1P5_NASVI/335-411---------------------------PPVFT......VT-------------------------------------P-Q
H2RMV3_TAKRU/3258-3334---------------------------PPVVT......SP-------------------------------------I-A
H2RTG6_TAKRU/104-167---------------------------KPTIT......CE-------------------------------------T-N
A7RHA1_NEMVE/223-323---------------------------KPLIQ......II-------------------------------------P-N
F7EZJ4_ORNAN/47-119---------------------------PPVVS......IH-------------------------------------P-A
H0VZZ7_CAVPO/13147-13224---------------------------KPVIVT....GLQ-------------------------------------D-T
U3IRV3_ANAPL/1933-2011---------------------------PPRIT......AG-------------------------------------P-S
G1M2L3_AILME/258-331---------------------------KPSVV......SP-------------------------------------S-L
H2SGH5_TAKRU/458-536---------------------------KPEITN...RYNS-------------------------------------P-V
U3JRE7_FICAL/2504-2582---------------------------KPSIV......SP-------------------------------------A-G
Q7KUK9_DROME/1117-1203---------------------------PPKIQ......AA-------------------------------------G-I
T1JQ42_TETUR/2317-2395---------------------------KPRID......RT-------------------------------------N-L
L5K5L3_PTEAL/239-309---------------------------PPVIV.......E-------------------------------------M-N
A7SFR8_NEMVE/46-114---------------------------PPVIT......EQ-------------------------------------P-M
C3YE96_BRAFL/11-88---------------------------PPKIV......SS-------------------------------------P-Q
G1L1P3_AILME/31591-31669---------------------------PPKIT......QS-------------------------------------L-K
E9ICY3_SOLIN/192-269---------------------------PPVFT......LE-------------------------------------P-E
H3BA40_LATCH/431-504---------------------------KPEVT......AP-------------------------------------Q-N
H9H6P4_MONDO/149-222---------------------------KPNIV......TS-------------------------------------N-N
F1N757_BOVIN/19142-19222---------------------------KPVLD......LK-------------------------------------L-S
B8A5X4_DANRE/249-328---------------------------KPVVS......AP-------------------------------------V-I
G5ED27_CAEEL/3765-3842---------------------------PPVID......IS-------------------------------------R-N
G3IA17_CRIGR/26-98---------------------------KPTIQ......IF-------------------------------------N-T
LIGO3_HUMAN/406-484---------------------------KPKIRE...RRLQ-------------------------------------R-V
B3DHL7_DANRE/396-486---------------------------PPIIS......SE-------------------------------------P-I
F6PCI7_DANRE/123-187---------------------------KPVINE...TIL.-------------------------------------.-.
Q0E9I7_DROME/618-698---------------------------PPKIT.....PFS-------------------------------------F-G
F6RH77_XENTR/792-871---------------------------PPVFT......QT-------------------------------------P-G
F6RHB6_XENTR/521-596---------------------------PPVIK......AP-------------------------------------S-N
C3YI92_BRAFL/240-314---------------------------PPTVV......VP-------------------------------------S-E
K1QDZ3_CRAGI/330-408---------------------------KPVIL......KK-------------------------------------P-F
G5AZS1_HETGA/225-297---------------------------PPSIQ......AT-------------------------------------N-T
H2RAR7_PANTR/241-318---------------------------KPRLL......FP-------------------------------------T-N
G3SKZ8_LOXAF/2514-2589---------------------------PPRIT......NH-------------------------------------P-P
I3K298_ORENI/241-338---------------------------PPKIL......FP-------------------------------------S-E
K7EG05_ORNAN/40-109---------------------------EPSVT......VN-------------------------------------P-A
F7ALJ3_MONDO/573-647---------------------------PPQIS.....INT-------------------------------------S-S
A0A068XUD2_HYMMI/23-102---------------------------KPRIVQ....QLK-------------------------------------S-E
G1RTX9_NOMLE/362-430---------------------------KPKIT.......W-------------------------------------R-L
K7J3K2_NASVI/230-325---------------------------PPVIH......VP-------------------------------------N-Q
T1K8T5_TETUR/700-780---------------------------KPVIES...FRFP-------------------------------------G-G
A7T347_NEMVE/207-273---------------------------PPEIT......PI-------------------------------------Q-N
G3HU05_CRIGR/156-238---------------------------KPTVN......IP-------------------------------------S-S
C3XTR2_BRAFL/407-496---------------------------RPEIV......SQ-------------------------------------S-T
Q16PL9_AEDAE/1970-2042---------------------------KPEVT......IS-------------------------------------P-D
G1MRA1_MELGA/3214-3292---------------------------PPTIT......NS-------------------------------------R-S
C3ZMB7_BRAFL/142-212---------------------------PPSIS......VP-------------------------------------T-K
L9LAX3_TUPCH/95-167---------------------------KPQVR.....LSD-------------------------------------P-T
H9ITP2_BOMMO/3557-3636---------------------------PPEFT......TT-------------------------------------P-S
W5NKB1_LEPOC/185-258---------------------------PPSLR......LS-------------------------------------V-N
A8X5T7_CAEBR/262-333---------------------------KPIVF......VT-------------------------------------P-T
F6WH01_ORNAN/522-603---------------------------PPKFV......VQ-------------------------------------P-S
B7QLJ5_IXOSC/4-82---------------------------KPKVE......LT-------------------------------------L-G
W4ZEX8_STRPU/110-190---------------------------PPYIF......VP-------------------------------------P-Q
H2W626_CAEJA/1269-1345---------------------------KPKII......SE-------------------------------------T-P
G3SWG4_LOXAF/126-199---------------------------KPSIQ......AS-------------------------------------F-T
L5MGE5_MYODS/777-852---------------------------PPRIR......ST-------------------------------------A-T
W5K8G9_ASTMX/18-102---------------------------KPSVS.....LLR-------------------------------------P-S
F7BFG5_XENTR/276-363---------------------------KPVIA......AS-------------------------------------S-S
CEAM5_HUMAN/502-575---------------------------KPSIS......SN-------------------------------------N-S
G1LNF0_AILME/259-344---------------------------KPTVQ......AS-------------------------------------A-T
G3NWN1_GASAC/3143-3221---------------------------PPSID......GP-------------------------------------A-E
B0WQT6_CULQU/2315-2388---------------------------PPRIS......FS-------------------------------------P-T
F1QAV8_DANRE/242-317---------------------------KPSIL......VP-------------------------------------S-S
H2UIH8_TAKRU/1-84---------------------------PPAIT......TQ-------------------------------------P-E
W5KN69_ASTMX/239-306---------------------------PPQIV.....YII-------------------------------------P-V
E3MB14_CAERE/2695-2773---------------------------PPSISD....ELS-------------------------------------S-N
L5MIN9_MYODS/127-196---------------------------KPKIT.....LG.-------------------------------------.-.
B0S6Y0_DANRE/5046-5124---------------------------PPTFT......KK-------------------------------------P-S
H3BWN1_TETNG/120-194---------------------------EPQIK......RH-------------------------------------P-T
Q7QCH7_ANOGA/112-186---------------------------PPKIT.....HVT-------------------------------------S-G
U3K448_FICAL/135-215---------------------------KPSVH......LE-------------------------------------P-S
Q63116_RAT/211-296---------------------------IPVVS......VP-------------------------------------E-T
T1JAP3_STRMM/8-82---------------------------PPVIT......KM-------------------------------------P-Q
G4VHL0_SCHMA/34-117---------------------------KPIIT......HS-------------------------------------P-S
H2SMR3_TAKRU/295-377---------------------------PPVFV......VR-------------------------------------P-R
H3CVA2_TETNG/320-393---------------------------PPSLV......EW-------------------------------------P-E
KIT_FELCA/413-496---------------------------KPEIL......TH-------------------------------------E-S
T1J767_STRMM/86-168---------------------------KPKII......KK-------------------------------------F-E
W5MH34_LEPOC/5091-5168---------------------------PPIFT......VK-------------------------------------P-D
I3KJA7_ORENI/452-528---------------------------PPRVL......TP-------------------------------------P-N
H2TYY0_TAKRU/252-331---------------------------KPAVS......AP-------------------------------------E-T
E2BGQ9_HARSA/550-635---------------------------KPRII......EE-------------------------------------P-V
B4R2G8_DROSI/333-408---------------------------KPRIV........-------------------------------------.-.
H2UZ60_TAKRU/136-218---------------------------PPVCK......IP-------------------------------------S-S
A0A068XP72_HYMMI/1181-1259---------------------------PPEIS......KE-------------------------------------G-L
H2W626_CAEJA/2096-2171---------------------------PPIIV......NE-------------------------------------G-G
E9FRF0_DAPPU/341-417---------------------------KPKIV........-------------------------------------.-.
T1JWQ7_TETUR/141-219---------------------------PPSIVD...NETS-------------------------------------S-D
G7PXR7_MACFA/146-219---------------------------KPNIT......IN-------------------------------------N-S
D3ZEF7_RAT/157-227---------------------------EPQVT......VK-------------------------------------S-M
T1G0N8_HELRO/356-442---------------------------KPKIL......NK-------------------------------------K-K
F4WXQ5_ACREC/40-119---------------------------PPTIL......VK-------------------------------------P-Q
G3WK71_SARHA/132-205---------------------------KPHCS......IR-------------------------------------G-T
H2YX49_CIOSA/39-117---------------------------KPKIF......LD-------------------------------------P-S
M3ZF48_XIPMA/1530-1611---------------------------KPRIT......TV-------------------------------------S-T
B4IEG8_DROSE/277-377---------------------------KPKIV......YP-------------------------------------T-L
C3YXV4_BRAFL/434-522---------------------------KPHIE......AR-------------------------------------T-S
T1L0G5_TETUR/1227-1307---------------------------KPKFI......VP-------------------------------------P-P
A7T5G7_NEMVE/176-254---------------------------PPTIT......KS-------------------------------------P-P
H2W3A3_CAEJA/124-200---------------------------KPTIR......GD-------------------------------------P-F
H3B9Q7_LATCH/92-171---------------------------PPVIV......VP-------------------------------------P-E
W4WPS4_ATTCE/2117-2185---------------------------PPTIT.....PSE-------------------------------------W-S
T1FSI9_HELRO/3-79---------------------------KPKIV......ES-------------------------------------P-K
V8P4F9_OPHHA/1279-1354---------------------------IPSVI......TS-------------------------------------P-S
E1B9K4_BOVIN/696-768---------------------------PPSVS......AV-------------------------------------N-G
G1PQB8_MYOLU/91-165---------------------------PPQLV......PA-------------------------------------P-N
M4A3M8_XIPMA/201-278---------------------------KPDLL......QP-------------------------------------H-G
W5MXI9_LEPOC/240-335---------------------------KPRIT......NP-------------------------------------L-N
Q7QH01_ANOGA/200-274---------------------------KPYFV......AE-------------------------------------P-D
A0A068XVM9_HYMMI/160-251---------------------------EPKIV......AA-------------------------------------S-E
W4VTQ7_ATTCE/336-427---------------------------KPKIM......EF-------------------------------------L-N
U1MB61_ASCSU/233-309---------------------------KPQLV......ND-------------------------------------S-G
I3JK65_ORENI/1643-1723---------------------------PPVIQ......QS-------------------------------------H-H
G1PE98_MYOLU/142-224---------------------------PPVCT......VP-------------------------------------K-A
G1NPM8_MELGA/231-326---------------------------PPEIS......YP-------------------------------------Q-N
I3J3G4_ORENI/208-291---------------------------KPDIT......GH-------------------------------------K-R
A8WZ25_CAEBR/71-139---------------------------PPEIS......VP-------------------------------------T-N
M4AZI7_XIPMA/409-487---------------------------KPKIRE...NKT.-------------------------------------.-.
H3AR10_LATCH/182-255---------------------------KPTIS......SN-------------------------------------D-S
I1FMM2_AMPQE/133-214---------------------------PPAIL......LS-------------------------------------P-T
B4QNK1_DROSI/552-632---------------------------PPQLA......IE-------------------------------------P-S
B0WQS2_CULQU/395-476---------------------------PPQIR......SQ-------------------------------------R-A
W4ZIA3_STRPU/27-102---------------------------PPSIV......EQ-------------------------------------P-E
W5MUL9_LEPOC/261-337---------------------------KPRLL......SP-------------------------------------S-G
R7L6X0_9BACT/143-212---------------------------KPSPT......LD-------------------------------------N-N
F7AMC7_ORNAN/100-173---------------------------PPHIT......AN-------------------------------------N-S
G3X1Y5_SARHA/77-149---------------------------KPKCS......VE-------------------------------------G-E
W5KA48_ASTMX/94-164---------------------------PPKIV......NF-------------------------------------S-K
C3XQC8_BRAFL/319-401---------------------------KPVINLL..LLAM-------------------------------------P-S
T1K8T5_TETUR/506-594---------------------------KPIIA......LQ-------------------------------------F-L
F4X807_ACREC/2585-2662---------------------------KPYFV......VP-------------------------------------L-S
B7PCC8_IXOSC/372-452---------------------------PPVID......SQ-------------------------------------S-L
Q7QGT8_ANOGA/598-679---------------------------PPSIT.....PFF-------------------------------------F-G
G3VWI5_SARHA/240-311---------------------------TPKVT......IE-------------------------------------P-S
G3VC29_SARHA/140-213---------------------------KPVIT......AN-------------------------------------T-T
W5L0Z5_ASTMX/61-138---------------------------PPVIT......VQ-------------------------------------P-A
W5NCC6_LEPOC/388-463---------------------------PPQIL......TE-------------------------------------S-G
L9L2E3_TUPCH/225-305---------------------------KPRLL......LP-------------------------------------P-T
R4GLP6_CHICK/4237-4314---------------------------PPSFV......KT-------------------------------------P-D
E4WVK0_OIKDI/201-279---------------------------PPSVT......NP-------------------------------------P-L
VCAM1_RAT/513-583---------------------------EPTIW......VS-------------------------------------P-S
W4XB08_STRPU/529-608---------------------------KPIID......QS-------------------------------------R-T
J9JQ41_ACYPI/68-152---------------------------KPMII......FH-------------------------------------P-E
H2TCX5_TAKRU/496-570---------------------------KPVLR......IV-------------------------------------P-N
G3P8R0_GASAC/105-178---------------------------PPVCS......MT-------------------------------------G-S
G3VSL9_SARHA/171-243---------------------------KPNLT......AN-------------------------------------K-T
W4XQ21_STRPU/745-820---------------------------PPEMV......YY-------------------------------------P-E
E4WSA8_OIKDI/267-346---------------------------PPKIT.....GIS-------------------------------------K-S
H3BZV8_TETNG/385-454---------------------------KPVIT.....SLT-------------------------------------K-R
E0V9F8_PEDHC/17-97---------------------------PPQIT......IR-------------------------------------P-K
G3TMS7_LOXAF/360-429---------------------------KPEIT......WS-------------------------------------S-G
F6RH77_XENTR/4441-4515---------------------------PPTIK......VP-------------------------------------P-L
F1NH95_CHICK/294-384---------------------------PPRVR......VF-------------------------------------P-T
T1JY23_TETUR/776-864---------------------------KPRII......NS-------------------------------------P-I
A0A0H5S2B2_BRUMA/626-704---------------------------KPRIR......YS-------------------------------------P-S
G1Q228_MYOLU/133-202---------------------------EPSIT......VN-------------------------------------F-E
G1Q3U7_MYOLU/323-399---------------------------RPSLS......VQ-------------------------------------P-G
F6WT52_MONDO/207-289---------------------------PPKLW......LE-------------------------------------P-S
T1IX56_STRMM/587-667---------------------------PPKITP....FSF-------------------------------------Q-D
Q16SD7_AEDAE/410-492---------------------------PPVIR.....EAF-------------------------------------P-E
E0VQ49_PEDHC/218-299---------------------------KPYVK......LP-------------------------------------P-H
Q66I72_DANRE/124-206---------------------------KPVSR......IP-------------------------------------S-S
I3JXY4_ORENI/2312-2391---------------------------PPVIS......GT-------------------------------------S-R
A7RTK9_NEMVE/67-134---------------------------PPSIV......QF-------------------------------------P-S
K1QFM1_CRAGI/129-198---------------------------KPTIS......HE-------------------------------------T-N
H9G4V2_ANOCA/202-277---------------------------KPEVQ.....VL.-------------------------------------Q-N
H2RMU8_TAKRU/898-975---------------------------PPSIL......EK-------------------------------------P-E
W5KK86_ASTMX/483-559---------------------------KPVIV......SF-------------------------------------V-G
E0W000_PEDHC/1395-1475---------------------------KPKFT......TK-------------------------------------P-K
H2SGH4_TAKRU/1376-1465---------------------------KPRIT......KS-------------------------------------S-F
F6ZYW4_XENTR/207-287---------------------------EPTIF......LT-------------------------------------K-S
G6D925_DANPL/189-262---------------------------IPSVT......VP-------------------------------------K-K
F6Q1C2_CIOIN/116-186---------------------------PPQLT.....DVS-------------------------------------E-D
B7QMC6_IXOSC/434-517---------------------------PPKLT......GS-------------------------------------P-T
T1KEF4_TETUR/154-239---------------------------KPIITDF..KSGE-------------------------------------P-L
G1MCJ0_AILME/480-554---------------------------PPQLV.....PAP-------------------------------------N-I
B0WMB0_CULQU/375-448---------------------------PPEIS......EP-------------------------------------P-R
E5SCK7_TRISP/564-642---------------------------KPSIT......LH-------------------------------------P-S
G3PML3_GASAC/244-323---------------------------KPTIN........-------------------------------------.-.
H2ZZ57_LATCH/1323-1400---------------------------PPSVS.....VVP-------------------------------------K-G
H2YGJ8_CIOSA/150-222---------------------------PPVFT......TS-------------------------------------P-K
B0W5X0_CULQU/123-198---------------------------KPSIQ........-------------------------------------.-.
T1K1V6_TETUR/2849-2928---------------------------KPKIQP....FNF-------------------------------------P-N
G1Q8Z3_MYOLU/108-177---------------------------KPELQ.....LLE-------------------------------------Q-T
H9JRT0_BOMMO/2553-2626---------------------------PPVIT......IT-------------------------------------P-A
H3ADQ7_LATCH/3302-3380---------------------------PPVISS....DA.-------------------------------------.-S
T1HEN7_RHOPR/1933-2009---------------------------PPKID.....KSS-------------------------------------P-L
E0VFM7_PEDHC/451-528---------------------------PPKIL......LT-------------------------------------Q-D
T1F8I6_HELRO/427-506---------------------------EPVIT......IQ-------------------------------------P-K
I1GIL2_AMPQE/402-472---------------------------KPKIT......EP-------------------------------------P-Q
H3AZ49_LATCH/1367-1445---------------------------PPSITG...AGVP-------------------------------------G-E
K7J0L1_NASVI/142-216---------------------------PPEIT......AK-------------------------------------S-S
T1HQ02_RHOPR/313-388---------------------------PPVFT......LT-------------------------------------P-H
G3VD55_SARHA/119-195---------------------------KPNIG......AS-------------------------------------P-G
B0W4B4_CULQU/435-508---------------------------PPRIV......VP-------------------------------------P-R
B1ZNU7_OPITP/131-199---------------------------PPVITM...LGVP-------------------------------------A-D
H3DK40_TETNG/293-367---------------------------PPVII......QP-------------------------------------P-E
G1U9S3_RABIT/4153-4230---------------------------PPVFT......QK-------------------------------------P-S
W5PAY5_SHEEP/299-372---------------------------RPVLT.....FSV-------------------------------------P-G
H2S7R9_TAKRU/215-288---------------------------KPTLL......LK-------------------------------------P-E
H8KUV5_SOLCM/39-113---------------------------PPVIT......SN-------------------------------------P-A
W5K1E8_ASTMX/169-243---------------------------KPEITD....KIE-------------------------------------I-I
T1IT85_STRMM/2042-2120---------------------------PPKIVP....FAF-------------------------------------Q-D
E5S3T5_TRISP/194-270---------------------------KPSIT........-------------------------------------.-.
G6CQX9_DANPL/337-406---------------------------KPELL......KT-------------------------------------K-.
B0S758_DANRE/6448-6525---------------------------PPSFV......TT-------------------------------------P-Q
K7H008_CAEJA/3858-3932---------------------------KPEIVS....GLV-------------------------------------P-T
F6Y6T8_CANLF/460-547---------------------------EPSLK......VP-------------------------------------N-N
B4MQT4_DROWI/1523-1602---------------------------KPVIV......KH-------------------------------------F-E
D6WVT0_TRICA/130-205---------------------------PPSIQ......IF-------------------------------------P-N
G1QBE9_MYOLU/236-323---------------------------KPTIQ......AS-------------------------------------T-T
A0A0J9XYL2_BRUMA/287-363---------------------------PPVIT......ES-------------------------------------P-E
F6R9N9_ORNAN/703-782---------------------------PPVFT......QE-------------------------------------P-N
Q7PN36_ANOGA/318-399---------------------------PPVVV......LQ-------------------------------------L-G
D6WIF5_TRICA/225-302---------------------------PPQIS......QK-------------------------------------P-R
H3BAW7_LATCH/116-187---------------------------KPDIT......PS-------------------------------------K-T
C3YXQ6_BRAFL/634-705---------------------------PPEVF......IP-------------------------------------R-P
M4A8Z7_XIPMA/1-72---------------------------KPYLV......MS-------------------------------------E-A
T1JW82_TETUR/357-428---------------------------RPSMI......VS-------------------------------------P-S
H2YT91_CIOSA/45-118---------------------------PPVIT......TG-------------------------------------G-N
H0V9V0_CAVPO/324-397---------------------------KPYIT......VN-------------------------------------N-S
M3ZDA5_XIPMA/2944-3017---------------------------KPRLD......AE-------------------------------------T-D
F1QHX4_DANRE/2356-2435---------------------------KPEIT......NQ-------------------------------------Y-S
F1MRU1_BOVIN/214-310---------------------------PPVIK......AP-------------------------------------P-Q
D6WVT0_TRICA/222-299---------------------------PPEIT......VA-------------------------------------K-S
K7I7M9_CAEJA/97-171---------------------------PPKIT......TR-------------------------------------P-V
B4JGM2_DROGR/141-215---------------------------PPVIS.....ELT-------------------------------------P-K
H9IS41_BOMMO/56-136---------------------------PPIVR......VE-------------------------------------P-K
H3B115_LATCH/871-950---------------------------KPSIS......SP-------------------------------------F-S
C3YAA7_BRAFL/933-1017---------------------------PPVIT.....KQ.-------------------------------------A-P
E9G8I6_DAPPU/1013-1100---------------------------RPSIS......GS-------------------------------------L-I
H3BF77_LATCH/100-172---------------------------EPQIN......IS-------------------------------------K-N
W4XM75_STRPU/242-322---------------------------PPTIT......GN-------------------------------------T-N
F4WZW8_ACREC/365-443---------------------------PPSFV......KT-------------------------------------P-T
Q1MT63_DANRE/117-185---------------------------EPHVV......IH-------------------------------------P-K
K1Q0W8_CRAGI/685-763---------------------------PPIVK......VS-------------------------------------P-S
M3ZLD4_XIPMA/214-293---------------------------KPVVS......TP-------------------------------------K-A
Q178V3_AEDAE/124-202---------------------------PPSIVE....SLT-------------------------------------S-N
W5MUK1_LEPOC/22-96---------------------------KPILT......RE-------------------------------------P-S
W5JY76_ASTMX/329-403---------------------------PPSLS......EP-------------------------------------P-R
M3XGP0_LATCH/200-282---------------------------PPSLT......LS-------------------------------------T-D
H2ZZ03_LATCH/91-169---------------------------KPSFT......VQ-------------------------------------L-K
A0A068Y1P8_ECHMU/1274-1348---------------------------KPQLV.....KTP-------------------------------------A-N
W5LCY5_ASTMX/2471-2548---------------------------PPSIV......NK-------------------------------------G-G
H3ANM9_LATCH/143-224---------------------------EPEVT......CQ-------------------------------------A-D
J9JL89_ACYPI/218-297---------------------------KPYMK......LP-------------------------------------K-T
C3ZAB6_BRAFL/505-591---------------------------KPTIT......TH-------------------------------------P-K
F6WFL2_MONDO/295-370---------------------------PPEFV......QW-------------------------------------P-Q
W5M0S1_LEPOC/4119-4194---------------------------PPTIR......SS-------------------------------------E-T
F6S0V2_MONDO/291-365---------------------------KPNIT......IN-------------------------------------S-T
H9JF49_BOMMO/162-238---------------------------KPTIT......LH-------------------------------------Y-S
W5KDQ7_ASTMX/6-85---------------------------KPLVT......WE-------------------------------------A-D
W5NE83_LEPOC/2521-2603---------------------------PPHIT.....SSP-------------------------------------P-S
G3P7F4_GASAC/2423-2505---------------------------PPRIT.....LGP-------------------------------------P-T
W5M8G0_LEPOC/824-911---------------------------KPEIQK....GAQ-------------------------------------W-S
J0DZ27_LOALO/1386-1467---------------------------KPSFT......QP-------------------------------------L-N
B7PZR6_IXOSC/2264-2335---------------------------PPSIS.....RLP-------------------------------------R-D
M3ZVE1_XIPMA/10-94---------------------------EPRIV......HH-------------------------------------P-S
A0A087ZZ96_APIME/242-324---------------------------KPRLL......VS-------------------------------------A-L
H0VAJ3_CAVPO/747-825---------------------------RPVIT......NS-------------------------------------G-S
G3WAP0_SARHA/391-475---------------------------KPEIL........-------------------------------------.-.
R4GA37_ANOCA/247-325---------------------------KPKLV......IP-------------------------------------E-S
C3ZM68_BRAFL/329-400---------------------------PPTVN......VP-------------------------------------K-S
M3ZJI9_XIPMA/1437-1515---------------------------PPTIV......GS-------------------------------------G-S
X1XGE4_ACYPI/2-81---------------------------PPSISD....SLS-------------------------------------S-S
E2AQW8_CAMFO/122-201---------------------------PPIIK......MK-------------------------------------P-N
J9EEP1_WUCBA/29-106---------------------------PPVIV......NA-------------------------------------P-T
I3IUL2_ORENI/135-202---------------------------PPSVS......VS-------------------------------------P-S
H2SHQ3_TAKRU/12-78---------------------------EPTLE......AH-------------------------------------P-A
L5M2Z7_MYODS/4159-4236---------------------------KPHIIK....ELE-------------------------------------P-V
U1NSC7_ASCSU/65-133---------------------------PPVLS......AW-------------------------------------D-H
F6ZIS0_CIOIN/2550-2629---------------------------PPSINE...DGSS-------------------------------------P-S
T1KRW2_TETUR/30-116---------------------------PPSIT......KQ-------------------------------------P-K
M4AN26_XIPMA/2400-2482---------------------------PPRIT......IG-------------------------------------P-S
E2R9V7_CANLF/302-375---------------------------KPSLW......VT-------------------------------------N-F
D6W7B4_TRICA/124-199---------------------------KPSIR........-------------------------------------.-.
Q16PP3_AEDAE/1974-2041---------------------------KPSVS........-------------------------------------.-.
H2M0W7_ORYLA/521-594---------------------------PPAIT......VE-------------------------------------G-N
WFKN1_HUMAN/185-267---------------------------PPALY......SS-------------------------------------P-S
F6X9K9_CIOIN/228-307---------------------------PPEIT......VS-------------------------------------P-K
K1QVT8_CRAGI/14-89---------------------------PPIIT......SE-------------------------------------F-R
K1QD41_CRAGI/27-103---------------------------KPYIT......SS-------------------------------------S-P
G4VNR9_SCHMA/2657-2735---------------------------PPRII......QE-------------------------------------P-K
I3J5F7_ORENI/255-332---------------------------PPSLT......AQ-------------------------------------P-K
W0JC77_9BACT/402-470---------------------------KPKFT......LQ-------------------------------------P-K
T1F313_HELRO/1059-1137---------------------------PPTII......SH-------------------------------------L-Q
G3Q4I8_GASAC/2429-2507---------------------------KPVIR......GS-------------------------------------T-G
T1I1E7_RHOPR/199-276---------------------------PPEFV......AT-------------------------------------P-K
W5M0S1_LEPOC/4029-4103---------------------------PPVIT......SQ-------------------------------------T-K
C3XX67_BRAFL/249-323---------------------------PPKIT......SD-------------------------------------N-T
G3WMC9_SARHA/242-335---------------------------RPEIF......SP-------------------------------------N-D
F6ZNR9_XENTR/40-122---------------------------PPTIT.....HQS-------------------------------------P-K
W5L6K7_ASTMX/12-90---------------------------PPVIV......KP-------------------------------------F-S
G3PR28_GASAC/2218-2297---------------------------KPQIR......GP-------------------------------------Q-S
L5JVK8_PTEAL/102-169---------------------------KPVIN......IT-------------------------------------K-I
K1R6E6_CRAGI/3602-3673---------------------------KPVITG....GTE-------------------------------------S-L
K7EE84_ORNAN/7-89---------------------------PPVIT......NQ-------------------------------------S-Q
G3WAZ9_SARHA/211-292---------------------------PPEVS......LS-------------------------------------K-T
W5MSU1_LEPOC/252-346---------------------------KPVIH......IP-------------------------------------N-K
T1FGA0_HELRO/153-227---------------------------PPKIV......TP-------------------------------------E-I
B7PZR6_IXOSC/790-866---------------------------EPSVS......LT-------------------------------------R-L
G0MYL1_CAEBE/160-231---------------------------KPSII......QF-------------------------------------T-D
F6RH77_XENTR/611-685---------------------------PPKAV......LE-------------------------------------P-R
W5MSM2_LEPOC/111-192---------------------------KPRFL......IK-------------------------------------P-L
E3MB14_CAERE/2599-2679---------------------------PPVIK......GD-------------------------------------P-R
W5MVU4_LEPOC/2357-2436---------------------------KPDIT......NK-------------------------------------H-S
B4J8M6_DROGR/130-203---------------------------EPSVV......TE-------------------------------------P-S
E9GAQ5_DAPPU/119-203---------------------------KPVITDS..KGIE-------------------------------------V-R
K1QVW7_CRAGI/597-675---------------------------PPVID.....AFS-------------------------------------F-E
J9K856_ACYPI/327-400---------------------------KPFIN......TE-------------------------------------P-K
T1I3G6_RHOPR/230-303---------------------------PPEII......QK-------------------------------------P-K
J9KA37_ACYPI/1145-1221---------------------------KPTIIL....PLQ-------------------------------------D-N
B0WMI5_CULQU/96-169---------------------------PPTIV......KS-------------------------------------P-H
H2SHA3_TAKRU/41-112---------------------------KPSVS......CP-------------------------------------D-P
T1KP14_TETUR/654-736---------------------------KPHFT......LT-------------------------------------P-S
G6DLT7_DANPL/240-317---------------------------PPKIF......QK-------------------------------------P-R
M3ZJI9_XIPMA/3791-3868---------------------------PPSIT......SS-------------------------------------R-T
I3MQM5_ICTTR/242-321---------------------------PPVIQ......WP-------------------------------------G-L
G3UP82_MELGA/243-320---------------------------PPVLL......TP-------------------------------------T-G
T1IRS7_STRMM/262-342---------------------------PPTVN......LT-------------------------------------P-L
I3K8L1_ORENI/148-221---------------------------KPRCY......TE-------------------------------------G-S
T1F6A1_HELRO/162-244---------------------------PPKIS......LS-------------------------------------I-T
G3PTV5_GASAC/187-271---------------------------PPGIT......LS-------------------------------------H-K
E3MB16_CAERE/446-520---------------------------KPVID......PS-------------------------------------K-T
U3JKT4_FICAL/3786-3860---------------------------PPVMT......VE-------------------------------------P-V
H2MBW3_ORYLA/191-272---------------------------PPTLS......VS-------------------------------------Q-N
G5C6C4_HETGA/2123-2201---------------------------PPSITG...NHAT-------------------------------------P-E
W5J457_ANODA/546-621---------------------------KPHIV........-------------------------------------.-.
A7SZF1_NEMVE/152-219---------------------------PPRIT......SF-------------------------------------T-S
F1QHX4_DANRE/2261-2340---------------------------KPQLR......NS-------------------------------------P-T
B4H7E0_DROPE/283-392---------------------------KPKIV......YP-------------------------------------A-R
Q17HV8_AEDAE/443-519---------------------------KPKII........-------------------------------------.-.
E0VTY5_PEDHC/221-298---------------------------PPEIE......VE-------------------------------------R-S
C3Z263_BRAFL/527-604---------------------------KPKIVK...FENK-------------------------------------N-G
Q2KHZ6_BOVIN/130-196---------------------------KPVIT......VK-------------------------------------K-L
CSF1R_MOUSE/399-487---------------------------PPEVS......VT-------------------------------------W-M
I3JFY2_ORENI/153-227---------------------------KPYIQ......MM-------------------------------------A-S
M3Y4D4_MUSPF/109-196---------------------------PPQIL......VH-------------------------------------P-Q
B4JJ90_DROGR/433-514---------------------------PPSIT.....DVS-------------------------------------S-P
T1IKD2_STRMM/3892-3963---------------------------PPRLT......LN-------------------------------------P-T
F1MPQ4_BOVIN/247-315---------------------------EPKIT......AS-------------------------------------S-Q
W5KAY9_ASTMX/2363-2442---------------------------KPYIL......TR-------------------------------------P-R
I3JQA4_ORENI/414-501---------------------------KPVIT......AQ-------------------------------------E-G
M3ZDA5_XIPMA/2848-2924---------------------------PPRIT......GP-------------------------------------K-E
H0XI36_OTOGA/389-463---------------------------PPVIT......VS-------------------------------------S-N
F1PAW2_CANLF/395-467---------------------------RPVLT......LS-------------------------------------P-P
K7GUB9_CAEJA/659-747---------------------------KPVIL......KK-------------------------------------R-L
G1KKG2_ANOCA/1292-1369---------------------------PPQIV......QF-------------------------------------P-E
F4W8E7_ACREC/709-796---------------------------KPEMT......NT-------------------------------------P-L
D6WFM0_TRICA/741-827---------------------------KPEID......QH-------------------------------------P-A
E5S3T6_TRISP/102-185---------------------------PPKIT.....EIP-------------------------------------E-N
J9KSY0_ACYPI/411-495---------------------------KPVIN......SP-------------------------------------Q-V
C3ZA32_BRAFL/1951-2024---------------------------KPEVV.....SVK-------------------------------------P-G
T1HID6_RHOPR/383-466---------------------------PPSII......SH-------------------------------------R-T
E1FMD8_LOALO/559-635---------------------------PPRIT.....EKP-------------------------------------R-R
H0Z2M2_TAEGU/103-176---------------------------KPVLS......SP-------------------------------------T-S
F6ZIS0_CIOIN/1986-2065---------------------------PPSIR......GS-------------------------------------G-E
A7SQE0_NEMVE/88-161---------------------------PPNIT......SF-------------------------------------R-S
B0XGP5_CULQU/1294-1360---------------------------PPKII......AS-------------------------------------H-P
F6RH77_XENTR/2475-2551---------------------------PPKIT......GS-------------------------------------V-Q
B7PAM8_IXOSC/380-463---------------------------KPTIEP....FSY-------------------------------------P-S
W4XRM4_STRPU/912-985---------------------------PPHIT.....EAP-------------------------------------T-N
W5KIY7_ASTMX/466-542---------------------------KPELSL....GFP-------------------------------------R-G
J9LBC5_ACYPI/62-145---------------------------KPTLK......YK-------------------------------------F-I
A0A0H5S739_BRUMA/198-273---------------------------PPVIS......MW-------------------------------------T-D
G4VNR9_SCHMA/1012-1091---------------------------PPVII......QP-------------------------------------L-Q
E4XJ18_OIKDI/3647-3721---------------------------EPEIV......NS-------------------------------------P-I
B0TDQ1_HELMI/975-1049---------------------------PPSIT......AQ-------------------------------------P-V
E1FJE7_LOALO/1270-1347---------------------------PPSIV......AE-------------------------------------M-K
W5LW67_LEPOC/107-174---------------------------KPQVS........-------------------------------------.-.
B4JKX6_DROGR/2483-2556---------------------------PPVVT......LN-------------------------------------P-N
H3CMV4_TETNG/857-934---------------------------PPSFS......VP-------------------------------------L-R
H0ZHW9_TAEGU/184-279---------------------------PPQII......FP-------------------------------------K-N
G7Y4Z3_CLOSI/2627-2720---------------------------KPQFT......QT-------------------------------------F-L
H2KQX3_CLOSI/90-173---------------------------RPVIR......TN-------------------------------------P-T
E4XJ18_OIKDI/4194-4261---------------------------PPRIT......MR-------------------------------------T-S
Q0IE99_AEDAE/2-80---------------------------PPKIS.....SMT-------------------------------------S-N
E4XAC9_OIKDI/140-228---------------------------PPVII......AP-------------------------------------S-D
W5PA51_SHEEP/377-450---------------------------KPVLT......FS-------------------------------------S-P
G6D7M4_DANPL/314-398---------------------------PPTVT......LK-------------------------------------P-S
M3YML2_MUSPF/376-449---------------------------RPVLT......LS-------------------------------------P-P
G3RU01_GORGO/64-137---------------------------KPSIT.....SNN-------------------------------------F-N
H9JRT0_BOMMO/2462-2537---------------------------PPQVD......IW-------------------------------------P-Q
W5MVU4_LEPOC/2262-2341---------------------------KPELK......SP-------------------------------------K-T
Q16PP3_AEDAE/932-1022---------------------------PPKIS......KP-------------------------------------S-E
H2UGD5_TAKRU/574-651---------------------------PPTIQ......VP-------------------------------------H-E
G6D9Q8_DANPL/119-190---------------------------PPSVR......AS-------------------------------------P-E
G1T5K0_RABIT/86-161---------------------------PPVIH......VP-------------------------------------A-N
E9FR26_DAPPU/616-692---------------------------KPTIL......IP-------------------------------------P-P
H3E0H5_PRIPA/252-327---------------------------PPKIY......IE-------------------------------------P-A
U3IV84_ANAPL/3163-3238---------------------------PPKIR......ST-------------------------------------E-V
E1FMD7_LOALO/132-208---------------------------PPKIT......GS-------------------------------------A-F
G3MXB5_BOVIN/114-198---------------------------EPSLS......VQ-------------------------------------P-P
M4AZ01_XIPMA/16-83---------------------------PPSVS......VT-------------------------------------P-S
I3KMS8_ORENI/203-284---------------------------PPSLS......VS-------------------------------------Q-D
CD48_MOUSE/130-197---------------------------KPSIE......IN-------------------------------------K-T
G6D925_DANPL/279-358---------------------------PPQVT......VT-------------------------------------P-T
F6ZIS0_CIOIN/1705-1780---------------------------PPVIS......KP-------------------------------------N-E
C3ZMD0_BRAFL/209-280---------------------------PPTVT......VP-------------------------------------E-S
Q17AE7_AEDAE/114-191---------------------------KPSVQ......LQ-------------------------------------L-K
H9JMA6_BOMMO/261-347---------------------------KPEIL.....PIS-------------------------------------R-H
G3WKG1_SARHA/170-256---------------------------EPQIL......TP-------------------------------------P-R
B0W823_CULQU/203-284---------------------------PPVVS......VK-------------------------------------P-D
G3TMS7_LOXAF/155-224---------------------------EPRVT......VE-------------------------------------H-T
E9GRB9_DAPPU/217-295---------------------------RPVIV......RP-------------------------------------P-Q
A7SDB2_NEMVE/305-377---------------------------PPEIS.....YIS-------------------------------------P-S
R4GKL3_CHICK/104-172---------------------------EPIII......LN-------------------------------------P-T
C3XTR1_BRAFL/68-139---------------------------PPAVI......VP-------------------------------------E-R
W5L176_ASTMX/149-222---------------------------KPRCS......IE-------------------------------------G-S
E2BH42_HARSA/257-346---------------------------KPKIM......EF-------------------------------------M-N
F6V5H1_HORSE/2-88---------------------------KPSAF.....IFP-------------------------------------P-S
G5C5W1_HETGA/214-299---------------------------PPVIK......AT-------------------------------------R-K
G6DKG1_DANPL/42-127---------------------------KPKII......EH-------------------------------------P-K
R4G959_ANOCA/385-467---------------------------RPSVM......SD-------------------------------------P-L
W5PR72_SHEEP/404-501---------------------------KPIII.....RAP-------------------------------------A-S
W5M0S1_LEPOC/3938-4013---------------------------PPMIQ......VH-------------------------------------S-D
B0WAZ0_CULQU/89-163---------------------------PPRIT......FS-------------------------------------L-S
F4WYU8_ACREC/5120-5192---------------------------KPQIC........-------------------------------------.-.
F7EI49_XENTR/201-271---------------------------TPSIT......VL-------------------------------------P-S
G3UCU3_LOXAF/24-87---------------------------RPVIS......LQ-------------------------------------P-P
F7B359_HORSE/474-547---------------------------RPVLT......LN-------------------------------------P-A
F1MYJ5_BOVIN/112-185---------------------------PPVLT......AL-------------------------------------P-S
E5SCK7_TRISP/943-1011---------------------------KPVVS......ID-------------------------------------P-A
L9L7I2_TUPCH/578-652---------------------------KPSLN......IS-------------------------------------N-T
H9JF36_BOMMO/227-305---------------------------KPRVH......VH-------------------------------------K-T
I1FA73_AMPQE/139-217---------------------------KPTIQ......SV-------------------------------------P-T
H9JLG2_BOMMO/434-516---------------------------PPQIR......HS-------------------------------------F-G
I1FMF7_AMPQE/1385-1475---------------------------PPYII......QR-------------------------------------P-S
G1KIU8_ANOCA/239-312---------------------------PPSLK......LS-------------------------------------V-N
H2M9X3_ORYLA/71-150---------------------------PPVIV......VP-------------------------------------P-K
E2BUG1_HARSA/323-401---------------------------KPKIVT....GLQ-------------------------------------S-I
E9IXQ1_SOLIN/94-171---------------------------KPVIEE....ILS-------------------------------------P-.
F6RH77_XENTR/4079-4153---------------------------PPVIV......PH-------------------------------------Q-K
F4C0V0_METCG/1785-1853---------------------------KPEIL......VP-------------------------------------P-T
H2ZZW2_LATCH/63-137---------------------------KPIIT......VT-------------------------------------S-S
H0WPD4_OTOGA/398-489---------------------------PPVVT.....ALH-------------------------------------S-A
C3ZMZ2_BRAFL/240-316---------------------------EPVIT.....GFE-------------------------------------T-Q
E1FJS4_LOALO/417-493---------------------------KPIIY......GS-------------------------------------E-G
W5NAA9_LEPOC/139-219---------------------------KPQVH......AE-------------------------------------P-D
T1G7B8_HELRO/226-303---------------------------KPRIA......SS-------------------------------------P-Q
G6D453_DANPL/281-350---------------------------PPSVT......VD-------------------------------------S-K
I3KU66_ORENI/203-286---------------------------PPVLI......SS-------------------------------------P-T
W5M153_LEPOC/2152-2229---------------------------PPQVT......VT-------------------------------------P-K
K7E183_MONDO/335-409---------------------------KPTIT......IQ-------------------------------------S-T
D6WUX6_TRICA/1036-1122---------------------------PPHIQ......AS-------------------------------------G-I
H9JIU0_BOMMO/441-511---------------------------KPVIT........-------------------------------------.-.
T1JY17_TETUR/289-359---------------------------KPEIQ......LT-------------------------------------S-D
H3ECZ2_PRIPA/106-182---------------------------KPQLL......TD-------------------------------------P-G
T1JFS9_STRMM/113-185---------------------------KPVII......RH-------------------------------------P-V
K1PMJ2_CRAGI/222-290---------------------------KPRIT......LE-------------------------------------P-S
W5LBA6_ASTMX/1097-1174---------------------------PPSIL......VP-------------------------------------L-K
B7PZR6_IXOSC/1264-1340---------------------------KPKVM......AE-------------------------------------V-N
I1EDT6_AMPQE/278-356---------------------------PPSIT......SI-------------------------------------S-N
W5M0S1_LEPOC/2162-2241---------------------------PPSIRGS..DEVS-------------------------------------P-L
B7PGA6_IXOSC/2036-2116---------------------------RPVFT......VP-------------------------------------L-N
E9FVQ7_DAPPU/235-322---------------------------KPVVVE....YLN-------------------------------------A-S
K1PPU7_CRAGI/4542-4621---------------------------KPRLS......LP-------------------------------------G-S
G4VB40_SCHMA/199-282---------------------------PPVIS.....ENS-------------------------------------S-S
G6DIT1_DANPL/2751-2824---------------------------PPEIT......IT-------------------------------------P-N
G4LZT5_SCHMA/152-230---------------------------KPQII......EE-------------------------------------P-K
F7ACV2_XENTR/75-150---------------------------PPVLN......GV-------------------------------------H-N
F6UN68_CALJA/155-225---------------------------EPQVT......LK-------------------------------------S-V
T1FD50_HELRO/342-429---------------------------KPKVE......IS-------------------------------------P-N
E1BMI5_BOVIN/143-216---------------------------RPVIT......SN-------------------------------------N-S
G3UI37_LOXAF/149-218---------------------------RPRVT......LS-------------------------------------S-K
F6XJC4_XENTR/348-421---------------------------KPELS......VS-------------------------------------S-K
W5M0S1_LEPOC/2931-3007---------------------------PPSIV.....GVN-------------------------------------P-E
F1PEU6_CANLF/3803-3880---------------------------PPAIT......PS-------------------------------------P-S
H9JVG8_BOMMO/1263-1341---------------------------KPTLV......IE-------------------------------------H-R
W5KF42_ASTMX/1168-1234---------------------------KPKIQ......AV-------------------------------------P-A
C3Z8U0_BRAFL/167-235---------------------------PPHIA......VH-------------------------------------P-S
T1EIZ2_HELRO/95-168---------------------------RPRIL......TE-------------------------------------P-Q
F1Q4R3_DANRE/135-207---------------------------EPQIV........-------------------------------------.-.
H2RMR3_TAKRU/406-477---------------------------KPVIS.....SLT-------------------------------------K-H
H2RSI2_TAKRU/314-387---------------------------PPQVT......VE-------------------------------------M-Q
F6ZIS0_CIOIN/3211-3286---------------------------PPSLV......TS-------------------------------------Q-T
T1J836_STRMM/109-187---------------------------PPRIT......GS-------------------------------------K-A
W5KED2_ASTMX/163-249---------------------------KPIIT......YA-------------------------------------P-R
E1BYQ7_CHICK/2719-2798---------------------------RPEIS......NQ-------------------------------------Y-N
C3YXP9_BRAFL/407-496---------------------------KPYIN......TV-------------------------------------S-L
T1K8C5_TETUR/449-535---------------------------PPKIT......AE-------------------------------------T-S
F6TLZ2_HORSE/375-448---------------------------PPGLT......LS-------------------------------------P-P
V8NQ86_OPHHA/292-379---------------------------KPEIV......TS-------------------------------------E-R
E2C0D1_HARSA/52-119---------------------------PPSIS......LS-------------------------------------T-S
W5KFF2_ASTMX/142-227---------------------------KPVIPT...CAVP-------------------------------------K-S
G6CIK0_DANPL/333-413---------------------------KPTLV......QI-------------------------------------Q-N
W5L7U0_ASTMX/252-331---------------------------KPSVMT....SAT-------------------------------------K-.
G6CY01_DANPL/72-161---------------------------RPELV......YT-------------------------------------F-I
T1FRR3_HELRO/64-144---------------------------PPTIN......LH-------------------------------------L-R
I1FMM8_AMPQE/1023-1104---------------------------PPYIS......SP-------------------------------------P-S
F6UVS1_ORNAN/1900-1980---------------------------KPRIV......TK-------------------------------------S-A
X1WX65_ACYPI/14-108---------------------------KPRIT......EH-------------------------------------P-T
V8P7Z0_OPHHA/288-365---------------------------KPILI......VP-------------------------------------E-T
E0VDC0_PEDHC/501-572---------------------------KPECA......IT-------------------------------------Q-T
G3IMA0_CRIGR/236-308---------------------------KPHIQ......IK-------------------------------------N-K
Q0E9H8_DROME/246-327---------------------------KPKIN......VQ-------------------------------------D-K
H2N299_ORYLA/2348-2426---------------------------KPEITS...RYE.-------------------------------------.-S
B7QG16_IXOSC/472-551---------------------------KPVIMP....YSF-------------------------------------P-K
H3AVP4_LATCH/357-433---------------------------PPQIL......NK-------------------------------------N-N
C3ZUH1_BRAFL/228-299---------------------------PPQVQ......VP-------------------------------------S-P
G1N5Z4_MELGA/1555-1629---------------------------EPRVQ......VS-------------------------------------P-E
U3JNU8_FICAL/142-213---------------------------KPIIR.....GAE-------------------------------------P-G
B7QG14_IXOSC/22-101---------------------------KPQIQP...FSFP-------------------------------------P-N
D6WKD8_TRICA/1040-1116---------------------------IPVVS......KP-------------------------------------P-P
T1GUI0_MEGSC/964-1046---------------------------PPKIT.....PF.-------------------------------------S-N
H9KZA3_CHICK/519-594---------------------------PPVIQ......VP-------------------------------------N-N
E2AJZ4_CAMFO/103-176---------------------------KPYFV......AT-------------------------------------P-S
T1FPW8_HELRO/408-484---------------------------PPQII......SA-------------------------------------P-T
H3CPR0_TETNG/17-88---------------------------PPVLT......VK-------------------------------------P-N
L9LBG8_TUPCH/85-158---------------------------KPTIT......VS-------------------------------------S-T
G1T5L9_RABIT/136-203---------------------------KPVIE......AK-------------------------------------Q-I
B7PTR3_IXOSC/179-258---------------------------KPTVT......TT-------------------------------------L-Q
E0VLF8_PEDHC/208-290---------------------------KPVIT......VP-------------------------------------R-P
H9JRT0_BOMMO/2182-2254---------------------------PPTVS......IR-------------------------------------P-I
T1KG58_TETUR/4-82---------------------------KPIVN......LV-------------------------------------L-G
G4VTL1_SCHMA/2296-2370---------------------------KPYLV......NH-------------------------------------P-N
G8NZI3_GRAMM/861-930---------------------------TPSII......AQ-------------------------------------P-V
I3MFI4_ICTTR/4078-4152---------------------------PPVIN......TQ-------------------------------------P-K
T1EE45_HELRO/592-667---------------------------KPVIK......IY-------------------------------------P-T
I1GBN4_AMPQE/455-539---------------------------PPTID......VE-------------------------------------S-E
K1PHQ7_CRAGI/384-465---------------------------PPVIT......FS-------------------------------------Q-P
G3GT78_CRIGR/242-336---------------------------PPQIY......SP-------------------------------------N-D
E2ACI8_CAMFO/258-341---------------------------IPEIE......VK-------------------------------------K-N
J9KTT8_ACYPI/27-111---------------------------PPSLT......VK-------------------------------------P-R
H2MVA6_ORYLA/3476-3554---------------------------PPSFT......VQ-------------------------------------I-Q
A0A068YAL3_ECHMU/5182-5262---------------------------KPQIN......LP-------------------------------------S-R
F5HLD4_ANOGA/2744-2821---------------------------PPIIR......LQ-------------------------------------P-S
L9L8V9_TUPCH/591-661---------------------------PPEVS......IS-------------------------------------I-N
F7EAV6_XENTR/1634-1711---------------------------PPSFT......AK-------------------------------------P-D
T1I8U8_RHOPR/202-281---------------------------KPKISE....SMP-------------------------------------K-S
G6CNA5_DANPL/356-441---------------------------PPELQ......YT-------------------------------------F-I
T1IT85_STRMM/3332-3409---------------------------PPKII......LS-------------------------------------E-K
H9GNS4_ANOCA/9-84---------------------------KPYIS......IH-------------------------------------P-R