Sequence alignment for CL0011

PF05326

Q99N75_MOUSE/3-124--------------------------------------------------------------------------------
Q9D2X6_MOUSE/3-124--------------------------------------------------------------------------------
Q76I99_MOUSE/3-123--------------------------------------------------------------------------------
PIP_RAT/1-126--------------------------------------------------------------------------------
PIP_RABIT/3-126--------------------------------------------------------------------------------
PIP_CAVPO/3-126--------------------------------------------------------------------------------
PIP_BOVIN/3-127--------------------------------------------------------------------------------
E9PX96_MOUSE/10-142--------------------------------------------------------------------------------
G1QRT8_NOMLE/4-126--------------------------------------------------------------------------------
G7P1H3_MACFA/4-126--------------------------------------------------------------------------------
PIP_MOUSE/2-126--------------------------------------------------------------------------------

PF15028

PTCRA_RAT/20-147--------------------------------------------------------------------------------
G1QXF2_NOMLE/20-146--------------------------------------------------------------------------------
PTCRA_BOVIN/31-157--------------------------------------------------------------------------------
G3WD30_SARHA/20-146--------------------------------------------------------------------------------
M3YPD2_MUSPF/40-162--------------------------------------------------------------------------------
H0VKD6_CAVPO/20-147--------------------------------------------------------------------------------
G1U7X8_RABIT/20-147--------------------------------------------------------------------------------

PF09085

W5PFN9_SHEEP/105-212--------------------------------------------------------------------------------
H0WQ95_OTOGA/112-222--------------------------------------------------------------------------------
G5E838_MOUSE/110-220--------------------------------------------------------------------------------
G1PL68_MYOLU/112-219--------------------------------------------------------------------------------
I3LSA9_PIG/49-158--------------------------------------------------------------------------------
M3W8G7_FELCA/115-224--------------------------------------------------------------------------------
MADCA_HUMAN/113-224--------------------------------------------------------------------------------
F7BUG9_MONDO/130-238--------------------------------------------------------------------------------
I3N840_SPETR/111-217--------------------------------------------------------------------------------
L8Y2P3_TUPCH/565-674--------------------------------------------------------------------------------
G3HF34_CRIGR/110-220--------------------------------------------------------------------------------

PF11465

CD244_HUMAN/22-127--------------------------------------------------------------------------------
CD244_RAT/22-128--------------------------------------------------------------------------------
CD244_MOUSE/22-129--------------------------------------------------------------------------------

PF01688

GI_HHV2H/8-165--------------------------------------------------------------------------------
GI_GAHVM/2-157--------------------------------------------------------------------------------
GI_PSHV1/10-157--------------------------------------------------------------------------------
GI_VZVD/7-164--------------------------------------------------------------------------------
GI_HHV11/8-165--------------------------------------------------------------------------------

PF10430

F8W3C8_DANRE/7-103--------------------------------------------------------------------------------
W5M5U9_LEPOC/23-114--------------------------------------------------------------------------------
W5KIA3_ASTMX/20-110--------------------------------------------------------------------------------
Q80YS4_MOUSE/24-118--------------------------------------------------------------------------------
G1KU09_ANOCA/38-132--------------------------------------------------------------------------------
F7EC20_XENTR/25-118--------------------------------------------------------------------------------
H0YT27_TAEGU/25-119--------------------------------------------------------------------------------

PF08204

O57240_9POXV/2-124--------------------------------------------------------------------------------
CD47_BOVIN/8-140--------------------------------------------------------------------------------
Q9DHI5_YLDV/7-104--------------------------------------------------------------------------------
CD47_HUMAN/8-142--------------------------------------------------------------------------------
Q8JTQ3_LSDV/14-122--------------------------------------------------------------------------------
Q5ZL65_CHICK/8-141--------------------------------------------------------------------------------
Q9Q8V0_RFVKA/10-120--------------------------------------------------------------------------------
Q9D9W5_MOUSE/8-139--------------------------------------------------------------------------------
Q8V3H1_SWPV1/6-113--------------------------------------------------------------------------------
Q6TUP1_YMTV5/1-98--------------------------------------------------------------------------------
A8VKH9_PIG/8-140--------------------------------------------------------------------------------
B2CWN5_9POXV/1-111--------------------------------------------------------------------------------

PF16680

W5KJS3_ASTMX/45-112--------------------------------------------------------------------------------
H9GCG3_ANOCA/63-138--------------------------------------------------------------------------------
K7GSE2_PIG/39-114--------------------------------------------------------------------------------
CD3D_RAT/30-103--------------------------------------------------------------------------------
H2NFG8_PONAB/39-114--------------------------------------------------------------------------------
CD3E_PIG/42-118--------------------------------------------------------------------------------
G5BHL4_HETGA/19-92--------------------------------------------------------------------------------
G3WJY6_SARHA/44-120--------------------------------------------------------------------------------
F7F8D9_MONDO/35-112--------------------------------------------------------------------------------
I3MMT1_SPETR/36-114--------------------------------------------------------------------------------
F6X8V5_ORNAN/39-109--------------------------------------------------------------------------------
L5KJW9_PTEAL/39-116--------------------------------------------------------------------------------
F7CUQ0_HORSE/39-110--------------------------------------------------------------------------------
E2RHB8_CANFA/39-114--------------------------------------------------------------------------------
M3WFR1_FELCA/39-114--------------------------------------------------------------------------------
CD3E_MOUSE/35-110--------------------------------------------------------------------------------
U3ISR2_ANAPL/34-103--------------------------------------------------------------------------------
F7F8B6_MONDO/49-121--------------------------------------------------------------------------------
G1M3D4_AILME/39-114--------------------------------------------------------------------------------
J9NXV0_CANFA/30-103--------------------------------------------------------------------------------
CD3G_SHEEP/9-84--------------------------------------------------------------------------------
D4A5M2_RAT/30-105--------------------------------------------------------------------------------
G5BHL3_HETGA/37-113--------------------------------------------------------------------------------
L5M0Z4_MYODS/24-101--------------------------------------------------------------------------------
W5MH99_LEPOC/35-109--------------------------------------------------------------------------------
F7CSX8_HORSE/46-120--------------------------------------------------------------------------------
H0VN41_CAVPO/30-103--------------------------------------------------------------------------------
G3U502_LOXAF/18-89--------------------------------------------------------------------------------
M3XJR7_LATCH/43-115--------------------------------------------------------------------------------
G3IMA2_CRIGR/9-82--------------------------------------------------------------------------------
F7FPX1_CALJA/30-103--------------------------------------------------------------------------------
F1N9E2_CHICK/34-109--------------------------------------------------------------------------------
H3BFR3_LATCH/32-111--------------------------------------------------------------------------------
H0UW68_CAVPO/43-116--------------------------------------------------------------------------------
W5PGT3_SHEEP/36-112--------------------------------------------------------------------------------
I3MVU8_SPETR/39-109--------------------------------------------------------------------------------
CD3E_BOVIN/36-113--------------------------------------------------------------------------------
G1SDA6_RABIT/30-103--------------------------------------------------------------------------------
M3XZE1_MUSPF/30-101--------------------------------------------------------------------------------
M3WFR0_FELCA/39-111--------------------------------------------------------------------------------
CD3E_FELCA/47-124--------------------------------------------------------------------------------
G3T784_LOXAF/30-104--------------------------------------------------------------------------------
CD3D_MOUSE/30-103--------------------------------------------------------------------------------
G3T782_LOXAF/35-111--------------------------------------------------------------------------------
F1M9F8_RAT/39-114--------------------------------------------------------------------------------
Q3LRP4_CALJA/42-120--------------------------------------------------------------------------------
L5M0W2_MYODS/39-112--------------------------------------------------------------------------------
B4F6W6_XENTR/31-102--------------------------------------------------------------------------------
W5PHC2_SHEEP/30-99--------------------------------------------------------------------------------
CD3D_BOVIN/30-100--------------------------------------------------------------------------------
I6LI21_MUSPF/32-108--------------------------------------------------------------------------------
H0W6D3_CAVPO/39-114--------------------------------------------------------------------------------
F7D784_MONDO/39-114--------------------------------------------------------------------------------
G7NCB9_MACMU/42-120--------------------------------------------------------------------------------
G1STZ2_RABIT/39-114--------------------------------------------------------------------------------
G8JL01_BOVIN/15-90--------------------------------------------------------------------------------
K7GLV9_PIG/30-103--------------------------------------------------------------------------------
F6WI60_MACMU/30-103--------------------------------------------------------------------------------
L5M0S8_MYODS/30-101--------------------------------------------------------------------------------
G1MXZ8_MELGA/33-102--------------------------------------------------------------------------------
H0YPP3_TAEGU/33-105--------------------------------------------------------------------------------
H0X808_OTOGA/42-120--------------------------------------------------------------------------------
M3ZL37_XIPMA/31-110--------------------------------------------------------------------------------
G3WK56_SARHA/41-113--------------------------------------------------------------------------------
G3T785_LOXAF/39-113--------------------------------------------------------------------------------
G3WKI7_SARHA/39-113--------------------------------------------------------------------------------
CD3G_MOUSE/39-114--------------------------------------------------------------------------------
G1SRV6_RABIT/14-92--------------------------------------------------------------------------------
G1M3E8_AILME/39-111--------------------------------------------------------------------------------
G1R705_NOMLE/42-120--------------------------------------------------------------------------------
CD3E_CANFA/47-124--------------------------------------------------------------------------------
H0X0C4_OTOGA/30-103--------------------------------------------------------------------------------
F6QRU0_XENTR/52-121--------------------------------------------------------------------------------
L5KKM4_PTEAL/24-101--------------------------------------------------------------------------------
L9KSF6_TUPCH/19-94--------------------------------------------------------------------------------
M3XZF4_MUSPF/39-112--------------------------------------------------------------------------------
I3MMT3_SPETR/39-114--------------------------------------------------------------------------------
F7CIT2_HORSE/30-97--------------------------------------------------------------------------------
G1M3G6_AILME/47-123--------------------------------------------------------------------------------

PF00047

OX2G_RAT/34-136--------------------------------------------------------------------------------
CEAM1_HUMAN/331-411--------------------------------------------------------------------------------
IGHM_CHICK/220-311--------------------------------------------------------------------------------
IL6RA_MOUSE/30-107--------------------------------------------------------------------------------
KI2S5_HUMAN/132-213--------------------------------------------------------------------------------
NRG_DROME/525-609--------------------------------------------------------------------------------
TIE1_MOUSE/127-208--------------------------------------------------------------------------------
KI2S5_HUMAN/32-115--------------------------------------------------------------------------------
IGHE_MOUSE/209-300--------------------------------------------------------------------------------
CSF1R_FELCA/207-293--------------------------------------------------------------------------------
TIE1_MOUSE/353-439--------------------------------------------------------------------------------
NTRK3_HUMAN/214-299--------------------------------------------------------------------------------
MUCM_RABIT/11-105--------------------------------------------------------------------------------
KIT_HUMAN/216-305--------------------------------------------------------------------------------
FLT3_MOUSE/256-346--------------------------------------------------------------------------------
SEM3E_MOUSE/585-669--------------------------------------------------------------------------------
FCGR1_MOUSE/204-284--------------------------------------------------------------------------------
FGFR1_CHICK/37-115--------------------------------------------------------------------------------
PGFRB_HUMAN/37-115--------------------------------------------------------------------------------
PTPRM_HUMAN/189-275--------------------------------------------------------------------------------
CD4_MOUSE/25-127--------------------------------------------------------------------------------
OPCM_RAT/227-311--------------------------------------------------------------------------------
IGHD_HUMAN/173-264--------------------------------------------------------------------------------
V055_FOWPN/31-121--------------------------------------------------------------------------------
DIG1_CAEEL/310-389--------------------------------------------------------------------------------
CD33_HUMAN/146-227--------------------------------------------------------------------------------
NRG_DROME/251-332--------------------------------------------------------------------------------
DIG1_CAEEL/1822-1903--------------------------------------------------------------------------------
IL1R2_HUMAN/241-341--------------------------------------------------------------------------------
VCAM1_HUMAN/229-306--------------------------------------------------------------------------------
OX2G_MOUSE/143-229--------------------------------------------------------------------------------
KI3L1_HUMAN/32-110--------------------------------------------------------------------------------
THY1_HUMAN/21-119--------------------------------------------------------------------------------
IL1BP_VACCW/228-322--------------------------------------------------------------------------------

PF16758

UL14_HCMVM/48-234--------------------------------------------------------------------------------
UL141_HCMVM/51-241--------------------------------------------------------------------------------

PF13927

B4JUY8_DROGR/56-147--------------------------------------------------------------------------------
Q9E8G3_9ADEN/418-485--------------------------------------------------------------------------------
Q14VV5_RAHV1/122-191--------------------------------------------------------------------------------
Q05KR2_RAT/225-316--------------------------------------------------------------------------------
D2GWX3_AILME/205-296--------------------------------------------------------------------------------
Q9TV71_HORSE/225-316--------------------------------------------------------------------------------
Q5R5D6_PONAB/81-172--------------------------------------------------------------------------------
B3RNX0_TRIAD/137-219--------------------------------------------------------------------------------
Q4RP84_TETNG/334-402--------------------------------------------------------------------------------
Q7TPQ6_MOUSE/37-119--------------------------------------------------------------------------------
Q64861_9ADEN/137-203--------------------------------------------------------------------------------
Q16X13_AEDAE/196-289--------------------------------------------------------------------------------
B7Z4Y8_HUMAN/87-162--------------------------------------------------------------------------------
A9Y0V1_9CICH/291-381--------------------------------------------------------------------------------
B4F6P7_XENTR/145-216--------------------------------------------------------------------------------
A4JYH8_DANRE/212-293--------------------------------------------------------------------------------
Q8AXU0_ONCMY/214-296--------------------------------------------------------------------------------
A9Y0V0_9CICH/193-275--------------------------------------------------------------------------------
Q4RZA3_TETNG/179-261--------------------------------------------------------------------------------
B0WE60_CULQU/104-184--------------------------------------------------------------------------------
Q675X8_OIKDI/328-400--------------------------------------------------------------------------------
A7RZM7_NEMVE/164-243--------------------------------------------------------------------------------
C3PU48_HELVI/65-147--------------------------------------------------------------------------------
Q9E8F9_9ADEN/415-478--------------------------------------------------------------------------------
VS10L_MOUSE/484-552--------------------------------------------------------------------------------
Q17P33_AEDAE/147-237--------------------------------------------------------------------------------
Q5M7A8_XENLA/139-209--------------------------------------------------------------------------------
B5JJ62_9BACT/373-440--------------------------------------------------------------------------------
A8KB70_DANRE/141-217--------------------------------------------------------------------------------
A8E4T3_DANRE/125-204--------------------------------------------------------------------------------
Q6PUA9_AMBME/211-289--------------------------------------------------------------------------------
Q6P6Y9_XENLA/207-286--------------------------------------------------------------------------------
B4F6V0_XENTR/207-287--------------------------------------------------------------------------------
A7LKP4_HORSE/132-214--------------------------------------------------------------------------------
Q5GAK1_9VIRU/122-188--------------------------------------------------------------------------------
Q5CZQ8_DANRE/218-294--------------------------------------------------------------------------------
Q16ZU2_AEDAE/151-229--------------------------------------------------------------------------------
B3MMJ5_DROAN/141-228--------------------------------------------------------------------------------
Q25177_HYDVU/232-308--------------------------------------------------------------------------------
VS10L_MOUSE/388-462--------------------------------------------------------------------------------
B5JL51_9BACT/220-289--------------------------------------------------------------------------------
B9XJC2_PEDPL/341-410--------------------------------------------------------------------------------
B4A6E2_SALNE/162-234--------------------------------------------------------------------------------
B9XRA3_PEDPL/769-839--------------------------------------------------------------------------------
B9XFJ5_PEDPL/981-1051--------------------------------------------------------------------------------
Q11WJ8_CYTH3/1793-1868--------------------------------------------------------------------------------
B9XK99_PEDPL/434-502--------------------------------------------------------------------------------
B9XNF4_PEDPL/912-982--------------------------------------------------------------------------------
B9XJC2_PEDPL/171-239--------------------------------------------------------------------------------
B9XIT4_PEDPL/501-570--------------------------------------------------------------------------------
B9XNF4_PEDPL/1266-1335--------------------------------------------------------------------------------
Q8QFN4_SALSA/217-311--------------------------------------------------------------------------------
MILR1_HUMAN/127-200--------------------------------------------------------------------------------
I0AZP8_9POXV/264-344--------------------------------------------------------------------------------
B1NA53_XENLA/215-283--------------------------------------------------------------------------------
A7SRI5_NEMVE/60-138--------------------------------------------------------------------------------
Q58EM0_DANRE/46-124--------------------------------------------------------------------------------
B4F6P7_XENTR/242-336--------------------------------------------------------------------------------
Q5FW36_XENTR/237-331--------------------------------------------------------------------------------
IL1R2_MOUSE/248-342--------------------------------------------------------------------------------
Q9N2H5_HORSE/236-330--------------------------------------------------------------------------------
B5KH15_TETNG/127-187--------------------------------------------------------------------------------
Q5BKG7_XENTR/123-200--------------------------------------------------------------------------------
Q8AXT5_SALSA/239-334--------------------------------------------------------------------------------
Q4VWU3_XENLA/180-252--------------------------------------------------------------------------------
A7TDK3_NEMVE/95-165--------------------------------------------------------------------------------
A4JYL8_DANRE/119-181--------------------------------------------------------------------------------
Q4S0F0_TETNG/121-184--------------------------------------------------------------------------------
A6NJE8_HUMAN/286-359--------------------------------------------------------------------------------
GP42_RAT/114-188--------------------------------------------------------------------------------
FCRL6_HUMAN/206-280--------------------------------------------------------------------------------
FCRL1_MOUSE/116-189--------------------------------------------------------------------------------
D2I2T6_AILME/288-361--------------------------------------------------------------------------------
A7SAT9_NEMVE/170-237--------------------------------------------------------------------------------
Q98173_MCV1/178-253--------------------------------------------------------------------------------
C3KJI3_ANOFI/124-193--------------------------------------------------------------------------------
ILRL1_HUMAN/211-307--------------------------------------------------------------------------------
ILRL1_RAT/216-311--------------------------------------------------------------------------------
B5XCQ4_SALSA/120-188--------------------------------------------------------------------------------
B5XDA6_SALSA/115-177--------------------------------------------------------------------------------
Q4SQP9_TETNG/121-187--------------------------------------------------------------------------------
Q676C3_OIKDI/705-769--------------------------------------------------------------------------------
IRPL2_HUMAN/241-335--------------------------------------------------------------------------------
B0R0J8_DANRE/123-187--------------------------------------------------------------------------------
Q3SZI9_BOVIN/149-216--------------------------------------------------------------------------------
B4E1U5_HUMAN/83-150--------------------------------------------------------------------------------
B5XGJ4_SALSA/128-200--------------------------------------------------------------------------------
Q18PG4_MOUSE/127-196--------------------------------------------------------------------------------
Q6NZB6_MOUSE/352-421--------------------------------------------------------------------------------
D2I0U5_AILME/321-390--------------------------------------------------------------------------------
LY9_HUMAN/362-431--------------------------------------------------------------------------------
SLAF5_HUMAN/134-197--------------------------------------------------------------------------------
Q6NZB6_MOUSE/147-217--------------------------------------------------------------------------------
D2I0U5_AILME/119-189--------------------------------------------------------------------------------
LY9_HUMAN/156-226--------------------------------------------------------------------------------
Q0ZHH3_SALSA/290-382--------------------------------------------------------------------------------
B0WG40_CULQU/57-138--------------------------------------------------------------------------------
Q4TGC2_TETNG/85-158--------------------------------------------------------------------------------
A4JYH8_DANRE/415-499--------------------------------------------------------------------------------
A9Y0V0_9CICH/397-485--------------------------------------------------------------------------------
CSF11_TAKRU/411-499--------------------------------------------------------------------------------
Q8AXU0_ONCMY/416-504--------------------------------------------------------------------------------
Q4T5K0_TETNG/309-397--------------------------------------------------------------------------------
Q9MYN0_BOVIN/160-243--------------------------------------------------------------------------------
Q6PUA9_AMBME/408-495--------------------------------------------------------------------------------
B4F6V0_XENTR/405-489--------------------------------------------------------------------------------
Q9DEE1_CHICK/207-302--------------------------------------------------------------------------------
Q90874_CHICK/229-319--------------------------------------------------------------------------------
B3VBV3_RABIT/213-301--------------------------------------------------------------------------------
D3ZRM2_RAT/211-299--------------------------------------------------------------------------------
Q86FD7_SCHJA/138-225--------------------------------------------------------------------------------
A7S2Y7_NEMVE/135-214--------------------------------------------------------------------------------
A7RKF7_NEMVE/125-206--------------------------------------------------------------------------------
B7PBK2_IXOSC/49-137--------------------------------------------------------------------------------
A9JTC6_DANRE/131-215--------------------------------------------------------------------------------
Q7YS40_PIG/127-195--------------------------------------------------------------------------------
Q28753_9CETA/127-199--------------------------------------------------------------------------------
A7YW37_BOVIN/141-211--------------------------------------------------------------------------------
D0UGD1_SALSA/144-215--------------------------------------------------------------------------------
D0UGC3_SALSA/143-215--------------------------------------------------------------------------------
Q4RU18_TETNG/215-283--------------------------------------------------------------------------------
B5KH12_DANRE/121-187--------------------------------------------------------------------------------
C7FF20_CTEID/121-187--------------------------------------------------------------------------------
A8CZ68_CYPCA/100-170--------------------------------------------------------------------------------
A9CQ46_CARAU/114-180--------------------------------------------------------------------------------
B7P1H7_IXOSC/58-137--------------------------------------------------------------------------------
Q4RGD6_TETNG/356-418--------------------------------------------------------------------------------
Q4SGL7_TETNG/81-143--------------------------------------------------------------------------------
Q5EG07_ICTPU/362-434--------------------------------------------------------------------------------
B4L0P5_DROMO/97-184--------------------------------------------------------------------------------
ICAM3_PANTR/399-466--------------------------------------------------------------------------------
D2HGY8_AILME/379-446--------------------------------------------------------------------------------
ICAM3_BOVIN/400-467--------------------------------------------------------------------------------
ICAM1_BOVIN/393-460--------------------------------------------------------------------------------
Q9ERF7_CRIGR/391-458--------------------------------------------------------------------------------
Q4VWT0_XENLA/203-275--------------------------------------------------------------------------------
Q5ZKN0_CHICK/121-207--------------------------------------------------------------------------------
B7UTR6_CHICK/312-386--------------------------------------------------------------------------------
D2HUU5_AILME/123-194--------------------------------------------------------------------------------
NCTR1_RAT/123-194--------------------------------------------------------------------------------
Q8K4V6_MOUSE/523-602--------------------------------------------------------------------------------
A5D7Q0_BOVIN/129-208--------------------------------------------------------------------------------
C9JMK7_HUMAN/314-393--------------------------------------------------------------------------------
A8MZH0_HUMAN/311-390--------------------------------------------------------------------------------
Q1I0P7_MACMU/323-402--------------------------------------------------------------------------------
LIRB3_HUMAN/324-400--------------------------------------------------------------------------------
Q67EV3_RAT/123-203--------------------------------------------------------------------------------
D4AAQ4_RAT/141-221--------------------------------------------------------------------------------
D3ZRL6_RAT/122-197--------------------------------------------------------------------------------
B1MTX6_CALMO/123-198--------------------------------------------------------------------------------
A8K3V4_HUMAN/252-343--------------------------------------------------------------------------------
CD86_HUMAN/138-222--------------------------------------------------------------------------------
Q8K3J3_MERUN/138-220--------------------------------------------------------------------------------
Q8CJE8_MESAU/137-221--------------------------------------------------------------------------------
A8WX99_CAEBR/133-228--------------------------------------------------------------------------------
OX2V_HHV6Z/146-225--------------------------------------------------------------------------------
Q5YFN7_9VIRU/132-198--------------------------------------------------------------------------------
Q4S7L7_TETNG/144-208--------------------------------------------------------------------------------
SLAF8_HUMAN/127-205--------------------------------------------------------------------------------
Q3U1C3_MOUSE/125-203--------------------------------------------------------------------------------
Q95JN1_MACFA/53-120--------------------------------------------------------------------------------
A4GW16_CERAT/123-196--------------------------------------------------------------------------------
A4Q8S8_SPAAU/133-219--------------------------------------------------------------------------------
Q14VV3_RAHV1/126-194--------------------------------------------------------------------------------
Q4SPM6_TETNG/127-188--------------------------------------------------------------------------------
Q90777_CHICK/186-256--------------------------------------------------------------------------------
D2HPH1_AILME/172-242--------------------------------------------------------------------------------
VS10L_MOUSE/288-369--------------------------------------------------------------------------------
D2H9T8_AILME/435-506--------------------------------------------------------------------------------
D3ZW99_RAT/125-200--------------------------------------------------------------------------------
TARM1_HUMAN/125-203--------------------------------------------------------------------------------
D2HYQ1_AILME/99-177--------------------------------------------------------------------------------
Q2V8M5_ICTPU/214-288--------------------------------------------------------------------------------
Q0GKW7_ICTPU/273-340--------------------------------------------------------------------------------
Q4VWU8_XENLA/212-284--------------------------------------------------------------------------------
Q6DCH5_XENLA/194-269--------------------------------------------------------------------------------
B3RFN4_XENLA/196-268--------------------------------------------------------------------------------
Q7YQJ5_CANFA/191-264--------------------------------------------------------------------------------
FCRLA_HUMAN/171-244--------------------------------------------------------------------------------
FCRLA_MOUSE/181-254--------------------------------------------------------------------------------

PF13895

D3ZVK9_RAT/327-417--------------------------------------------------------------------------------
D3ZQX2_RAT/63-153--------------------------------------------------------------------------------
IRPL2_HUMAN/143-231--------------------------------------------------------------------------------
CD86_HUMAN/138-236--------------------------------------------------------------------------------
A1BG_HUMAN/209-301--------------------------------------------------------------------------------
PECA1_PIG/327-405--------------------------------------------------------------------------------
PECA1_MOUSE/316-393--------------------------------------------------------------------------------
A6NJE8_HUMAN/104-185--------------------------------------------------------------------------------
VS10L_MOUSE/388-477--------------------------------------------------------------------------------
A7T6F1_NEMVE/26-106--------------------------------------------------------------------------------
A7RUN6_NEMVE/106-186--------------------------------------------------------------------------------
A1BG_MOUSE/28-125--------------------------------------------------------------------------------
A1BG_RAT/218-314--------------------------------------------------------------------------------
FCRLA_MOUSE/79-175--------------------------------------------------------------------------------
D3ZRM2_RAT/20-112--------------------------------------------------------------------------------
Q11VY4_CYTH3/701-789--------------------------------------------------------------------------------
A6GXG9_FLAPJ/1010-1093--------------------------------------------------------------------------------
FCRLB_HUMAN/22-100--------------------------------------------------------------------------------
IL1R1_RAT/122-217--------------------------------------------------------------------------------
GP42_RAT/22-108--------------------------------------------------------------------------------
A6QQQ4_BOVIN/113-195--------------------------------------------------------------------------------
ILRL2_RAT/126-220--------------------------------------------------------------------------------
A7SZF2_NEMVE/222-298--------------------------------------------------------------------------------
A1SP19_NOCSJ/451-536--------------------------------------------------------------------------------
C3XPD2_BRAFL/8-98--------------------------------------------------------------------------------
B7Q9Q6_IXOSC/51-137--------------------------------------------------------------------------------
B3RLN9_TRIAD/257-344--------------------------------------------------------------------------------
A7SRI5_NEMVE/63-151--------------------------------------------------------------------------------
TACT_HUMAN/25-136--------------------------------------------------------------------------------
ISLR2_HUMAN/240-372--------------------------------------------------------------------------------
B4DVJ9_HUMAN/23-102--------------------------------------------------------------------------------
E9PD35_HUMAN/138-224--------------------------------------------------------------------------------
E9PX73_MOUSE/46-128--------------------------------------------------------------------------------
F1P3W0_CHICK/181-268--------------------------------------------------------------------------------
F1R1B9_DANRE/314-392--------------------------------------------------------------------------------
F6QPE0_BOVIN/327-404--------------------------------------------------------------------------------
F7AWH8_XENTR/85-171--------------------------------------------------------------------------------
F7DK71_HORSE/161-253--------------------------------------------------------------------------------
F7DLW8_HORSE/326-403--------------------------------------------------------------------------------
G1L4E1_AILME/105-189--------------------------------------------------------------------------------
G1L7T4_AILME/329-410--------------------------------------------------------------------------------
G1M3E0_AILME/129-211--------------------------------------------------------------------------------
G1M8A4_AILME/973-1063--------------------------------------------------------------------------------
H2NXI9_PONAB/312-389--------------------------------------------------------------------------------
H2RC57_PANTR/28-117--------------------------------------------------------------------------------
H3CEP5_TETNG/209-301--------------------------------------------------------------------------------
H3CGE1_TETNG/471-557--------------------------------------------------------------------------------
M0RCJ0_RAT/106-186--------------------------------------------------------------------------------
M3XWI6_MUSPF/119-204--------------------------------------------------------------------------------
LIRB5_HUMAN/28-115--------------------------------------------------------------------------------
PECA1_HUMAN/327-404--------------------------------------------------------------------------------

PF16706

G1TVX5_RABIT/169-260--------------------------------------------------------------------------------
F6YE25_HORSE/168-260--------------------------------------------------------------------------------
H0UTJ7_CAVPO/168-259--------------------------------------------------------------------------------
F6UM65_CANFA/166-254--------------------------------------------------------------------------------
M3W7L5_FELCA/169-261--------------------------------------------------------------------------------
H9H653_MONDO/206-297--------------------------------------------------------------------------------
V8PHR1_OPHHA/159-248--------------------------------------------------------------------------------
L5LHN8_MYODS/162-254--------------------------------------------------------------------------------
H0WN21_OTOGA/168-257--------------------------------------------------------------------------------
IZUM1_MOUSE/168-260--------------------------------------------------------------------------------
G3TPD8_LOXAF/168-260--------------------------------------------------------------------------------
IZUM1_RAT/168-260--------------------------------------------------------------------------------
I3MLV0_SPETR/170-262--------------------------------------------------------------------------------
G1M882_AILME/167-255--------------------------------------------------------------------------------
G1QXF7_NOMLE/168-260--------------------------------------------------------------------------------
W5PRD0_SHEEP/169-261--------------------------------------------------------------------------------
H3DD44_TETNG/58-151--------------------------------------------------------------------------------

PF07654

O35424_MOUSE/129-211--------------------------------------------------------------------------------
IGKC_HUMAN/12-98--------------------------------------------------------------------------------
KACB_RAT/12-98--------------------------------------------------------------------------------
IGKC_MOUSE/12-98--------------------------------------------------------------------------------
KAC5_RABIT/12-95--------------------------------------------------------------------------------
LAC1_MOUSE/13-96--------------------------------------------------------------------------------
LAC2_MOUSE/13-95--------------------------------------------------------------------------------
LAC_PIG/13-96--------------------------------------------------------------------------------
LAC_RABIT/13-96--------------------------------------------------------------------------------
TCB2_MOUSE/17-102--------------------------------------------------------------------------------
IGHE_HUMAN/331-415--------------------------------------------------------------------------------
IGHE_RAT/322-410--------------------------------------------------------------------------------
IGHG1_HUMAN/13-95--------------------------------------------------------------------------------
IGHG1_HUMAN/130-216--------------------------------------------------------------------------------
IGHG1_HUMAN/236-321--------------------------------------------------------------------------------
IGHG2_CAVPO/234-321--------------------------------------------------------------------------------
GCAA_MOUSE/13-94--------------------------------------------------------------------------------
GCAA_MOUSE/130-216--------------------------------------------------------------------------------
GCAA_MOUSE/236-321--------------------------------------------------------------------------------
GCAB_MOUSE/241-326--------------------------------------------------------------------------------
IGG2B_MOUSE/241-326--------------------------------------------------------------------------------
IGHG1_MOUSE/230-315--------------------------------------------------------------------------------
IGHG_RABIT/123-209--------------------------------------------------------------------------------
IGHM_HUMAN/337-425--------------------------------------------------------------------------------
IGHM_CHICK/330-419--------------------------------------------------------------------------------
IGHA1_HUMAN/12-96--------------------------------------------------------------------------------
IGHA_MOUSE/12-95--------------------------------------------------------------------------------
IGHA_RABIT/182-272--------------------------------------------------------------------------------
IGHD_HUMAN/14-96--------------------------------------------------------------------------------
B2MG_RABIT/11-92--------------------------------------------------------------------------------
B2MG_CAVPO/11-92--------------------------------------------------------------------------------
B2MG_MOUSE/31-112--------------------------------------------------------------------------------
B2MG_BOVIN/31-111--------------------------------------------------------------------------------
IGHG3_MOUSE/235-320--------------------------------------------------------------------------------
DPB1_HUMAN/130-212--------------------------------------------------------------------------------
DOB_HUMAN/129-211--------------------------------------------------------------------------------
DPA1_HUMAN/124-206--------------------------------------------------------------------------------
IGHG1_RAT/232-317--------------------------------------------------------------------------------
IGG2B_RAT/239-324--------------------------------------------------------------------------------
IGG2C_RAT/13-94--------------------------------------------------------------------------------
LAC_CHICK/14-95--------------------------------------------------------------------------------
IGLL1_MOUSE/117-200--------------------------------------------------------------------------------
B2MG_CHICK/31-112--------------------------------------------------------------------------------
B2MG_HORSE/31-111--------------------------------------------------------------------------------
B2MG_DANRE/30-109--------------------------------------------------------------------------------
Q8WM94_DANRE/110-193--------------------------------------------------------------------------------
Q90ZJ6_ORYLA/30-109--------------------------------------------------------------------------------
A6QQE7_BOVIN/117-198--------------------------------------------------------------------------------
E9QFF8_DANRE/65-144--------------------------------------------------------------------------------
F1NSZ6_CHICK/135-210--------------------------------------------------------------------------------
F1RBP5_DANRE/141-220--------------------------------------------------------------------------------
F6UY61_MONDO/133-213--------------------------------------------------------------------------------
F6W9R2_CALJA/32-111--------------------------------------------------------------------------------
G1TXW3_RABIT/124-203--------------------------------------------------------------------------------
H0UYJ7_CAVPO/115-195--------------------------------------------------------------------------------
H2MX91_ORYLA/120-197--------------------------------------------------------------------------------
H9GZQ9_HORSE/243-325--------------------------------------------------------------------------------
I3KVH2_ORENI/112-193--------------------------------------------------------------------------------
M3VX36_FELCA/121-201--------------------------------------------------------------------------------
M3W4D7_FELCA/33-111--------------------------------------------------------------------------------
M9MM93_DANRE/109-191--------------------------------------------------------------------------------
O62938_XIPMA/119-197--------------------------------------------------------------------------------
DQA1_HUMAN/118-199--------------------------------------------------------------------------------
HB2D_PIG/132-213--------------------------------------------------------------------------------
HB2D_RAT/130-211--------------------------------------------------------------------------------
HA2J_MOUSE/118-199--------------------------------------------------------------------------------
Q1MTC8_DANRE/121-202--------------------------------------------------------------------------------
Q5M8Y9_XENTR/126-205--------------------------------------------------------------------------------
Q5XJ70_DANRE/111-191--------------------------------------------------------------------------------
Q70IB5_BOVIN/134-215--------------------------------------------------------------------------------
R0JJE7_ANAPL/108-187--------------------------------------------------------------------------------
W5PE14_SHEEP/119-200--------------------------------------------------------------------------------

PF02124

GC_PSHV1/234-457--------------------------------------------------------------------------------
GC_VZVD/379-589--------------------------------------------------------------------------------
GC_HHV11/291-500--------------------------------------------------------------------------------
GC_GAHVM/283-492--------------------------------------------------------------------------------
GC_HHV2H/260-469--------------------------------------------------------------------------------

PF07679

LRIG1_MOUSE/601-691--------------------------------------------------------------------------------
TITIN_HUMAN/7385-7474--------------------------------------------------------------------------------
PALLD_HUMAN/271-361--------------------------------------------------------------------------------
PALLD_HUMAN/1135-1225--------------------------------------------------------------------------------
HMCN2_HUMAN/4309-4395--------------------------------------------------------------------------------
IGDC3_HUMAN/330-417--------------------------------------------------------------------------------
NCAM2_HUMAN/21-111--------------------------------------------------------------------------------
MYOM1_MOUSE/1555-1645--------------------------------------------------------------------------------
OBSCN_HUMAN/10-99--------------------------------------------------------------------------------
PXDN_HUMAN/433-519--------------------------------------------------------------------------------
Q08476_CHICK/180-269--------------------------------------------------------------------------------
Q08476_CHICK/372-461--------------------------------------------------------------------------------
HMCN1_HUMAN/1171-1258--------------------------------------------------------------------------------
O00557_HUMAN/20-114--------------------------------------------------------------------------------
UNC89_CAEEL/648-737--------------------------------------------------------------------------------
UNC89_CAEEL/3286-3377--------------------------------------------------------------------------------
UNC89_CAEEL/3482-3573--------------------------------------------------------------------------------
UNC89_CAEEL/3920-4010--------------------------------------------------------------------------------
MYLK_SHEEP/331-421--------------------------------------------------------------------------------
MUSK_HUMAN/121-208--------------------------------------------------------------------------------
ROBO1_RAT/262-347--------------------------------------------------------------------------------
O55124_MOUSE/1345-1435--------------------------------------------------------------------------------
O57576_CYNPY/213-301--------------------------------------------------------------------------------
O76281_DROME/1225-1316--------------------------------------------------------------------------------
O76281_DROME/3892-3982--------------------------------------------------------------------------------
O76281_DROME/6357-6446--------------------------------------------------------------------------------
CAVPT_BRALA/59-149--------------------------------------------------------------------------------
MYLK_CHICK/28-118--------------------------------------------------------------------------------
MYLK_CHICK/156-245--------------------------------------------------------------------------------
A4V2I0_DROME/25-135--------------------------------------------------------------------------------
P79757_CHICK/328-417--------------------------------------------------------------------------------
P79757_CHICK/734-823--------------------------------------------------------------------------------
UNC22_CAEEL/4150-4239--------------------------------------------------------------------------------
UNC22_CAEEL/6585-6674--------------------------------------------------------------------------------
UNC22_CAEEL/6863-6953--------------------------------------------------------------------------------
VCAM1_CANFA/25-112--------------------------------------------------------------------------------
Q8BID4_MOUSE/6-97--------------------------------------------------------------------------------
Q8T103_BOMMO/4625-4714--------------------------------------------------------------------------------
Q90X22_DANRE/66-155--------------------------------------------------------------------------------
Q90X22_DANRE/178-268--------------------------------------------------------------------------------
Q90YM0_DANRE/209-296--------------------------------------------------------------------------------
Q90Z41_CHICK/223-308--------------------------------------------------------------------------------
Q95YM1_PROCL/4632-4721--------------------------------------------------------------------------------
Q98918_CHICK/3071-3160--------------------------------------------------------------------------------
SPEG_MOUSE/727-816--------------------------------------------------------------------------------
SPEG_MOUSE/1490-1579--------------------------------------------------------------------------------
Q9GV22_MYTGA/344-433--------------------------------------------------------------------------------
Q9GV22_MYTGA/647-736--------------------------------------------------------------------------------

PF02440

Q4KSJ0_9ADEN/110-200--------------------------------------------------------------------------------
Q91CB8_ADE08/236-321--------------------------------------------------------------------------------
Q80IV8_ADE08/252-335--------------------------------------------------------------------------------
Q91PL0_9ADEN/13-104--------------------------------------------------------------------------------
Q6QPD0_9ADEN/15-113--------------------------------------------------------------------------------
Q6H1B4_9ADEN/16-113--------------------------------------------------------------------------------
Q3ZKT4_9ADEN/13-104--------------------------------------------------------------------------------
Q76C87_ADE08/128-219--------------------------------------------------------------------------------
E3TMR2_ADE16/13-100--------------------------------------------------------------------------------
Q8JZH7_ADE17/110-200--------------------------------------------------------------------------------
E321_ADE35/14-100--------------------------------------------------------------------------------
Q7TBH0_ADE08/34-124--------------------------------------------------------------------------------
B9A5V9_9ADEN/260-345--------------------------------------------------------------------------------
Q8JZH7_ADE17/15-105--------------------------------------------------------------------------------
Q6QP93_9ADEN/15-105--------------------------------------------------------------------------------
Q8UY72_9ADEN/16-114--------------------------------------------------------------------------------
B9A5V9_9ADEN/110-200--------------------------------------------------------------------------------
Q4KSJ0_9ADEN/254-339--------------------------------------------------------------------------------
Q6QPD1_9ADEN/15-112--------------------------------------------------------------------------------
Q91CB6_ADE09/110-200--------------------------------------------------------------------------------

PF07686

TVB8_MOUSE/25-130--------------------------------------------------------------------------------
MPZL2_HUMAN/30-143--------------------------------------------------------------------------------
IGS11_HUMAN/27-141--------------------------------------------------------------------------------
TVB1_MOUSE/25-132--------------------------------------------------------------------------------
CD2_HORSE/25-122--------------------------------------------------------------------------------
CLM2_MOUSE/19-124--------------------------------------------------------------------------------
GPA33_HUMAN/25-138--------------------------------------------------------------------------------
TVA2_MOUSE/26-132--------------------------------------------------------------------------------
TVB1_HUMAN/25-135--------------------------------------------------------------------------------
HVM07_MOUSE/24-138--------------------------------------------------------------------------------
LV603_HUMAN/5-110--------------------------------------------------------------------------------
Q9UEL6_HUMAN/15-129--------------------------------------------------------------------------------
MO2R1_MOUSE/42-147--------------------------------------------------------------------------------
SHPS1_BOVIN/38-145--------------------------------------------------------------------------------
CD2_MOUSE/23-121--------------------------------------------------------------------------------
TIMD4_HUMAN/23-128--------------------------------------------------------------------------------
TVC_HUMAN/24-136--------------------------------------------------------------------------------
FAIM3_HUMAN/19-123--------------------------------------------------------------------------------
TVA2_HUMAN/32-138--------------------------------------------------------------------------------
HV108_HUMAN/5-119--------------------------------------------------------------------------------
CEA21_HUMAN/38-141--------------------------------------------------------------------------------
CSPG2_MOUSE/27-148--------------------------------------------------------------------------------
SIGL5_HUMAN/24-140--------------------------------------------------------------------------------
VSIG1_CHICK/26-136--------------------------------------------------------------------------------
HV107_HUMAN/5-115--------------------------------------------------------------------------------
TVB5_MOUSE/14-122--------------------------------------------------------------------------------
CXAR_DANRE/28-142--------------------------------------------------------------------------------
CEAM4_HUMAN/38-141--------------------------------------------------------------------------------
HHLA2_HUMAN/226-330--------------------------------------------------------------------------------
PVRL4_HUMAN/35-146--------------------------------------------------------------------------------
CD8B_FELCA/24-135--------------------------------------------------------------------------------
SKIT3_MOUSE/32-141--------------------------------------------------------------------------------
PDCD1_MOUSE/37-145--------------------------------------------------------------------------------
KV123_HUMAN/28-129--------------------------------------------------------------------------------
Q8UV83_DANRE/144-247--------------------------------------------------------------------------------
SCN2B_HUMAN/33-147--------------------------------------------------------------------------------
VSIG2_HUMAN/27-142--------------------------------------------------------------------------------
FCAMR_HUMAN/65-171--------------------------------------------------------------------------------
LV1B_MOUSE/24-128--------------------------------------------------------------------------------
CD8A_MOUSE/36-148--------------------------------------------------------------------------------
CLM5_MOUSE/23-126--------------------------------------------------------------------------------
JAML1_HUMAN/25-136--------------------------------------------------------------------------------
BTNLA_MOUSE/37-146--------------------------------------------------------------------------------
TVB6_MOUSE/27-136--------------------------------------------------------------------------------
CD7_HUMAN/31-132--------------------------------------------------------------------------------
TVA1_HUMAN/25-131--------------------------------------------------------------------------------
CD2_HUMAN/28-127--------------------------------------------------------------------------------
TVA1_MOUSE/25-130--------------------------------------------------------------------------------
CD2_RAT/23-120--------------------------------------------------------------------------------
SCN3B_MOUSE/28-143--------------------------------------------------------------------------------
VPREB_HUMAN/24-134--------------------------------------------------------------------------------
TREM1_MOUSE/25-134--------------------------------------------------------------------------------
SCN1B_HUMAN/23-139--------------------------------------------------------------------------------
Q9R121_RAT/32-135--------------------------------------------------------------------------------
SIRPD_HUMAN/34-140--------------------------------------------------------------------------------
MXRA8_HUMAN/168-292--------------------------------------------------------------------------------
A2BGB5_DANRE/30-142--------------------------------------------------------------------------------
B8ZZZ4_HUMAN/29-130--------------------------------------------------------------------------------
F1NMT9_CHICK/44-146--------------------------------------------------------------------------------
F1P992_CANFA/18-131--------------------------------------------------------------------------------
F6RFK3_CHICK/32-139--------------------------------------------------------------------------------
G3V7D2_RAT/42-151--------------------------------------------------------------------------------
L8YBJ5_TUPCH/164-276--------------------------------------------------------------------------------
M0QX98_HUMAN/6-107--------------------------------------------------------------------------------
CD8B_RAT/24-134--------------------------------------------------------------------------------
Q3LFS9_MOUSE/42-141--------------------------------------------------------------------------------
Q5SNP6_DANRE/26-130--------------------------------------------------------------------------------
Q8BNV8_MOUSE/24-121--------------------------------------------------------------------------------
Q8K094_MOUSE/37-141--------------------------------------------------------------------------------
Q9JHL7_RAT/42-140--------------------------------------------------------------------------------

PF05790

CD2_HUMAN/135-205--------------------------------------------------------------------------------
Q8K0X1_MOUSE/133-221--------------------------------------------------------------------------------
CD4_RAT/316-390--------------------------------------------------------------------------------
CD4_SAISC/125-202--------------------------------------------------------------------------------
VCAM1_HUMAN/133-221--------------------------------------------------------------------------------
CD4_RABIT/318-390--------------------------------------------------------------------------------
CD2_RAT/128-198--------------------------------------------------------------------------------
VCAM1_CANFA/133-221--------------------------------------------------------------------------------
CD4_RAT/127-206--------------------------------------------------------------------------------
Q9GKR2_BOVIN/134-222--------------------------------------------------------------------------------
CD4_RABIT/129-208--------------------------------------------------------------------------------
CD2_MOUSE/129-199--------------------------------------------------------------------------------
VCAM1_CANFA/421-509--------------------------------------------------------------------------------
VCAM1_RAT/133-221--------------------------------------------------------------------------------
CD4_CANFA/133-211--------------------------------------------------------------------------------
Q9GKR2_BOVIN/422-510--------------------------------------------------------------------------------
O55054_MOUSE/104-183--------------------------------------------------------------------------------
P79355_FELCA/332-405--------------------------------------------------------------------------------
CD4_CANFA/321-392--------------------------------------------------------------------------------
VCAM1_RAT/421-509--------------------------------------------------------------------------------
CD4_DELLE/314-387--------------------------------------------------------------------------------
Q28939_PIG/134-219--------------------------------------------------------------------------------
O88650_MARMO/10-83--------------------------------------------------------------------------------
P70443_MOUSE/8-81--------------------------------------------------------------------------------
CD2_HORSE/130-201--------------------------------------------------------------------------------
CD4_DELLE/125-203--------------------------------------------------------------------------------
P79355_FELCA/144-222--------------------------------------------------------------------------------

PF16681

F1SAK8_PIG/36-116--------------------------------------------------------------------------------
CD3E_SHEEP/30-112--------------------------------------------------------------------------------
CD3E_BOVIN/30-112--------------------------------------------------------------------------------
G3QUY7_GORGO/36-127--------------------------------------------------------------------------------
H0X808_OTOGA/36-118--------------------------------------------------------------------------------
G5BHL3_HETGA/31-112--------------------------------------------------------------------------------
G3T782_LOXAF/29-109--------------------------------------------------------------------------------
I3MMT1_SPETR/30-113--------------------------------------------------------------------------------
H0UW68_CAVPO/36-115--------------------------------------------------------------------------------
G1SRV6_RABIT/8-90--------------------------------------------------------------------------------
H9GCG3_ANOCA/57-136--------------------------------------------------------------------------------
Q3LRP4_CALJA/36-118--------------------------------------------------------------------------------
L5M0Z4_MYODS/18-99--------------------------------------------------------------------------------
G3WKI6_SARHA/41-122--------------------------------------------------------------------------------
CD3E_CANFA/41-122--------------------------------------------------------------------------------
F7D784_MONDO/33-114--------------------------------------------------------------------------------
M3XJR7_LATCH/37-113--------------------------------------------------------------------------------
F7CSX8_HORSE/40-119--------------------------------------------------------------------------------
L5KKM4_PTEAL/18-99--------------------------------------------------------------------------------
D4A5M2_RAT/24-104--------------------------------------------------------------------------------
G7PP33_MACFA/36-118--------------------------------------------------------------------------------
CD3E_MOUSE/29-109--------------------------------------------------------------------------------

PF08205

PVRL3_HUMAN/173-257--------------------------------------------------------------------------------
SN_MOUSE/142-229--------------------------------------------------------------------------------
RAGE_HUMAN/124-219--------------------------------------------------------------------------------
NPHN_MOUSE/152-242--------------------------------------------------------------------------------
NPHN_MOUSE/357-442--------------------------------------------------------------------------------
CRTAM_MOUSE/119-205--------------------------------------------------------------------------------
PVRL4_MOUSE/150-233--------------------------------------------------------------------------------
PVRL2_MOUSE/155-240--------------------------------------------------------------------------------
PVRL1_HUMAN/148-237--------------------------------------------------------------------------------
TMM25_HUMAN/26-118--------------------------------------------------------------------------------
SN_HUMAN/142-228--------------------------------------------------------------------------------
CD22_HUMAN/143-230--------------------------------------------------------------------------------
NPHN_HUMAN/138-228--------------------------------------------------------------------------------
CD80_RABIT/140-226--------------------------------------------------------------------------------
MUC18_HUMAN/139-234--------------------------------------------------------------------------------
BCAM_HUMAN/150-248--------------------------------------------------------------------------------
BCAM_BOVIN/150-248--------------------------------------------------------------------------------
CD166_MOUSE/137-231--------------------------------------------------------------------------------
O35444_MOUSE/123-217--------------------------------------------------------------------------------
FAS3_DROME/126-222--------------------------------------------------------------------------------
B4MCT1_DROVI/186-273--------------------------------------------------------------------------------
E1C6L8_CHICK/151-245--------------------------------------------------------------------------------
F1SPA8_PIG/71-155--------------------------------------------------------------------------------
F7EIQ1_CALJA/148-231--------------------------------------------------------------------------------
G1TJN6_RABIT/203-292--------------------------------------------------------------------------------
G3V671_RAT/147-231--------------------------------------------------------------------------------
G7NXN7_MACFA/142-226--------------------------------------------------------------------------------
Q7ZZ85_DANRE/61-152--------------------------------------------------------------------------------

PF15910

F1NL21_CHICK/43-155--------------------------------------------------------------------------------
G1L868_AILME/23-135--------------------------------------------------------------------------------
F6ZKL5_HORSE/23-134--------------------------------------------------------------------------------
G5BKP1_HETGA/16-127--------------------------------------------------------------------------------
H0VT36_CAVPO/23-134--------------------------------------------------------------------------------
I3LV71_PIG/23-135--------------------------------------------------------------------------------
ICOS_MOUSE/23-135--------------------------------------------------------------------------------
ICOS_HUMAN/23-134--------------------------------------------------------------------------------

PF06328

E1B6W6_HUMAN/24-110--------------------------------------------------------------------------------
G3H9X4_CRIGR/24-111--------------------------------------------------------------------------------
W5PCA4_SHEEP/27-112--------------------------------------------------------------------------------
H2MHM5_ORYLA/26-108--------------------------------------------------------------------------------
L9KWE5_TUPCH/160-246--------------------------------------------------------------------------------
I3LQQ8_PIG/25-111--------------------------------------------------------------------------------
H0VNJ1_CAVPO/26-112--------------------------------------------------------------------------------
G1MI84_AILME/334-420--------------------------------------------------------------------------------
L5JUJ0_PTEAL/24-110--------------------------------------------------------------------------------
K7E988_ORNAN/24-110--------------------------------------------------------------------------------
M4AJW4_XIPMA/27-111--------------------------------------------------------------------------------
G3QMC9_GORGO/26-112--------------------------------------------------------------------------------
G1KQG1_ANOCA/26-113--------------------------------------------------------------------------------
L9KSB2_TUPCH/4-90--------------------------------------------------------------------------------
L5LZA8_MYODS/26-112--------------------------------------------------------------------------------
Q9W6U9_CHICK/29-115--------------------------------------------------------------------------------
U3KE63_FICAL/318-404--------------------------------------------------------------------------------
H0WB19_CAVPO/28-115--------------------------------------------------------------------------------
IL6RB_RAT/26-112--------------------------------------------------------------------------------
L9JC93_TUPCH/24-110--------------------------------------------------------------------------------
G3X148_SARHA/23-106--------------------------------------------------------------------------------
F7BHT6_MONDO/28-110--------------------------------------------------------------------------------
H0VSE7_CAVPO/334-420--------------------------------------------------------------------------------
CSF3R_MOUSE/24-111--------------------------------------------------------------------------------
V8PEN3_OPHHA/29-110--------------------------------------------------------------------------------
W5MYE4_LEPOC/28-112--------------------------------------------------------------------------------
H0WL79_OTOGA/24-110--------------------------------------------------------------------------------
I12R2_BOVIN/28-110--------------------------------------------------------------------------------
E2R8G9_CANFA/24-110--------------------------------------------------------------------------------
G1T0W6_RABIT/46-133--------------------------------------------------------------------------------
F6Z8U4_XENTR/25-108--------------------------------------------------------------------------------
F1NDH9_CHICK/326-412--------------------------------------------------------------------------------
H3BGX0_LATCH/26-112--------------------------------------------------------------------------------
G3TD98_LOXAF/24-110--------------------------------------------------------------------------------
G3VNH6_SARHA/27-113--------------------------------------------------------------------------------
G5C6G6_HETGA/24-111--------------------------------------------------------------------------------
V8P914_OPHHA/322-410--------------------------------------------------------------------------------
G1L3X5_AILME/24-109--------------------------------------------------------------------------------
F1M9F2_RAT/331-418--------------------------------------------------------------------------------
I12R2_MOUSE/28-120--------------------------------------------------------------------------------
H3AKP8_LATCH/27-113--------------------------------------------------------------------------------
F6VD48_MONDO/28-114--------------------------------------------------------------------------------
M3WIJ4_FELCA/24-110--------------------------------------------------------------------------------
M3YTJ9_MUSPF/24-110--------------------------------------------------------------------------------
E1B9W2_BOVIN/24-110--------------------------------------------------------------------------------

PF00207

CO4A_HUMAN/781-869--------------------------------------------------------------------------------
Q9VIT8_DROME/562-654--------------------------------------------------------------------------------
CO3_MOUSE/770-866--------------------------------------------------------------------------------
CO4B_MOUSE/779-867--------------------------------------------------------------------------------
Q7Q7T0_ANOGA/634-725--------------------------------------------------------------------------------
Q7Q4F0_ANOGA/564-653--------------------------------------------------------------------------------
MUG2_MOUSE/740-830--------------------------------------------------------------------------------
Q7Q4I0_ANOGA/955-1046--------------------------------------------------------------------------------
A2MP_MOUSE/738-828--------------------------------------------------------------------------------
A2M_MOUSE/750-840--------------------------------------------------------------------------------
A2ML1_HUMAN/736-826--------------------------------------------------------------------------------
C3P1_HUMAN/10-104--------------------------------------------------------------------------------
CPMD8_HUMAN/750-841--------------------------------------------------------------------------------
OVOS2_HUMAN/726-816--------------------------------------------------------------------------------
Q29N18_DROPS/745-836--------------------------------------------------------------------------------
Q0C7A6_AEDAE/183-274--------------------------------------------------------------------------------
A2MG_PONAB/738-828--------------------------------------------------------------------------------
Q16YC2_AEDAE/682-773--------------------------------------------------------------------------------
Q17K56_AEDAE/533-625--------------------------------------------------------------------------------
A7SDN3_NEMVE/771-861--------------------------------------------------------------------------------
CD109_HUMAN/693-784--------------------------------------------------------------------------------
Y3030_RALSO/871-965--------------------------------------------------------------------------------
A5PMP6_DANRE/779-875--------------------------------------------------------------------------------
Q12VC6_METBU/707-796--------------------------------------------------------------------------------
Q3A743_PELCD/1262-1354--------------------------------------------------------------------------------
A7MNC2_CROS8/849-939--------------------------------------------------------------------------------
Q17M04_AEDAE/556-648--------------------------------------------------------------------------------
Q08R52_STIAD/712-804--------------------------------------------------------------------------------
Q1DE47_MYXXD/137-227--------------------------------------------------------------------------------
Q11S66_CYTH3/1263-1352--------------------------------------------------------------------------------
Q025N0_SOLUE/854-944--------------------------------------------------------------------------------
A7SSC0_NEMVE/10-101--------------------------------------------------------------------------------
Q2JJS1_SYNJB/901-991--------------------------------------------------------------------------------
Q7ULY0_RHOBA/1286-1375--------------------------------------------------------------------------------
Q2IJH5_ANADE/1222-1312--------------------------------------------------------------------------------
Q1D840_MYXXD/1246-1336--------------------------------------------------------------------------------
Q1IT69_KORVE/868-958--------------------------------------------------------------------------------
Q7MT05_PORGI/1146-1236--------------------------------------------------------------------------------
OVOS_CHICK/748-838--------------------------------------------------------------------------------
Y984_THEMA/714-802--------------------------------------------------------------------------------
A6LJB2_THEM4/653-737--------------------------------------------------------------------------------
Q9VLT3_DROME/939-1030--------------------------------------------------------------------------------
Q7QGN1_ANOGA/635-726--------------------------------------------------------------------------------
A6L1P0_BACV8/1146-1235--------------------------------------------------------------------------------
A8F825_THELT/720-808--------------------------------------------------------------------------------
A5UX85_ROSS1/1485-1575--------------------------------------------------------------------------------
Q73KT0_TREDE/1174-1262--------------------------------------------------------------------------------
A6LIC0_PARD8/1134-1223--------------------------------------------------------------------------------
CD109_MOUSE/695-786--------------------------------------------------------------------------------
B4Q6W4_DROSI/635-727--------------------------------------------------------------------------------
B4QA08_DROSI/759-850--------------------------------------------------------------------------------
C3XSF4_BRAFL/154-244--------------------------------------------------------------------------------
E3FS79_STIAD/1202-1290--------------------------------------------------------------------------------
F1QX13_DANRE/768-861--------------------------------------------------------------------------------
F1R0S4_DANRE/788-875--------------------------------------------------------------------------------
F1R8N2_DANRE/735-823--------------------------------------------------------------------------------
F1RQW2_PIG/780-867--------------------------------------------------------------------------------
F6TCT8_XENTR/740-830--------------------------------------------------------------------------------
F7CSP0_XENTR/773-869--------------------------------------------------------------------------------
F7CVI9_XENTR/767-856--------------------------------------------------------------------------------
H2LRL9_ORYLA/415-503--------------------------------------------------------------------------------
H2M6N3_ORYLA/762-861--------------------------------------------------------------------------------
H2UUU6_TAKRU/643-731--------------------------------------------------------------------------------
H3CLD7_TETNG/732-828--------------------------------------------------------------------------------
H3D959_TETNG/731-828--------------------------------------------------------------------------------
H3DA42_TETNG/714-803--------------------------------------------------------------------------------
H3DA56_TETNG/728-816--------------------------------------------------------------------------------
H3DDC7_TETNG/573-663--------------------------------------------------------------------------------
H3DHK0_TETNG/619-707--------------------------------------------------------------------------------
H3DL28_TETNG/714-814--------------------------------------------------------------------------------
CO5_HUMAN/772-859--------------------------------------------------------------------------------
Q5LHC2_BACFN/1165-1253--------------------------------------------------------------------------------
Q5ZUX7_LEGPH/1263-1351--------------------------------------------------------------------------------
Q7PMK4_ANOGA/645-736--------------------------------------------------------------------------------
Y4489_PSEAE/857-944--------------------------------------------------------------------------------
Q9VLY7_DROME/697-787--------------------------------------------------------------------------------
R4GGS2_CHICK/726-814--------------------------------------------------------------------------------
R5UFN1_9BACE/1152-1240--------------------------------------------------------------------------------
R6X5P5_9PORP/1138-1223--------------------------------------------------------------------------------
R7EM63_9BACE/1203-1287--------------------------------------------------------------------------------

PF02960

K1_HHV8P/160-279--------------------------------------------------------------------------------

PF03921

ICAM3_HUMAN/30-119--------------------------------------------------------------------------------
ICAM2_HUMAN/24-114--------------------------------------------------------------------------------
ICAM2_MOUSE/22-114--------------------------------------------------------------------------------
ICAM1_HUMAN/24-115--------------------------------------------------------------------------------
ICAM1_MOUSE/24-114--------------------------------------------------------------------------------

PF02480

GE_PSHV1/44-516SLRRTLPAGGTFKWVLVLSDPC....APKPTEICVSVGHCFYDLVSSDNDSECANKDRRVLTLALLTKSKTGELRVIGPM
GE_HHV2H/57-501PLDACGPLRPS..WVALWPPRR..................VLETVVD...AAC....MRAPEP.......LAIAYSPPFP
GE_HHV11/59-506PLDGCGPLHPS..WVSLMPPKQ..................VPETVVD...AAC....MRAPVP.......LAMAYAPPAP
GE_VZVD/193-615....GVRYTET..WSFLPSLTCTGDAAPAIQHICLKHTTCFQDVVVD...VDCAENTKEDQLA.........EISYRFQG
GE_GAHVM/41-479PVVDGTLYTET..WTWIPNHCN....ETATGYVCLESAHCFTDLILG...VSCMRYADEIVLR.......TDKFIVDAGS

PF01537

K4P3S4_9ALPH/66-190-------------VRYATSA.A-----------------------------AC---------------------------
Q86788_FHV1/60-176-------------WGYVEHS.S-----------------------------GC---------------------------
Q67644_ILTV/108-239-------------NRYLTRVSR-----------------------------GC---------------------------
GD_SUHVR/56-181-------------VYHTRPLED-----------------------------PC---------------------------
GD_EHV1D/129-252-------------LRIVTAT.R-----------------------------PC---------------------------
Q89634_FHV1/69-193-------------VRYVTSM.D-----------------------------SC---------------------------
O41524_9ALPH/49-174-------------VRYVTST.D-----------------------------PC---------------------------
GD_HHV1P/82-206-------------VYYAVLE.R-----------------------------AC---------------------------
GD_CHV1/81-206-------------VYYAVLE.R-----------------------------AC---------------------------
Q67648_9ALPH/79-203-------------TKHVIYT.D-----------------------------NC---------------------------
Q77L58_MEHV1/64-188-------------TKHVIYD.E-----------------------------NC---------------------------
O90421_9ALPH/53-169-------------VNATERS.K-----------------------------GC---------------------------
Q5FBC8_9ALPH/54-170-------------IAIKAES.K-----------------------------GC---------------------------
O39306_EHV4/54-170-------------VALTAES.K-----------------------------GC---------------------------
Q91E41_9ALPH/52-168-------------NGYTEYS.K-----------------------------GC---------------------------
O41523_9ALPH/53-168-------------NGYVEYS.K-----------------------------GC---------------------------
O39504_9ALPH/64-183-------------VRAVDAS.R-----------------------------GC---------------------------
Q6X201_9ALPH/66-185-------------ARATDTS.H-----------------------------GC---------------------------
Q87093_CHV1/74-190-------------LARS..Y.S-----------------------------RC---------------------------
Q69367_9ALPH/73-189-------------VARV..Y.S-----------------------------GC---------------------------
A7U885_HHV2/81-195-------------LGRS..F.L-----------------------------TG---------------------------
Q9QPU9_9ALPH/70-184-------------VSVP..T.P-----------------------------EC---------------------------

PF05326

Q99N75_MOUSE/3-124--------------------------------------------------------------------------------
Q9D2X6_MOUSE/3-124--------------------------------------------------------------------------------
Q76I99_MOUSE/3-123--------------------------------------------------------------------------------
PIP_RAT/1-126--------------------------------------------------------------------------------
PIP_RABIT/3-126--------------------------------------------------------------------------------
PIP_CAVPO/3-126--------------------------------------------------------------------------------
PIP_BOVIN/3-127--------------------------------------------------------------------------------
E9PX96_MOUSE/10-142--------------------------------------------------------------------------------
G1QRT8_NOMLE/4-126--------------------------------------------------------------------------------
G7P1H3_MACFA/4-126--------------------------------------------------------------------------------
PIP_MOUSE/2-126--------------------------------------------------------------------------------

PF15028

PTCRA_RAT/20-147--------------------------------------------------------------------------------
G1QXF2_NOMLE/20-146--------------------------------------------------------------------------------
PTCRA_BOVIN/31-157--------------------------------------------------------------------------------
G3WD30_SARHA/20-146--------------------------------------------------------------------------------
M3YPD2_MUSPF/40-162--------------------------------------------------------------------------------
H0VKD6_CAVPO/20-147--------------------------------------------------------------------------------
G1U7X8_RABIT/20-147--------------------------------------------------------------------------------

PF09085

W5PFN9_SHEEP/105-212--------------------------------------------------------------------------------
H0WQ95_OTOGA/112-222--------------------------------------------------------------------------------
G5E838_MOUSE/110-220--------------------------------------------------------------------------------
G1PL68_MYOLU/112-219--------------------------------------------------------------------------------
I3LSA9_PIG/49-158--------------------------------------------------------------------------------
M3W8G7_FELCA/115-224--------------------------------------------------------------------------------
MADCA_HUMAN/113-224--------------------------------------------------------------------------------
F7BUG9_MONDO/130-238--------------------------------------------------------------------------------
I3N840_SPETR/111-217--------------------------------------------------------------------------------
L8Y2P3_TUPCH/565-674--------------------------------------------------------------------------------
G3HF34_CRIGR/110-220--------------------------------------------------------------------------------

PF11465

CD244_HUMAN/22-127--------------------------------------------------------------------------------
CD244_RAT/22-128--------------------------------------------------------------------------------
CD244_MOUSE/22-129--------------------------------------------------------------------------------

PF01688

GI_HHV2H/8-165--------------------------------------------------------------------------------
GI_GAHVM/2-157--------------------------------------------------------------------------------
GI_PSHV1/10-157--------------------------------------------------------------------------------
GI_VZVD/7-164--------------------------------------------------------------------------------
GI_HHV11/8-165--------------------------------------------------------------------------------

PF10430

F8W3C8_DANRE/7-103--------------------------------------------------------------------------------
W5M5U9_LEPOC/23-114--------------------------------------------------------------------------------
W5KIA3_ASTMX/20-110--------------------------------------------------------------------------------
Q80YS4_MOUSE/24-118--------------------------------------------------------------------------------
G1KU09_ANOCA/38-132--------------------------------------------------------------------------------
F7EC20_XENTR/25-118--------------------------------------------------------------------------------
H0YT27_TAEGU/25-119--------------------------------------------------------------------------------

PF08204

O57240_9POXV/2-124--------------------------------------------------------------------------------
CD47_BOVIN/8-140--------------------------------------------------------------------------------
Q9DHI5_YLDV/7-104--------------------------------------------------------------------------------
CD47_HUMAN/8-142--------------------------------------------------------------------------------
Q8JTQ3_LSDV/14-122--------------------------------------------------------------------------------
Q5ZL65_CHICK/8-141--------------------------------------------------------------------------------
Q9Q8V0_RFVKA/10-120--------------------------------------------------------------------------------
Q9D9W5_MOUSE/8-139--------------------------------------------------------------------------------
Q8V3H1_SWPV1/6-113--------------------------------------------------------------------------------
Q6TUP1_YMTV5/1-98--------------------------------------------------------------------------------
A8VKH9_PIG/8-140--------------------------------------------------------------------------------
B2CWN5_9POXV/1-111--------------------------------------------------------------------------------

PF16680

W5KJS3_ASTMX/45-112--------------------------------------------------------------------------------
H9GCG3_ANOCA/63-138--------------------------------------------------------------------------------
K7GSE2_PIG/39-114--------------------------------------------------------------------------------
CD3D_RAT/30-103--------------------------------------------------------------------------------
H2NFG8_PONAB/39-114--------------------------------------------------------------------------------
CD3E_PIG/42-118--------------------------------------------------------------------------------
G5BHL4_HETGA/19-92--------------------------------------------------------------------------------
G3WJY6_SARHA/44-120--------------------------------------------------------------------------------
F7F8D9_MONDO/35-112--------------------------------------------------------------------------------
I3MMT1_SPETR/36-114--------------------------------------------------------------------------------
F6X8V5_ORNAN/39-109--------------------------------------------------------------------------------
L5KJW9_PTEAL/39-116--------------------------------------------------------------------------------
F7CUQ0_HORSE/39-110--------------------------------------------------------------------------------
E2RHB8_CANFA/39-114--------------------------------------------------------------------------------
M3WFR1_FELCA/39-114--------------------------------------------------------------------------------
CD3E_MOUSE/35-110--------------------------------------------------------------------------------
U3ISR2_ANAPL/34-103--------------------------------------------------------------------------------
F7F8B6_MONDO/49-121--------------------------------------------------------------------------------
G1M3D4_AILME/39-114--------------------------------------------------------------------------------
J9NXV0_CANFA/30-103--------------------------------------------------------------------------------
CD3G_SHEEP/9-84--------------------------------------------------------------------------------
D4A5M2_RAT/30-105--------------------------------------------------------------------------------
G5BHL3_HETGA/37-113--------------------------------------------------------------------------------
L5M0Z4_MYODS/24-101--------------------------------------------------------------------------------
W5MH99_LEPOC/35-109--------------------------------------------------------------------------------
F7CSX8_HORSE/46-120--------------------------------------------------------------------------------
H0VN41_CAVPO/30-103--------------------------------------------------------------------------------
G3U502_LOXAF/18-89--------------------------------------------------------------------------------
M3XJR7_LATCH/43-115--------------------------------------------------------------------------------
G3IMA2_CRIGR/9-82--------------------------------------------------------------------------------
F7FPX1_CALJA/30-103--------------------------------------------------------------------------------
F1N9E2_CHICK/34-109--------------------------------------------------------------------------------
H3BFR3_LATCH/32-111--------------------------------------------------------------------------------
H0UW68_CAVPO/43-116--------------------------------------------------------------------------------
W5PGT3_SHEEP/36-112--------------------------------------------------------------------------------
I3MVU8_SPETR/39-109--------------------------------------------------------------------------------
CD3E_BOVIN/36-113--------------------------------------------------------------------------------
G1SDA6_RABIT/30-103--------------------------------------------------------------------------------
M3XZE1_MUSPF/30-101--------------------------------------------------------------------------------
M3WFR0_FELCA/39-111--------------------------------------------------------------------------------
CD3E_FELCA/47-124--------------------------------------------------------------------------------
G3T784_LOXAF/30-104--------------------------------------------------------------------------------
CD3D_MOUSE/30-103--------------------------------------------------------------------------------
G3T782_LOXAF/35-111--------------------------------------------------------------------------------
F1M9F8_RAT/39-114--------------------------------------------------------------------------------
Q3LRP4_CALJA/42-120--------------------------------------------------------------------------------
L5M0W2_MYODS/39-112--------------------------------------------------------------------------------
B4F6W6_XENTR/31-102--------------------------------------------------------------------------------
W5PHC2_SHEEP/30-99--------------------------------------------------------------------------------
CD3D_BOVIN/30-100--------------------------------------------------------------------------------
I6LI21_MUSPF/32-108--------------------------------------------------------------------------------
H0W6D3_CAVPO/39-114--------------------------------------------------------------------------------
F7D784_MONDO/39-114--------------------------------------------------------------------------------
G7NCB9_MACMU/42-120--------------------------------------------------------------------------------
G1STZ2_RABIT/39-114--------------------------------------------------------------------------------
G8JL01_BOVIN/15-90--------------------------------------------------------------------------------
K7GLV9_PIG/30-103--------------------------------------------------------------------------------
F6WI60_MACMU/30-103--------------------------------------------------------------------------------
L5M0S8_MYODS/30-101--------------------------------------------------------------------------------
G1MXZ8_MELGA/33-102--------------------------------------------------------------------------------
H0YPP3_TAEGU/33-105--------------------------------------------------------------------------------
H0X808_OTOGA/42-120--------------------------------------------------------------------------------
M3ZL37_XIPMA/31-110--------------------------------------------------------------------------------
G3WK56_SARHA/41-113--------------------------------------------------------------------------------
G3T785_LOXAF/39-113--------------------------------------------------------------------------------
G3WKI7_SARHA/39-113--------------------------------------------------------------------------------
CD3G_MOUSE/39-114--------------------------------------------------------------------------------
G1SRV6_RABIT/14-92--------------------------------------------------------------------------------
G1M3E8_AILME/39-111--------------------------------------------------------------------------------
G1R705_NOMLE/42-120--------------------------------------------------------------------------------
CD3E_CANFA/47-124--------------------------------------------------------------------------------
H0X0C4_OTOGA/30-103--------------------------------------------------------------------------------
F6QRU0_XENTR/52-121--------------------------------------------------------------------------------
L5KKM4_PTEAL/24-101--------------------------------------------------------------------------------
L9KSF6_TUPCH/19-94--------------------------------------------------------------------------------
M3XZF4_MUSPF/39-112--------------------------------------------------------------------------------
I3MMT3_SPETR/39-114--------------------------------------------------------------------------------
F7CIT2_HORSE/30-97--------------------------------------------------------------------------------
G1M3G6_AILME/47-123--------------------------------------------------------------------------------

PF00047

OX2G_RAT/34-136--------------------------------------------------------------------------------
CEAM1_HUMAN/331-411--------------------------------------------------------------------------------
IGHM_CHICK/220-311--------------------------------------------------------------------------------
IL6RA_MOUSE/30-107--------------------------------------------------------------------------------
KI2S5_HUMAN/132-213--------------------------------------------------------------------------------
NRG_DROME/525-609--------------------------------------------------------------------------------
TIE1_MOUSE/127-208--------------------------------------------------------------------------------
KI2S5_HUMAN/32-115--------------------------------------------------------------------------------
IGHE_MOUSE/209-300--------------------------------------------------------------------------------
CSF1R_FELCA/207-293--------------------------------------------------------------------------------
TIE1_MOUSE/353-439--------------------------------------------------------------------------------
NTRK3_HUMAN/214-299--------------------------------------------------------------------------------
MUCM_RABIT/11-105--------------------------------------------------------------------------------
KIT_HUMAN/216-305--------------------------------------------------------------------------------
FLT3_MOUSE/256-346--------------------------------------------------------------------------------
SEM3E_MOUSE/585-669--------------------------------------------------------------------------------
FCGR1_MOUSE/204-284--------------------------------------------------------------------------------
FGFR1_CHICK/37-115--------------------------------------------------------------------------------
PGFRB_HUMAN/37-115--------------------------------------------------------------------------------
PTPRM_HUMAN/189-275--------------------------------------------------------------------------------
CD4_MOUSE/25-127--------------------------------------------------------------------------------
OPCM_RAT/227-311--------------------------------------------------------------------------------
IGHD_HUMAN/173-264--------------------------------------------------------------------------------
V055_FOWPN/31-121--------------------------------------------------------------------------------
DIG1_CAEEL/310-389--------------------------------------------------------------------------------
CD33_HUMAN/146-227--------------------------------------------------------------------------------
NRG_DROME/251-332--------------------------------------------------------------------------------
DIG1_CAEEL/1822-1903--------------------------------------------------------------------------------
IL1R2_HUMAN/241-341--------------------------------------------------------------------------------
VCAM1_HUMAN/229-306--------------------------------------------------------------------------------
OX2G_MOUSE/143-229--------------------------------------------------------------------------------
KI3L1_HUMAN/32-110--------------------------------------------------------------------------------
THY1_HUMAN/21-119--------------------------------------------------------------------------------
IL1BP_VACCW/228-322--------------------------------------------------------------------------------

PF16758

UL14_HCMVM/48-234--------------------------------------------------------------------------------
UL141_HCMVM/51-241--------------------------------------------------------------------------------

PF13927

B4JUY8_DROGR/56-147--------------------------------------------------------------------------------
Q9E8G3_9ADEN/418-485--------------------------------------------------------------------------------
Q14VV5_RAHV1/122-191--------------------------------------------------------------------------------
Q05KR2_RAT/225-316--------------------------------------------------------------------------------
D2GWX3_AILME/205-296--------------------------------------------------------------------------------
Q9TV71_HORSE/225-316--------------------------------------------------------------------------------
Q5R5D6_PONAB/81-172--------------------------------------------------------------------------------
B3RNX0_TRIAD/137-219--------------------------------------------------------------------------------
Q4RP84_TETNG/334-402--------------------------------------------------------------------------------
Q7TPQ6_MOUSE/37-119--------------------------------------------------------------------------------
Q64861_9ADEN/137-203--------------------------------------------------------------------------------
Q16X13_AEDAE/196-289--------------------------------------------------------------------------------
B7Z4Y8_HUMAN/87-162--------------------------------------------------------------------------------
A9Y0V1_9CICH/291-381--------------------------------------------------------------------------------
B4F6P7_XENTR/145-216--------------------------------------------------------------------------------
A4JYH8_DANRE/212-293--------------------------------------------------------------------------------
Q8AXU0_ONCMY/214-296--------------------------------------------------------------------------------
A9Y0V0_9CICH/193-275--------------------------------------------------------------------------------
Q4RZA3_TETNG/179-261--------------------------------------------------------------------------------
B0WE60_CULQU/104-184--------------------------------------------------------------------------------
Q675X8_OIKDI/328-400--------------------------------------------------------------------------------
A7RZM7_NEMVE/164-243--------------------------------------------------------------------------------
C3PU48_HELVI/65-147--------------------------------------------------------------------------------
Q9E8F9_9ADEN/415-478--------------------------------------------------------------------------------
VS10L_MOUSE/484-552--------------------------------------------------------------------------------
Q17P33_AEDAE/147-237--------------------------------------------------------------------------------
Q5M7A8_XENLA/139-209--------------------------------------------------------------------------------
B5JJ62_9BACT/373-440--------------------------------------------------------------------------------
A8KB70_DANRE/141-217--------------------------------------------------------------------------------
A8E4T3_DANRE/125-204--------------------------------------------------------------------------------
Q6PUA9_AMBME/211-289--------------------------------------------------------------------------------
Q6P6Y9_XENLA/207-286--------------------------------------------------------------------------------
B4F6V0_XENTR/207-287--------------------------------------------------------------------------------
A7LKP4_HORSE/132-214--------------------------------------------------------------------------------
Q5GAK1_9VIRU/122-188--------------------------------------------------------------------------------
Q5CZQ8_DANRE/218-294--------------------------------------------------------------------------------
Q16ZU2_AEDAE/151-229--------------------------------------------------------------------------------
B3MMJ5_DROAN/141-228--------------------------------------------------------------------------------
Q25177_HYDVU/232-308--------------------------------------------------------------------------------
VS10L_MOUSE/388-462--------------------------------------------------------------------------------
B5JL51_9BACT/220-289--------------------------------------------------------------------------------
B9XJC2_PEDPL/341-410--------------------------------------------------------------------------------
B4A6E2_SALNE/162-234--------------------------------------------------------------------------------
B9XRA3_PEDPL/769-839--------------------------------------------------------------------------------
B9XFJ5_PEDPL/981-1051--------------------------------------------------------------------------------
Q11WJ8_CYTH3/1793-1868--------------------------------------------------------------------------------
B9XK99_PEDPL/434-502--------------------------------------------------------------------------------
B9XNF4_PEDPL/912-982--------------------------------------------------------------------------------
B9XJC2_PEDPL/171-239--------------------------------------------------------------------------------
B9XIT4_PEDPL/501-570--------------------------------------------------------------------------------
B9XNF4_PEDPL/1266-1335--------------------------------------------------------------------------------
Q8QFN4_SALSA/217-311--------------------------------------------------------------------------------
MILR1_HUMAN/127-200--------------------------------------------------------------------------------
I0AZP8_9POXV/264-344--------------------------------------------------------------------------------
B1NA53_XENLA/215-283--------------------------------------------------------------------------------
A7SRI5_NEMVE/60-138--------------------------------------------------------------------------------
Q58EM0_DANRE/46-124--------------------------------------------------------------------------------
B4F6P7_XENTR/242-336--------------------------------------------------------------------------------
Q5FW36_XENTR/237-331--------------------------------------------------------------------------------
IL1R2_MOUSE/248-342--------------------------------------------------------------------------------
Q9N2H5_HORSE/236-330--------------------------------------------------------------------------------
B5KH15_TETNG/127-187--------------------------------------------------------------------------------
Q5BKG7_XENTR/123-200--------------------------------------------------------------------------------
Q8AXT5_SALSA/239-334--------------------------------------------------------------------------------
Q4VWU3_XENLA/180-252--------------------------------------------------------------------------------
A7TDK3_NEMVE/95-165--------------------------------------------------------------------------------
A4JYL8_DANRE/119-181--------------------------------------------------------------------------------
Q4S0F0_TETNG/121-184--------------------------------------------------------------------------------
A6NJE8_HUMAN/286-359--------------------------------------------------------------------------------
GP42_RAT/114-188--------------------------------------------------------------------------------
FCRL6_HUMAN/206-280--------------------------------------------------------------------------------
FCRL1_MOUSE/116-189--------------------------------------------------------------------------------
D2I2T6_AILME/288-361--------------------------------------------------------------------------------
A7SAT9_NEMVE/170-237--------------------------------------------------------------------------------
Q98173_MCV1/178-253--------------------------------------------------------------------------------
C3KJI3_ANOFI/124-193--------------------------------------------------------------------------------
ILRL1_HUMAN/211-307--------------------------------------------------------------------------------
ILRL1_RAT/216-311--------------------------------------------------------------------------------
B5XCQ4_SALSA/120-188--------------------------------------------------------------------------------
B5XDA6_SALSA/115-177--------------------------------------------------------------------------------
Q4SQP9_TETNG/121-187--------------------------------------------------------------------------------
Q676C3_OIKDI/705-769--------------------------------------------------------------------------------
IRPL2_HUMAN/241-335--------------------------------------------------------------------------------
B0R0J8_DANRE/123-187--------------------------------------------------------------------------------
Q3SZI9_BOVIN/149-216--------------------------------------------------------------------------------
B4E1U5_HUMAN/83-150--------------------------------------------------------------------------------
B5XGJ4_SALSA/128-200--------------------------------------------------------------------------------
Q18PG4_MOUSE/127-196--------------------------------------------------------------------------------
Q6NZB6_MOUSE/352-421--------------------------------------------------------------------------------
D2I0U5_AILME/321-390--------------------------------------------------------------------------------
LY9_HUMAN/362-431--------------------------------------------------------------------------------
SLAF5_HUMAN/134-197--------------------------------------------------------------------------------
Q6NZB6_MOUSE/147-217--------------------------------------------------------------------------------
D2I0U5_AILME/119-189--------------------------------------------------------------------------------
LY9_HUMAN/156-226--------------------------------------------------------------------------------
Q0ZHH3_SALSA/290-382--------------------------------------------------------------------------------
B0WG40_CULQU/57-138--------------------------------------------------------------------------------
Q4TGC2_TETNG/85-158--------------------------------------------------------------------------------
A4JYH8_DANRE/415-499--------------------------------------------------------------------------------
A9Y0V0_9CICH/397-485--------------------------------------------------------------------------------
CSF11_TAKRU/411-499--------------------------------------------------------------------------------
Q8AXU0_ONCMY/416-504--------------------------------------------------------------------------------
Q4T5K0_TETNG/309-397--------------------------------------------------------------------------------
Q9MYN0_BOVIN/160-243--------------------------------------------------------------------------------
Q6PUA9_AMBME/408-495--------------------------------------------------------------------------------
B4F6V0_XENTR/405-489--------------------------------------------------------------------------------
Q9DEE1_CHICK/207-302--------------------------------------------------------------------------------
Q90874_CHICK/229-319--------------------------------------------------------------------------------
B3VBV3_RABIT/213-301--------------------------------------------------------------------------------
D3ZRM2_RAT/211-299--------------------------------------------------------------------------------
Q86FD7_SCHJA/138-225--------------------------------------------------------------------------------
A7S2Y7_NEMVE/135-214--------------------------------------------------------------------------------
A7RKF7_NEMVE/125-206--------------------------------------------------------------------------------
B7PBK2_IXOSC/49-137--------------------------------------------------------------------------------
A9JTC6_DANRE/131-215--------------------------------------------------------------------------------
Q7YS40_PIG/127-195--------------------------------------------------------------------------------
Q28753_9CETA/127-199--------------------------------------------------------------------------------
A7YW37_BOVIN/141-211--------------------------------------------------------------------------------
D0UGD1_SALSA/144-215--------------------------------------------------------------------------------
D0UGC3_SALSA/143-215--------------------------------------------------------------------------------
Q4RU18_TETNG/215-283--------------------------------------------------------------------------------
B5KH12_DANRE/121-187--------------------------------------------------------------------------------
C7FF20_CTEID/121-187--------------------------------------------------------------------------------
A8CZ68_CYPCA/100-170--------------------------------------------------------------------------------
A9CQ46_CARAU/114-180--------------------------------------------------------------------------------
B7P1H7_IXOSC/58-137--------------------------------------------------------------------------------
Q4RGD6_TETNG/356-418--------------------------------------------------------------------------------
Q4SGL7_TETNG/81-143--------------------------------------------------------------------------------
Q5EG07_ICTPU/362-434--------------------------------------------------------------------------------
B4L0P5_DROMO/97-184--------------------------------------------------------------------------------
ICAM3_PANTR/399-466--------------------------------------------------------------------------------
D2HGY8_AILME/379-446--------------------------------------------------------------------------------
ICAM3_BOVIN/400-467--------------------------------------------------------------------------------
ICAM1_BOVIN/393-460--------------------------------------------------------------------------------
Q9ERF7_CRIGR/391-458--------------------------------------------------------------------------------
Q4VWT0_XENLA/203-275--------------------------------------------------------------------------------
Q5ZKN0_CHICK/121-207--------------------------------------------------------------------------------
B7UTR6_CHICK/312-386--------------------------------------------------------------------------------
D2HUU5_AILME/123-194--------------------------------------------------------------------------------
NCTR1_RAT/123-194--------------------------------------------------------------------------------
Q8K4V6_MOUSE/523-602--------------------------------------------------------------------------------
A5D7Q0_BOVIN/129-208--------------------------------------------------------------------------------
C9JMK7_HUMAN/314-393--------------------------------------------------------------------------------
A8MZH0_HUMAN/311-390--------------------------------------------------------------------------------
Q1I0P7_MACMU/323-402--------------------------------------------------------------------------------
LIRB3_HUMAN/324-400--------------------------------------------------------------------------------
Q67EV3_RAT/123-203--------------------------------------------------------------------------------
D4AAQ4_RAT/141-221--------------------------------------------------------------------------------
D3ZRL6_RAT/122-197--------------------------------------------------------------------------------
B1MTX6_CALMO/123-198--------------------------------------------------------------------------------
A8K3V4_HUMAN/252-343--------------------------------------------------------------------------------
CD86_HUMAN/138-222--------------------------------------------------------------------------------
Q8K3J3_MERUN/138-220--------------------------------------------------------------------------------
Q8CJE8_MESAU/137-221--------------------------------------------------------------------------------
A8WX99_CAEBR/133-228--------------------------------------------------------------------------------
OX2V_HHV6Z/146-225--------------------------------------------------------------------------------
Q5YFN7_9VIRU/132-198--------------------------------------------------------------------------------
Q4S7L7_TETNG/144-208--------------------------------------------------------------------------------
SLAF8_HUMAN/127-205--------------------------------------------------------------------------------
Q3U1C3_MOUSE/125-203--------------------------------------------------------------------------------
Q95JN1_MACFA/53-120--------------------------------------------------------------------------------
A4GW16_CERAT/123-196--------------------------------------------------------------------------------
A4Q8S8_SPAAU/133-219--------------------------------------------------------------------------------
Q14VV3_RAHV1/126-194--------------------------------------------------------------------------------
Q4SPM6_TETNG/127-188--------------------------------------------------------------------------------
Q90777_CHICK/186-256--------------------------------------------------------------------------------
D2HPH1_AILME/172-242--------------------------------------------------------------------------------
VS10L_MOUSE/288-369--------------------------------------------------------------------------------
D2H9T8_AILME/435-506--------------------------------------------------------------------------------
D3ZW99_RAT/125-200--------------------------------------------------------------------------------
TARM1_HUMAN/125-203--------------------------------------------------------------------------------
D2HYQ1_AILME/99-177--------------------------------------------------------------------------------
Q2V8M5_ICTPU/214-288--------------------------------------------------------------------------------
Q0GKW7_ICTPU/273-340--------------------------------------------------------------------------------
Q4VWU8_XENLA/212-284--------------------------------------------------------------------------------
Q6DCH5_XENLA/194-269--------------------------------------------------------------------------------
B3RFN4_XENLA/196-268--------------------------------------------------------------------------------
Q7YQJ5_CANFA/191-264--------------------------------------------------------------------------------
FCRLA_HUMAN/171-244--------------------------------------------------------------------------------
FCRLA_MOUSE/181-254--------------------------------------------------------------------------------

PF13895

D3ZVK9_RAT/327-417--------------------------------------------------------------------------------
D3ZQX2_RAT/63-153--------------------------------------------------------------------------------
IRPL2_HUMAN/143-231--------------------------------------------------------------------------------
CD86_HUMAN/138-236--------------------------------------------------------------------------------
A1BG_HUMAN/209-301--------------------------------------------------------------------------------
PECA1_PIG/327-405--------------------------------------------------------------------------------
PECA1_MOUSE/316-393--------------------------------------------------------------------------------
A6NJE8_HUMAN/104-185--------------------------------------------------------------------------------
VS10L_MOUSE/388-477--------------------------------------------------------------------------------
A7T6F1_NEMVE/26-106--------------------------------------------------------------------------------
A7RUN6_NEMVE/106-186--------------------------------------------------------------------------------
A1BG_MOUSE/28-125--------------------------------------------------------------------------------
A1BG_RAT/218-314--------------------------------------------------------------------------------
FCRLA_MOUSE/79-175--------------------------------------------------------------------------------
D3ZRM2_RAT/20-112--------------------------------------------------------------------------------
Q11VY4_CYTH3/701-789--------------------------------------------------------------------------------
A6GXG9_FLAPJ/1010-1093--------------------------------------------------------------------------------
FCRLB_HUMAN/22-100--------------------------------------------------------------------------------
IL1R1_RAT/122-217--------------------------------------------------------------------------------
GP42_RAT/22-108--------------------------------------------------------------------------------
A6QQQ4_BOVIN/113-195--------------------------------------------------------------------------------
ILRL2_RAT/126-220--------------------------------------------------------------------------------
A7SZF2_NEMVE/222-298--------------------------------------------------------------------------------
A1SP19_NOCSJ/451-536--------------------------------------------------------------------------------
C3XPD2_BRAFL/8-98--------------------------------------------------------------------------------
B7Q9Q6_IXOSC/51-137--------------------------------------------------------------------------------
B3RLN9_TRIAD/257-344--------------------------------------------------------------------------------
A7SRI5_NEMVE/63-151--------------------------------------------------------------------------------
TACT_HUMAN/25-136--------------------------------------------------------------------------------
ISLR2_HUMAN/240-372--------------------------------------------------------------------------------
B4DVJ9_HUMAN/23-102--------------------------------------------------------------------------------
E9PD35_HUMAN/138-224--------------------------------------------------------------------------------
E9PX73_MOUSE/46-128--------------------------------------------------------------------------------
F1P3W0_CHICK/181-268--------------------------------------------------------------------------------
F1R1B9_DANRE/314-392--------------------------------------------------------------------------------
F6QPE0_BOVIN/327-404--------------------------------------------------------------------------------
F7AWH8_XENTR/85-171--------------------------------------------------------------------------------
F7DK71_HORSE/161-253--------------------------------------------------------------------------------
F7DLW8_HORSE/326-403--------------------------------------------------------------------------------
G1L4E1_AILME/105-189--------------------------------------------------------------------------------
G1L7T4_AILME/329-410--------------------------------------------------------------------------------
G1M3E0_AILME/129-211--------------------------------------------------------------------------------
G1M8A4_AILME/973-1063--------------------------------------------------------------------------------
H2NXI9_PONAB/312-389--------------------------------------------------------------------------------
H2RC57_PANTR/28-117--------------------------------------------------------------------------------
H3CEP5_TETNG/209-301--------------------------------------------------------------------------------
H3CGE1_TETNG/471-557--------------------------------------------------------------------------------
M0RCJ0_RAT/106-186--------------------------------------------------------------------------------
M3XWI6_MUSPF/119-204--------------------------------------------------------------------------------
LIRB5_HUMAN/28-115--------------------------------------------------------------------------------
PECA1_HUMAN/327-404--------------------------------------------------------------------------------

PF16706

G1TVX5_RABIT/169-260--------------------------------------------------------------------------------
F6YE25_HORSE/168-260--------------------------------------------------------------------------------
H0UTJ7_CAVPO/168-259--------------------------------------------------------------------------------
F6UM65_CANFA/166-254--------------------------------------------------------------------------------
M3W7L5_FELCA/169-261--------------------------------------------------------------------------------
H9H653_MONDO/206-297--------------------------------------------------------------------------------
V8PHR1_OPHHA/159-248--------------------------------------------------------------------------------
L5LHN8_MYODS/162-254--------------------------------------------------------------------------------
H0WN21_OTOGA/168-257--------------------------------------------------------------------------------
IZUM1_MOUSE/168-260--------------------------------------------------------------------------------
G3TPD8_LOXAF/168-260--------------------------------------------------------------------------------
IZUM1_RAT/168-260--------------------------------------------------------------------------------
I3MLV0_SPETR/170-262--------------------------------------------------------------------------------
G1M882_AILME/167-255--------------------------------------------------------------------------------
G1QXF7_NOMLE/168-260--------------------------------------------------------------------------------
W5PRD0_SHEEP/169-261--------------------------------------------------------------------------------
H3DD44_TETNG/58-151--------------------------------------------------------------------------------

PF07654

O35424_MOUSE/129-211--------------------------------------------------------------------------------
IGKC_HUMAN/12-98--------------------------------------------------------------------------------
KACB_RAT/12-98--------------------------------------------------------------------------------
IGKC_MOUSE/12-98--------------------------------------------------------------------------------
KAC5_RABIT/12-95--------------------------------------------------------------------------------
LAC1_MOUSE/13-96--------------------------------------------------------------------------------
LAC2_MOUSE/13-95--------------------------------------------------------------------------------
LAC_PIG/13-96--------------------------------------------------------------------------------
LAC_RABIT/13-96--------------------------------------------------------------------------------
TCB2_MOUSE/17-102--------------------------------------------------------------------------------
IGHE_HUMAN/331-415--------------------------------------------------------------------------------
IGHE_RAT/322-410--------------------------------------------------------------------------------
IGHG1_HUMAN/13-95--------------------------------------------------------------------------------
IGHG1_HUMAN/130-216--------------------------------------------------------------------------------
IGHG1_HUMAN/236-321--------------------------------------------------------------------------------
IGHG2_CAVPO/234-321--------------------------------------------------------------------------------
GCAA_MOUSE/13-94--------------------------------------------------------------------------------
GCAA_MOUSE/130-216--------------------------------------------------------------------------------
GCAA_MOUSE/236-321--------------------------------------------------------------------------------
GCAB_MOUSE/241-326--------------------------------------------------------------------------------
IGG2B_MOUSE/241-326--------------------------------------------------------------------------------
IGHG1_MOUSE/230-315--------------------------------------------------------------------------------
IGHG_RABIT/123-209--------------------------------------------------------------------------------
IGHM_HUMAN/337-425--------------------------------------------------------------------------------
IGHM_CHICK/330-419--------------------------------------------------------------------------------
IGHA1_HUMAN/12-96--------------------------------------------------------------------------------
IGHA_MOUSE/12-95--------------------------------------------------------------------------------
IGHA_RABIT/182-272--------------------------------------------------------------------------------
IGHD_HUMAN/14-96--------------------------------------------------------------------------------
B2MG_RABIT/11-92--------------------------------------------------------------------------------
B2MG_CAVPO/11-92--------------------------------------------------------------------------------
B2MG_MOUSE/31-112--------------------------------------------------------------------------------
B2MG_BOVIN/31-111--------------------------------------------------------------------------------
IGHG3_MOUSE/235-320--------------------------------------------------------------------------------
DPB1_HUMAN/130-212--------------------------------------------------------------------------------
DOB_HUMAN/129-211--------------------------------------------------------------------------------
DPA1_HUMAN/124-206--------------------------------------------------------------------------------
IGHG1_RAT/232-317--------------------------------------------------------------------------------
IGG2B_RAT/239-324--------------------------------------------------------------------------------
IGG2C_RAT/13-94--------------------------------------------------------------------------------
LAC_CHICK/14-95--------------------------------------------------------------------------------
IGLL1_MOUSE/117-200--------------------------------------------------------------------------------
B2MG_CHICK/31-112--------------------------------------------------------------------------------
B2MG_HORSE/31-111--------------------------------------------------------------------------------
B2MG_DANRE/30-109--------------------------------------------------------------------------------
Q8WM94_DANRE/110-193--------------------------------------------------------------------------------
Q90ZJ6_ORYLA/30-109--------------------------------------------------------------------------------
A6QQE7_BOVIN/117-198--------------------------------------------------------------------------------
E9QFF8_DANRE/65-144--------------------------------------------------------------------------------
F1NSZ6_CHICK/135-210--------------------------------------------------------------------------------
F1RBP5_DANRE/141-220--------------------------------------------------------------------------------
F6UY61_MONDO/133-213--------------------------------------------------------------------------------
F6W9R2_CALJA/32-111--------------------------------------------------------------------------------
G1TXW3_RABIT/124-203--------------------------------------------------------------------------------
H0UYJ7_CAVPO/115-195--------------------------------------------------------------------------------
H2MX91_ORYLA/120-197--------------------------------------------------------------------------------
H9GZQ9_HORSE/243-325--------------------------------------------------------------------------------
I3KVH2_ORENI/112-193--------------------------------------------------------------------------------
M3VX36_FELCA/121-201--------------------------------------------------------------------------------
M3W4D7_FELCA/33-111--------------------------------------------------------------------------------
M9MM93_DANRE/109-191--------------------------------------------------------------------------------
O62938_XIPMA/119-197--------------------------------------------------------------------------------
DQA1_HUMAN/118-199--------------------------------------------------------------------------------
HB2D_PIG/132-213--------------------------------------------------------------------------------
HB2D_RAT/130-211--------------------------------------------------------------------------------
HA2J_MOUSE/118-199--------------------------------------------------------------------------------
Q1MTC8_DANRE/121-202--------------------------------------------------------------------------------
Q5M8Y9_XENTR/126-205--------------------------------------------------------------------------------
Q5XJ70_DANRE/111-191--------------------------------------------------------------------------------
Q70IB5_BOVIN/134-215--------------------------------------------------------------------------------
R0JJE7_ANAPL/108-187--------------------------------------------------------------------------------
W5PE14_SHEEP/119-200--------------------------------------------------------------------------------

PF02124

GC_PSHV1/234-457-----------------------------------------AYPPSTLTGAWFIDGNRSAESAGFATNVRQIITSDGEVD
GC_VZVD/379-589-----------------------------------------YYPPHSVRVRWTSRFG.NIG.KNFITDAIQEYAN.G.LF
GC_HHV11/291-500-----------------------------------------YYPRNPVEFVWFEDDH.QVFNPGQIDTQTHEHPD.G..F
GC_GAHVM/283-492-----------------------------------------FYPPGSVYVSWRQNGN.IAT.PRKDRDGSFWWFESGRGA
GC_HHV2H/260-469-----------------------------------------YYPGNRAEFVWFEDGR.RVFDPAQIHTQTQENPD.G..F

PF07679

LRIG1_MOUSE/601-691--------------------------------------------------------------------------------
TITIN_HUMAN/7385-7474--------------------------------------------------------------------------------
PALLD_HUMAN/271-361--------------------------------------------------------------------------------
PALLD_HUMAN/1135-1225--------------------------------------------------------------------------------
HMCN2_HUMAN/4309-4395--------------------------------------------------------------------------------
IGDC3_HUMAN/330-417--------------------------------------------------------------------------------
NCAM2_HUMAN/21-111--------------------------------------------------------------------------------
MYOM1_MOUSE/1555-1645--------------------------------------------------------------------------------
OBSCN_HUMAN/10-99--------------------------------------------------------------------------------
PXDN_HUMAN/433-519--------------------------------------------------------------------------------
Q08476_CHICK/180-269--------------------------------------------------------------------------------
Q08476_CHICK/372-461--------------------------------------------------------------------------------
HMCN1_HUMAN/1171-1258--------------------------------------------------------------------------------
O00557_HUMAN/20-114--------------------------------------------------------------------------------
UNC89_CAEEL/648-737--------------------------------------------------------------------------------
UNC89_CAEEL/3286-3377--------------------------------------------------------------------------------
UNC89_CAEEL/3482-3573--------------------------------------------------------------------------------
UNC89_CAEEL/3920-4010--------------------------------------------------------------------------------
MYLK_SHEEP/331-421--------------------------------------------------------------------------------
MUSK_HUMAN/121-208--------------------------------------------------------------------------------
ROBO1_RAT/262-347--------------------------------------------------------------------------------
O55124_MOUSE/1345-1435--------------------------------------------------------------------------------
O57576_CYNPY/213-301--------------------------------------------------------------------------------
O76281_DROME/1225-1316--------------------------------------------------------------------------------
O76281_DROME/3892-3982--------------------------------------------------------------------------------
O76281_DROME/6357-6446--------------------------------------------------------------------------------
CAVPT_BRALA/59-149--------------------------------------------------------------------------------
MYLK_CHICK/28-118--------------------------------------------------------------------------------
MYLK_CHICK/156-245--------------------------------------------------------------------------------
A4V2I0_DROME/25-135--------------------------------------------------------------------------------
P79757_CHICK/328-417--------------------------------------------------------------------------------
P79757_CHICK/734-823--------------------------------------------------------------------------------
UNC22_CAEEL/4150-4239--------------------------------------------------------------------------------
UNC22_CAEEL/6585-6674--------------------------------------------------------------------------------
UNC22_CAEEL/6863-6953--------------------------------------------------------------------------------
VCAM1_CANFA/25-112--------------------------------------------------------------------------------
Q8BID4_MOUSE/6-97--------------------------------------------------------------------------------
Q8T103_BOMMO/4625-4714--------------------------------------------------------------------------------
Q90X22_DANRE/66-155--------------------------------------------------------------------------------
Q90X22_DANRE/178-268--------------------------------------------------------------------------------
Q90YM0_DANRE/209-296--------------------------------------------------------------------------------
Q90Z41_CHICK/223-308--------------------------------------------------------------------------------
Q95YM1_PROCL/4632-4721--------------------------------------------------------------------------------
Q98918_CHICK/3071-3160--------------------------------------------------------------------------------
SPEG_MOUSE/727-816--------------------------------------------------------------------------------
SPEG_MOUSE/1490-1579--------------------------------------------------------------------------------
Q9GV22_MYTGA/344-433--------------------------------------------------------------------------------
Q9GV22_MYTGA/647-736--------------------------------------------------------------------------------

PF02440

Q4KSJ0_9ADEN/110-200--------------------------------------------------------------------------------
Q91CB8_ADE08/236-321--------------------------------------------------------------------------------
Q80IV8_ADE08/252-335--------------------------------------------------------------------------------
Q91PL0_9ADEN/13-104--------------------------------------------------------------------------------
Q6QPD0_9ADEN/15-113--------------------------------------------------------------------------------
Q6H1B4_9ADEN/16-113--------------------------------------------------------------------------------
Q3ZKT4_9ADEN/13-104--------------------------------------------------------------------------------
Q76C87_ADE08/128-219--------------------------------------------------------------------------------
E3TMR2_ADE16/13-100--------------------------------------------------------------------------------
Q8JZH7_ADE17/110-200--------------------------------------------------------------------------------
E321_ADE35/14-100--------------------------------------------------------------------------------
Q7TBH0_ADE08/34-124--------------------------------------------------------------------------------
B9A5V9_9ADEN/260-345--------------------------------------------------------------------------------
Q8JZH7_ADE17/15-105--------------------------------------------------------------------------------
Q6QP93_9ADEN/15-105--------------------------------------------------------------------------------
Q8UY72_9ADEN/16-114--------------------------------------------------------------------------------
B9A5V9_9ADEN/110-200--------------------------------------------------------------------------------
Q4KSJ0_9ADEN/254-339--------------------------------------------------------------------------------
Q6QPD1_9ADEN/15-112--------------------------------------------------------------------------------
Q91CB6_ADE09/110-200--------------------------------------------------------------------------------

PF07686

TVB8_MOUSE/25-130--------------------------------------------------------------------------------
MPZL2_HUMAN/30-143--------------------------------------------------------------------------------
IGS11_HUMAN/27-141--------------------------------------------------------------------------------
TVB1_MOUSE/25-132--------------------------------------------------------------------------------
CD2_HORSE/25-122--------------------------------------------------------------------------------
CLM2_MOUSE/19-124--------------------------------------------------------------------------------
GPA33_HUMAN/25-138--------------------------------------------------------------------------------
TVA2_MOUSE/26-132--------------------------------------------------------------------------------
TVB1_HUMAN/25-135--------------------------------------------------------------------------------
HVM07_MOUSE/24-138--------------------------------------------------------------------------------
LV603_HUMAN/5-110--------------------------------------------------------------------------------
Q9UEL6_HUMAN/15-129--------------------------------------------------------------------------------
MO2R1_MOUSE/42-147--------------------------------------------------------------------------------
SHPS1_BOVIN/38-145--------------------------------------------------------------------------------
CD2_MOUSE/23-121--------------------------------------------------------------------------------
TIMD4_HUMAN/23-128--------------------------------------------------------------------------------
TVC_HUMAN/24-136--------------------------------------------------------------------------------
FAIM3_HUMAN/19-123--------------------------------------------------------------------------------
TVA2_HUMAN/32-138--------------------------------------------------------------------------------
HV108_HUMAN/5-119--------------------------------------------------------------------------------
CEA21_HUMAN/38-141--------------------------------------------------------------------------------
CSPG2_MOUSE/27-148--------------------------------------------------------------------------------
SIGL5_HUMAN/24-140--------------------------------------------------------------------------------
VSIG1_CHICK/26-136--------------------------------------------------------------------------------
HV107_HUMAN/5-115--------------------------------------------------------------------------------
TVB5_MOUSE/14-122--------------------------------------------------------------------------------
CXAR_DANRE/28-142--------------------------------------------------------------------------------
CEAM4_HUMAN/38-141--------------------------------------------------------------------------------
HHLA2_HUMAN/226-330--------------------------------------------------------------------------------
PVRL4_HUMAN/35-146--------------------------------------------------------------------------------
CD8B_FELCA/24-135--------------------------------------------------------------------------------
SKIT3_MOUSE/32-141--------------------------------------------------------------------------------
PDCD1_MOUSE/37-145--------------------------------------------------------------------------------
KV123_HUMAN/28-129--------------------------------------------------------------------------------
Q8UV83_DANRE/144-247--------------------------------------------------------------------------------
SCN2B_HUMAN/33-147--------------------------------------------------------------------------------
VSIG2_HUMAN/27-142--------------------------------------------------------------------------------
FCAMR_HUMAN/65-171--------------------------------------------------------------------------------
LV1B_MOUSE/24-128--------------------------------------------------------------------------------
CD8A_MOUSE/36-148--------------------------------------------------------------------------------
CLM5_MOUSE/23-126--------------------------------------------------------------------------------
JAML1_HUMAN/25-136--------------------------------------------------------------------------------
BTNLA_MOUSE/37-146--------------------------------------------------------------------------------
TVB6_MOUSE/27-136--------------------------------------------------------------------------------
CD7_HUMAN/31-132--------------------------------------------------------------------------------
TVA1_HUMAN/25-131--------------------------------------------------------------------------------
CD2_HUMAN/28-127--------------------------------------------------------------------------------
TVA1_MOUSE/25-130--------------------------------------------------------------------------------
CD2_RAT/23-120--------------------------------------------------------------------------------
SCN3B_MOUSE/28-143--------------------------------------------------------------------------------
VPREB_HUMAN/24-134--------------------------------------------------------------------------------
TREM1_MOUSE/25-134--------------------------------------------------------------------------------
SCN1B_HUMAN/23-139--------------------------------------------------------------------------------
Q9R121_RAT/32-135--------------------------------------------------------------------------------
SIRPD_HUMAN/34-140--------------------------------------------------------------------------------
MXRA8_HUMAN/168-292--------------------------------------------------------------------------------
A2BGB5_DANRE/30-142--------------------------------------------------------------------------------
B8ZZZ4_HUMAN/29-130--------------------------------------------------------------------------------
F1NMT9_CHICK/44-146--------------------------------------------------------------------------------
F1P992_CANFA/18-131--------------------------------------------------------------------------------
F6RFK3_CHICK/32-139--------------------------------------------------------------------------------
G3V7D2_RAT/42-151--------------------------------------------------------------------------------
L8YBJ5_TUPCH/164-276--------------------------------------------------------------------------------
M0QX98_HUMAN/6-107--------------------------------------------------------------------------------
CD8B_RAT/24-134--------------------------------------------------------------------------------
Q3LFS9_MOUSE/42-141--------------------------------------------------------------------------------
Q5SNP6_DANRE/26-130--------------------------------------------------------------------------------
Q8BNV8_MOUSE/24-121--------------------------------------------------------------------------------
Q8K094_MOUSE/37-141--------------------------------------------------------------------------------
Q9JHL7_RAT/42-140--------------------------------------------------------------------------------

PF05790

CD2_HUMAN/135-205--------------------------------------------------------------------------------
Q8K0X1_MOUSE/133-221--------------------------------------------------------------------------------
CD4_RAT/316-390--------------------------------------------------------------------------------
CD4_SAISC/125-202--------------------------------------------------------------------------------
VCAM1_HUMAN/133-221--------------------------------------------------------------------------------
CD4_RABIT/318-390--------------------------------------------------------------------------------
CD2_RAT/128-198--------------------------------------------------------------------------------
VCAM1_CANFA/133-221--------------------------------------------------------------------------------
CD4_RAT/127-206--------------------------------------------------------------------------------
Q9GKR2_BOVIN/134-222--------------------------------------------------------------------------------
CD4_RABIT/129-208--------------------------------------------------------------------------------
CD2_MOUSE/129-199--------------------------------------------------------------------------------
VCAM1_CANFA/421-509--------------------------------------------------------------------------------
VCAM1_RAT/133-221--------------------------------------------------------------------------------
CD4_CANFA/133-211--------------------------------------------------------------------------------
Q9GKR2_BOVIN/422-510--------------------------------------------------------------------------------
O55054_MOUSE/104-183--------------------------------------------------------------------------------
P79355_FELCA/332-405--------------------------------------------------------------------------------
CD4_CANFA/321-392--------------------------------------------------------------------------------
VCAM1_RAT/421-509--------------------------------------------------------------------------------
CD4_DELLE/314-387--------------------------------------------------------------------------------
Q28939_PIG/134-219--------------------------------------------------------------------------------
O88650_MARMO/10-83--------------------------------------------------------------------------------
P70443_MOUSE/8-81--------------------------------------------------------------------------------
CD2_HORSE/130-201--------------------------------------------------------------------------------
CD4_DELLE/125-203--------------------------------------------------------------------------------
P79355_FELCA/144-222--------------------------------------------------------------------------------

PF16681

F1SAK8_PIG/36-116--------------------------------------------------------------------------------
CD3E_SHEEP/30-112--------------------------------------------------------------------------------
CD3E_BOVIN/30-112--------------------------------------------------------------------------------
G3QUY7_GORGO/36-127--------------------------------------------------------------------------------
H0X808_OTOGA/36-118--------------------------------------------------------------------------------
G5BHL3_HETGA/31-112--------------------------------------------------------------------------------
G3T782_LOXAF/29-109--------------------------------------------------------------------------------
I3MMT1_SPETR/30-113--------------------------------------------------------------------------------
H0UW68_CAVPO/36-115--------------------------------------------------------------------------------
G1SRV6_RABIT/8-90--------------------------------------------------------------------------------
H9GCG3_ANOCA/57-136--------------------------------------------------------------------------------
Q3LRP4_CALJA/36-118--------------------------------------------------------------------------------
L5M0Z4_MYODS/18-99--------------------------------------------------------------------------------
G3WKI6_SARHA/41-122--------------------------------------------------------------------------------
CD3E_CANFA/41-122--------------------------------------------------------------------------------
F7D784_MONDO/33-114--------------------------------------------------------------------------------
M3XJR7_LATCH/37-113--------------------------------------------------------------------------------
F7CSX8_HORSE/40-119--------------------------------------------------------------------------------
L5KKM4_PTEAL/18-99--------------------------------------------------------------------------------
D4A5M2_RAT/24-104--------------------------------------------------------------------------------
G7PP33_MACFA/36-118--------------------------------------------------------------------------------
CD3E_MOUSE/29-109--------------------------------------------------------------------------------

PF08205

PVRL3_HUMAN/173-257--------------------------------------------------------------------------------
SN_MOUSE/142-229--------------------------------------------------------------------------------
RAGE_HUMAN/124-219--------------------------------------------------------------------------------
NPHN_MOUSE/152-242--------------------------------------------------------------------------------
NPHN_MOUSE/357-442--------------------------------------------------------------------------------
CRTAM_MOUSE/119-205--------------------------------------------------------------------------------
PVRL4_MOUSE/150-233--------------------------------------------------------------------------------
PVRL2_MOUSE/155-240--------------------------------------------------------------------------------
PVRL1_HUMAN/148-237--------------------------------------------------------------------------------
TMM25_HUMAN/26-118--------------------------------------------------------------------------------
SN_HUMAN/142-228--------------------------------------------------------------------------------
CD22_HUMAN/143-230--------------------------------------------------------------------------------
NPHN_HUMAN/138-228--------------------------------------------------------------------------------
CD80_RABIT/140-226--------------------------------------------------------------------------------
MUC18_HUMAN/139-234--------------------------------------------------------------------------------
BCAM_HUMAN/150-248--------------------------------------------------------------------------------
BCAM_BOVIN/150-248--------------------------------------------------------------------------------
CD166_MOUSE/137-231--------------------------------------------------------------------------------
O35444_MOUSE/123-217--------------------------------------------------------------------------------
FAS3_DROME/126-222--------------------------------------------------------------------------------
B4MCT1_DROVI/186-273--------------------------------------------------------------------------------
E1C6L8_CHICK/151-245--------------------------------------------------------------------------------
F1SPA8_PIG/71-155--------------------------------------------------------------------------------
F7EIQ1_CALJA/148-231--------------------------------------------------------------------------------
G1TJN6_RABIT/203-292--------------------------------------------------------------------------------
G3V671_RAT/147-231--------------------------------------------------------------------------------
G7NXN7_MACFA/142-226--------------------------------------------------------------------------------
Q7ZZ85_DANRE/61-152--------------------------------------------------------------------------------

PF15910

F1NL21_CHICK/43-155--------------------------------------------------------------------------------
G1L868_AILME/23-135--------------------------------------------------------------------------------
F6ZKL5_HORSE/23-134--------------------------------------------------------------------------------
G5BKP1_HETGA/16-127--------------------------------------------------------------------------------
H0VT36_CAVPO/23-134--------------------------------------------------------------------------------
I3LV71_PIG/23-135--------------------------------------------------------------------------------
ICOS_MOUSE/23-135--------------------------------------------------------------------------------
ICOS_HUMAN/23-134--------------------------------------------------------------------------------

PF06328

E1B6W6_HUMAN/24-110--------------------------------------------------------------------------------
G3H9X4_CRIGR/24-111--------------------------------------------------------------------------------
W5PCA4_SHEEP/27-112--------------------------------------------------------------------------------
H2MHM5_ORYLA/26-108--------------------------------------------------------------------------------
L9KWE5_TUPCH/160-246--------------------------------------------------------------------------------
I3LQQ8_PIG/25-111--------------------------------------------------------------------------------
H0VNJ1_CAVPO/26-112--------------------------------------------------------------------------------
G1MI84_AILME/334-420--------------------------------------------------------------------------------
L5JUJ0_PTEAL/24-110--------------------------------------------------------------------------------
K7E988_ORNAN/24-110--------------------------------------------------------------------------------
M4AJW4_XIPMA/27-111--------------------------------------------------------------------------------
G3QMC9_GORGO/26-112--------------------------------------------------------------------------------
G1KQG1_ANOCA/26-113--------------------------------------------------------------------------------
L9KSB2_TUPCH/4-90--------------------------------------------------------------------------------
L5LZA8_MYODS/26-112--------------------------------------------------------------------------------
Q9W6U9_CHICK/29-115--------------------------------------------------------------------------------
U3KE63_FICAL/318-404--------------------------------------------------------------------------------
H0WB19_CAVPO/28-115--------------------------------------------------------------------------------
IL6RB_RAT/26-112--------------------------------------------------------------------------------
L9JC93_TUPCH/24-110--------------------------------------------------------------------------------
G3X148_SARHA/23-106--------------------------------------------------------------------------------
F7BHT6_MONDO/28-110--------------------------------------------------------------------------------
H0VSE7_CAVPO/334-420--------------------------------------------------------------------------------
CSF3R_MOUSE/24-111--------------------------------------------------------------------------------
V8PEN3_OPHHA/29-110--------------------------------------------------------------------------------
W5MYE4_LEPOC/28-112--------------------------------------------------------------------------------
H0WL79_OTOGA/24-110--------------------------------------------------------------------------------
I12R2_BOVIN/28-110--------------------------------------------------------------------------------
E2R8G9_CANFA/24-110--------------------------------------------------------------------------------
G1T0W6_RABIT/46-133--------------------------------------------------------------------------------
F6Z8U4_XENTR/25-108--------------------------------------------------------------------------------
F1NDH9_CHICK/326-412--------------------------------------------------------------------------------
H3BGX0_LATCH/26-112--------------------------------------------------------------------------------
G3TD98_LOXAF/24-110--------------------------------------------------------------------------------
G3VNH6_SARHA/27-113--------------------------------------------------------------------------------
G5C6G6_HETGA/24-111--------------------------------------------------------------------------------
V8P914_OPHHA/322-410--------------------------------------------------------------------------------
G1L3X5_AILME/24-109--------------------------------------------------------------------------------
F1M9F2_RAT/331-418--------------------------------------------------------------------------------
I12R2_MOUSE/28-120--------------------------------------------------------------------------------
H3AKP8_LATCH/27-113--------------------------------------------------------------------------------
F6VD48_MONDO/28-114--------------------------------------------------------------------------------
M3WIJ4_FELCA/24-110--------------------------------------------------------------------------------
M3YTJ9_MUSPF/24-110--------------------------------------------------------------------------------
E1B9W2_BOVIN/24-110--------------------------------------------------------------------------------

PF00207

CO4A_HUMAN/781-869--------------------------------------------------------------------------------
Q9VIT8_DROME/562-654--------------------------------------------------------------------------------
CO3_MOUSE/770-866--------------------------------------------------------------------------------
CO4B_MOUSE/779-867--------------------------------------------------------------------------------
Q7Q7T0_ANOGA/634-725--------------------------------------------------------------------------------
Q7Q4F0_ANOGA/564-653--------------------------------------------------------------------------------
MUG2_MOUSE/740-830--------------------------------------------------------------------------------
Q7Q4I0_ANOGA/955-1046--------------------------------------------------------------------------------
A2MP_MOUSE/738-828--------------------------------------------------------------------------------
A2M_MOUSE/750-840--------------------------------------------------------------------------------
A2ML1_HUMAN/736-826--------------------------------------------------------------------------------
C3P1_HUMAN/10-104--------------------------------------------------------------------------------
CPMD8_HUMAN/750-841--------------------------------------------------------------------------------
OVOS2_HUMAN/726-816--------------------------------------------------------------------------------
Q29N18_DROPS/745-836--------------------------------------------------------------------------------
Q0C7A6_AEDAE/183-274--------------------------------------------------------------------------------
A2MG_PONAB/738-828--------------------------------------------------------------------------------
Q16YC2_AEDAE/682-773--------------------------------------------------------------------------------
Q17K56_AEDAE/533-625--------------------------------------------------------------------------------
A7SDN3_NEMVE/771-861--------------------------------------------------------------------------------
CD109_HUMAN/693-784--------------------------------------------------------------------------------
Y3030_RALSO/871-965--------------------------------------------------------------------------------
A5PMP6_DANRE/779-875--------------------------------------------------------------------------------
Q12VC6_METBU/707-796--------------------------------------------------------------------------------
Q3A743_PELCD/1262-1354--------------------------------------------------------------------------------
A7MNC2_CROS8/849-939--------------------------------------------------------------------------------
Q17M04_AEDAE/556-648--------------------------------------------------------------------------------
Q08R52_STIAD/712-804--------------------------------------------------------------------------------
Q1DE47_MYXXD/137-227--------------------------------------------------------------------------------
Q11S66_CYTH3/1263-1352--------------------------------------------------------------------------------
Q025N0_SOLUE/854-944--------------------------------------------------------------------------------
A7SSC0_NEMVE/10-101--------------------------------------------------------------------------------
Q2JJS1_SYNJB/901-991--------------------------------------------------------------------------------
Q7ULY0_RHOBA/1286-1375--------------------------------------------------------------------------------
Q2IJH5_ANADE/1222-1312--------------------------------------------------------------------------------
Q1D840_MYXXD/1246-1336--------------------------------------------------------------------------------
Q1IT69_KORVE/868-958--------------------------------------------------------------------------------
Q7MT05_PORGI/1146-1236--------------------------------------------------------------------------------
OVOS_CHICK/748-838--------------------------------------------------------------------------------
Y984_THEMA/714-802--------------------------------------------------------------------------------
A6LJB2_THEM4/653-737--------------------------------------------------------------------------------
Q9VLT3_DROME/939-1030--------------------------------------------------------------------------------
Q7QGN1_ANOGA/635-726--------------------------------------------------------------------------------
A6L1P0_BACV8/1146-1235--------------------------------------------------------------------------------
A8F825_THELT/720-808--------------------------------------------------------------------------------
A5UX85_ROSS1/1485-1575--------------------------------------------------------------------------------
Q73KT0_TREDE/1174-1262--------------------------------------------------------------------------------
A6LIC0_PARD8/1134-1223--------------------------------------------------------------------------------
CD109_MOUSE/695-786--------------------------------------------------------------------------------
B4Q6W4_DROSI/635-727--------------------------------------------------------------------------------
B4QA08_DROSI/759-850--------------------------------------------------------------------------------
C3XSF4_BRAFL/154-244--------------------------------------------------------------------------------
E3FS79_STIAD/1202-1290--------------------------------------------------------------------------------
F1QX13_DANRE/768-861--------------------------------------------------------------------------------
F1R0S4_DANRE/788-875--------------------------------------------------------------------------------
F1R8N2_DANRE/735-823--------------------------------------------------------------------------------
F1RQW2_PIG/780-867--------------------------------------------------------------------------------
F6TCT8_XENTR/740-830--------------------------------------------------------------------------------
F7CSP0_XENTR/773-869--------------------------------------------------------------------------------
F7CVI9_XENTR/767-856--------------------------------------------------------------------------------
H2LRL9_ORYLA/415-503--------------------------------------------------------------------------------
H2M6N3_ORYLA/762-861--------------------------------------------------------------------------------
H2UUU6_TAKRU/643-731--------------------------------------------------------------------------------
H3CLD7_TETNG/732-828--------------------------------------------------------------------------------
H3D959_TETNG/731-828--------------------------------------------------------------------------------
H3DA42_TETNG/714-803--------------------------------------------------------------------------------
H3DA56_TETNG/728-816--------------------------------------------------------------------------------
H3DDC7_TETNG/573-663--------------------------------------------------------------------------------
H3DHK0_TETNG/619-707--------------------------------------------------------------------------------
H3DL28_TETNG/714-814--------------------------------------------------------------------------------
CO5_HUMAN/772-859--------------------------------------------------------------------------------
Q5LHC2_BACFN/1165-1253--------------------------------------------------------------------------------
Q5ZUX7_LEGPH/1263-1351--------------------------------------------------------------------------------
Q7PMK4_ANOGA/645-736--------------------------------------------------------------------------------
Y4489_PSEAE/857-944--------------------------------------------------------------------------------
Q9VLY7_DROME/697-787--------------------------------------------------------------------------------
R4GGS2_CHICK/726-814--------------------------------------------------------------------------------
R5UFN1_9BACE/1152-1240--------------------------------------------------------------------------------
R6X5P5_9PORP/1138-1223--------------------------------------------------------------------------------
R7EM63_9BACE/1203-1287--------------------------------------------------------------------------------

PF02960

K1_HHV8P/160-279--------------------------------------------------------------------------------

PF03921

ICAM3_HUMAN/30-119--------------------------------------------------------------------------------
ICAM2_HUMAN/24-114--------------------------------------------------------------------------------
ICAM2_MOUSE/22-114--------------------------------------------------------------------------------
ICAM1_HUMAN/24-115--------------------------------------------------------------------------------
ICAM1_MOUSE/24-114--------------------------------------------------------------------------------

PF02480

GE_PSHV1/44-516AASSALVGDAGELEQLRRRVSAGMGLTDDGDISFAAADKVNEGLYGVRVMGSGDSYTFFNVTVATETAGDDR........
GE_HHV2H/57-501AGDEGLYS....ELAWRDRVAVVN.....ESLVIYGALETDSGLYTLSVVGLSDEARQVASVVLVVEPAPVPTPTPDDYD
GE_HHV11/59-506SATGGLRT....DFVWQERAAVVN.....RSLVIHGVRETDSGLYTLSVGDIKDPARQVASVVLVVQPAPVPTPPPTPAD
GE_VZVD/193-615KKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKT.........
GE_GAHVM/41-479IKQIESLSLNGVPNIFLSTKASNK.......LEILNASLQNAGIYIRYSRNGTRTAKLDVVVVGVLGQARD.........

PF01537

K4P3S4_9ALPH/66-190--------------------------------------------------------------------------------
Q86788_FHV1/60-176--------------------------------------------------------------------------------
Q67644_ILTV/108-239--------------------------------------------------------------------------------
GD_SUHVR/56-181--------------------------------------------------------------------------------
GD_EHV1D/129-252--------------------------------------------------------------------------------
Q89634_FHV1/69-193--------------------------------------------------------------------------------
O41524_9ALPH/49-174--------------------------------------------------------------------------------
GD_HHV1P/82-206--------------------------------------------------------------------------------
GD_CHV1/81-206--------------------------------------------------------------------------------
Q67648_9ALPH/79-203--------------------------------------------------------------------------------
Q77L58_MEHV1/64-188--------------------------------------------------------------------------------
O90421_9ALPH/53-169--------------------------------------------------------------------------------
Q5FBC8_9ALPH/54-170--------------------------------------------------------------------------------
O39306_EHV4/54-170--------------------------------------------------------------------------------
Q91E41_9ALPH/52-168--------------------------------------------------------------------------------
O41523_9ALPH/53-168--------------------------------------------------------------------------------
O39504_9ALPH/64-183--------------------------------------------------------------------------------
Q6X201_9ALPH/66-185--------------------------------------------------------------------------------
Q87093_CHV1/74-190--------------------------------------------------------------------------------
Q69367_9ALPH/73-189--------------------------------------------------------------------------------
A7U885_HHV2/81-195--------------------------------------------------------------------------------
Q9QPU9_9ALPH/70-184--------------------------------------------------------------------------------

PF05326

Q99N75_MOUSE/3-124-------------------------------------------SL-----------QMFYQPGALMHL--------LI-L
Q9D2X6_MOUSE/3-124-------------------------------------------SL-----------QILSQPQAVTHF--------LI-L
Q76I99_MOUSE/3-123-------------------------------------------SL-----------QILQQTGGVM.L--------LI-L
PIP_RAT/1-126-------------------------------------------MQ-----------GLSFTSTAATFF--------LV-L
PIP_RABIT/3-126-------------------------------------------AL-----------QFLLRVSPAFLL--------LV-L
PIP_CAVPO/3-126-------------------------------------------TF-----------QFLFRASPATLL--------LT-L
PIP_BOVIN/3-127-------------------------------------------SL-----------HLLLRASPAALL--------LI-L
E9PX96_MOUSE/10-142-------------------------------------------SL-----------QKFYQPGAVIYL--------LI-V
G1QRT8_NOMLE/4-126-------------------------------------------.L-----------QLLFRASPATLL--------LV-L
G7P1H3_MACFA/4-126-------------------------------------------.L-----------QFLFRASPATLL--------LV-L
PIP_MOUSE/2-126-------------------------------------------.Q-----------GLSFTFSAVTLF--------LV-L

PF15028

PTCRA_RAT/20-147----------------------------------------GIAGT-----------PFPSLAPPVTLLVDG-RRHTLV-V
G1QXF2_NOMLE/20-146----------------------------------------GVGGT-----------LFPSLAPPIMLLVDG-KQQMVV-V
PTCRA_BOVIN/31-157----------------------------------------GMGST-----------PFPSLAPPITLLVDG-KQQTLV-V
G3WD30_SARHA/20-146----------------------------------------GMCTA-----------PFPSMAPPLTQVVDG-QQKTLV-I
M3YPD2_MUSPF/40-162----------------------------------------GVGGT-----------PFPSLAPPITLLVDG-KQQTLV-V
H0VKD6_CAVPO/20-147----------------------------------------GAVTA-----------AFPSLAPPVTLLVAG-QRRTLV-V
G1U7X8_RABIT/20-147----------------------------------------GVGHT-----------PFPSLAPPITLLVDG-RRQTLV-V

PF09085

W5PFN9_SHEEP/105-212-------------------------------------------.F-----------PDQLSVSPEAVVPGR-DQ--EV-A
H0WQ95_OTOGA/112-222-------------------------------------------AF-----------PDQLTVSPATLVPGV-DQ--EV-A
G5E838_MOUSE/110-220-------------------------------------------AF-----------PDQLVVSPEFLVPGQ-DQ--VV-S
G1PL68_MYOLU/112-219-------------------------------------------AF-----------PNQLTVSPVDLVAGR-DQ--EL-A
I3LSA9_PIG/49-158-------------------------------------------AF-----------PDQLTVSPESLVPGR-DR--EV-A
M3W8G7_FELCA/115-224-------------------------------------------AF-----------PAQLTVSPVALVAKQ-DR--EV-A
MADCA_HUMAN/113-224-------------------------------------------AF-----------PDQLTVSPAALVPG.-DP--EV-A
F7BUG9_MONDO/130-238-------------------------------------------AF-----------PDKLEVSPSTLVLGQ-AA--TL-V
I3N840_SPETR/111-217-------------------------------------------AF-----------PDQLAVSPATLVPGR-NQ--EV-A
L8Y2P3_TUPCH/565-674-------------------------------------------AF-----------PDQLTVSPVVLVPEQ-EQ--EV-T
G3HF34_CRIGR/110-220-------------------------------------------AF-----------PDQLVVSPKFLVPGE-DQ--EV-S

PF11465

CD244_HUMAN/22-127----------------------------------------CQGSA-----------DHVVSISGVPLQ------------
CD244_RAT/22-128----------------------------------------CADSS-----------EEVLGVSGKPVR------------
CD244_MOUSE/22-129----------------------------------------CPDSS-----------EEVVGVSGKPVQ------------

PF01688

GI_HHV2H/8-165----------------------------------------GLAILGLWVCAT....GLVVRGPTVSLVSDS-LVDAGA-V
GI_GAHVM/2-157----------------------------------------YLLQLLFWIRLFRGIWSIVYTGTSVTLSTDQ-SALVAF-C
GI_PSHV1/10-157----------------------------------------...AVAIFLALVTCCLGTVIKGLGVSGVFED-TLVVF.-.
GI_VZVD/7-164----------------------------------------LISAVIFYIQVTN...ALIFKGDHVSLQVNS-SLTSIL-I
GI_HHV11/8-165----------------------------------------GLVLVGLWVCAT....SLVVRGPTVSLVSNS-FVDAGA-L

PF10430

F8W3C8_DANRE/7-103-----------SDVTLVNPD----------PVV----------------------------------SPLT-APS--L-L
W5M5U9_LEPOC/23-114-----------VDFTLINPN----------PLG----------------------------------TNSD-S.S--L-V
W5KIA3_ASTMX/20-110-----------SDLTLINPD----------PVV----------------------------------SSGD-A.S--L-Y
Q80YS4_MOUSE/24-118-----------MDLILINSL----------PLV----------------------------------SDAE-T.S--L-T
G1KU09_ANOCA/38-132-----------FDLILINSL----------PTE----------------------------------VDSE-T.S--L-I
F7EC20_XENTR/25-118-----------.DLIIVNSL----------PLF----------------------------------SNRE-T.S--L-T
H0YT27_TAEGU/25-119-----------LDLILINSF----------PLV----------------------------------GNSE-T.S--L-I

PF08204

O57240_9POXV/2-124SRVRISLIYLYTLVVITTTK----------TIE-------------------------------.YTACND-TII--I-P
CD47_BOVIN/8-140LLLGSVRCGS.AQLIFNAIK----------SVE-------------------------------.YTLCNQ-TVV--I-P
Q9DHI5_YLDV/7-104MYMYNYIIICLFKLSLSTYI----------KVN-------------------------------.YTTCNS-SIY--I-V
CD47_HUMAN/8-142LLLGSACCGS.AQLLFNKTK----------SVE-------------------------------.FTFCND-TVV--I-P
Q8JTQ3_LSDV/14-122LFLTIYINSS.FSIPENKVS----------SIN-------------------------------.YSKCNK-TII--I-D
Q5ZL65_CHICK/8-141ALLAVLGAGS.TQLVFNAVD----------FVE-------------------------------.KYACND-TVV--L-P
Q9Q8V0_RFVKA/10-120AHVGLLLVVF.VHLTVGNKV----------TVM-------------------------------PYTVCNT-TIT--L-E
Q9D9W5_MOUSE/8-139LLLGSFHCGL.AQLTFKNIN----------SVK-------------------------------.ASNCSR-IVL--I-P
Q8V3H1_SWPV1/6-113LLLLCYYPVLSKFIFFTNE.----------...-------------------------------.FTICND-TVS--V-H
Q6TUP1_YMTV5/1-98MHTYNYIIFFLFKLISCSYI----------RVN-------------------------------.YTTCNS-VVN--V-V
A8VKH9_PIG/8-140VLLGSAYCGS.AQLIFNITK----------SVE-------------------------------.FTVCNT-TVT--I-P
B2CWN5_9POXV/1-111M.IGLLFFVYVVPLAAENEV----------TVT-------------------------------PYTVCNK-TVT--L-E

PF16680

W5KJS3_ASTMX/45-112---------------------------------------------------------------------..-DVI--L-T
H9GCG3_ANOCA/63-138---------------------------------------------------------------------GR-NVT--L-Q
K7GSE2_PIG/39-114---------------------------------------------------------------------DG-SVL--L-T
CD3D_RAT/30-103---------------------------------------------------------------------ED-KVF--V-N
H2NFG8_PONAB/39-114---------------------------------------------------------------------DG-SVL--L-T
CD3E_PIG/42-118---------------------------------------------------------------------GD-KVE--L-T
G5BHL4_HETGA/19-92---------------------------------------------------------------------ED-KVF--V-D
G3WJY6_SARHA/44-120---------------------------------------------------------------------DG-SAL--L-T
F7F8D9_MONDO/35-112---------------------------------------------------------------------DG-TVL--L-T
I3MMT1_SPETR/36-114---------------------------------------------------------------------GT-DVI--L-S
F6X8V5_ORNAN/39-109---------------------------------------------------------------------DG-TVT--L-A
L5KJW9_PTEAL/39-116---------------------------------------------------------------------DG-SVL--L-I
F7CUQ0_HORSE/39-110---------------------------------------------------------------------DG-SVL--L-I
E2RHB8_CANFA/39-114---------------------------------------------------------------------DG-SVL--L-I
M3WFR1_FELCA/39-114---------------------------------------------------------------------DG-SVL--L-T
CD3E_MOUSE/35-110---------------------------------------------------------------------GT-SVE--L-T
U3ISR2_ANAPL/34-103---------------------------------------------------------------------NE-KVY--L-I
F7F8B6_MONDO/49-121---------------------------------------------------------------------ED-KIF--L-K
G1M3D4_AILME/39-114---------------------------------------------------------------------DG-SVL--L-T
J9NXV0_CANFA/30-103---------------------------------------------------------------------ED-RVF--L-S
CD3G_SHEEP/9-84---------------------------------------------------------------------DG-SVI--L-I
D4A5M2_RAT/30-105---------------------------------------------------------------------GT-SVE--L-T
G5BHL3_HETGA/37-113---------------------------------------------------------------------GT-RVV--V-T
L5M0Z4_MYODS/24-101---------------------------------------------------------------------GT-RVE--V-T
W5MH99_LEPOC/35-109---------------------------------------------------------------------.T-SVT--L-S
F7CSX8_HORSE/46-120---------------------------------------------------------------------GT-TVK--L-T
H0VN41_CAVPO/30-103---------------------------------------------------------------------ED-RVS--V-S
G3U502_LOXAF/18-89---------------------------------------------------------------------KD-KVI--L-H
M3XJR7_LATCH/43-115---------------------------------------------------------------------GT-TVT--L-T
G3IMA2_CRIGR/9-82---------------------------------------------------------------------ED-QVF--V-S
F7FPX1_CALJA/30-103---------------------------------------------------------------------ED-RVF--V-S
F1N9E2_CHICK/34-109---------------------------------------------------------------------SG-KVF--L-Q
H3BFR3_LATCH/32-111---------------------------------------------------------------------GE-QVV--L-A
H0UW68_CAVPO/43-116---------------------------------------------------------------------.S-TVT--V-T
W5PGT3_SHEEP/36-112---------------------------------------------------------------------GN-SVE--L-T
I3MVU8_SPETR/39-109---------------------------------------------------------------------ED-KVL--L-Q
CD3E_BOVIN/36-113---------------------------------------------------------------------GN-TVE--L-T
G1SDA6_RABIT/30-103---------------------------------------------------------------------ED-SVF--L-S
M3XZE1_MUSPF/30-101---------------------------------------------------------------------ED-MVF--L-R
M3WFR0_FELCA/39-111---------------------------------------------------------------------ED-KVL--L-S
CD3E_FELCA/47-124---------------------------------------------------------------------GT-TVV--L-T
G3T784_LOXAF/30-104---------------------------------------------------------------------ED-KVI--L-N
CD3D_MOUSE/30-103---------------------------------------------------------------------ED-KVF--V-T
G3T782_LOXAF/35-111---------------------------------------------------------------------GT-RVV--L-T
F1M9F8_RAT/39-114---------------------------------------------------------------------DG-SVL--L-T
Q3LRP4_CALJA/42-120---------------------------------------------------------------------GT-TVT--L-T
L5M0W2_MYODS/39-112---------------------------------------------------------------------DG-SVL--L-T
B4F6W6_XENTR/31-102---------------------------------------------------------------------.N-YLT--L-K
W5PHC2_SHEEP/30-99---------------------------------------------------------------------ED-KVI--L-K
CD3D_BOVIN/30-100---------------------------------------------------------------------ED-KVM--L-E
I6LI21_MUSPF/32-108---------------------------------------------------------------------GT-MVV--L-T
H0W6D3_CAVPO/39-114---------------------------------------------------------------------DG-SVL--L-I
F7D784_MONDO/39-114---------------------------------------------------------------------GT-QVT--L-T
G7NCB9_MACMU/42-120---------------------------------------------------------------------GT-TVI--L-T
G1STZ2_RABIT/39-114---------------------------------------------------------------------DG-SVL--L-T
G8JL01_BOVIN/15-90---------------------------------------------------------------------DG-SVI--L-I
K7GLV9_PIG/30-103---------------------------------------------------------------------ED-KVF--V-S
F6WI60_MACMU/30-103---------------------------------------------------------------------ED-RVF--V-K
L5M0S8_MYODS/30-101---------------------------------------------------------------------ED-KVV--L-N
G1MXZ8_MELGA/33-102---------------------------------------------------------------------NG-KAF--L-Q
H0YPP3_TAEGU/33-105---------------------------------------------------------------------SG-KVF--L-E
H0X808_OTOGA/42-120---------------------------------------------------------------------GT-TVT--V-K
M3ZL37_XIPMA/31-110---------------------------------------------------------------------.K-EVT--L-T
G3WK56_SARHA/41-113---------------------------------------------------------------------ED-KVF--L-T
G3T785_LOXAF/39-113---------------------------------------------------------------------DG-SVL--L-T
G3WKI7_SARHA/39-113---------------------------------------------------------------------GT-EVT--L-T
CD3G_MOUSE/39-114---------------------------------------------------------------------DG-SVL--L-T
G1SRV6_RABIT/14-92---------------------------------------------------------------------GN-HVV--L-T
G1M3E8_AILME/39-111---------------------------------------------------------------------ED-KVF--L-H
G1R705_NOMLE/42-120---------------------------------------------------------------------GT-TVI--V-T
CD3E_CANFA/47-124---------------------------------------------------------------------GT-EVV--V-T
H0X0C4_OTOGA/30-103---------------------------------------------------------------------ED-KVL--L-N
F6QRU0_XENTR/52-121---------------------------------------------------------------------GR-TVK--I-M
L5KKM4_PTEAL/24-101---------------------------------------------------------------------GT-KVM--L-T
L9KSF6_TUPCH/19-94---------------------------------------------------------------------DG-SVL--L-T
M3XZF4_MUSPF/39-112---------------------------------------------------------------------DG-SVL--L-I
I3MMT3_SPETR/39-114---------------------------------------------------------------------DG-SVL--L-T
F7CIT2_HORSE/30-97---------------------------------------------------------------------EE-RLI--L-K
G1M3G6_AILME/47-123---------------------------------------------------------------------GT-RVV--L-T

PF00047

OX2G_RAT/34-136------------------VV----------TQD-------------------------------ERKLLHT-TAS--L-R
CEAM1_HUMAN/331-411------------------KA----------SKT-------------------------------TVTGDKD-SVN--L-T
IGHM_CHICK/220-311------------------IT----------PSF-------------------------------VDIFISK-SAT--L-T
IL6RA_MOUSE/30-107------------------VA----------NGT-------------------------------VTSLPGA-TVT--L-I
KI2S5_HUMAN/132-213------------------PA----------QPG-------------------------------PTVLAGE-SVT--L-S
NRG_DROME/525-609------------------QE----------PQN-------------------------------YEVAAGQ-SAT--F-R
TIE1_MOUSE/127-208------------------PD----------KVT-------------------------------HTVNKGD-TAV--L-S
KI2S5_HUMAN/32-115------------------LA----------HPG-------------------------------PLVKSEE-TVI--L-Q
IGHE_MOUSE/209-300------------------IP----------PSP-------------------------------LDLYQNG-APK--L-T
CSF1R_FELCA/207-293------------------LE----------PAE-------------------------------LVRIQGE-AAQ--I-V
TIE1_MOUSE/353-439------------------SM----------ATE-------------------------------VEFNIGT-MPR--I-N
NTRK3_HUMAN/214-299------------------VS----------HVN-------------------------------LTVREGD-NAV--I-T
MUCM_RABIT/11-105------------------LV----------SCE-------------------------------GALTDGN-LVA--M-G
KIT_HUMAN/216-305------------------VS----------KAS-------------------------------YLLREGE-EFT--V-T
FLT3_MOUSE/256-346------------------ST----------LPQ-------------------------------LFLKVGE-PLW--I-R
SEM3E_MOUSE/585-669------------------TE----------ERL-------------------------------AYGIESN-STL--L-E
FCGR1_MOUSE/204-284------------------RA----------SVS-------------------------------SPFPEGS-LVT--L-N
FGFR1_CHICK/37-115------------------IE----------VES-------------------------------HSAHPGD-LLQ--L-R
PGFRB_HUMAN/37-115------------------PP----------GPE-------------------------------LVLNVSS-TFV--L-T
PTPRM_HUMAN/189-275------------------LR----------IQN-------------------------------VEVNAGQ-FAT--F-Q
CD4_MOUSE/25-127------------------QG----------KTL-------------------------------VLGKEGE-SAE--L-P
OPCM_RAT/227-311------------------SK----------AKN-------------------------------TGVSVGQ-KGI--L-S
IGHD_HUMAN/173-264------------------LT----------PAV-------------------------------QDLWLRD-KAT--F-T
V055_FOWPN/31-121------------------KA----------PPY-------------------------------VLVPEGS-DIN--L-T
DIG1_CAEEL/310-389------------------EP----------QGP-------------------------------YEVAPGG-NIN--I-S
CD33_HUMAN/146-227------------------KI----------LIP-------------------------------GTLEPGH-SKN--L-T
NRG_DROME/251-332------------------VS----------RRQ-------------------------------SLALRGK-RME--L-F
DIG1_CAEEL/1822-1903------------------EG----------STT-------------------------------IQILPGS-QMT--I-A
IL1R2_HUMAN/241-341------------------SP----------LKT-------------------------------ISASLGS-RLT--I-P
VCAM1_HUMAN/229-306------------------SV----------NPS-------------------------------TKLQEGG-SVT--M-T
OX2G_MOUSE/143-229------------------PI----------VHL-------------------------------HYNYFED-HLN--I-T
KI3L1_HUMAN/32-110------------------SA----------WPS-------------------------------AVVPRGG-HVT--L-R
THY1_HUMAN/21-119------------------KV----------TSL-------------------------------TACLVDQ-SLR--L-D
IL1BP_VACCW/228-322------------------..----------.DG-------------------------------IVTSIGS-NLT--I-A

PF16758

UL14_HCMVM/48-234-------------------P----------GSP-------------------------------QLLPYGD-RLE--V-A
UL141_HCMVM/51-241-------------------S----------PAP-------------------------------VLVAEGE-QVT--I-P

PF13927

B4JUY8_DROGR/56-147------------------AP----------QVL.........RLHPSMH.......T-------VSVKRGEPASLTMV-V
Q9E8G3_9ADEN/418-485------------------YP----------DIS..........NSSLRI.......V-------SAIYNGS.LCNVYV-K
Q14VV5_RAHV1/122-191------------------IY----------NLT..........LYGEQL........-------.....GE.EMRLEV-L
Q05KR2_RAT/225-316------------------RP----------VIM..........SPRNET........-------MEADPGS.TIQ..L-I
D2GWX3_AILME/205-296------------------RP----------VIV..........SPANET........-------MEAGLGS.KLQ..L-I
Q9TV71_HORSE/225-316------------------KP----------LIV..........SPVNET........-------MEVDLGS.QVQ..L-I
Q5R5D6_PONAB/81-172------------------RP----------VIV..........SPANET........-------MEVDLGS.QIQ..L-I
B3RNX0_TRIAD/137-219------------------DG----------IIN..........STRQDT........-------....SST.KVA..L-Q
Q4RP84_TETNG/334-402------------------GR----------RVA.........SCVSCIP........-------....EEK.PHV..V-S
Q7TPQ6_MOUSE/37-119------------------VS----------ELVTELRSA..............PG..-------....SED.LHS..L-L
Q64861_9ADEN/137-203------------------PP----------KCD..........ITSRYL........-------GIQATGEDYCLIEI-N
Q16X13_AEDAE/196-289------------------NS----------QII..........AKSDTV...VAT..-------....LGT.ALV..V-E
B7Z4Y8_HUMAN/87-162------------------DP----------HLS..........LEGFKE........-------....GGI.QLR..L-R
A9Y0V1_9CICH/291-381------------------KP----------YIR.........LSPQLSPKLAHKGLS-------VEVNEGD.DLE..L-S
B4F6P7_XENTR/145-216------------------KP----------EVV...................ELP..-------....LEH.TER..L-P
A4JYH8_DANRE/212-293------------------PP----------YVY..........LKRNEY........-------.VKLVGE.RLQ..I-S
Q8AXU0_ONCMY/214-296------------------PP----------YVF..........LEKDEY........-------.VHIVGE.KLS..I-H
A9Y0V0_9CICH/193-275------------------PP----------YVF..........LETEEY........-------.VRIVGE.ELK..I-P
Q4RZA3_TETNG/179-261------------------PP----------YVF..........LEMDEY........-------.VRIVGE.ELK..I-R
B0WE60_CULQU/104-184------------------VP----------ICA..........TDKIVS........-------LGVSIDE.TVA..I-S
Q675X8_OIKDI/328-400------------------IP----------PKN.........ENIKIGEKNRLFSEM-------NAIAKGE.SVK..V-T
A7RZM7_NEMVE/164-243------------------LQ----------ILK..........STSSNV........-------VSSWHNN.KVQ..L-L
C3PU48_HELVI/65-147------------------IP----------KVE.........TKEHTPT........-------....EGK.PYK..L-E
Q9E8F9_9ADEN/415-478------------------ES----------SLN..........VESVSI........-------....NGS.ICQISL-H
VS10L_MOUSE/484-552------------------AP----------QCS..........VEGGPV........-------........DRSLRF-R
Q17P33_AEDAE/147-237------------------YP----------LPT..........FKPKDM...IIN..-------....LGE.TAR..F-Y
Q5M7A8_XENLA/139-209------------------NP----------DTK..........VEMEQK........-------....TTD.WCNFTL-H
B5JJ62_9BACT/373-440------------------PP----------TIT.............SQS........-------....SDS.YFW..L-N
A8KB70_DANRE/141-217------------------AP----------VLM.....RNSSQCSSSSS........-------....SSVQYCS..V-L
A8E4T3_DANRE/125-204------------------AP----------DII........RTCPQNSS......SS-------VSEHLEVSRCE..L-L
Q6PUA9_AMBME/211-289------------------IP----------TIF..........LFQKQS........-------TYLKQGE.KFE..I-C
Q6P6Y9_XENLA/207-286------------------VP----------TVF..........LSKSRQ........-------.LVKTGE.PFE..V-T
B4F6V0_XENTR/207-287------------------EP----------TIF..........LTKSRQ........-------.LVKTGE.PFE..V-T
A7LKP4_HORSE/132-214------------------RP----------RVT..........LDKKET........-------...IEGG.TVT..V-N
Q5GAK1_9VIRU/122-188------------------VT----------RVT........................-------....ITK.KCNV.L-T
Q5CZQ8_DANRE/218-294------------------EP----------VSY........................-------.....GD.TVKINL-H
Q16ZU2_AEDAE/151-229------------------IP----------QIM..........MYPQSY........-------..VAEQG.SVV..I-I
B3MMJ5_DROAN/141-228------------------PP----------KIS.........GGRPRYQ........-------....IGD.YVR..I-N
Q25177_HYDVU/232-308------------------KP----------IIS..........LSYSGK........-------..PQKGR.SIK..I-Q
VS10L_MOUSE/388-462------------------AP----------VIR..........VSSDRD....ASPA-------LYVTAGS.NVT..L-H
B5JL51_9BACT/220-289------------------TP----------ARF..........VERSAD........-------..FVGEP.GMG..L-D
B9XJC2_PEDPL/341-410------------------SP----------PVI.........YQQPVSQ...SFA..-------....PDY.PVA..L-R
B4A6E2_SALNE/162-234------------------AP----------ALA..........FTTDLT......AT-------KSVTTGS.ALT..L-N
B9XRA3_PEDPL/769-839------------------AP----------VIV..........QQPTPA.......N-------LYVFSGA.SNTWTM-S
B9XFJ5_PEDPL/981-1051------------------SP----------VIV..........QQPGPT.......N-------STLFTGG.KISFSL-G
Q11WJ8_CYTH3/1793-1868------------------TA----------ITI.........TTQPENQ...TVV..-------....TGG.VIT..L-S
B9XK99_PEDPL/434-502------------------AP----------IIL..........SQTGSG........-------.NVCEGS.N....M-I
B9XNF4_PEDPL/912-982------------------TP----------VSF.........TQQPASI...SVP..-------....ENY.AAS..F-T
B9XJC2_PEDPL/171-239------------------PP----------TIV..........ANITNR........-------.SVVAGA.NVT..F-Q
B9XIT4_PEDPL/501-570------------------LP----------SLVTVQPGNL.......TT........-------....NGGSQVT..F-T
B9XNF4_PEDPL/1266-1335------------------TP----------PII....N..QQPVSQTVY........-------....LHQ.RAT..F-S
Q8QFN4_SALSA/217-311------------------KP----------QVT..........YPRKET........-------VTVEPGS.RVE..L-V
MILR1_HUMAN/127-200------------------SP----------VLN..........IMVIQT........-------...ETDR.HIT..L-H
I0AZP8_9POXV/264-344------------------DP----------KIN........................-------..VTIGE.PAN..I-T
B1NA53_XENLA/215-283------------------KP----------TVD..........VEIPKA........-------....EVT.SVR..I-N
A7SRI5_NEMVE/60-138------------------AP----------ELI..........QSESTT....QVTW-------SNYADRD.PIE..L-N
Q58EM0_DANRE/46-124------------------AP----------IRM..........ISINSS........-------....ESG.LVQ...-.
B4F6P7_XENTR/242-336------------------PP----------SMT..........TPNAKT.......L-------YEFAAGE.EML..L-S
Q5FW36_XENTR/237-331------------------YP----------VIQ..........YPNHKP........-------IAAAIGS.KLL..I-P
IL1R2_MOUSE/248-342------------------IP----------VII..........SPLETI........-------.PASLGS.RLI..V-P
Q9N2H5_HORSE/236-330------------------VP----------VIV..........SPRQTI........-------.LASLGS.RLI..I-P
B5KH15_TETNG/127-187------------------EP----------SLV........................-------...LSGQ.TVT..L-V
Q5BKG7_XENTR/123-200------------------QP----------TVQ..........VFASNA........-------..EEEGK.NCTVFL-S
Q8AXT5_SALSA/239-334------------------PP----------QIN..........LPRNGS...TET..-------....TDL.YTTKKL-R
Q4VWU3_XENLA/180-252------------------KP----------HIQ..........VSSNET........-------...RVGA.NVT..V-R
A7TDK3_NEMVE/95-165------------------NP----------PIN............KTIN........-------....EEG.DVS..F-T
A4JYL8_DANRE/119-181------------------DP----------RVT..........CAVNKT........-------.....SN.LQE..L-L
Q4S0F0_TETNG/121-184------------------KP----------TIT..........CETNTS........-------....DSS.SVSGLL-T
A6NJE8_HUMAN/286-359------------------HP----------VLT..........LSPEKA........-------.LNFEGT.KVT..L-H
GP42_RAT/114-188------------------QP----------VLT..........LQHEAT...NLA..-------....EGD.KVK..F-L
FCRL6_HUMAN/206-280------------------RP----------VLT..........LHHGPA........-------.DPAVGD.MVQ..L-L
FCRL1_MOUSE/116-189------------------RP----------VLT..........FGDSGT........-------.QAVLGD.LVE..L-H
D2I2T6_AILME/288-361------------------RP----------ILT..........LREPGA........-------.QVFPGD.MVE..L-C
A7SAT9_NEMVE/170-237------------------AP----------TNT..........SFTTSD........-------..IVSGR.TLQ..M-K
Q98173_MCV1/178-253------------------EP----------ELT..........VTALSH........-------....ASD.SCMLRL-V
C3KJI3_ANOFI/124-193------------------KP----------VVE........LRTKPCRD........-------....TSG.SCK..V-S
ILRL1_HUMAN/211-307------------------FP----------VIG..........APAQNE.......I-------KEVEIGK.NAN..L-T
ILRL1_RAT/216-311------------------FP----------VIT..........NPPHNY.......T-------VEVEIGK.TAN..I-A
B5XCQ4_SALSA/120-188------------------KP----------TIT...........SSCNA........-------....NKT.ICT..L-T
B5XDA6_SALSA/115-177------------------KP----------RLT...................HTC..-------....TDA.SVS..L-R
Q4SQP9_TETNG/121-187------------------RP----------VIQ..........VSALRS........-------..NLSAE.PCTITV-N
Q676C3_OIKDI/705-769------------------AP----------EIT..........IDGVTE........-------..LKKGD.KLT..L-E
IRPL2_HUMAN/241-335------------------KP----------LFP..........MENQPS.......V-------IDVQLGK.PLN..I-P
B0R0J8_DANRE/123-187------------------KP----------VIN........ETILPSVV...PVF..-------....RGY.PVN..L-S
Q3SZI9_BOVIN/149-216------------------NL----------QVA..........HHTTWS........-------....ENN.TCEIQL-M
B4E1U5_HUMAN/83-150------------------NI----------QVT..........NHSQLF........-------....QNM.TCELHL-T
B5XGJ4_SALSA/128-200------------------KP----------SVR..........KVFSML........-------....KDS.HCVMAL-Q
Q18PG4_MOUSE/127-196------------------RP----------KVT..........IDRQSN........-------....KNG.TCVINL-T
Q6NZB6_MOUSE/352-421------------------KP----------SVT..........KSPVHM........-------....MNG.ICEVVL-T
D2I0U5_AILME/321-390------------------KP----------KIT..........WHPGLA........-------....EDG.ICRFSL-T
LY9_HUMAN/362-431------------------KP----------KIT..........WSLRHS........-------....EDG.ICRISL-T
SLAF5_HUMAN/134-197------------------KP----------KIT..........QSLMAS........-------....VNS.TCNVTL-T
Q6NZB6_MOUSE/147-217------------------KP----------QII..........VESVTP...SDT..-------....DSC.TFT..L-I
D2I0U5_AILME/119-189------------------EP----------QVI..........MKSVNM........-------.SDNGSC.NIT..L-I
LY9_HUMAN/156-226------------------EP----------QVT..........MKSVKV........-------....SENFSCNITL-M
Q0ZHH3_SALSA/290-382------------------PP----------SLS..........IFPSPLPLSV....-------....PGQ.VVK..V-Q
B0WG40_CULQU/57-138------------------NS----------MIN..........TTVNVH........-------......D.SVV..F-F
Q4TGC2_TETNG/85-158------------------SP----------KIL..........KNSGCK........-------....IQS.DI...L-T
A4JYH8_DANRE/415-499------------------KP----------VAR........................-------..VKWEN.VTT..L-S
A9Y0V0_9CICH/397-485------------------RP----------IAV........................-------..VKWEN.VTT..L-T
CSF11_TAKRU/411-499------------------KP----------IAV........................-------..VRWEN.ITT..L-T
Q8AXU0_ONCMY/416-504------------------RP----------VAV........................-------..VRWEN.ITT..L-T
Q4T5K0_TETNG/309-397------------------KP----------VIV..........AQEGPV........-------....DGQ......V-R
Q9MYN0_BOVIN/160-243------------------KP----------EIL..........THDRLV........-------....NGM......L-Q
Q6PUA9_AMBME/408-495------------------KP----------EIL..........SSERLD........-------....NGM......L-Q
B4F6V0_XENTR/405-489------------------RP----------EIL..........IADRTS........-------....EGT......L-Q
Q9DEE1_CHICK/207-302------------------PV----------QIL..........FPKDED.......V-------LEVELGA.AFS..L-K
Q90874_CHICK/229-319------------------RP----------EFI..........YPNNNT........-------IEVELGS.HVV..M-E
B3VBV3_RABIT/213-301------------------IP----------ALL..........GPKLNH........-------VEVELGK.DVQ..L-N
D3ZRM2_RAT/211-299------------------TP----------AIF..........GSKSAK........-------VGVELGE.DVE..L-N
Q86FD7_SCHJA/138-225------------------PP----------VIR..........SRFGAV........-------.RGHEGS.PLS..V-L
A7S2Y7_NEMVE/135-214------------------KP----------YIK..........FKTPPL........-------....ITI.PIQ..S-P
A7RKF7_NEMVE/125-206------------------RP----------HQT..........STNIII........-------...PYGG.STT..L-R
B7PBK2_IXOSC/49-137------------------SP----------TLC..........ASPGSL........-------.FISSGS.SIN..V-S
A9JTC6_DANRE/131-215------------------AP----------VTS..........TWPETL........-------....INGGPAD..L-Y
Q7YS40_PIG/127-195------------------EP----------ELY..........CESTEG........-------........NIS..V-R
Q28753_9CETA/127-199------------------TP----------SAS..........CFLT..........-------....EGG.NIT..L-T
A7YW37_BOVIN/141-211------------------SP----------STF..........CSLS..........-------....DDG.NIT..L-T
D0UGD1_SALSA/144-215------------------KE----------SLR........................-------....VGE.TLDLKL-H
D0UGC3_SALSA/143-215------------------KL----------SMG........................-------....MGE.DLDLKL-H
Q4RU18_TETNG/215-283------------------RL----------RLV..........IQPRPQ........-------.RLSVGE.NLQ..L-E
B5KH12_DANRE/121-187------------------IP----------KVP...................ALL..-------....VGG.RLF..L-K
C7FF20_CTEID/121-187------------------VP----------KVS........................-------.AVIFGD.SLS..L-E
A8CZ68_CYPCA/100-170------------------IP----------KVP...................AVM..-------....AGD.SLS..L-E
A9CQ46_CARAU/114-180------------------IP----------QVP........................-------.ALIAGD.SLS..L-E
B7P1H7_IXOSC/58-137------------------KP----------KVT........TLLQWTSH........-------....LNG.SISAKL-V
Q4RGD6_TETNG/356-418------------------SP----------SAE........................-------..VTEGQ.SVR..L-T
Q4SGL7_TETNG/81-143------------------LP----------SSL............GETK........-------....EGD.SLH..L-T
Q5EG07_ICTPU/362-434------------------PV----------SLI..........INPSRT........-------.QHFTSD.SLS..L-S
B4L0P5_DROMO/97-184------------------QP----------KII..........ESTVES........-------..IKRKI.KQSAII-Y
ICAM3_PANTR/399-466------------------GP----------KID..........RATCPQ........-------.HLKWKD.KTTHVL-Q
D2HGY8_AILME/379-446------------------GP----------KID..........QAKCPQ........-------.RLMWKD.KTIHVL-Q
ICAM3_BOVIN/400-467------------------GP----------TID..........RAKCPQ........-------.RLMWKE.KTMHIL-Q
ICAM1_BOVIN/393-460------------------GP----------RLD.......QRDCPGNWT........-------..WQEGS.EQT..L-K
Q9ERF7_CRIGR/391-458------------------GP----------RLD.......ENDCPGNWT........-------..WPEGS.QQN..L-S
Q4VWT0_XENLA/203-275------------------DD----------IVQ..........ISALPS..TNVS..-------....AGG.NLT..I-Q
Q5ZKN0_CHICK/121-207------------------PP----------SIS..........LSFEGHMMTTINIS-------IHVGRGS.NVT..I-R
B7UTR6_CHICK/312-386------------------RP----------SLS..........LKPLGR........-------..VQLGT.NVT..L-W
D2HUU5_AILME/123-194------------------TP----------TLS..........IHPGPE........-------..VPSGK.NVT..F-Y
NCTR1_RAT/123-194------------------TP----------TLW..........VHPGPE........-------..VTLGE.NVT..F-S
Q8K4V6_MOUSE/523-602------------------TP----------SLS..........VKPNHT........-------..VHSGE.TVS..L-L
A5D7Q0_BOVIN/129-208------------------RP----------SLS..........VRPSPS........-------..VALGE.NVT..L-L
C9JMK7_HUMAN/314-393------------------IP----------ALS..........VQPGPK........-------..VASGE.NVT..L-L
A8MZH0_HUMAN/311-390------------------RP----------SLS..........VQPVPT........-------..VAPGK.NVT..L-L
Q1I0P7_MACMU/323-402------------------RP----------SLL..........VQPGPT........-------..VVSGE.NVT..L-L
LIRB3_HUMAN/324-400------------------TV----------SLS..........AQPGPT........-------..VASGE.NVT..L-L
Q67EV3_RAT/123-203------------------NP----------SLS..........VWPSSD........-------..VTSGV.SIA..F-K
D4AAQ4_RAT/141-221------------------KP----------SIS..........AIPSSL........-------..VTSGG.NVT..L-K
D3ZRL6_RAT/122-197------------------KP----------VLS..........TDQSLV........-------..LLPGE.NVS..F-K
B1MTX6_CALMO/123-198------------------KP----------SLS..........ADRGLV........-------..VRPGE.NIS..F-T
A8K3V4_HUMAN/252-343------------------KP----------EIP.........VIVENNS........-------....TDV.LVERRF-T
CD86_HUMAN/138-222------------------QP----------EIV..........PISNIT........-------....ENV.YIN..L-T
Q8K3J3_MERUN/138-220------------------EP----------EIE..........LAQNVT........-------....RNS.GIN..L-T
Q8CJE8_MESAU/137-221------------------EP----------EIE..........VQNITR........-------........ISGINL-T
A8WX99_CAEBR/133-228------------------ED----------GIN........................-------.....AT.AIP..I-T
OX2V_HHV6Z/146-225------------------KP----------IVV..........LYFRY.........-------....LNN.FLD..V-T
Q5YFN7_9VIRU/132-198------------------NP----------ILG............ARIA........-------....IGE.NST..L-A
Q4S7L7_TETNG/144-208------------------HV----------SVS........................-------....INISHSS..L-V
SLAF8_HUMAN/127-205------------------RP----------VVQ..........VFIAVE........-------RDAQPSK.TCQVFL-S
Q3U1C3_MOUSE/125-203------------------KP----------EVQ..........VFTAAA........-------.EETQPLNTCQVFL-S
Q95JN1_MACFA/53-120------------------KP----------ELH..........IPEILL........-------....AEK.PVA..L-N
A4GW16_CERAT/123-196------------------YR----------KIN..........THILKV........-------...PETD.EVE..L-T
A4Q8S8_SPAAU/133-219------------------AT----------SVD......MKKLSYPIRA........-------....MVG.ELNVPL-R
Q14VV3_RAHV1/126-194------------------TH----------DIG..........FIFLPE........-------....TPG.SCKGIL-T
Q4SPM6_TETNG/127-188------------------QP----------ALV........................-------.....GH.SLE..V-T
Q90777_CHICK/186-256------------------LP----------HFI..........QQPEKL........-------.NVTRNS.PFN..L-T
D2HPH1_AILME/172-242------------------LP----------HFI..........RQPESM........-------.NVTRNT.AFN..L-T
VS10L_MOUSE/288-369------------------LP----------QLS..........VQPRAP........-------.ETEEGAAELR..L-S
D2H9T8_AILME/435-506------------------KP----------SLS..........AWPSTM........-------..FKLGK.AIT..L-Q
D3ZW99_RAT/125-200------------------KP----------SFQ..........AHHRGT........-------..VTAGS.TVT..L-Q
TARM1_HUMAN/125-203------------------KP----------FLR..........TYQRGT........-------..VTAGG.RVT..L-Q
D2HYQ1_AILME/99-177------------------KP----------SLQ..........AHRRGE........-------..ATAGD.TVT..L-Q
Q2V8M5_ICTPU/214-288------------------TP----------TMT...................IVGGR-------GRVRSGN.KVE..F-R
Q0GKW7_ICTPU/273-340------------------KP----------VVS..........INPDEQ........-------..VYRGE.TVT..L-R
Q4VWU8_XENLA/212-284------------------KP----------VIK..........VNRNHM........-------....TEVDHMT..I-T
Q6DCH5_XENLA/194-269------------------KP----------VIS..........VNSGSP........-------NQINEED.SIL..I-K
B3RFN4_XENLA/196-268------------------LP----------QIK..........VSPDQV........-------...TEGD.HMT..I-T
Q7YQJ5_CANFA/191-264------------------AP----------VLK........ASLSSPIL........-------....EGH.VVN..L-S
FCRLA_HUMAN/171-244------------------AP----------ILR..........AVPSAE........-------..PQAGS.PMT..L-S
FCRLA_MOUSE/181-254------------------AP----------VLK..........ALPSSE........-------..PQEGG.SVT..L-S

PF13895

D3ZVK9_RAT/327-417------------------GL.............---------....PS.......PV.......V..PEGG-NV..TL.H
D3ZQX2_RAT/63-153------------------RP..........ILR---------...VQP......DTV.......V..STQS-KV..IF.F
IRPL2_HUMAN/143-231------------------NS..........RIR---------..YLEK.......SE.......V..TKRK-E....I.S
CD86_HUMAN/138-236------------------QP..........EIV---------...PI........SN.......I..TENV-YI..NL.T
A1BG_HUMAN/209-301------------------PP..........VLM---------HHGESS.......QV.......L..HPGN-KV..TL.T
PECA1_PIG/327-405------------------RP..........KLK---------...SSA.......TR.......L..DQGE-SL..RL.W
PECA1_MOUSE/316-393------------------KP..........KLE---------...FSS.......SR.......L..DQGE-LL..DL.S
A6NJE8_HUMAN/104-185------------------SL..........ILQ---------...A.P.......LS.......V..FEGD-SV..VL.R
VS10L_MOUSE/388-477------------------AP..........VIR---------...VSS.......DRDASPALYV..TAGS-NV..TL.H
A7T6F1_NEMVE/26-106------------------NT..........KMV---------...ANA.......SF.......V..CIGG-VA..LF.N
A7RUN6_NEMVE/106-186------------------YT..........VLT---------...ASP.......PN.......V..TYGD-PV..YL.N
A1BG_MOUSE/28-125------------------EP..........KLW---------...AEP.......QS......LL..EPWA-NL..TL.V
A1BG_RAT/218-314------------------AT..........QLP---------...PSLCLMGSYLTI.......Y..PQKT-HE..TL.A
FCRLA_MOUSE/79-175------------------KPFHLSVSYDWLILQ---------...GPA.......TL.......I..FEGD-TL..VL.H
D3ZRM2_RAT/20-112------------------KS..........CIR---------...RSQ.......IH.......V..VEGE-PF..YLKP
Q11VY4_CYTH3/701-789------------------LP..........VIT---------...PYVK....IDAN.......A..WTSS-ST..AA.V
A6GXG9_FLAPJ/1010-1093------------------AP..........VCT---------...PP........TA.......T..VVSS-TV..II.T
FCRLB_HUMAN/22-100------------------KP..........ILS---------...LHPP.....WTT.......I..FKGE-RV..TL.K
IL1R1_RAT/122-217------------------GLC........YNTQ---------...ASF......IQR.......L..HVAG-DG..SL.V
GP42_RAT/22-108------------------DP..........VLS---------...R.........LN.......S..SETS-DL..LL.K
A6QQQ4_BOVIN/113-195------------------WL..........IIQ---------...ASA.......EV.......M..MEGE-SL..FL.R
ILRL2_RAT/126-220------------------ES..........SIN---------...SSDE.....YQQ......WL..PIGK-SG..SL.T
A7SZF2_NEMVE/222-298------------------SV..........SIA---------...PAR......TIT.......T..SEGS-YV..QM.T
A1SP19_NOCSJ/451-536------------------AP..........VNT---------...VPPA....ISGT.......A..AVGQ-T....L.S
C3XPD2_BRAFL/8-98------------------RL..........ELQ---------...PTN.......TT.......F..REGE-EV..KL.S
B7Q9Q6_IXOSC/51-137------------------GP..........EIR---------...GTK.......PH.......Y..RIGD-LV..NV.T
B3RLN9_TRIAD/257-344------------------KF..........MND---------N.FLNQ.......VV.......L..YQGH-NISYRI.N
A7SRI5_NEMVE/63-151------------------LI..........QSE---------...STT.......QVTW...SNY..ADRD-PI..EL.N
TACT_HUMAN/25-136------------------KT..........VNT---------...EEN.......VY.......A..TLGS-DV..NL.T
ISLR2_HUMAN/240-372------------------EP..........PLE---------...APG.......TP.......L..RAGL-AF..VL.H
B4DVJ9_HUMAN/23-102------------------..............V---------...A.P.......SS.......V..FEGD-SI..VL.K
E9PD35_HUMAN/138-224------------------.P..........FIN---------...KPD.......TL......LV..NRKD-AM..WV.P
E9PX73_MOUSE/46-128------------------KP..........QII---------...VES......VTP.......S.DTDSC-TF..TL.I
F1P3W0_CHICK/181-268------------------KP..........VLS---------...VQP......GHE.......V..AAGA-DV..ML.H
F1R1B9_DANRE/314-392------------------RP..........ILT---------...MSP.......YE.......V..FEGE-FF..KL.N
F6QPE0_BOVIN/327-404------------------KP..........KLE---------...SSA.......TH.......L..DQGE-DL..NL.W
F7AWH8_XENTR/85-171------------------.P..........FLD---------...VPF.......ID.......V..IEGS-DA..VG.M
F7DK71_HORSE/161-253------------------..............I---------...SYP.......QI.......L..TLST-SG..LL.V
F7DLW8_HORSE/326-403------------------KP..........KLE---------...SPT.......IR.......L..DKGG-SL..DL.W
G1L4E1_AILME/105-189------------------.L..........ILQ---------...VPY.......AA.......V..FEGE-PL..VM.R
G1L7T4_AILME/329-410------------------KP..........KLE---------...SST.......TR.......L..DQGE-SL..NL.W
G1M3E0_AILME/129-211------------------............ILS---------...DEY......KQI.......L..HAGR-DD..SL.T
G1M8A4_AILME/973-1063------------------KP..........WLF---------...AEP......SSV.......V..PMGQ-NV..TL.W
H2NXI9_PONAB/312-389------------------AP..........LLT---------...LSE.......PS.......V..SEGQ-MV..TV.T
H2RC57_PANTR/28-117------------------KP..........TLR---------...AEP......DSV.......I..TQGS-PV..TL.R
H3CEP5_TETNG/209-301------------------.P..........VIV---------...LSEK.....DTV......IL..RKGE-RF..EI.T
H3CGE1_TETNG/471-557------------------.P..........TLD---------...PVF.......QD.......VRSRNYQ-MV..TL.R
M0RCJ0_RAT/106-186------------------............LLQ---------...TPQ.......LV.......F..EEGE-TI..TL.R
M3XWI6_MUSPF/119-204------------------.L..........ILQ---------...GPV.......SP.......I..FEGD-PL..IL.R
LIRB5_HUMAN/28-115------------------KP..........TLW---------...AEP......ASV.......I..ARGK-PV..TL.W
PECA1_HUMAN/327-404------------------KP..........ELE---------...SSF.......TH.......L..DQGE-RL..NL.S

PF16706

G1TVX5_RABIT/169-260------------------RS--------------------------------------------.EVHQMD-DLI--L-D
F6YE25_HORSE/168-260------------------RQ--------------------------------------------VKVHRKE-DMI--L-D
H0UTJ7_CAVPO/168-259------------------RH--------------------------------------------VKLHQME-DMI--L-D
F6UM65_CANFA/166-254------------------HE--------------------------------------------VVVHELE-DLV--L-D
M3W7L5_FELCA/169-261------------------RH--------------------------------------------INVHEKE-DLV--L-D
H9H653_MONDO/206-297------------------.A--------------------------------------------VQVIEKG-DLI--L-D
V8PHR1_OPHHA/159-248------------------RK--------------------------------------------VHVEIDE-DLI--L-D
L5LHN8_MYODS/162-254------------------RR--------------------------------------------VNVHEME-DMI--L-D
H0WN21_OTOGA/168-257------------------RN--------------------------------------------VEVHEME-DMI--L-D
IZUM1_MOUSE/168-260------------------RH--------------------------------------------IEVHRSE-DLV--L-D
G3TPD8_LOXAF/168-260------------------RQ--------------------------------------------VEVQQME-DMI--L-D
IZUM1_RAT/168-260------------------RQ--------------------------------------------IEVHRLE-DMV--L-D
I3MLV0_SPETR/170-262------------------RH--------------------------------------------VEVHELE-DLI--L-D
G1M882_AILME/167-255------------------RE--------------------------------------------ITVHEME-DLR--L-N
G1QXF7_NOMLE/168-260------------------RN--------------------------------------------VEVPQME-DMM--L-D
W5PRD0_SHEEP/169-261------------------RE--------------------------------------------VKVHQME-DMI--L-D
H3DD44_TETNG/58-151------------------..--------------------------------------------VQAEEGG-QAV--L-D

PF07654

O35424_MOUSE/129-211-------------------------------------------------------------PE-RTPLLQQ-HNL--L-L
IGKC_HUMAN/12-98-------------------------------------------------------------PS-DEQLKSG-TAS--V-V
KACB_RAT/12-98-------------------------------------------------------------PS-TEQLATG-GAS--V-V
IGKC_MOUSE/12-98-------------------------------------------------------------PS-SEQLTSG-GAS--V-V
KAC5_RABIT/12-95-------------------------------------------------------------PA-PAQLATG-AVT--I-V
LAC1_MOUSE/13-96-------------------------------------------------------------PS-SEELETN-KAT--L-V
LAC2_MOUSE/13-95-------------------------------------------------------------PS-SEELKEN-KAT--L-V
LAC_PIG/13-96-------------------------------------------------------------PS-SEELGTN-KAT--L-V
LAC_RABIT/13-96-------------------------------------------------------------PS-SEELKDN-KAT--L-V
TCB2_MOUSE/17-102-------------------------------------------------------------SK-AEIANKQ-KAT--L-V
IGHE_HUMAN/331-415-------------------------------------------------------------TP-EWPGSRD-KRT--L-A
IGHE_RAT/322-410-------------------------------------------------------------PE-EEE..KD-KRT--L-T
IGHG1_HUMAN/13-95-------------------------------------------------------------PS-SKSTSGG-TAA--L-G
IGHG1_HUMAN/130-216-------------------------------------------------------------PK-DTLMISR-TPE--V-T
IGHG1_HUMAN/236-321-------------------------------------------------------------PS-RDELTKN-QVS--L-T
IGHG2_CAVPO/234-321-------------------------------------------------------------PS-RDELSKS-KVS--V-T
GCAA_MOUSE/13-94-------------------------------------------------------------PV-CGDTTGS-SVT--L-G
GCAA_MOUSE/130-216-------------------------------------------------------------IK-DVLMISL-SPI--V-T
GCAA_MOUSE/236-321-------------------------------------------------------------PP-EEEMTKK-QVT--L-T
GCAB_MOUSE/241-326-------------------------------------------------------------PP-AEEMTKK-EFS--L-T
IGG2B_MOUSE/241-326-------------------------------------------------------------PP-AEQLSRK-DVS--L-T
IGHG1_MOUSE/230-315-------------------------------------------------------------PP-KEQMAKD-KVS--L-T
IGHG_RABIT/123-209-------------------------------------------------------------PK-DTLMISR-TPE--V-T
IGHM_HUMAN/337-425-------------------------------------------------------------AR-EQLNLRE-SAT--I-T
IGHM_CHICK/330-419-------------------------------------------------------------PT-EQLNGNQ-RLS--V-T
IGHA1_HUMAN/12-96-------------------------------------------------------------SL-CSTQPDG-NVV--I-A
IGHA_MOUSE/12-95-------------------------------------------------------------TL-PPALSSD-PVI--I-G
IGHA_RABIT/182-272-------------------------------------------------------------PS-EELALNE-QVT--L-T
IGHD_HUMAN/14-96-------------------------------------------------------------GC-RHPKDNS-PVV--L-A
B2MG_RABIT/11-92-------------------------------------------------------------SR-HPAENGK-PNF--L-N
B2MG_CAVPO/11-92-------------------------------------------------------------SR-HPAENGK-QNF--I-N
B2MG_MOUSE/31-112-------------------------------------------------------------SR-HPPENGK-PNI--L-N
B2MG_BOVIN/31-111-------------------------------------------------------------SR-HPPEDGK-PNY--L-N
IGHG3_MOUSE/235-320-------------------------------------------------------------PP-REQMSKK-KVS--L-T
DPB1_HUMAN/130-212-------------------------------------------------------------PS-KKGPLQH-HNL--L-V
DOB_HUMAN/129-211-------------------------------------------------------------PE-RTPLLHQ-HNL--L-H
DPA1_HUMAN/124-206-------------------------------------------------------------PK-EPVELGQ-PNT--L-I
IGHG1_RAT/232-317-------------------------------------------------------------PT-KEEMTQN-EVS--I-T
IGG2B_RAT/239-324-------------------------------------------------------------PP-TEQLTEQ-TVS--L-T
IGG2C_RAT/13-94-------------------------------------------------------------PG-CSGTSGS-LVT--L-G
LAC_CHICK/14-95-------------------------------------------------------------SK-EELNEAT-KAT--L-V
IGLL1_MOUSE/117-200-------------------------------------------------------------PS-LKNLQAN-KAT--L-V
B2MG_CHICK/31-112-------------------------------------------------------------SR-FPASAGT-KNV--L-N
B2MG_HORSE/31-111-------------------------------------------------------------SR-HPAENGK-PNF--L-N
B2MG_DANRE/30-109-------------------------------------------------------------SH-FPGEYGK-PNT--L-I
Q8WM94_DANRE/110-193-------------------------------------------------------------PK-DDVELGV-QNT--L-V
Q90ZJ6_ORYLA/30-109-------------------------------------------------------------SR-DPGQYGK-ENT--L-I
A6QQE7_BOVIN/117-198-------------------------------------------------------------PK-SSVVLGI-PNT--L-I
E9QFF8_DANRE/65-144-------------------------------------------------------------PK-DDVELGV-QNS--L-I
F1NSZ6_CHICK/135-210-------------------------------------------------------------..-....LPE-TDR--L-A
F1RBP5_DANRE/141-220-------------------------------------------------------------..-KPAGGRH-PAV--L-M
F6UY61_MONDO/133-213-------------------------------------------------------------.S-KTAPVGH-HNL--L-V
F6W9R2_CALJA/32-111-------------------------------------------------------------.R-HPAENGK-PNF--L-N
G1TXW3_RABIT/124-203-------------------------------------------------------------..-.PFNTRE-PVM--L-A
H0UYJ7_CAVPO/115-195-------------------------------------------------------------PK-EPVELGE-PNI--L-I
H2MX91_ORYLA/120-197-------------------------------------------------------------..-..SGGHH-PAM--L-V
H9GZQ9_HORSE/243-325-------------------------------------------------------------..-PDELSKS-KVS--V-T
I3KVH2_ORENI/112-193-------------------------------------------------------------.R-DEVEFGE-KNT--L-I
M3VX36_FELCA/121-201-------------------------------------------------------------.N-SPVELGE-PNI--L-I
M3W4D7_FELCA/33-111-------------------------------------------------------------..-..PISDR-EVT--L-R
M9MM93_DANRE/109-191-------------------------------------------------------------PK-SDPQLNL-KNT--L-I
O62938_XIPMA/119-197-------------------------------------------------------------..-KAEYSQH-QQM--L-I
DQA1_HUMAN/118-199-------------------------------------------------------------SK-SPVTLGQ-PNI--L-I
HB2D_PIG/132-213-------------------------------------------------------------PS-KAEALNH-HNL--L-V
HB2D_RAT/130-211-------------------------------------------------------------PS-KTQPLEH-HNL--L-V
HA2J_MOUSE/118-199-------------------------------------------------------------PK-SPVLLGQ-PNT--L-I
Q1MTC8_DANRE/121-202-------------------------------------------------------------.V-RQAEGRH-PAV--L-L
Q5M8Y9_XENTR/126-205-------------------------------------------------------------..-KTLDLEH-ENL--I-T
Q5XJ70_DANRE/111-191-------------------------------------------------------------.E-DEVVLDE-KNT--L-I
Q70IB5_BOVIN/134-215-------------------------------------------------------------.A-STEALNH-HNL--L-V
R0JJE7_ANAPL/108-187-------------------------------------------------------------..-.SSSLPQ-TDR--L-A
W5PE14_SHEEP/119-200-------------------------------------------------------------PK-SRVQLGE-PNV--L-I

PF02124

GC_PSHV1/234-457VKWFLINT....KDSP.PPSVTPQTTVTFVATWTPPKGFETVFPDGKVTLTKVLRPLWLRKPI-VQVSRFP-PGY--L-V
GC_VZVD/379-589SYVSAVRIPQQKQMDYPPPAIQCN......VLWIRDGVSNMKY.......SAVVTPDVYPFPN-VSI.GII-DGH--I-V
GC_HHV11/291-500TTVSTVTSEAVGGQVP.PRTFTCQ......MTWHRDSVTFSRR.......NATGLALVLPRPT-ITM.EFG-VRI--V-V
GC_GAHVM/283-492TLVSTITL.GNSGIDF.PPKISCL......VAWKQGDMISTT........NATAIPTVYHHPR-LSL.AFK-DGY--A-I
GC_HHV2H/260-469STVSTVTSAAVGGQGP.PRTFTCQ......LTWHRDSVSFSRR.......NASGTASVLPRPT-ITM.EFT-GDH--A-V

PF07679

LRIG1_MOUSE/601-691-----------------------------------------------------PSFTKIP.HD-IAIRTGT-TAR--L-E
TITIN_HUMAN/7385-7474-----------------------------------------------------PVFTQKP.SP-VGALKGS-DVI--L-Q
PALLD_HUMAN/271-361-----------------------------------------------------PRFIQKL.RS-QEVAEGS-RVY--L-E
PALLD_HUMAN/1135-1225-----------------------------------------------------PHFLQAP.GD-LTVQEGK-LCR--M-D
HMCN2_HUMAN/4309-4395-----------------------------------------------------PVFQVEP.QD-MTVRSGD-DVA--L-R
IGDC3_HUMAN/330-417-----------------------------------------------------AEFVQHP.QS-ISRPAGT-TAM--F-T
NCAM2_HUMAN/21-111-----------------------------------------------------LQVTISL.SK-VELSVGE-SKF--F-T
MYOM1_MOUSE/1555-1645-----------------------------------------------------RVLGGLP.DV-VTIQEGK-ALN--L-T
OBSCN_HUMAN/10-99-----------------------------------------------------PRFLTRP.KA-FVVSVGK-DAT--L-S
PXDN_HUMAN/433-519-----------------------------------------------------PQFTVTP.QD-RVVIEGQ-TVD--F-Q
Q08476_CHICK/180-269-----------------------------------------------------PYFVTPL.EP-VQVTVGD-SAS--L-Q
Q08476_CHICK/372-461-----------------------------------------------------PFFDTPI.TP-VDGIIGE-SAD--F-E
HMCN1_HUMAN/1171-1258-----------------------------------------------------PKIQRGP.KH-LKVQVGQ-RVD--I-P
O00557_HUMAN/20-114-----------------------------------------------------LQVDIVP.SQ-GEISVGE-SKF--F-L
UNC89_CAEEL/648-737-----------------------------------------------------PAFVTKL.RD-KECKEGD-VID--F-E
UNC89_CAEEL/3286-3377-----------------------------------------------------PTFVREL.VT-TEVKINE-TAT--L-S
UNC89_CAEEL/3482-3573-----------------------------------------------------PEFTQKL.RP-LEVREQE-TLD--L-K
UNC89_CAEEL/3920-4010-----------------------------------------------------PDFLQPV.KP-AVVTVGE-TAV--L-E
MYLK_SHEEP/331-421-----------------------------------------------------PYFSKTI.RD-LEVVEGS-AAR--F-D
MUSK_HUMAN/121-208-----------------------------------------------------PKITRPP.IN-VKIIEGL-KAV--L-P
ROBO1_RAT/262-347-----------------------------------------------------PSFVKRP.SN-LAVTVDD-SAE--F-K
O55124_MOUSE/1345-1435-----------------------------------------------------KVIGGLP.DV-VTIMEGK-TLN--L-T
O57576_CYNPY/213-301-----------------------------------------------------VRARQTT.VN-ATANLGE-AAV--L-A
O76281_DROME/1225-1316-----------------------------------------------------PHIDRVNLKP-VIVKTGL-SIS--L-D
O76281_DROME/3892-3982-----------------------------------------------------FYFDGLIGKR-IKVRAGE-PVN--L-N
O76281_DROME/6357-6446-----------------------------------------------------PEFTKPL.HD-LTIHDGE-QLI--L-T
CAVPT_BRALA/59-149-----------------------------------------------------PKFSQVL.KD-MFVMEGS-AVT--F-F
MYLK_CHICK/28-118-----------------------------------------------------PAFTLPP.RN-IRVQLGA-TAR--F-E
MYLK_CHICK/156-245-----------------------------------------------------PKFATKP.NR-VVVREGQ-TGR--F-S
A4V2I0_DROME/25-135-----------------------------------------------------PVISQIS.KD-VVASVGD-SVE--F-N
P79757_CHICK/328-417-----------------------------------------------------ATILTKP.RS-ITVSEGE-TAR--F-S
P79757_CHICK/734-823-----------------------------------------------------PAFITQP.KS-QNVNEGQ-DVL--F-T
UNC22_CAEEL/4150-4239-----------------------------------------------------PKILTAS.RK-IKIKAGF-THN--L-E
UNC22_CAEEL/6585-6674-----------------------------------------------------PRFIVKP.YG-TEVGEGQ-SAN--F-Y
UNC22_CAEEL/6863-6953-----------------------------------------------------PSFTAQL.SD-SETEVGG-SAE--F-S
VCAM1_CANFA/25-112-----------------------------------------------------SKMEIFLEPR-VAAQIGD-VIS--L-T
Q8BID4_MOUSE/6-97-----------------------------------------------------PMFTQPL.QS-VVVLEGS-TAT--F-E
Q8T103_BOMMO/4625-4714-----------------------------------------------------PEIIEPL.KD-KIVAEGQ-AIE--F-S
Q90X22_DANRE/66-155-----------------------------------------------------PVFESKL.TP-AEVTIGE-SVR--F-T
Q90X22_DANRE/178-268-----------------------------------------------------PCFTTQI.QP-VQCVEGS-EVK--F-Q
Q90YM0_DANRE/209-296-----------------------------------------------------VSVPQQS.FN-ATADYGE-SVT--F-T
Q90Z41_CHICK/223-308-----------------------------------------------------PTFLRRP.IN-QVVLEEE-AVD--F-R
Q95YM1_PROCL/4632-4721-----------------------------------------------------PKIVQKL.KS-QVVQEGQ-GAF--F-E
Q98918_CHICK/3071-3160-----------------------------------------------------PPAVIVPLRD-AVTSEGQ-SAR--F-Q
SPEG_MOUSE/727-816-----------------------------------------------------PVFEIPL.QN-MVVAPGA-DVL--L-K
SPEG_MOUSE/1490-1579-----------------------------------------------------PRFESIM.ED-VEVGPGE-TAR--F-A
Q9GV22_MYTGA/344-433-----------------------------------------------------PRFIRKP.RN-ILAAEGQ-STK--F-D
Q9GV22_MYTGA/647-736-----------------------------------------------------PEFTTQL.SP-LSLNEGD-RLK--L-T

PF02440

Q4KSJ0_9ADEN/110-200-----------------------------------------------------VKPQPDP.EN-VFVYMGD--------N
Q91CB8_ADE08/236-321-----------------------------------------------------STNNLQP.TQ-LYVRPFT--------N
Q80IV8_ADE08/252-335-----------------------------------------------------PH.TPEA.KL-ITVSSGS--------D
Q91PL0_9ADEN/13-104-----------------------------------------------------VTAAHGQ.TV-VSIPLGH--------N
Q6QPD0_9ADEN/15-113-----------------------------------------------------ALCESVD.RD-VTITTGS--------N
Q6H1B4_9ADEN/16-113-----------------------------------------------------FINSFDH.KN-VTAYVGS--------N
Q3ZKT4_9ADEN/13-104-----------------------------------------------------VTVAHGQ.TI-VHITLGH--------N
Q76C87_ADE08/128-219-----------------------------------------------------VKPQSGP.EY-VYVNMGE--------N
E3TMR2_ADE16/13-100-----------------------------------------------------AAVTYGR.SH-LTVPVGS--------T
Q8JZH7_ADE17/110-200-----------------------------------------------------VKPQPEP.EY-VYVNMGE--------N
E321_ADE35/14-100-----------------------------------------------------ATLTSAR.SH-LTVTIGS--------N
Q7TBH0_ADE08/34-124-----------------------------------------------------AFSQAGI.IN-LNVLWGI--------N
B9A5V9_9ADEN/260-345-----------------------------------------------------PA.TIEA.ML-VTVTAGS--------N
Q8JZH7_ADE17/15-105-----------------------------------------------------TFSQAGF.HT-INATWWA--------N
Q6QP93_9ADEN/15-105-----------------------------------------------------IVFSAGFLKN-LTIYEGE--------N
Q8UY72_9ADEN/16-114-----------------------------------------------------VIHGMSN.EK-ITIYTGT--------N
B9A5V9_9ADEN/110-200-----------------------------------------------------VKPQPEP.EY-VFVYMGE--------N
Q4KSJ0_9ADEN/254-339-----------------------------------------------------PTNTPET.KQ-LTVSIGS--------N
Q6QPD1_9ADEN/15-112-----------------------------------------------------YASGYAN.IQ-KTLYVGS--------D
Q91CB6_ADE09/110-200-----------------------------------------------------RKPLSEP.HY-VTVTMGD--------N

PF07686

TVB8_MOUSE/25-130---------------------------------------------------------QSP-RY.LILGRAN-K.S--L-E
MPZL2_HUMAN/30-143---------------------------------------------------------YTS-RV.LEAVNGT-DAR--L-K
IGS11_HUMAN/27-141---------------------------------------------------------ESP-GS.IQVARGQ-PAV--L-P
TVB1_MOUSE/25-132---------------------------------------------------------QTP-RY.LVKGQGQ-KAK--M-R
CD2_HORSE/25-122---------------------------------------------------------KKN-IT.ILGALER-DIN--L-D
CLM2_MOUSE/19-124---------------------------------------------------------TGP-GS.VSGYVGG-SLR--V-Q
GPA33_HUMAN/25-138---------------------------------------------------------ETP-QDVLRASQGK-SVT--L-P
TVA2_MOUSE/26-132---------------------------------------------------------QSP-ES.LIVPEGA-RTS--L-N
TVB1_HUMAN/25-135---------------------------------------------------------QSP-RH.EVTEMGQ-EVT--L-R
HVM07_MOUSE/24-138---------------------------------------------------------QQP-GA.ELVKPGA-SVK--L-S
LV603_HUMAN/5-110---------------------------------------------------------TQP-HS.VSESPGK-TVI--I-S
Q9UEL6_HUMAN/15-129---------------------------------------------------------YTP-KE.IFVANGT-QGK--L-T
MO2R1_MOUSE/42-147---------------------------------------------------------QVN-TT.VSVQIGT-KAL--L-C
SHPS1_BOVIN/38-145---------------------------------------------------------QPE-RS.VSVAAGE-TAT--L-H
CD2_MOUSE/23-121---------------------------------------------------------RDN-ET.IWGVLGH-GIT--L-N
TIMD4_HUMAN/23-128---------------------------------------------------------TSE-TV.VTEVLGH-RVT--L-P
TVC_HUMAN/24-136---------------------------------------------------------GRT-KS.VTRQTGS-SAE--I-T
FAIM3_HUMAN/19-123---------------------------------------------------------ILP-EVKVEGELGG-SVT--I-K
TVA2_HUMAN/32-138---------------------------------------------------------QNS-PS.LSVQEGR-ISI--L-N
HV108_HUMAN/5-119---------------------------------------------------------VQS-GV.ERKVPGA-SVR--I-S
CEA21_HUMAN/38-141---------------------------------------------------------IAS-AP.FEVAEGE-NVH--L-S
CSPG2_MOUSE/27-148---------------------------------------------------------ETS-PP.VKGSLSG-KVV--L-P
SIGL5_HUMAN/24-140---------------------------------------------------------QVQ-KS.VTVQEGL-CVL--V-P
VSIG1_CHICK/26-136---------------------------------------------------------VPE-KT.VNVKTGG-NAT--L-L
HV107_HUMAN/5-115---------------------------------------------------------VQS-GA.EVKKPGS-SAR--L-S
TVB5_MOUSE/14-122---------------------------------------------------------QSP-RS.KVAVTGG-KVT--L-S
CXAR_DANRE/28-142---------------------------------------------------------TGQ-TS.IEKASGE-SVK--L-D
CEAM4_HUMAN/38-141---------------------------------------------------------IEA-LP.SSAAEGK-DVL--L-L
HHLA2_HUMAN/226-330---------------------------------------------------------TMK-DG.LHKMQSE-HVS--L-S
PVRL4_HUMAN/35-146---------------------------------------------------------ETS-DV.VTVVLGQ-DAK--L-P
CD8B_FELCA/24-135---------------------------------------------------------QAP-GS.VMVQTNG-MVI--M-S
SKIT3_MOUSE/32-141---------------------------------------------------------GLE-RP.VLAPLGG-ILE--L-S
PDCD1_MOUSE/37-145---------------------------------------------------------FYP-AW.LTVSEGA-NAT--F-T
KV123_HUMAN/28-129---------------------------------------------------------QSP-SS.LSASVGD-RVT--I-T
Q8UV83_DANRE/144-247---------------------------------------------------------QLP-VH.AVIKPGS-NVT--L-R
SCN2B_HUMAN/33-147---------------------------------------------------------TVP-AT.LNVLNGS-DAR--L-P
VSIG2_HUMAN/27-142---------------------------------------------------------KVP-TEPLSTPLGK-TAE--L-T
FCAMR_HUMAN/65-171---------------------------------------------------------KGS-RL.VSGEPGG-AVT--I-Q
LV1B_MOUSE/24-128---------------------------------------------------------TQE-SA.LTTSPGE-TVT--L-T
CD8A_MOUSE/36-148---------------------------------------------------------IFP-KK.MDAELGQ-KVD--L-V
CLM5_MOUSE/23-126---------------------------------------------------------TGP-EE.VSGQEQG-SLT--V-Q
JAML1_HUMAN/25-136---------------------------------------------------------VSP-PE.LTVHVGD-SAL--M-G
BTNLA_MOUSE/37-146---------------------------------------------------------GPP-HP.LLAIVGQ-DKE--L-P
TVB6_MOUSE/27-136---------------------------------------------------------QNP-RW.RLVPRGQ-AVN--L-R
CD7_HUMAN/31-132---------------------------------------------------------QSP-HC.TTVPVGA-SVN--I-T
TVA1_HUMAN/25-131---------------------------------------------------------QAQ-TE.ISVVEKE-DVT--L-D
CD2_HUMAN/28-127---------------------------------------------------------TNA-LE.TWGALGQ-DIN--L-D
TVA1_MOUSE/25-130---------------------------------------------------------QPD-AR.VTVSEGA-SLQ--L-R
CD2_RAT/23-120---------------------------------------------------------RDS-GT.VWGALGH-GIN--L-N
SCN3B_MOUSE/28-143---------------------------------------------------------EVP-SE.TEAVQGN-SMK--L-R
VPREB_HUMAN/24-134---------------------------------------------------------HQP-PA.MSSALGT-TIR--L-T
TREM1_MOUSE/25-134---------------------------------------------------------EEE-RY..DLVEGQ-TLT--V-K
SCN1B_HUMAN/23-139---------------------------------------------------------EVD-SE.TEAVYGM-TFK--I-L
Q9R121_RAT/32-135---------------------------------------------------------IEL-VP.PMVAEGG-NSV--L-F
SIRPD_HUMAN/34-140---------------------------------------------------------QTE-MS.QTVSTGE-SII--L-S
MXRA8_HUMAN/168-292---------------------------------------------------------DGE-KEVLAVARGA-PAL--L-T
A2BGB5_DANRE/30-142---------------------------------------------------------.TS-SE.LEAVNGT-EIR--L-K
B8ZZZ4_HUMAN/29-130---------------------------------------------------------...-LD.RTWNLGE-TVE--L-K
F1NMT9_CHICK/44-146---------------------------------------------------------...-.R.VTANVGQ-DVV--L-R
F1P992_CANFA/18-131---------------------------------------------------------..P-EQMIEKAKGE-TAY--L-P
F6RFK3_CHICK/32-139---------------------------------------------------------QTP-GY.ILTKTNN-STE--I-V
G3V7D2_RAT/42-151---------------------------------------------------------.QP-SV.VLASSHG-VAS--F-P
L8YBJ5_TUPCH/164-276---------------------------------------------------------.TD-RE.VHGAVGS-RVT--L-H
M0QX98_HUMAN/6-107---------------------------------------------------------.ES-TP.FNVAEGK-EVL--L-L
CD8B_RAT/24-134---------------------------------------------------------QTP-SS.LLVQTNQ-TAK--M-S
Q3LFS9_MOUSE/42-141---------------------------------------------------------...-.P.PQVAEDN-NVL--L-L
Q5SNP6_DANRE/26-130---------------------------------------------------------.QQ-PL.VVAELGS-SVT--L-P
Q8BNV8_MOUSE/24-121---------------------------------------------------------QNP-EL.LRTQEGE-TVS--V-T
Q8K094_MOUSE/37-141---------------------------------------------------------...-.N.STGVLGG-STT--L-H
Q9JHL7_RAT/42-140---------------------------------------------------------...-.P.PNVVEEK-SVL--L-L

PF05790

CD2_HUMAN/135-205---------------------------------------------------------ISWTCI-N.TTLTC-E-------
Q8K0X1_MOUSE/133-221---------------------------------------------------------VTVKCL-APDIYPV-Y-------
CD4_RAT/316-390---------------------------------------------------------MKVTQP-DSNTLTC-E-------
CD4_SAISC/125-202---------------------------------------------------------LTANPD-T.HLLQG-Q-------
VCAM1_HUMAN/133-221---------------------------------------------------------ITVKCS-VADVYPF-D-------
CD4_RABIT/318-390---------------------------------------------------------LKVTQV-K.NKLTC-E-------
CD2_RAT/128-198---------------------------------------------------------IYWECS-N.ATLTC-E-------
VCAM1_CANFA/133-221---------------------------------------------------------VTVTCL-VRDVYPF-D-------
CD4_RAT/127-206---------------------------------------------------------VTFNPG-T.RLLQG-Q-------
Q9GKR2_BOVIN/134-222---------------------------------------------------------VTVTCS-VPDVYPF-E-------
CD4_RABIT/129-208---------------------------------------------------------LTANPN-T.RLLHG-Q-------
CD2_MOUSE/129-199---------------------------------------------------------IHWECP-N.TTLTC-A-------
VCAM1_CANFA/421-509---------------------------------------------------------VTVSCE-VPNVYPS-D-------
VCAM1_RAT/133-221---------------------------------------------------------VMVKCL-APDVYPI-D-------
CD4_CANFA/133-211---------------------------------------------------------SSGSSN-I.RLLQG-Q-------
Q9GKR2_BOVIN/422-510---------------------------------------------------------VTVSCR-VPNVYPS-D-------
O55054_MOUSE/104-183---------------------------------------------------------VTFSPG-T.SLLQG-Q-------
P79355_FELCA/332-405---------------------------------------------------------MRVTQS-G.NNLTC-E-------
CD4_CANFA/321-392---------------------------------------------------------MRANSS-Q.NNLTC-E-------
VCAM1_RAT/421-509---------------------------------------------------------VTVNCT-VPNVYPF-D-------
CD4_DELLE/314-387---------------------------------------------------------MRVTKS-P.NSLTC-E-------
Q28939_PIG/134-219---------------------------------------------------------VTVRCL-VPDVYPV-E-------
O88650_MARMO/10-83---------------------------------------------------------MNVTYH-Q.NDLIC-E-------
P70443_MOUSE/8-81---------------------------------------------------------MKVAQL-N.NTLTC-E-------
CD2_HORSE/130-201---------------------------------------------------------ISWSCT-N.TTLTC-E-------
CD4_DELLE/125-203---------------------------------------------------------LTASSD-T.RLLLG-Q-------
P79355_FELCA/144-222---------------------------------------------------------TSTSTS-I.YLLQG-Q-------

PF16681

F1SAK8_PIG/36-116-------------------------------------------------------FKVSISGD-K-VELTC-P-------
CD3E_SHEEP/30-112-------------------------------------------------------YEVSISGN-S-VELTC-P-------
CD3E_BOVIN/30-112-------------------------------------------------------YEVSISGN-T-VELTC-P-------
G3QUY7_GORGO/36-127-------------------------------------------------------YKVSISGT-T-VILTC-P-------
H0X808_OTOGA/36-118-------------------------------------------------------YKVSISGT-T-VTVKC-P-------
G5BHL3_HETGA/31-112-------------------------------------------------------YRVSISGT-R-VVVTC-F-------
G3T782_LOXAF/29-109-------------------------------------------------------YKVSISGT-R-VVLTC-P-------
I3MMT1_SPETR/30-113-------------------------------------------------------YKVSISGT-D-VILSC-P-------
H0UW68_CAVPO/36-115-------------------------------------------------------YEVSISRS-T-VTVTC-Y-------
G1SRV6_RABIT/8-90-------------------------------------------------------FAVSISGN-H-VVLTC-P-------
H9GCG3_ANOCA/57-136-------------------------------------------------------IKVKQNGR-N-VTLQC-S-------
Q3LRP4_CALJA/36-118-------------------------------------------------------YKVSISGT-T-VTLTC-P-------
L5M0Z4_MYODS/18-99-------------------------------------------------------FKVSISGT-R-VEVTC-P-------
G3WKI6_SARHA/41-122-------------------------------------------------------FGVYISGT-E-VTLTC-P-------
CD3E_CANFA/41-122-------------------------------------------------------FKVSISGT-E-VVVTC-P-------
F7D784_MONDO/33-114-------------------------------------------------------FGVSISGT-Q-VTLTC-P-------
M3XJR7_LATCH/37-113-------------------------------------------------------VKVEVSGT-T-VTLTC-P-------
F7CSX8_HORSE/40-119-------------------------------------------------------YEVSISGT-T-VKLTC-P-------
L5KKM4_PTEAL/18-99-------------------------------------------------------YKVSISGT-K-VMLTC-P-------
D4A5M2_RAT/24-104-------------------------------------------------------YEVSISGT-S-VELTC-P-------
G7PP33_MACFA/36-118-------------------------------------------------------YQVSISGT-T-VILTC-S-------
CD3E_MOUSE/29-109-------------------------------------------------------YKVSISGT-S-VELTC-P-------

PF08205

PVRL3_HUMAN/173-257---------------------------------------------------------SLIKGP-D.SLIDG-G..--.-.
SN_MOUSE/142-229---------------------------------------------------------PTITIP-E.ELREG-M..--.-.
RAGE_HUMAN/124-219---------------------------------------------------------PEIVDS-A.SELTA-G..--.-.
NPHN_MOUSE/152-242---------------------------------------------------------LQLTPE-AGSTVTW-V..--.-.
NPHN_MOUSE/357-442---------------------------------------------------------VTILGS-T.SQSEN-K..--.-.
CRTAM_MOUSE/119-205---------------------------------------------------------PTVEAL-VLRRQNG-E..--.-.
PVRL4_MOUSE/150-233---------------------------------------------------------PSLNPG-P.PLEEG-Q..--.-.
PVRL2_MOUSE/155-240---------------------------------------------------------NHAEAQ-E.VTIGP-Q..--.-.
PVRL1_HUMAN/148-237---------------------------------------------------------NWIEGT-Q.AVLRA-KKG--.-Q
TMM25_HUMAN/26-118---------------------------------------------------------GELEPQ-IDGQTWA-ERA--L-R
SN_HUMAN/142-228---------------------------------------------------------PTIASP-V.ELLEG-T..--.-.
CD22_HUMAN/143-230---------------------------------------------------------PHIQLP-P.EIQES-Q..--.-.
NPHN_HUMAN/138-228---------------------------------------------------------LLLTPE-AGTMVTW-V..--.-.
CD80_RABIT/140-226---------------------------------------------------------DFPVPS-I.TDIGH-PD.--.-.
MUC18_HUMAN/139-234---------------------------------------------------------PNIQVN-P.LGIPV-NS.--.-.
BCAM_HUMAN/150-248---------------------------------------------------------TEVSPN-K.GTLSV-ME.--.-.
BCAM_BOVIN/150-248---------------------------------------------------------PEVSPN-K.GILSV-MD.--.-.
CD166_MOUSE/137-231---------------------------------------------------------PEIVNK-A.PFLET-D..--.-.
O35444_MOUSE/123-217---------------------------------------------------------PEIVDP-A.SELTA-S..--.-.
FAS3_DROME/126-222---------------------------------------------------------PIIELL-..SRPNR-EGY--F-N
B4MCT1_DROVI/186-273---------------------------------------------------------PKIQQG-D.YLVTT-E..--.-.
E1C6L8_CHICK/151-245---------------------------------------------------------PEITPN-S.AGIPA-QS.--.-.
F1SPA8_PIG/71-155---------------------------------------------------------.FPVPS-I.TALGN-PS.--.-.
F7EIQ1_CALJA/148-231---------------------------------------------------------.TAEAQ-K.VQLTG-E..--.-.
G1TJN6_RABIT/203-292---------------------------------------------------------.MVEPR-E.VLLAQ-QPR--E-P
G3V671_RAT/147-231---------------------------------------------------------.FPTPN-I.TESGN-PS.--.-.
G7NXN7_MACFA/142-226---------------------------------------------------------.FPTPS-I.TDFEI-PP.--.-.
Q7ZZ85_DANRE/61-152---------------------------------------------------------PVIKNK-V.KELEN-G..--.-.

PF15910

F1NL21_CHICK/43-155--------------------------------------------------QVSDPQGIVEFEN-GNFKLIF-Q-------
G1L868_AILME/23-135--------------------------------------------------NDSAKSEMFTFHD-GGVQILC-K-------
F6ZKL5_HORSE/23-134--------------------------------------------------GDSAKSDMFIAHD-GGVQILC-K-------
G5BKP1_HETGA/16-127--------------------------------------------------NDSAKYEMFTFHH-GGVQVLC-R-------
H0VT36_CAVPO/23-134--------------------------------------------------SDTCKYGMFTFHR-GGVQVLC-K-------
I3LV71_PIG/23-135--------------------------------------------------NDSAKSEMFMFHD-GGLQIVC-K-------
ICOS_MOUSE/23-135--------------------------------------------------NGSADHRMFSFHN-GGVQISC-K-------
ICOS_HUMAN/23-134--------------------------------------------------NGSANYEMFIFHN-GGVQILC-K-------

PF06328

E1B6W6_HUMAN/24-110----------------------------------------------------EECGHISVSAP-I.VHLGD-PIT--A-S
G3H9X4_CRIGR/24-111----------------------------------------------------ESCGHIRISVP-V.VRLGD-PVI--A-S
W5PCA4_SHEEP/27-112----------------------------------------------------.PCAHIHPESS-V.VQLGS-NFT--A-V
H2MHM5_ORYLA/26-108----------------------------------------------------NRCADVQSSSP-V.VPLGS-PVN--A-T
L9KWE5_TUPCH/160-246----------------------------------------------------.....IYFPPK-ILTSVGS-NVS--F-R
I3LQQ8_PIG/25-111----------------------------------------------------EECGYISLPAP-I.IRLGD-PIT--V-S
H0VNJ1_CAVPO/26-112----------------------------------------------------DTCGVISPESP-V.IQSGS-NFT--A-F
G1MI84_AILME/334-420----------------------------------------------------.....IYFPPK-ILTRVGS-NVS--I-H
L5JUJ0_PTEAL/24-110----------------------------------------------------EGCGHISLSAS-T.VRLGD-AIT--A-S
K7E988_ORNAN/24-110----------------------------------------------------KPCGHIVPESA-V.LELGS-NFT--A-I
M4AJW4_XIPMA/27-111----------------------------------------------------QPCARIHTSSS-V.VTLGS-PVT--A-T
G3QMC9_GORGO/26-112----------------------------------------------------DPCGYISPESP-V.VQLHS-NFT--A-V
G1KQG1_ANOCA/26-113----------------------------------------------------QMCGHIYPESP-VILPIGS-SFT--A-F
L9KSB2_TUPCH/4-90----------------------------------------------------HSCGHINPPSA-V.VQCGS-NFT--A-V
L5LZA8_MYODS/26-112----------------------------------------------------DVCGYIDPESP-V.VQLGS-NFT--A-V
Q9W6U9_CHICK/29-115----------------------------------------------------QSCGHIIPESP-V.LALGS-NFT--A-L
U3KE63_FICAL/318-404----------------------------------------------------......YFPAK-TLTSAGS-NIS--F-L
H0WB19_CAVPO/28-115----------------------------------------------------CKRGDVTVRPA-RVVALGS-AVE--V-S
IL6RB_RAT/26-112----------------------------------------------------EPCGYIYPEFP-V.VQRGS-NFT--A-T
L9JC93_TUPCH/24-110----------------------------------------------------EECGHISLPIP-I.VRLGD-PIT--A-S
G3X148_SARHA/23-106----------------------------------------------------.DCGDIQVSAS-V.IHLGA-SVT--A-S
F7BHT6_MONDO/28-110----------------------------------------------------CKKGAVTVSPA-RMVLLGS-TIN--I-S
H0VSE7_CAVPO/334-420----------------------------------------------------.....IYFPPK-ILTSAGS-NVS--F-H
CSF3R_MOUSE/24-111----------------------------------------------------ESCGHIEISPP-V.VRLGD-PVL--A-S
V8PEN3_OPHHA/29-110----------------------------------------------------NMCGYIVPESP-VKLSIGS-NFT--A-F
W5MYE4_LEPOC/28-112----------------------------------------------------..CGKIVPESP-V.IELNT-NFT--A-T
H0WL79_OTOGA/24-110----------------------------------------------------EACGHISLSAP-I.VRLGD-SVT--A-S
I12R2_BOVIN/28-110----------------------------------------------------CKRGDVTVQPS-HVISLGS-AVN--I-S
E2R8G9_CANFA/24-110----------------------------------------------------EECGRINLPTP-T.VHLGD-PLT--A-S
G1T0W6_RABIT/46-133----------------------------------------------------ETCGRISLSAS-T.VRLGA-PIT--A-S
F6Z8U4_XENTR/25-108----------------------------------------------------KFCGDIVPDPN-F.VHLEK-PFT--A-R
F1NDH9_CHICK/326-412----------------------------------------------------......YFPTK-ILTSVGS-NVS--F-H
H3BGX0_LATCH/26-112----------------------------------------------------DPCGILSVEAP-V.VLLGS-SVT--A-S
G3TD98_LOXAF/24-110----------------------------------------------------AECGRISLSHP-I.VRLGD-PVT--A-S
G3VNH6_SARHA/27-113----------------------------------------------------KLCGRIEPESP-V.IAFNT-TFT--A-T
G5C6G6_HETGA/24-111----------------------------------------------------ENCGHISISAH-V.MRLGD-PVT--A-S
V8P914_OPHHA/322-410----------------------------------------------------....VMYFPSK-LLASVGT-NVS--F-Y
G1L3X5_AILME/24-109----------------------------------------------------EECGRISLPTP-I.VHLGD-PIT--A-S
F1M9F2_RAT/331-418----------------------------------------------------....VMYFPPK-ILTSVGS-NAS--F-C
I12R2_MOUSE/28-120----------------------------------------------------CKLGTVTVQPA-PVIPLGS-AAN--I-S
H3AKP8_LATCH/27-113----------------------------------------------------DSWGYIIPEAK-V.LQLGT-QFT--A-S
F6VD48_MONDO/28-114----------------------------------------------------KPCGHIIPESP-I.ITPNT-KFT--A-I
M3WIJ4_FELCA/24-110----------------------------------------------------EECGHISLPTS-A.VRLGD-SIT--A-S
M3YTJ9_MUSPF/24-110----------------------------------------------------EECGRISLPTP-T.VHLGD-PIT--A-S
E1B9W2_BOVIN/24-110----------------------------------------------------EQCGHILLSAP-I.VRLGD-QVT--A-S

PF00207

CO4A_HUMAN/781-869---------------------------------------------------------NWLWRV-ETVD...-...--.-.
Q9VIT8_DROME/562-654---------------------------------------------------------TWLFTD-IRKS...-...--.-.
CO3_MOUSE/770-866---------------------------------------------------------SWLWTI-EELKE..-...--P-E
CO4B_MOUSE/779-867---------------------------------------------------------NWLWRV-EPVD...-...--.-.
Q7Q7T0_ANOGA/634-725---------------------------------------------------------SWLWQN-VSIG...-...--.-.
Q7Q4F0_ANOGA/564-653---------------------------------------------------------TWLWES-IKAK...-...--.-.
MUG2_MOUSE/740-830---------------------------------------------------------TWVWDI-VTVN...-...--.-.
Q7Q4I0_ANOGA/955-1046---------------------------------------------------------VWLWKD-VNIG...-...--.-.
A2MP_MOUSE/738-828---------------------------------------------------------TWIWDL-VIVD...-...--.-.
A2M_MOUSE/750-840---------------------------------------------------------TWIWDL-VPLD...-...--.-.
A2ML1_HUMAN/736-826---------------------------------------------------------TWLWDL-FPIG...-...--.-.
C3P1_HUMAN/10-104---------------------------------------------------------SWLWRK-FTLP...-...--.-.
CPMD8_HUMAN/750-841---------------------------------------------------------TWIWHC-LNIS...-...--.-.
OVOS2_HUMAN/726-816---------------------------------------------------------TWMWDL-VSVD...-...--.-.
Q29N18_DROPS/745-836---------------------------------------------------------NWIFYN-AEKT...-...--.-.
Q0C7A6_AEDAE/183-274---------------------------------------------------------SWFWKN-STM....-...--.-.
A2MG_PONAB/738-828---------------------------------------------------------TWIWDL-VVVN...-...--.-.
Q16YC2_AEDAE/682-773---------------------------------------------------------TWLFEN-AYS....-...--.-.
Q17K56_AEDAE/533-625---------------------------------------------------------SWLWKS-FSMD...-...--.-.
A7SDN3_NEMVE/771-861---------------------------------------------------------TWIFDE-YQTG...-...--.-.
CD109_HUMAN/693-784---------------------------------------------------------TWIWLD-TNMG...-...--.-.
Y3030_RALSO/871-965---------------------------------------------------------TAAWVA-NLQT...-...--.-.
A5PMP6_DANRE/779-875---------------------------------------------------------SWLWTD-IRLPST.-...--A-K
Q12VC6_METBU/707-796---------------------------------------------------------TWIWMP-EILT...-...--.-.
Q3A743_PELCD/1262-1354---------------------------------------------------------AVFWSG-IL.....-...--.-.
A7MNC2_CROS8/849-939---------------------------------------------------------TAAWLP-TLTT...-...--.-.
Q17M04_AEDAE/556-648---------------------------------------------------------TWLWTE-MIEV...-...--.-.
Q08R52_STIAD/712-804---------------------------------------------------------TLYWNA-GVRT...-...--.-.
Q1DE47_MYXXD/137-227---------------------------------------------------------TFLFEP-LVVT...-...--.-.
Q11S66_CYTH3/1263-1352---------------------------------------------------------AFFF.P-DLKT...-...--.-.
Q025N0_SOLUE/854-944---------------------------------------------------------TAFWNP-DLVT...-...--.-.
A7SSC0_NEMVE/10-101---------------------------------------------------------TWLWTE-ENVN...-...--.-.
Q2JJS1_SYNJB/901-991---------------------------------------------------------TAAWFP-DLVT...-...--.-.
Q7ULY0_RHOBA/1286-1375---------------------------------------------------------AFFF.P-ELIA...-...--.-.
Q2IJH5_ANADE/1222-1312---------------------------------------------------------TVLFAP-EVLT...-...--.-.
Q1D840_MYXXD/1246-1336---------------------------------------------------------TAFWAP-QVLT...-...--.-.
Q1IT69_KORVE/868-958---------------------------------------------------------TAYWSA-TVQT...-...--.-.
Q7MT05_PORGI/1146-1236---------------------------------------------------------TAFFEP-ALLT...-...--.-.
OVOS_CHICK/748-838---------------------------------------------------------TWIWDI-ILIN...-...--.-.
Y984_THEMA/714-802---------------------------------------------------------TALWIP-SLKL...-...--.-.
A6LJB2_THEM4/653-737---------------------------------------------------------TAYWNP-SLMK...-...--.-.
Q9VLT3_DROME/939-1030---------------------------------------------------------VWLWKD-VNIG...-...--.-.
Q7QGN1_ANOGA/635-726---------------------------------------------------------SWLWKN-ATI....-...--.-.
A6L1P0_BACV8/1146-1235---------------------------------------------------------AFFY.P-QLRT...-...--.-.
A8F825_THELT/720-808---------------------------------------------------------TALWIP-QLRT...-...--.-.
A5UX85_ROSS1/1485-1575---------------------------------------------------------TAFWNP-ALVT...-...--.-.
Q73KT0_TREDE/1174-1262---------------------------------------------------------VYFFGP-FEIK...-...--.-.
A6LIC0_PARD8/1134-1223---------------------------------------------------------AFFY.P-TLQT...-...--.-.
CD109_MOUSE/695-786---------------------------------------------------------TWIWLD-AYMG...-...--.-.
B4Q6W4_DROSI/635-727---------------------------------------------------------TWLFSD-INDV...-...--.-.
B4QA08_DROSI/759-850---------------------------------------------------------TWIFAD-IEST...-...--.-.
C3XSF4_BRAFL/154-244---------------------------------------------------------TWIFED-VQVD...-...--.-.
E3FS79_STIAD/1202-1290---------------------------------------------------------.ALWSG-VVPV...-...--.-.
F1QX13_DANRE/768-861---------------------------------------------------------SWLWEE-FDLC...-...--.-D
F1R0S4_DANRE/788-875---------------------------------------------------------SWLWEE-HLSK...-...--.-.
F1R8N2_DANRE/735-823---------------------------------------------------------TWIWEL-AEVG...-...--.-.
F1RQW2_PIG/780-867---------------------------------------------------------.WLWRV-EEVP...-...--.-.
F6TCT8_XENTR/740-830---------------------------------------------------------TWLWDL-VETD...-...--.-.
F7CSP0_XENTR/773-869---------------------------------------------------------SWFWKV-EQMVE..-...--K-A
F7CVI9_XENTR/767-856---------------------------------------------------------SWLWRT-VKVY...-...--.-.
H2LRL9_ORYLA/415-503---------------------------------------------------------SFAFTD-FEVN...-...--.-.
H2M6N3_ORYLA/762-861---------------------------------------------------------SWLWSD-IILPQCP-.PN--T-P
H2UUU6_TAKRU/643-731---------------------------------------------------------SFAFME-FDVN...-...--.-.
H3CLD7_TETNG/732-828---------------------------------------------------------SWLWRT-VDLPA..-...--Q-A
H3D959_TETNG/731-828---------------------------------------------------------SWLWTD-VVLPACP-ATQ--P-A
H3DA42_TETNG/714-803---------------------------------------------------------TWIWDL-VSVG...-...--.-.
H3DA56_TETNG/728-816---------------------------------------------------------TWVWKL-VKVG...-...--.-.
H3DDC7_TETNG/573-663---------------------------------------------------------TWVWHC-LNVS...-...--.-.
H3DHK0_TETNG/619-707---------------------------------------------------------TLLWID-SDVS...-...--.-.
H3DL28_TETNG/714-814---------------------------------------------------------SWLWTD-VNLPVNC-PVD--E-P
CO5_HUMAN/772-859---------------------------------------------------------SWLWEV-HLVP...-...--.-.
Q5LHC2_BACFN/1165-1253---------------------------------------------------------..FFYP-QLHT...-...--.-.
Q5ZUX7_LEGPH/1263-1351---------------------------------------------------------.VYWSG-ILDS...-...--.-.
Q7PMK4_ANOGA/645-736---------------------------------------------------------SWLWKT-DKIG...-...--.-.
Y4489_PSEAE/857-944---------------------------------------------------------TAAWQP-ELVT...-...--.-.
Q9VLY7_DROME/697-787---------------------------------------------------------TWLFLN-ISAS...-...--.-.
R4GGS2_CHICK/726-814---------------------------------------------------------SWLWRR-IHVA...-...--.-.
R5UFN1_9BACE/1152-1240---------------------------------------------------------..FFYP-QLRT...-...--.-.
R6X5P5_9PORP/1138-1223---------------------------------------------------------..FFYP-ALVT...-...--.-.
R7EM63_9BACE/1203-1287---------------------------------------------------------..FFYP-QLRT...-...--.-.

PF02960

K1_HHV8P/160-279------------------------------------------------------GLSSRLSNR-LCFSARC-ANI--T-P

PF03921

ICAM3_HUMAN/30-119----------------------------------------------------QE.FLLRVEPQ-NPVLSAG-GSL--F-V
ICAM2_HUMAN/24-114----------------------------------------------------EKVFEVHVRPK-KLAVEPK-GSL--E-V
ICAM2_MOUSE/22-114----------------------------------------------------EKAFEVYIWSE-KQIVEAT-ESW--K-I
ICAM1_HUMAN/24-115----------------------------------------------------PGNAQTSVSPS-KVILPRG-GSV--L-V
ICAM1_MOUSE/24-114----------------------------------------------------PGDAQVSIHPR-EAFLPQG-GSV--Q-V

PF02480

GE_PSHV1/44-516...........................DLATVRHVDIAHNIVPSEDRDHVFVSMPRMHVAWPH-GTTVLHP-KMI--I-A
GE_HHV2H/57-501EEDDAGVTNARRSAFPPQPPPRRPPVAPPTHPR....VIPEVSHVRGVTVHMETLEAILFAPG-ETFGTNV-SIH--A-I
GE_HHV11/59-506YDEDDNDEG.EDESLAGTPASGTPRLPPPPAPPRSWPSAPEVSHVRGVTVRMETPEAILFSPG-ETFSTNV-SIH--A-I
GE_VZVD/193-615...........................RNPTPA.......VTPQPRGAEFHMWNYHSHVFSVG-DTFSLAM-HLQ--Y-K
GE_GAHVM/41-479...........................RLPQMS.....SPMISSHADIKLSLKNFKALVYHVG-DTINVST-AVI--L-G

PF01537

K4P3S4_9ALPH/66-190-------------------------------------------------------DMLALIAD-PQVGRTL-WEA--V-R
Q86788_FHV1/60-176-------------------------------------------------------ELRLLDPR-VDVSSRS-PEK--.-.
Q67644_ILTV/108-239-------------------------------------------------------DVVELNPI-SNVDDMI-SAA--K-E
GD_SUHVR/56-181-------------------------------------------------------GVVALISD-PQVDRLL-NEA--V-A
GD_EHV1D/129-252-------------------------------------------------------EMIALIAK-TNIDSIL-KEL--A-A
Q89634_FHV1/69-193-------------------------------------------------------GMVALISE-PDIDATI-RTI--Q-L
O41524_9ALPH/49-174-------------------------------------------------------DMVALISN-PNIESTI-KTI--Q-F
GD_HHV1P/82-206-------------------------------------------------------RSVLLNAP-SEAPQIV-RGA--S-E
GD_CHV1/81-206-------------------------------------------------------RSVLLWAP-TEAVQVV-RGA--P-E
Q67648_9ALPH/79-203-------------------------------------------------------SFAVLNPF-GDPKYTL-LSL--L-L
Q77L58_MEHV1/64-188-------------------------------------------------------GFAVLNPI-SDPKYVL-LSQ--L-L
O90421_9ALPH/53-169-------------------------------------------------------ELRLLEPR-VNAAKRP-PER--.-.
Q5FBC8_9ALPH/54-170-------------------------------------------------------ELILLDPP-IDVSYRR-EDK--.-.
O39306_EHV4/54-170-------------------------------------------------------QLILLDPP-IDMGYRL-EDK--.-.
Q91E41_9ALPH/52-168-------------------------------------------------------ELHLLEPY-VNISLRS-KEK--.-.
O41523_9ALPH/53-168-------------------------------------------------------ELRLLDTY-VNVSSRP-EKK--.-.
O39504_9ALPH/64-183-------------------------------------------------------ALALLDMA-ETVVPGG-PRA--A-.
Q6X201_9ALPH/66-185-------------------------------------------------------ALVVLDME-NSIVPSG-PRD--A-.
Q87093_CHV1/74-190-------------------------------------------------------GLALLVPP-IRRFRGT-DGG--A-.
Q69367_9ALPH/73-189-------------------------------------------------------GLALLAPP-IRRFSGT-DGG--A-.
A7U885_HHV2/81-195-------------------------------------------------------GLVLLAPP-VRGF.GA-PNA--T-.
Q9QPU9_9ALPH/70-184-------------------------------------------------------QLATLHPS-LRHY.GK-TAQ--R-.

PF05326

Q99N75_MOUSE/3-124CLFLETP....YG-----------------------------------------------------------QE------
Q9D2X6_MOUSE/3-124CLILEIA....SG-----------------------------------------------------------QD------
Q76I99_MOUSE/3-123SLLLETA....YG-----------------------------------------------------------QD------
PIP_RAT/1-126CLQLGIN....EG-----------------------------------------------------------QD------
PIP_RABIT/3-126CLQLEIN....KA-----------------------------------------------------------EE------
PIP_CAVPO/3-126YLQLGVI....TA-----------------------------------------------------------QE------
PIP_BOVIN/3-127CLQLGTT....KA-----------------------------------------------------------QE------
E9PX96_MOUSE/10-142FLLQETAGFWYHG-----------------------------------------------------------LH------
G1QRT8_NOMLE/4-126CLQLGAN....KA-----------------------------------------------------------QD------
G7P1H3_MACFA/4-126CLHLGAN....KA-----------------------------------------------------------QE------
PIP_MOUSE/2-126CLQLGII....ES-----------------------------------------------------------QD------

PF15028

PTCRA_RAT/20-147CLVLDAA----PP-----------------------------------------------------------GL------
G1QXF2_NOMLE/20-146CLVLDVA----PP-----------------------------------------------------------GF------
PTCRA_BOVIN/31-157CLVLDVA----PP-----------------------------------------------------------GF------
G3WD30_SARHA/20-146CLVLDIS----PS-----------------------------------------------------------FA------
M3YPD2_MUSPF/40-162CLVLNVA----PP-----------------------------------------------------------GF------
H0VKD6_CAVPO/20-147CLVLDVA----AP-----------------------------------------------------------GP------
G1U7X8_RABIT/20-147CMVLDVA----PP-----------------------------------------------------------DP------

PF09085

W5PFN9_SHEEP/105-212CTAHNVT----PA-----------------------------------------------------------GP------
H0WQ95_OTOGA/112-222CTAHKVT----PV-----------------------------------------------------------GS------
G5E838_MOUSE/110-220CTAHNIW----PA-----------------------------------------------------------DP------
G1PL68_MYOLU/112-219CTAHNIT----PA-----------------------------------------------------------SP------
I3LSA9_PIG/49-158CTAHNVS----PA-----------------------------------------------------------RP------
M3W8G7_FELCA/115-224CTAHNVT----PV-----------------------------------------------------------SP------
MADCA_HUMAN/113-224CTAHKVT----PV-----------------------------------------------------------DP------
F7BUG9_MONDO/130-238CSAREVS----PY-----------------------------------------------------------D.------
I3N840_SPETR/111-217CTAHSVS----PT-----------------------------------------------------------..------
L8Y2P3_TUPCH/565-674CTAHNVT----PT-----------------------------------------------------------SQ------
G3HF34_CRIGR/110-220CTAHNIF----PP-----------------------------------------------------------GP------

PF11465

CD244_HUMAN/22-127-LQPNSI----QT-----------------------------------------------------------KV------
CD244_RAT/22-128-LRPSNI----QA-----------------------------------------------------------KH------
CD244_MOUSE/22-129-LRPSNI----QT-----------------------------------------------------------KD------

PF01688

GI_HHV2H/8-165GP..QGF----VE-----------------------------------------------------------ED------
GI_GAHVM/2-157GL..DKM----VN-----------------------------------------------------------..------
GI_PSHV1/10-157....EKV----ET-----------------------------------------------------------ED------
GI_VZVD/7-164PMQNDNY----TE-----------------------------------------------------------..------
GI_HHV11/8-165GP..DGV----VE-----------------------------------------------------------ED------

PF10430

F8W3C8_DANRE/7-103C--V-------SSDWSSG------------------------------------------------------GSVLALGQ
W5M5U9_LEPOC/23-114C--V-------NSEWSDS------------------------------------------------------........
W5KIA3_ASTMX/20-110C--V-------SSDWTPT------------------------------------------------------SS......
Q80YS4_MOUSE/24-118C--I-------ASGWHPH------------------------------------------------------........
G1KU09_ANOCA/38-132C--I-------TSRWCSL------------------------------------------------------........
F7EC20_XENTR/25-118C--I-------APEWSSP------------------------------------------------------........
H0YT27_TAEGU/25-119C--V-------TSKWHSR------------------------------------------------------........

PF08204

O57240_9POXV/2-124C--T-------IDN....------------------------------------------------------..------
CD47_BOVIN/8-140C--F-------VNNVETK------------------------------------------------------NI------
Q9DHI5_YLDV/7-104C--S-------S.NLPYN------------------------------------------------------SI------
CD47_HUMAN/8-142C--F-------VTNMEAQ------------------------------------------------------NT------
Q8JTQ3_LSDV/14-122C--D-------INHFKYN------------------------------------------------------..------
Q5ZL65_CHICK/8-141C--I-------VTNLKEN------------------------------------------------------ND------
Q9Q8V0_RFVKA/10-120C--N-------LDELIYK------------------------------------------------------DI------
Q9D9W5_MOUSE/8-139C--Y-------VSNIEAQ------------------------------------------------------DI------
Q8V3H1_SWPV1/6-113C--D-------ISSLIYS------------------------------------------------------NI------
Q6TUP1_YMTV5/1-98C--D-------V.KLPYN------------------------------------------------------SA------
A8VKH9_PIG/8-140C--F-------VNNMEAK------------------------------------------------------NI------
B2CWN5_9POXV/1-111C--N-------LDALIYK------------------------------------------------------DI------

PF16680

W5KJS3_ASTMX/45-112C--P-------ESDST----------------------------------------------------------------
H9GCG3_ANOCA/63-138C--S-------GGSEG----------------------------------------------------------------
K7GSE2_PIG/39-114C--G-------LPDQN----------------------------------------------------------------
CD3D_RAT/30-103C--N-------TS...----------------------------------------------------------------
H2NFG8_PONAB/39-114C--D-------AEAKN----------------------------------------------------------------
CD3E_PIG/42-118C--P-------EDPES----------------------------------------------------------------
G5BHL4_HETGA/19-92C--N-------TS...----------------------------------------------------------------
G3WJY6_SARHA/44-120C--N-------FKGKE----------------------------------------------------------------
F7F8D9_MONDO/35-112C--N-------FQEVQ----------------------------------------------------------------
I3MMT1_SPETR/36-114C--P-------PKTLQ----------------------------------------------------------------
F6X8V5_ORNAN/39-109C--N-------VLIKN----------------------------------------------------------------
L5KJW9_PTEAL/39-116C--K-------SKDKN----------------------------------------------------------------
F7CUQ0_HORSE/39-110C--G-------SKNEE----------------------------------------------------------------
E2RHB8_CANFA/39-114C--D-------SQSKD----------------------------------------------------------------
M3WFR1_FELCA/39-114C--E-------SPDKD----------------------------------------------------------------
CD3E_MOUSE/35-110C--P-------LDSDE----------------------------------------------------------------
U3ISR2_ANAPL/34-103C--G-------SHKE.----------------------------------------------------------------
F7F8B6_MONDO/49-121C--N-------GTE..----------------------------------------------------------------
G1M3D4_AILME/39-114C--E-------SQDKD----------------------------------------------------------------
J9NXV0_CANFA/30-103C--N-------TS...----------------------------------------------------------------
CD3G_SHEEP/9-84C--V-------TDEKK----------------------------------------------------------------
D4A5M2_RAT/30-105C--P-------LENED----------------------------------------------------------------
G5BHL3_HETGA/37-113C--F-------LDPST----------------------------------------------------------------
L5M0Z4_MYODS/24-101C--P-------EDPDS----------------------------------------------------------------
W5MH99_LEPOC/35-109C--P-------EDSDS----------------------------------------------------------------
F7CSX8_HORSE/46-120C--P-------ENFGN----------------------------------------------------------------
H0VN41_CAVPO/30-103C--N-------TT...----------------------------------------------------------------
G3U502_LOXAF/18-89P--D-------GN...----------------------------------------------------------------
M3XJR7_LATCH/43-115C--P-------TDY..----------------------------------------------------------------
G3IMA2_CRIGR/9-82C--N-------TS...----------------------------------------------------------------
F7FPX1_CALJA/30-103C--N-------TS...----------------------------------------------------------------
F1N9E2_CHICK/34-109C--Q-------ESKDD----------------------------------------------------------------
H3BFR3_LATCH/32-111C--K-------GVASQ----------------------------------------------------------------
H0UW68_CAVPO/43-116C--Y-------LNPEE----------------------------------------------------------------
W5PGT3_SHEEP/36-112C--P-------KDFEN----------------------------------------------------------------
I3MVU8_SPETR/39-109C--N-------SS...----------------------------------------------------------------
CD3E_BOVIN/36-113C--P-------REFEG----------------------------------------------------------------
G1SDA6_RABIT/30-103C--N-------TS...----------------------------------------------------------------
M3XZE1_MUSPF/30-101C--D-------TN...----------------------------------------------------------------
M3WFR0_FELCA/39-111C--N-------TS...----------------------------------------------------------------
CD3E_FELCA/47-124C--P-------EDLGS----------------------------------------------------------------
G3T784_LOXAF/30-104C--N-------GN...----------------------------------------------------------------
CD3D_MOUSE/30-103C--N-------TS...----------------------------------------------------------------
G3T782_LOXAF/35-111C--P-------VESEQ----------------------------------------------------------------
F1M9F8_RAT/39-114C--D-------LNEKT----------------------------------------------------------------
Q3LRP4_CALJA/42-120C--P-------RYDGH----------------------------------------------------------------
L5M0W2_MYODS/39-112C--N-------LEGKD----------------------------------------------------------------
B4F6W6_XENTR/31-102C--N-------SASS.----------------------------------------------------------------
W5PHC2_SHEEP/30-99C--N-------SS...----------------------------------------------------------------
CD3D_BOVIN/30-100C--N-------SS...----------------------------------------------------------------
I6LI21_MUSPF/32-108C--P-------EEVDT----------------------------------------------------------------
H0W6D3_CAVPO/39-114C--N-------SQDKE----------------------------------------------------------------
F7D784_MONDO/39-114C--P-------EKSED----------------------------------------------------------------
G7NCB9_MACMU/42-120C--S-------QHLGS----------------------------------------------------------------
G1STZ2_RABIT/39-114C--K-------LPDKN----------------------------------------------------------------
G8JL01_BOVIN/15-90C--V-------TNDTT----------------------------------------------------------------
K7GLV9_PIG/30-103C--N-------TS...----------------------------------------------------------------
F6WI60_MACMU/30-103C--N-------TS...----------------------------------------------------------------
L5M0S8_MYODS/30-101C--T-------G....----------------------------------------------------------------
G1MXZ8_MELGA/33-102C--Q-------TNKEE----------------------------------------------------------------
H0YPP3_TAEGU/33-105C--V-------RDQGS----------------------------------------------------------------
H0X808_OTOGA/42-120C--P-------LDTEH----------------------------------------------------------------
M3ZL37_XIPMA/31-110C--P-------LTGS.----------------------------------------------------------------
G3WK56_SARHA/41-113C--N-------GTA..----------------------------------------------------------------
G3T785_LOXAF/39-113C--N-------LADKH----------------------------------------------------------------
G3WKI7_SARHA/39-113C--P-------EKTNE----------------------------------------------------------------
CD3G_MOUSE/39-114C--G-------LTDKT----------------------------------------------------------------
G1SRV6_RABIT/14-92C--P-------VEADA----------------------------------------------------------------
G1M3E8_AILME/39-111C--N-------TS...----------------------------------------------------------------
G1R705_NOMLE/42-120C--P-------QYSGS----------------------------------------------------------------
CD3E_CANFA/47-124C--P-------DVFGY----------------------------------------------------------------
H0X0C4_OTOGA/30-103C--D-------SG...----------------------------------------------------------------
F6QRU0_XENTR/52-121C--P-------LEKQ.----------------------------------------------------------------
L5KKM4_PTEAL/24-101C--P-------EDSES----------------------------------------------------------------
L9KSF6_TUPCH/19-94C--D-------LQDKD----------------------------------------------------------------
M3XZF4_MUSPF/39-112C--D-------SKDTK----------------------------------------------------------------
I3MMT3_SPETR/39-114C--D-------LTDKY----------------------------------------------------------------
F7CIT2_HORSE/30-97C--N-------SS...----------------------------------------------------------------
G1M3G6_AILME/47-123C--P-------EEAEA----------------------------------------------------------------

PF00047

OX2G_RAT/34-136C--S-------LK....T------------------------------------------------------TQ------
CEAM1_HUMAN/331-411C--S-------TN.....------------------------------------------------------.D------
IGHM_CHICK/220-311C--R-------VSN..MV------------------------------------------------------NA------
IL6RA_MOUSE/30-107C--P-------GK....E------------------------------------------------------AA------
KI2S5_HUMAN/132-213C--S-------SR.....------------------------------------------------------.S------
NRG_DROME/525-609C--N-------EA...HD------------------------------------------------------DT------
TIE1_MOUSE/127-208A--H-------VH.....------------------------------------------------------KE------
KI2S5_HUMAN/32-115C--W-------SD.....------------------------------------------------------.V------
IGHE_MOUSE/209-300C--L-------VVD..LE------------------------------------------------------SE------
CSF1R_FELCA/207-293C--S-------AS....N------------------------------------------------------ID------
TIE1_MOUSE/353-439C--A-------AAG..NP------------------------------------------------------FP------
NTRK3_HUMAN/214-299C--N-------GS.....------------------------------------------------------GS------
MUCM_RABIT/11-105C--L-------AR...DF------------------------------------------------------LP------
KIT_HUMAN/216-305C--T-------IK....D------------------------------------------------------VS------
FLT3_MOUSE/256-346C--K-------AI....H------------------------------------------------------VN------
SEM3E_MOUSE/585-669C--T-------PR.....------------------------------------------------------.S------
FCGR1_MOUSE/204-284C--E-------TNL..LL------------------------------------------------------QR------
FGFR1_CHICK/37-115C--R-------LR.....------------------------------------------------------.D------
PGFRB_HUMAN/37-115C--S-------GS.....------------------------------------------------------..------
PTPRM_HUMAN/189-275C--S-------AI....G------------------------------------------------------RT------
CD4_MOUSE/25-127C--E-------SS.....------------------------------------------------------QK------
OPCM_RAT/227-311C--E-------AS.....------------------------------------------------------AV------
IGHD_HUMAN/173-264C--F-------VV...GS------------------------------------------------------DL------
V055_FOWPN/31-121C--F-------IKDDQGA------------------------------------------------------GE------
DIG1_CAEEL/310-389C--T-------SV.....------------------------------------------------------AY------
CD33_HUMAN/146-227C--S-------VSW.ACE------------------------------------------------------QG------
NRG_DROME/251-332C--I-------YG.....------------------------------------------------------GT------
DIG1_CAEEL/1822-1903C--N-------AT.....------------------------------------------------------GI------
IL1R2_HUMAN/241-341C--K-------VFL..GT------------------------------------------------------GT------
VCAM1_HUMAN/229-306C--S-------SE.....------------------------------------------------------GL------
OX2G_MOUSE/143-229C--S-------AT.....------------------------------------------------------AR------
KI3L1_HUMAN/32-110C--H-------YR.....------------------------------------------------------.H------
THY1_HUMAN/21-119C--R-------HE...NT------------------------------------------------------SS------
IL1BP_VACCW/228-322C--R-------VSL..RP------------------------------------------------------PT------

PF16758

UL14_HCMVM/48-234C--I-------FPAHDWP------------------------------------------------------EVSI----
UL141_HCMVM/51-241C--T-------VMTHSWP------------------------------------------------------MVSI----

PF13927

B4JUY8_DROGR/56-147C..A-------D......------------------------------------------------------..------
Q9E8G3_9ADEN/418-485C..G-------E.....P------------------------------------------------------VY------
Q14VV5_RAHV1/122-191CSGE-------L......------------------------------------------------------..------
Q05KR2_RAT/225-316C..N-------V....TG------------------------------------------------------QF------
D2GWX3_AILME/205-296C..N-------V.....S------------------------------------------------------GH------
Q9TV71_HORSE/225-316C..N-------V.....T------------------------------------------------------GM------
Q5R5D6_PONAB/81-172C..N-------V.....T------------------------------------------------------GQ------
B3RNX0_TRIAD/137-219C..T-------A.....S------------------------------------------------------GN------
Q4RP84_TETNG/334-402V..E-------G.....R------------------------------------------------------KK------
Q7TPQ6_MOUSE/37-119C..S-------A....VG------------------------------------------------------KP------
Q64861_9ADEN/137-203C..T-------N.....S------------------------------------------------------KY------
Q16X13_AEDAE/196-289C..S-------S......------------------------------------------------------.I------
B7Z4Y8_HUMAN/87-162S..S-------G......------------------------------------------------------WY------
A9Y0V1_9CICH/291-381V..L-------I.....E------------------------------------------------------AY------
B4F6P7_XENTR/145-216C..P-------D...TDG------------------------------------------------------FF------
A4JYH8_DANRE/212-293C..T-------T.....N------------------------------------------------------NP------
Q8AXU0_ONCMY/214-296C..T-------T.....H------------------------------------------------------NP------
A9Y0V0_9CICH/193-275C..T-------T.....H------------------------------------------------------NP------
Q4RZA3_TETNG/179-261C..M-------T.....H------------------------------------------------------NP------
B0WE60_CULQU/104-184C..N-------I.....I------------------------------------------------------AH------
Q675X8_OIKDI/328-400C..R-------YEFDGDH------------------------------------------------------LI------
A7RZM7_NEMVE/164-243C..H-------V....KV------------------------------------------------------AR------
C3PU48_HELVI/65-147C..P-------I....PK------------------------------------------------------SY------
Q9E8F9_9ADEN/415-478C..G-------I.....E------------------------------------------------------NN------
VS10L_MOUSE/484-552C..S-------W....PG------------------------------------------------------GV------
Q17P33_AEDAE/147-237C..E-------AFVGKLD------------------------------------------------------LP------
Q5M7A8_XENLA/139-209C..S-------A.....P------------------------------------------------------TK------
B5JJ62_9BACT/373-440A..T-------ASINVQY------------------------------------------------------QS------
A8KB70_DANRE/141-217C..S-------V......------------------------------------------------------VN------
A8E4T3_DANRE/125-204C..S-------V......------------------------------------------------------VN------
Q6PUA9_AMBME/211-289C..T-------I.....R------------------------------------------------------SQ------
Q6P6Y9_XENLA/207-286C..T-------I.....V------------------------------------------------------DV------
B4F6V0_XENTR/207-287C..T-------V.....M------------------------------------------------------DV------
A7LKP4_HORSE/132-214C..S-------V.....P------------------------------------------------------EE------
Q5GAK1_9VIRU/122-188C...-------.....VG------------------------------------------------------ET------
Q5CZQ8_DANRE/218-294L..N-------RSLVRLN------------------------------------------------------YT------
Q16ZU2_AEDAE/151-229C..A-------H......------------------------------------------------------IV------
B3MMJ5_DROAN/141-228C..T-------A.....G------------------------------------------------------RS------
Q25177_HYDVU/232-308C..L-------V......------------------------------------------------------DS------
VS10L_MOUSE/388-462C..S-------A......------------------------------------------------------PS------
B5JL51_9BACT/220-289L..S-------L....EH------------------------------------------------------VG------
B9XJC2_PEDPL/341-410V..L-------A....YG------------------------------------------------------SA------
B4A6E2_SALNE/162-234V..V-------V.....T------------------------------------------------------GG------
B9XRA3_PEDPL/769-839V..N-------A......------------------------------------------------------..------
B9XFJ5_PEDPL/981-1051V..T-------A......------------------------------------------------------..------
Q11WJ8_CYTH3/1793-1868V..A-------A......------------------------------------------------------.T------
B9XK99_PEDPL/434-502C..N-------V....SV------------------------------------------------------MG------
B9XNF4_PEDPL/912-982V..A-------A......------------------------------------------------------TG------
B9XJC2_PEDPL/171-239V..A-------A......------------------------------------------------------TG------
B9XIT4_PEDPL/501-570S..A-------L......------------------------------------------------------VG------
B9XNF4_PEDPL/1266-1335I..S-------A......------------------------------------------------------VG------
Q8QFN4_SALSA/217-311C..S-------AFLGVGE------------------------------------------------------GT------
MILR1_HUMAN/127-200C..L-------S.....V------------------------------------------------------NG------
I0AZP8_9POXV/264-344C..T-------A..VSTS------------------------------------------------------LL------
B1NA53_XENLA/215-283C..T-------V.....L------------------------------------------------------GT------
A7SRI5_NEMVE/60-138C..T-------F.....D------------------------------------------------------GF------
Q58EM0_DANRE/46-124C..S-------T....RD------------------------------------------------------VY------
B4F6P7_XENTR/242-336C..E-------VFCPFVR------------------------------------------------------NS------
Q5FW36_XENTR/237-331C..K-------VYIGNGG------------------------------------------------------NN------
IL1R2_MOUSE/248-342C..K-------V..FLGT------------------------------------------------------GT------
Q9N2H5_HORSE/236-330C..K-------V..FLGA------------------------------------------------------GT------
B5KH15_TETNG/127-187C..E-------A......------------------------------------------------------..------
Q5BKG7_XENTR/123-200C..V-------T......------------------------------------------------------TN------
Q8AXT5_SALSA/239-334C..E-------A..FCGQ------------------------------------------------------NI------
Q4VWU3_XENLA/180-252C..S-------S.TLTPA------------------------------------------------------RR------
A7TDK3_NEMVE/95-165C..N-------ATSTLVG------------------------------------------------------SW------
A4JYL8_DANRE/119-181C..S-------V......------------------------------------------------------DY------
Q4S0F0_TETNG/121-184C..S-------A......------------------------------------------------------.A------
A6NJE8_HUMAN/286-359C..E-------T.....Q------------------------------------------------------ED------
GP42_RAT/114-188C..E-------T.....Q------------------------------------------------------LG------
FCRL6_HUMAN/206-280C..E-------A.....Q------------------------------------------------------RG------
FCRL1_MOUSE/116-189C..K-------A.....L------------------------------------------------------RG------
D2I2T6_AILME/288-361C..E-------A.....Q------------------------------------------------------RG------
A7SAT9_NEMVE/170-237C..H-------A.....D------------------------------------------------------AY------
Q98173_MCV1/178-253C..T-------A.....A------------------------------------------------------GQ------
C3KJI3_ANOFI/124-193C..E-------A....YL------------------------------------------------------ID------
ILRL1_HUMAN/211-307C..S-------A..CFGK------------------------------------------------------GT------
ILRL1_RAT/216-311C..S-------ACFGTAS------------------------------------------------------QF------
B5XCQ4_SALSA/120-188C..E-------G....DT------------------------------------------------------TD------
B5XDA6_SALSA/115-177C..D-------V......------------------------------------------------------AN------
Q4SQP9_TETNG/121-187C..S-------V......------------------------------------------------------..------
Q676C3_OIKDI/705-769C..I-------A.....E------------------------------------------------------GY------
IRPL2_HUMAN/241-335C..K-------AFFGFSG------------------------------------------------------ES------
B0R0J8_DANRE/123-187C..I-------A.....D------------------------------------------------------GK------
Q3SZI9_BOVIN/149-216C..S-------V.....E------------------------------------------------------NP------
B4E1U5_HUMAN/83-150C..S-------V.....E------------------------------------------------------DA------
B5XGJ4_SALSA/128-200C...-------......S------------------------------------------------------SS------
Q18PG4_MOUSE/127-196C..S-------T.....D------------------------------------------------------QD------
Q6NZB6_MOUSE/352-421C..S-------V.....D------------------------------------------------------GG------
D2I0U5_AILME/321-390C..S-------V.....E------------------------------------------------------DS------
LY9_HUMAN/362-431C..S-------V.....E------------------------------------------------------DG------
SLAF5_HUMAN/134-197C..S-------V.....E------------------------------------------------------KE------
Q6NZB6_MOUSE/147-217C..T-------V.....K------------------------------------------------------GT------
D2I0U5_AILME/119-189C..F-------V.....E------------------------------------------------------RA------
LY9_HUMAN/156-226C..S-------V.....K------------------------------------------------------GA------
Q0ZHH3_SALSA/290-382C..E-------A....SG------------------------------------------------------FF------
B0WG40_CULQU/57-138C..S-------L....QY------------------------------------------------------HR------
Q4TGC2_TETNG/85-158C..A-------C....IS------------------------------------------------------QG------
A4JYH8_DANRE/415-499C..R-------S.....Y------------------------------------------------------GY------
A9Y0V0_9CICH/397-485C..T-------S.....H------------------------------------------------------GY------
CSF11_TAKRU/411-499C..T-------S.....F------------------------------------------------------GY------
Q8AXU0_ONCMY/416-504C..T-------S.....F------------------------------------------------------GY------
Q4T5K0_TETNG/309-397C..I-------A.....A------------------------------------------------------GY------
Q9MYN0_BOVIN/160-243C..V-------A.....A------------------------------------------------------GF------
Q6PUA9_AMBME/408-495C..V-------A.....A------------------------------------------------------GF------
B4F6V0_XENTR/405-489C..V-------A.....T------------------------------------------------------GF------
Q9DEE1_CHICK/207-302C..Q-------A...RLG------------------------------------------------------IK------
Q90874_CHICK/229-319C..N-------VSSGVYG------------------------------------------------------LL------
B3VBV3_RABIT/213-301C..S-------ALLNEKD------------------------------------------------------QL------
D3ZRM2_RAT/211-299C..S-------A......------------------------------------------------------VL------
Q86FD7_SCHJA/138-225C..E-------V.....D------------------------------------------------------GF------
A7S2Y7_NEMVE/135-214N..L-------TVIGIEV------------------------------------------------------KG------
A7RKF7_NEMVE/125-206V..S-------P.....Y------------------------------------------------------PT------
B7PBK2_IXOSC/49-137C..P-------I....EH------------------------------------------------------SL------
A9JTC6_DANRE/131-215C..N-------A....TE------------------------------------------------------GY------
Q7YS40_PIG/127-195C..L-------ILAASLR------------------------------------------------------HI------
Q28753_9CETA/127-199C..S-------I...PEG------------------------------------------------------DP------
A7YW37_BOVIN/141-211C..E-------IMEAGYD------------------------------------------------------ID------
D0UGD1_SALSA/144-215TPQA-------MKVVFQG------------------------------------------------------WN------
D0UGC3_SALSA/143-215TPQA-------MRVVFQG------------------------------------------------------RN------
Q4RU18_TETNG/215-283C..G-------A.....V------------------------------------------------------GR------
B5KH12_DANRE/121-187Y..V-------K.....D------------------------------------------------------VS------
C7FF20_CTEID/121-187C..N-------L.....D------------------------------------------------------PT------
A8CZ68_CYPCA/100-170C..K-------A.....D------------------------------------------------------SS------
A9CQ46_CARAU/114-180C..Q-------I.....E------------------------------------------------------ST------
B7P1H7_IXOSC/58-137C..T-------S......------------------------------------------------------YS------
Q4RGD6_TETNG/356-418C..S-------T.....H------------------------------------------------------CP------
Q4SGL7_TETNG/81-143C..Q-------S.....G------------------------------------------------------CG------
Q5EG07_ICTPU/362-434C..E-------D......------------------------------------------------------QS------
B4L0P5_DROMO/97-184C..V-------F.EIYPQ------------------------------------------------------NE------
ICAM3_PANTR/399-466C..Q-------A.....R------------------------------------------------------GN------
D2HGY8_AILME/379-446C..Q-------A.....R------------------------------------------------------GN------
ICAM3_BOVIN/400-467C..Q-------A.....R------------------------------------------------------GN------
ICAM1_BOVIN/393-460C..E-------A.....Q------------------------------------------------------GN------
Q9ERF7_CRIGR/391-458C..Q-------A.....F------------------------------------------------------GN------
Q4VWT0_XENLA/203-275C..Q-------T......------------------------------------------------------AK------
Q5ZKN0_CHICK/121-207C...-------.......------------------------------------------------------..------
B7UTR6_CHICK/312-386C..T-------S......------------------------------------------------------GV------
D2HUU5_AILME/123-194C..R-------L......------------------------------------------------------GT------
NCTR1_RAT/123-194C..H-------L.....K------------------------------------------------------TA------
Q8K4V6_MOUSE/523-602C..W-------S......------------------------------------------------------MD------
A5D7Q0_BOVIN/129-208C..Q-------S......------------------------------------------------------GN------
C9JMK7_HUMAN/314-393C..Q-------S......------------------------------------------------------WH------
A8MZH0_HUMAN/311-390C..Q-------S......------------------------------------------------------RG------
Q1I0P7_MACMU/323-402C..Q-------S......------------------------------------------------------..------
LIRB3_HUMAN/324-400C..Q-------S......------------------------------------------------------..------
Q67EV3_RAT/123-203CSSS-------MGFGRFI------------------------------------------------------LI------
D4AAQ4_RAT/141-221C..S-------SHQGYGR------------------------------------------------------YT------
D3ZRL6_RAT/122-197C..S-------S.....A------------------------------------------------------HN------
B1MTX6_CALMO/123-198C..S-------S.....A------------------------------------------------------HL------
A8K3V4_HUMAN/252-343C..L-------L.....K------------------------------------------------------NV------
CD86_HUMAN/138-222C..S-------S....IH------------------------------------------------------GY------
Q8K3J3_MERUN/138-220C..T-------S....EH------------------------------------------------------GF------
Q8CJE8_MESAU/137-221C..S-------S....KE------------------------------------------------------GY------
A8WX99_CAEBR/133-228T..E-------A......------------------------------------------------------.P------
OX2V_HHV6Z/146-225C..T-------V....TS------------------------------------------------------YP------
Q5YFN7_9VIRU/132-198C..K-------V....QT------------------------------------------------------AK------
Q4S7L7_TETNG/144-208C...-------.....GE------------------------------------------------------AW------
SLAF8_HUMAN/127-205C..W-------A......------------------------------------------------------PN------
Q3U1C3_MOUSE/125-203C..W-------A......------------------------------------------------------PN------
Q95JN1_MACFA/53-120C..T-------L....KG------------------------------------------------------TC------
A4GW16_CERAT/123-196R..Q-------A....TG------------------------------------------------------YP------
A4Q8S8_SPAAU/133-219C..P-------I....ED------------------------------------------------------FK------
Q14VV3_RAHV1/126-194C..S-------V....RR------------------------------------------------------TE------
Q4SPM6_TETNG/127-188C..R-------V.....R------------------------------------------------------GR------
Q90777_CHICK/186-256C..Q-------A.....V------------------------------------------------------GP------
D2HPH1_AILME/172-242C..Q-------A.....V------------------------------------------------------GP------
VS10L_MOUSE/288-369C...-------.....VG------------------------------------------------------WN------
D2H9T8_AILME/435-506C..R-------V......------------------------------------------------------..------
D3ZW99_RAT/125-200C..Q-------K....AG------------------------------------------------------SV------
TARM1_HUMAN/125-203C..Q-------K....RD------------------------------------------------------QL------
D2HYQ1_AILME/99-177C..Q-------R....PD------------------------------------------------------NV------
Q2V8M5_ICTPU/214-288C..I-------T...KVN------------------------------------------------------AR------
Q0GKW7_ICTPU/273-340C..D-------I....QD------------------------------------------------------EE------
Q4VWU8_XENLA/212-284C..D-------T.....E------------------------------------------------------LS------
Q6DCH5_XENLA/194-269C..D-------T.....N------------------------------------------------------LS------
B3RFN4_XENLA/196-268C..D-------T.....K------------------------------------------------------LS------
Q7YQJ5_CANFA/191-264C..E-------TKLLLQR------------------------------------------------------PG------
FCRLA_HUMAN/171-244C..Q-------T.....K------------------------------------------------------LP------
FCRLA_MOUSE/181-254C..Q-------TKLALQR------------------------------------------------------SA------

PF13895

D3ZVK9_RAT/327-417C--T...----SL.....------------------------------------------------------..------
D3ZQX2_RAT/63-153C--E...----RS.....------------------------------------------------------..------
IRPL2_HUMAN/143-231C--P..D----MDDF...------------------------------------------------------.K------
CD86_HUMAN/138-236C--S..S----IH.....------------------------------------------------------..------
A1BG_HUMAN/209-301C--V...----AP.....------------------------------------------------------..------
PECA1_PIG/327-405C--S...----IP.....------------------------------------------------------..------
PECA1_MOUSE/316-393C--S...----VS.....------------------------------------------------------..------
A6NJE8_HUMAN/104-185C--R...----AK.....------------------------------------------------------..------
VS10L_MOUSE/388-477C--S...----AP.....------------------------------------------------------..------
A7T6F1_NEMVE/26-106C--S...----AV.....------------------------------------------------------..------
A7RUN6_NEMVE/106-186C--T...----AT.....------------------------------------------------------..------
A1BG_MOUSE/28-125C--A...----VD.....------------------------------------------------------..------
A1BG_RAT/218-314C--K...----AP.....------------------------------------------------------..------
FCRLA_MOUSE/79-175C--R...----AW.....------------------------------------------------------..------
D3ZRM2_RAT/20-112C--D...----MSAP...------------------------------------------------------.M------
Q11VY4_CYTH3/701-789C--E...----ADTV...------------------------------------------------------.N------
A6GXG9_FLAPJ/1010-1093C--A...----SPTV...------------------------------------------------------TL------
FCRLB_HUMAN/22-100C--D...----GYHP...------------------------------------------------------LL------
IL1R1_RAT/122-217C--P...----YLDFF..------------------------------------------------------KD------
GP42_RAT/22-108C--T...----TK.....------------------------------------------------------..------
A6QQQ4_BOVIN/113-195C--H...----SW.....------------------------------------------------------..------
ILRL2_RAT/126-220C--H...----LYF....------------------------------------------------------.P------
A7SZF2_NEMVE/222-298C--S...----AS.....------------------------------------------------------..------
A1SP19_NOCSJ/451-536C--SQGT----WS.....------------------------------------------------------..------
C3XPD2_BRAFL/8-98C--S...----AN.....------------------------------------------------------..------
B7Q9Q6_IXOSC/51-137C--R...----AG.....------------------------------------------------------..------
B3RLN9_TRIAD/257-344C--Q...----AQ.....------------------------------------------------------..------
A7SRI5_NEMVE/63-151C--T...----FD.....------------------------------------------------------..------
TACT_HUMAN/25-136C--Q...----TQT....------------------------------------------------------..------
ISLR2_HUMAN/240-372C--I...----AD.....------------------------------------------------------..------
B4DVJ9_HUMAN/23-102C--Q...----GE.....------------------------------------------------------..------
E9PD35_HUMAN/138-224C--L...----VS.....------------------------------------------------------..------
E9PX73_MOUSE/46-128C--T...----VK.....------------------------------------------------------..------
F1P3W0_CHICK/181-268C--T...----IR.....------------------------------------------------------..------
F1R1B9_DANRE/314-392C--S...----SSVIS..------------------------------------------------------NK------
F6QPE0_BOVIN/327-404C--S...----IP.....------------------------------------------------------..------
F7AWH8_XENTR/85-171C--....----FP.....------------------------------------------------------..------
F7DK71_HORSE/161-253C--PE.L----SEF....------------------------------------------------------..------
F7DLW8_HORSE/326-403C--S...----IP.....------------------------------------------------------..------
G1L4E1_AILME/105-189C--R...----GW.....------------------------------------------------------..------
G1L7T4_AILME/329-410C--S...----IPGA...------------------------------------------------------.P------
G1M3E0_AILME/129-211C--H...----LNF....------------------------------------------------------.P------
G1M8A4_AILME/973-1063C--Q...----GP.....------------------------------------------------------..------
H2NXI9_PONAB/312-389C--A...----AG.....------------------------------------------------------..------
H2RC57_PANTR/28-117C--Q...----GSLEAQE------------------------------------------------------NH------
H3CEP5_TETNG/209-301C--S...----ST.....------------------------------------------------------..------
H3CGE1_TETNG/471-557C--A...----VL.....------------------------------------------------------..------
M0RCJ0_RAT/106-186C--H...----SW.....------------------------------------------------------..------
M3XWI6_MUSPF/119-204C--Q...----AW.....------------------------------------------------------..------
LIRB5_HUMAN/28-115C--Q...----GP.....------------------------------------------------------..------
PECA1_HUMAN/327-404C--S...----IP.....------------------------------------------------------..------

PF16706

G1TVX5_RABIT/169-260C--K----------------------------------------------------------------------------
F6YE25_HORSE/168-260C--E----------------------------------------------------------------------------
H0UTJ7_CAVPO/168-259C--H----------------------------------------------------------------------------
F6UM65_CANFA/166-254C--E----------------------------------------------------------------------------
M3W7L5_FELCA/169-261C--E----------------------------------------------------------------------------
H9H653_MONDO/206-297C--E----------------------------------------------------------------------------
V8PHR1_OPHHA/159-248C--A----------------------------------------------------------------------------
L5LHN8_MYODS/162-254C--E----------------------------------------------------------------------------
H0WN21_OTOGA/168-257C--E----------------------------------------------------------------------------
IZUM1_MOUSE/168-260C--L----------------------------------------------------------------------------
G3TPD8_LOXAF/168-260C--E----------------------------------------------------------------------------
IZUM1_RAT/168-260C--Q----------------------------------------------------------------------------
I3MLV0_SPETR/170-262C--L----------------------------------------------------------------------------
G1M882_AILME/167-255C--E----------------------------------------------------------------------------
G1QXF7_NOMLE/168-260C--E----------------------------------------------------------------------------
W5PRD0_SHEEP/169-261C--E----------------------------------------------------------------------------
H3DD44_TETNG/58-151C--L----------------------------------------------------------------------------

PF07654

O35424_MOUSE/129-211C-----S----VT---GF------------------------------------------------------YP------
IGKC_HUMAN/12-98C-----L----LN---NF------------------------------------------------------YP------
KACB_RAT/12-98C-----L----MN---NF------------------------------------------------------YP------
IGKC_MOUSE/12-98C-----F----LN---NF------------------------------------------------------YP------
KAC5_RABIT/12-95C-----V----AN---KY------------------------------------------------------FP------
LAC1_MOUSE/13-96C-----T----IT---DF------------------------------------------------------YP------
LAC2_MOUSE/13-95C-----L----IS---NF------------------------------------------------------SP------
LAC_PIG/13-96C-----L----IS---DF------------------------------------------------------YP------
LAC_RABIT/13-96C-----L----IS---DF------------------------------------------------------YP------
TCB2_MOUSE/17-102C-----L----AR---GF------------------------------------------------------FP------
IGHE_HUMAN/331-415C-----L----IQ---NF------------------------------------------------------MP------
IGHE_RAT/322-410C-----L----IQ---NF------------------------------------------------------FP------
IGHG1_HUMAN/13-95C-----L----VK---DY------------------------------------------------------FP------
IGHG1_HUMAN/130-216C-----V----VV---DV------------------------------------------------------SH------
IGHG1_HUMAN/236-321C-----L----VK---GF------------------------------------------------------YP------
IGHG2_CAVPO/234-321C-----L----II---NF------------------------------------------------------FP------
GCAA_MOUSE/13-94C-----L----VK---GY------------------------------------------------------FP------
GCAA_MOUSE/130-216C-----V----VV---DV------------------------------------------------------SE------
GCAA_MOUSE/236-321C-----M----VT---DF------------------------------------------------------MP------
GCAB_MOUSE/241-326C-----M----IT---GF------------------------------------------------------LP------
IGG2B_MOUSE/241-326C-----L----VV---GF------------------------------------------------------NP------
IGHG1_MOUSE/230-315C-----M----IT---DF------------------------------------------------------FP------
IGHG_RABIT/123-209C-----V----VV---DV------------------------------------------------------SQ------
IGHM_HUMAN/337-425C-----L----VT---GF------------------------------------------------------SP------
IGHM_CHICK/330-419C-----M----AQ---GF------------------------------------------------------NP------
IGHA1_HUMAN/12-96C-----L----VQ---GF------------------------------------------------------FP------
IGHA_MOUSE/12-95C-----L----IH---DY------------------------------------------------------FP------
IGHA_RABIT/182-272C-----L----VR---GF------------------------------------------------------SP------
IGHD_HUMAN/14-96C-----L----IT---GY------------------------------------------------------HP------
B2MG_RABIT/11-92C-----Y----VS---GF------------------------------------------------------HP------
B2MG_CAVPO/11-92C-----Y----VS---GF------------------------------------------------------HP------
B2MG_MOUSE/31-112C-----Y----VT---QF------------------------------------------------------HP------
B2MG_BOVIN/31-111C-----Y----VY---GF------------------------------------------------------HP------
IGHG3_MOUSE/235-320C-----L----VT---NF------------------------------------------------------FS------
DPB1_HUMAN/130-212C-----H----VT---DF------------------------------------------------------YP------
DOB_HUMAN/129-211C-----S----VT---GF------------------------------------------------------YP------
DPA1_HUMAN/124-206C-----H----ID---KF------------------------------------------------------FP------
IGHG1_RAT/232-317C-----M----VK---GF------------------------------------------------------YP------
IGG2B_RAT/239-324C-----L----TS---GF------------------------------------------------------LP------
IGG2C_RAT/13-94C-----L----VK---GY------------------------------------------------------FP------
LAC_CHICK/14-95C-----L----IN---DF------------------------------------------------------YP------
IGLL1_MOUSE/117-200C-----L----VS---EF------------------------------------------------------YP------
B2MG_CHICK/31-112C-----F----AA---GF------------------------------------------------------HP------
B2MG_HORSE/31-111C-----Y----VS---GF------------------------------------------------------HP------
B2MG_DANRE/30-109C-----Y----VS---SF------------------------------------------------------HP------
Q8WM94_DANRE/110-193C-----H----VT---GF------------------------------------------------------YP------
Q90ZJ6_ORYLA/30-109C-----H----VS---NF------------------------------------------------------HP------
A6QQE7_BOVIN/117-198C-----Q----VD---NI------------------------------------------------------FP------
E9QFF8_DANRE/65-144C-----H----AT---GF------------------------------------------------------YP------
F1NSZ6_CHICK/135-210C-----Y----VT---GF------------------------------------------------------YP------
F1RBP5_DANRE/141-220C-----S----AY---EF------------------------------------------------------YP------
F6UY61_MONDO/133-213C-----S----VS---GF------------------------------------------------------YP------
F6W9R2_CALJA/32-111C-----Y----VS---GF------------------------------------------------------HP------
G1TXW3_RABIT/124-203C-----Y----VW---GF------------------------------------------------------YP------
H0UYJ7_CAVPO/115-195C-----H----VD---KF------------------------------------------------------FP------
H2MX91_ORYLA/120-197C-----S----VY---DF------------------------------------------------------YP------
H9GZQ9_HORSE/243-325C-----L----VK---DF------------------------------------------------------YP------
I3KVH2_ORENI/112-193C-----H----VT---GF------------------------------------------------------YP------
M3VX36_FELCA/121-201C-----F----ID---KF------------------------------------------------------SP------
M3W4D7_FELCA/33-111C-----W----AL---GF------------------------------------------------------YP------
M9MM93_DANRE/109-191C-----H----VT---GF------------------------------------------------------FP------
O62938_XIPMA/119-197C-----S----AY---DF------------------------------------------------------YP------
DQA1_HUMAN/118-199C-----L----VD---NI------------------------------------------------------FP------
HB2D_PIG/132-213C-----A----VT---DF------------------------------------------------------YP------
HB2D_RAT/130-211C-----S----VS---DF------------------------------------------------------YP------
HA2J_MOUSE/118-199C-----F----VD---NI------------------------------------------------------FP------
Q1MTC8_DANRE/121-202C-----S----AY---EF------------------------------------------------------YP------
Q5M8Y9_XENTR/126-205C-----F----VD---GF------------------------------------------------------FP------
Q5XJ70_DANRE/111-191C-----Y----VT---GF------------------------------------------------------FP------
Q70IB5_BOVIN/134-215C-----S----VT---DF------------------------------------------------------YP------
R0JJE7_ANAPL/108-187C-----Y----VT---GF------------------------------------------------------YP------
W5PE14_SHEEP/119-200C-----I----VD---NI------------------------------------------------------FP------

PF02124

GC_PSHV1/234-457C-----R----AS---DI------------------------------------------------------LC------
GC_VZVD/379-589C-----T----AK---CV------------------------------------------------------PR------
GC_HHV11/291-500C-----T----AG---CV------------------------------------------------------PE------
GC_GAHVM/283-492C-----T----IE---CV------------------------------------------------------PS------
GC_HHV2H/260-469C-----T----AG---CV------------------------------------------------------PE------

PF07679

LRIG1_MOUSE/601-691C-----A----AT---GH------------------------------------------------------.P------
TITIN_HUMAN/7385-7474C-----E----IS---GT------------------------------------------------------.P------
PALLD_HUMAN/271-361C-----R----VT---GN------------------------------------------------------.P------
PALLD_HUMAN/1135-1225C-----K----VS---GL------------------------------------------------------.P------
HMCN2_HUMAN/4309-4395C-----Q----AT---GE------------------------------------------------------.P------
IGDC3_HUMAN/330-417C-----Q----AQ---GE------------------------------------------------------.P------
NCAM2_HUMAN/21-111C-----T----AI---GE------------------------------------------------------.P------
MYOM1_MOUSE/1555-1645C-----N----VW---GD------------------------------------------------------.P------
OBSCN_HUMAN/10-99C-----Q----IV---GN------------------------------------------------------.P------
PXDN_HUMAN/433-519C-----E----AK---GN------------------------------------------------------.P------
Q08476_CHICK/180-269C-----Q----VA---GT------------------------------------------------------.P------
Q08476_CHICK/372-461C-----H----IS---GT------------------------------------------------------.Q------
HMCN1_HUMAN/1171-1258C-----N----AQ---GT------------------------------------------------------.P------
O00557_HUMAN/20-114C-----Q----VA---GD------------------------------------------------------AK------
UNC89_CAEEL/648-737C-----E----VE---GW------------------------------------------------------.P------
UNC89_CAEEL/3286-3377V-----T----VK---GV------------------------------------------------------.P------
UNC89_CAEEL/3482-3573V-----T----VI---GT------------------------------------------------------.P------
UNC89_CAEEL/3920-4010G-----K----IS---GK------------------------------------------------------.P------
MYLK_SHEEP/331-421C-----K----IE---GY------------------------------------------------------.P------
MUSK_HUMAN/121-208C-----T----TM---GN------------------------------------------------------.P------
ROBO1_RAT/262-347C-----E----AR---GD------------------------------------------------------.P------
O55124_MOUSE/1345-1435C-----T----VF---GN------------------------------------------------------.P------
O57576_CYNPY/213-301C-----D----AD---GF------------------------------------------------------.P------
O76281_DROME/1225-1316I-----N----IR---GE------------------------------------------------------.P------
O76281_DROME/3892-3982I-----P----IS---GA------------------------------------------------------.P------
O76281_DROME/6357-6446C-----Y----VK---GD------------------------------------------------------.P------
CAVPT_BRALA/59-149A-----R----VW---GI------------------------------------------------------.P------
MYLK_CHICK/28-118G-----K----VR---GY------------------------------------------------------.P------
MYLK_CHICK/156-245C-----K----IT---GR------------------------------------------------------.P------
A4V2I0_DROME/25-135C-----T----VE---EV------------------------------------------------------.G------
P79757_CHICK/328-417C-----D----VD---GE------------------------------------------------------.P------
P79757_CHICK/734-823C-----E----VS---GD------------------------------------------------------.P------
UNC22_CAEEL/4150-4239V-----D----FI---GA------------------------------------------------------.P------
UNC22_CAEEL/6585-6674C-----R----VI---AS------------------------------------------------------.S------
UNC22_CAEEL/6863-6953A-----A----VS---GQ------------------------------------------------------.P------
VCAM1_CANFA/25-112C-----S----TT---GC------------------------------------------------------.E------
Q8BID4_MOUSE/6-97A-----H----VS---GS------------------------------------------------------.P------
Q8T103_BOMMO/4625-4714C-----K----IV---GK------------------------------------------------------.P------
Q90X22_DANRE/66-155V-----T----VS---GF------------------------------------------------------.P------
Q90X22_DANRE/178-268Y-----K----VT---GT------------------------------------------------------.P------
Q90YM0_DANRE/209-296C-----R----AY---GS------------------------------------------------------.P------
Q90Z41_CHICK/223-308C-----Q----VQ---GD------------------------------------------------------.P------
Q95YM1_PROCL/4632-4721C-----I----IT---AS------------------------------------------------------.P------
Q98918_CHICK/3071-3160C-----R----VT---GT------------------------------------------------------..------
SPEG_MOUSE/727-816C-----I----IT---AN------------------------------------------------------.P------
SPEG_MOUSE/1490-1579V-----V----VE---GK------------------------------------------------------.P------
Q9GV22_MYTGA/344-433C-----K----II---GA------------------------------------------------------.S------
Q9GV22_MYTGA/647-736C-----T----VK---GQ------------------------------------------------------.P------

PF02440

Q4KSJ0_9ADEN/110-200V-----T----LV---GP------------------------------------------------------.Q------
Q91CB8_ADE08/236-321V-----S----LT---GP------------------------------------------------------.P------
Q80IV8_ADE08/252-335L-----T----LL---GP------------------------------------------------------..------
Q91PL0_9ADEN/13-104N-----T----LI---GP------------------------------------------------------PI------
Q6QPD0_9ADEN/15-113Y-----T----LK---GP------------------------------------------------------.P------
Q6H1B4_9ADEN/16-113C-----V----LT---GY------------------------------------------------------QS------
Q3ZKT4_9ADEN/13-104H-----T----LV---GP------------------------------------------------------PI------
Q76C87_ADE08/128-219K-----T----FI---GP------------------------------------------------------.P------
E3TMR2_ADE16/13-100C-----T----LQ---GP------------------------------------------------------.Q------
Q8JZH7_ADE17/110-200K-----T----LV---GP------------------------------------------------------.P------
E321_ADE35/14-100C-----T----LK---GP------------------------------------------------------.Q------
Q7TBH0_ADE08/34-124L-----T----LV---GP------------------------------------------------------.L------
B9A5V9_9ADEN/260-345L-----T----LV---GP------------------------------------------------------KA------
Q8JZH7_ADE17/15-105I-----T----LV---GP------------------------------------------------------.S------
Q6QP93_9ADEN/15-105A-----T----LV---GI------------------------------------------------------.S------
Q8UY72_9ADEN/16-114H-----T----LK---GP------------------------------------------------------EK------
B9A5V9_9ADEN/110-200K-----T----LE---GP------------------------------------------------------.P------
Q4KSJ0_9ADEN/254-339L-----T----LV---GP------------------------------------------------------..------
Q6QPD1_9ADEN/15-112G-----T----LE---GT------------------------------------------------------QS------
Q91CB6_ADE09/110-200I-----T----LV---GP------------------------------------------------------.S------

PF07686

TVB8_MOUSE/25-130C.....E----QH...L.....--------------------------------------------------.G------
MPZL2_HUMAN/30-143C.....T----FS...SF.APV--------------------------------------------------GD------
IGS11_HUMAN/27-141C.....T----FT...TS..AA--------------------------------------------------LI------
TVB1_MOUSE/25-132C......----IP...EK....--------------------------------------------------.G------
CD2_HORSE/25-122I......----.P...AF.QMS--------------------------------------------------EH------
CLM2_MOUSE/19-124C.....Q----YS...PS..Y.--------------------------------------------------.K------
GPA33_HUMAN/25-138C.....T----YH...TS..TS--------------------------------------------------SR------
TVA2_MOUSE/26-132C.....T----FS...DS....--------------------------------------------------.A------
TVB1_HUMAN/25-135C.....K----PI...S.....--------------------------------------------------.G------
HVM07_MOUSE/24-138C.....K----AS...GY...T--------------------------------------------------FT------
LV603_HUMAN/5-110C.....T----RS...DG..TI--------------------------------------------------.A------
Q9UEL6_HUMAN/15-129C.....K----FK...ST.STT--------------------------------------------------GG------
MO2R1_MOUSE/42-147C....FS----IP...LT....--------------------------------------------------.K------
SHPS1_BOVIN/38-145C....TV----TS...LS....--------------------------------------------------.P------
CD2_MOUSE/23-121I......----.P...NF.QMT--------------------------------------------------DD------
TIMD4_HUMAN/23-128C.....L----YS...SW...S--------------------------------------------------HN------
TVC_HUMAN/24-136C.....D----LT........V--------------------------------------------------TN------
FAIM3_HUMAN/19-123C.....P----LP.........--------------------------------------------------EM------
TVA2_HUMAN/32-138C.....D----YT...NS....--------------------------------------------------.M------
HV108_HUMAN/5-119C.....K----AS...GY...A--------------------------------------------------FE------
CEA21_HUMAN/38-141V.....V----YL...PE....--------------------------------------------------.N------
CSPG2_MOUSE/27-148CH..FST----LPTLPPN.YNT--------------------------------------------------SE------
SIGL5_HUMAN/24-140C.....S----FSYPWRS.WYS--------------------------------------------------SP------
VSIG1_CHICK/26-136C.....T----YT...SS..QP--------------------------------------------------LG------
HV107_HUMAN/5-115C.....K----VS...GD...D--------------------------------------------------FN------
TVB5_MOUSE/14-122C.....H----QT.........--------------------------------------------------NN------
CXAR_DANRE/28-142C.....Q----FT...LA.SDD--------------------------------------------------SG------
CEAM4_HUMAN/38-141A.....C----NI...SE....--------------------------------------------------.T------
HHLA2_HUMAN/226-330C....QP----VN...DY.FSP--------------------------------------------------NQ------
PVRL4_HUMAN/35-146C.....F----YR...GD..SG--------------------------------------------------EQ------
CD8B_FELCA/24-135C.....E----AK...TS..PT--------------------------------------------------..------
SKIT3_MOUSE/32-141C.....Q----LS...PP..QN--------------------------------------------------AQ------
PDCD1_MOUSE/37-145C.....S----LS...NW..S.--------------------------------------------------.E------
KV123_HUMAN/28-129C.....R----AS...QS....--------------------------------------------------.I------
Q8UV83_DANRE/144-247C.....S----VE...GK.TCD--------------------------------------------------KG------
SCN2B_HUMAN/33-147C.....T----FN..SCY.TVN--------------------------------------------------HK------
VSIG2_HUMAN/27-142C.....T----YS...TS...V--------------------------------------------------GD------
FCAMR_HUMAN/65-171C.....H----YA...PS..SV--------------------------------------------------NR------
LV1B_MOUSE/24-128C.....R----SS...TG..AV--------------------------------------------------TT------
CD8A_MOUSE/36-148C.....E----VL...GS....--------------------------------------------------.V------
CLM5_MOUSE/23-126C.....R----YS...SY..W.--------------------------------------------------.K------
JAML1_HUMAN/25-136C.....V----FQ...ST..ED--------------------------------------------------KC------
BTNLA_MOUSE/37-146C.....K----LS...LN..IS--------------------------------------------------AE------
TVB6_MOUSE/27-136C.....I----LK...NS....--------------------------------------------------.Q------
CD7_HUMAN/31-132C......----.....ST....--------------------------------------------------.S------
TVA1_HUMAN/25-131C.....V----YE...TR..D.--------------------------------------------------.T------
CD2_HUMAN/28-127I......----.P...SF.QMS--------------------------------------------------DD------
TVA1_MOUSE/25-130C.....K----YS...YS....--------------------------------------------------.A------
CD2_RAT/23-120I......----.P...NF.QMT--------------------------------------------------DD------
SCN3B_MOUSE/28-143C....IS----CM...KR.EEV--------------------------------------------------EA------
VPREB_HUMAN/24-134C.....T----LR...ND..HD--------------------------------------------------IG------
TREM1_MOUSE/25-134C.....P----FN......IMK--------------------------------------------------YA------
SCN1B_HUMAN/23-139C....IS----CK...RR.SET--------------------------------------------------NA------
Q9R121_RAT/32-135V.....H----EM...PL....--------------------------------------------------.N------
SIRPD_HUMAN/34-140C....SV----PN...TL....--------------------------------------------------.P------
MXRA8_HUMAN/168-292CVNRGHV----WT...DR.HVE--------------------------------------------------EA------
A2BGB5_DANRE/30-142C.....T----FK...SNRPLS--------------------------------------------------EE------
B8ZZZ4_HUMAN/29-130C.....Q----VL...LS....--------------------------------------------------NP------
F1NMT9_CHICK/44-146C.....H----LS...PC..KD--------------------------------------------------AR------
F1P992_CANFA/18-131C.....K----FT...LS.PED--------------------------------------------------QG------
F6RFK3_CHICK/32-139C.....P----MK...G.....--------------------------------------------------.E------
G3V7D2_RAT/42-151C.....E----YA...SS..HN--------------------------------------------------TD------
L8YBJ5_TUPCH/164-276C.....S----FW...SS.EWV--------------------------------------------------SD------
M0QX98_HUMAN/6-107V.....H----NL...PQ....--------------------------------------------------.H------
CD8B_RAT/24-134C.....E----AK...TF....--------------------------------------------------PK------
Q3LFS9_MOUSE/42-141V.....H----NL...PL....--------------------------------------------------.A------
Q5SNP6_DANRE/26-130C.....F----HS...DD....--------------------------------------------------.F------
Q8BNV8_MOUSE/24-121C.....W----YD...SL....--------------------------------------------------YH------
Q8K094_MOUSE/37-141C.....S----LT...SN..EN--------------------------------------------------VT------
Q9JHL7_RAT/42-140A.....H----NL...PQ....--------------------------------------------------.E------

PF05790

CD2_HUMAN/135-205------------V---MNGT..---....-------------------------------------------..------
Q8K0X1_MOUSE/133-221------------R---LEIDLF---KGDQ-------------------------------------------LM------
CD4_RAT/316-390------------V---MGPT..---..SP-------------------------------------------KM------
CD4_SAISC/125-202------------S---LTLTLE---S.PP-------------------------------------------GS------
VCAM1_HUMAN/133-221------------R---LEIDLL---KGDH-------------------------------------------LM------
CD4_RABIT/318-390------------V---LGPI..---..DP-------------------------------------------KM------
CD2_RAT/128-198------------V---LEGT..---....-------------------------------------------..------
VCAM1_CANFA/133-221------------R---LEMNLL---NGND-------------------------------------------LL------
CD4_RAT/127-206------------S---LTLILD---SNPK-------------------------------------------VS------
Q9GKR2_BOVIN/134-222------------R---LEIELL---KGNR-------------------------------------------PM------
CD4_RABIT/129-208------------S---LTLTLE---G.PS-------------------------------------------VG------
CD2_MOUSE/129-199------------V---LQGT..---....-------------------------------------------..------
VCAM1_CANFA/421-509------------R---LEIELF---KGET-------------------------------------------II------
VCAM1_RAT/133-221------------R---LEIELF---KGDR-------------------------------------------LM------
CD4_CANFA/133-211------------Q---LTLTLE---N.PS-------------------------------------------GS------
Q9GKR2_BOVIN/422-510------------Q---LEIELF---KGES-------------------------------------------IM------
O55054_MOUSE/104-183------------S---LTLTLD---SNSK-------------------------------------------VS------
P79355_FELCA/332-405------------V---LGPT..---..SP-------------------------------------------EL------
CD4_CANFA/321-392------------V---LGPT..---..SP-------------------------------------------EL------
VCAM1_RAT/421-509------------H---LEIELL---KGET-------------------------------------------TL------
CD4_DELLE/314-387------------V---LGPT..---..SP-------------------------------------------RL------
Q28939_PIG/134-219------------K---LEIELL---KDNH-------------------------------------------SM------
O88650_MARMO/10-83------------V---LGPT..---..PP-------------------------------------------KL------
P70443_MOUSE/8-81------------V---MGPT..---..SP-------------------------------------------KM------
CD2_HORSE/130-201------------V---TKGT..---....-------------------------------------------..------
CD4_DELLE/125-203------------S---LTLTLE---G.PS-------------------------------------------GS------
P79355_FELCA/144-222------------S---LTLTLE---S.PS-------------------------------------------SS------

PF16681

F1SAK8_PIG/36-116------------E--------------DP-------------------------------------------E.------
CD3E_SHEEP/30-112------------K--------------DF-------------------------------------------E.------
CD3E_BOVIN/30-112------------R--------------EF-------------------------------------------E.------
G3QUY7_GORGO/36-127------------Q--------------YP-------------------------------------------G.------
H0X808_OTOGA/36-118------------L--------------DT-------------------------------------------E.------
G5BHL3_HETGA/31-112------------L--------------DP-------------------------------------------S.------
G3T782_LOXAF/29-109------------V--------------ES-------------------------------------------E.------
I3MMT1_SPETR/30-113------------P--------------KT-------------------------------------------L.------
H0UW68_CAVPO/36-115------------L--------------NP-------------------------------------------E.------
G1SRV6_RABIT/8-90------------V--------------EA-------------------------------------------D.------
H9GCG3_ANOCA/57-136------------G--------------GS-------------------------------------------EG------
Q3LRP4_CALJA/36-118------------R--------------YD-------------------------------------------G.------
L5M0Z4_MYODS/18-99------------E--------------DP-------------------------------------------D.------
G3WKI6_SARHA/41-122------------E--------------KT-------------------------------------------N.------
CD3E_CANFA/41-122------------D--------------VF-------------------------------------------G.------
F7D784_MONDO/33-114------------E--------------KS-------------------------------------------E.------
M3XJR7_LATCH/37-113------------.--------------..-------------------------------------------T.------
F7CSX8_HORSE/40-119------------E--------------NF-------------------------------------------G.------
L5KKM4_PTEAL/18-99------------E--------------DS-------------------------------------------E.------
D4A5M2_RAT/24-104------------L--------------EN-------------------------------------------E.------
G7PP33_MACFA/36-118------------Q--------------HL-------------------------------------------G.------
CD3E_MOUSE/29-109------------L--------------DS-------------------------------------------D.------

PF08205

PVRL3_HUMAN/173-257.-----N----ET---VAAICI...AATG-------------------------------------------KP------
SN_MOUSE/142-229.-----.----.E---RNFNCSTPYLCLQ-------------------------------------------EK------
RAGE_HUMAN/124-219.-----V----PN---KVGTCV...SEGS-------------------------------------------YP------
NPHN_MOUSE/152-242A-----G----QE---YVVTCV...SGDA-------------------------------------------KP------
NPHN_MOUSE/357-442.-----.----.N---VTLCCL...TKSS-------------------------------------------RP------
CRTAM_MOUSE/119-205.-----.----KS---VVLKCS...TERS-------------------------------------------KP------
PVRL4_MOUSE/150-233.-----G----LT---LAASC....TAEG-------------------------------------------SP------
PVRL2_MOUSE/155-240.-----.----SV---AVARCV...STGG-------------------------------------------RP------
PVRL1_HUMAN/148-237D-----D----KV---LVATCT...SANG-------------------------------------------KP------
TMM25_HUMAN/26-118E-----N----ER---HAFTCR...VAGG-------------------------------------------PG------
SN_HUMAN/142-228.-----.----.E---VDFNCSTPYVCLQ-------------------------------------------E.------
CD22_HUMAN/143-230.-----.----.E---VTLTCLLNFSCYG-------------------------------------------YP------
NPHN_HUMAN/138-228A-----G----QE---YVVNCV...SGDA-------------------------------------------KP------
CD80_RABIT/140-226P-----N----VK---RI.RCS...ASGG-------------------------------------------FP------
MUC18_HUMAN/139-234K-----E----PE---EVATCV...GRNG-------------------------------------------YP------
BCAM_HUMAN/150-248D-----S----AQ---EIATCN...SRNG-------------------------------------------NP------
BCAM_BOVIN/150-248D-----F----AQ---EIATCS...SRNG-------------------------------------------NP------
CD166_MOUSE/137-231.-----Q----LK---KLGDCI...SRDS-------------------------------------------YP------
O35444_MOUSE/123-217.-----V----PN---KVGTCV...SEGS-------------------------------------------YP------
FAS3_DROME/126-222E-----G----TE---FRARCS...VRDG-------------------------------------------RP------
B4MCT1_DROVI/186-273.-----D----RE---IELECI...SAGG-------------------------------------------KP------
E1C6L8_CHICK/151-245N-----D----ML---KIAQCT...SENS-------------------------------------------FP------
F1SPA8_PIG/71-155P-----N----IK---RI.RCS...TSGG-------------------------------------------FP------
F7EIQ1_CALJA/148-231.-----.----PV---PVARCV...STGG-------------------------------------------RP------
G1TJN6_RABIT/203-292E-----E----TV---AVARCV...STGG-------------------------------------------RP------
G3V671_RAT/147-231A-----D----IK---RI.TCF...ASGG-------------------------------------------FP------
G7NXN7_MACFA/142-226S-----N----IR---RI.ICS...TSGG-------------------------------------------FP------
Q7ZZ85_DANRE/61-152.-----K----LT---QLGECV...VESA-------------------------------------------NP------

PF15910

F1NL21_CHICK/43-155------N----PK---NVNEFSMTLLKGR-------------------------------------------ER------
G1L868_AILME/23-135------F----SD---TVWQFKMKLWKGT-------------------------------------------E.------
F6ZKL5_HORSE/23-134------Y----PE---TVRQFKMQLLKGM-------------------------------------------Q.------
G5BKP1_HETGA/16-127------Y----PE---IVQQFKMQLLRGK-------------------------------------------Q.------
H0VT36_CAVPO/23-134------Y----PD---MVQQFKMQLLKGK-------------------------------------------H.------
I3LV71_PIG/23-135------Y----PD---TVRQFKMQLLKGK-------------------------------------------N.------
ICOS_MOUSE/23-135------Y----PE---TVQQLKMRLFRER-------------------------------------------E.------
ICOS_HUMAN/23-134------Y----PD---IVQQFKMQLLKGG-------------------------------------------Q.------

PF06328

E1B6W6_HUMAN/24-110C-----I----IK---Q..NC.---SHLD-------------------------------------------PE------
G3H9X4_CRIGR/24-111C-----T----IS---P..NC.---SKLD-------------------------------------------QE------
W5PCA4_SHEEP/27-112C-----V----LK---E..KCM---NDYH-------------------------------------------VT------
H2MHM5_ORYLA/26-108C-----V----VD---K..GCP---LFLG-------------------------------------------QA------
L9KWE5_TUPCH/160-246C-----I----YK---N....E---NKIV-------------------------------------------SS------
I3LQQ8_PIG/25-111C-----I----IN---Q..NC.---TSLG-------------------------------------------PE------
H0VNJ1_CAVPO/26-112C-----V----LK---E..KCM---SVYE-------------------------------------------VN------
G1MI84_AILME/334-420C-----I----YK---N....E---NEIV-------------------------------------------SS------
L5JUJ0_PTEAL/24-110C-----I----IK---Q..NC.---SYLG-------------------------------------------PE------
K7E988_ORNAN/24-110C-----I----LY---E..ECL---EMNY-------------------------------------------ED------
M4AJW4_XIPMA/27-111C-----V----IR---E..DCP---LVIG-------------------------------------------QA------
G3QMC9_GORGO/26-112C-----V----LK---E..KCM---DYFH-------------------------------------------VN------
G1KQG1_ANOCA/26-113C-----V----LY---D..TCP---YYDK-------------------------------------------VH------
L9KSB2_TUPCH/4-90C-----V----VK---E..ECM---DFFH-------------------------------------------VN------
L5LZA8_MYODS/26-112C-----V----LK---E..KCV---DYLH-------------------------------------------VN------
Q9W6U9_CHICK/29-115C-----I----LN---E..SCL---DFGN-------------------------------------------IY------
U3KE63_FICAL/318-404C-----I----YK---N....R---TEPV-------------------------------------------EA------
H0WB19_CAVPO/28-115C-----S----LK---PGQGCQ---RHAS-------------------------------------------SD------
IL6RB_RAT/26-112C-----V----LK---E..KCL---QVYS-------------------------------------------VN------
L9JC93_TUPCH/24-110C-----T----VS---R..NC.---NHQG-------------------------------------------LK------
G3X148_SARHA/23-106C-----T----IN---P..NCL---KPIG-------------------------------------------TA------
F7BHT6_MONDO/28-110C-----S----LK---PQNGCS---HRSD-------------------------------------------FQ------
H0VSE7_CAVPO/334-420C-----I----YK---N....E---NKIV-------------------------------------------SS------
CSF3R_MOUSE/24-111C-----T----IS---P..NC.---SKLD-------------------------------------------QQ------
V8PEN3_OPHHA/29-110C-----I----LH---N..NC.---SYGK-------------------------------------------IR------
W5MYE4_LEPOC/28-112C-----V----LS---E..SGM---LKTQ-------------------------------------------AT------
H0WL79_OTOGA/24-110C-----I----IN---K..NC.---SHVG-------------------------------------------LE------
I12R2_BOVIN/28-110C-----S----LK---PKQGCL---PSSS-------------------------------------------FN------
E2R8G9_CANFA/24-110C-----I----IS---P..NC.---SHLG-------------------------------------------PE------
G1T0W6_RABIT/46-133C-----T----IS---Q..NC.---SQLY-------------------------------------------LE------
F6Z8U4_XENTR/25-108C-----I----IN---E..TCL---KE..-------------------------------------------.D------
F1NDH9_CHICK/326-412C-----I----YK---N....K---TQSV-------------------------------------------AS------
H3BGX0_LATCH/26-112C-----S----VK---DLGNCS---FFED-------------------------------------------DE------
G3TD98_LOXAF/24-110C-----V----IG---Q..NC.---NHLD-------------------------------------------PE------
G3VNH6_SARHA/27-113C-----V----LY---E..DCT---KEHH-------------------------------------------FN------
G5C6G6_HETGA/24-111C-----T----VT---Q..SC.---SHLD-------------------------------------------PE------
V8P914_OPHHA/322-410C-----V----YK---T....K---DKMI-------------------------------------------SS------
G1L3X5_AILME/24-109C-----I----IS---P..NC.---SHLD-------------------------------------------PE------
F1M9F2_RAT/331-418C-----I----YK---N....E---NQTI-------------------------------------------SS------
I12R2_MOUSE/28-120C-----S----LN---PKQGCS---HYPS-------------------------------------------SN------
H3AKP8_LATCH/27-113C-----I----LK---E..SKM---KVMG-------------------------------------------IN------
F6VD48_MONDO/28-114C-----I----LK---E..ECV---NDQH-------------------------------------------LN------
M3WIJ4_FELCA/24-110C-----T----IS---P..NC.---SHLG-------------------------------------------PE------
M3YTJ9_MUSPF/24-110C-----V----IS---P..NC.---SHLD-------------------------------------------PE------
E1B9W2_BOVIN/24-110C-----I----IN---R..NC.---SHLG-------------------------------------------TD------

PF00207

CO4A_HUMAN/781-869.-----.----..---..RFQI---LTLW-------------------------------------------LP------
Q9VIT8_DROME/562-654.-----Q----K.---..EVTD---LEIK-------------------------------------------LP------
CO3_MOUSE/770-866K-----N----G.---.ISTKV---MNIF-------------------------------------------LK------
CO4B_MOUSE/779-867.-----.----..---..SSKL---LTVW-------------------------------------------LP------
Q7Q7T0_ANOGA/634-725.-----R----T.---..GSRT---VHEV-------------------------------------------LP------
Q7Q4F0_ANOGA/564-653.-----.----N.---..GQTS---IEKS-------------------------------------------LP------
MUG2_MOUSE/740-830.-----S----T.---..GVAE---VEMT-------------------------------------------VP------
Q7Q4I0_ANOGA/955-1046.-----P----H.---..GRYI---FNLD-------------------------------------------VP------
A2MP_MOUSE/738-828.-----S----T.---..GVAE---MEVT-------------------------------------------VP------
A2M_MOUSE/750-840.-----V----S.---..GDGE---LAVK-------------------------------------------VP------
A2ML1_HUMAN/736-826.-----N----S.---..GKEA---VHVT-------------------------------------------VP------
C3P1_HUMAN/10-104K-----S----KS---GISHYP---ISVK-------------------------------------------VP------
CPMD8_HUMAN/750-841D-----P----S.---..GEGT---LSVK-------------------------------------------VP------
OVOS2_HUMAN/726-816S-----.----S.---..GSAN---LSFL-------------------------------------------IP------
Q29N18_DROPS/745-836D-----.----A.---..DGFT---LAKK-------------------------------------------VP------
Q0C7A6_AEDAE/183-274K-----N----Q.---..KTQT---FHDV-------------------------------------------VP------
A2MG_PONAB/738-828S-----.----S.---..GVAE---VGVT-------------------------------------------VP------
Q16YC2_AEDAE/682-773G-----F----S.---..GEKT---ITKK-------------------------------------------VP------
Q17K56_AEDAE/533-625G-----R----N.---..NFKA---IEDS-------------------------------------------VP------
A7SDN3_NEMVE/771-861L-----.----D.---..GKLA---LRYT-------------------------------------------LP------
CD109_HUMAN/693-784Y-----.----R.---..IYQE---FEVT-------------------------------------------VP------
Y3030_RALSO/871-965G-----A----D.---..GRAR---MTFT-------------------------------------------MP------
A5PMP6_DANRE/779-875S-----D----G.---.LAVFP---VDTV-------------------------------------------LP------
Q12VC6_METBU/707-796D-----D----N.---..GLAT---LDLN-------------------------------------------AP------
Q3A743_PELCD/1262-1354D-----A----D.---.SQKRS---VSFT-------------------------------------------VP------
A7MNC2_CROS8/849-939N-----A----Q.---..GQTT---FSFR-------------------------------------------MP------
Q17M04_AEDAE/556-648D-----D----K.---..GHVD---ITDI-------------------------------------------IP------
Q08R52_STIAD/712-804N-----A----Q.---.TGEAR---ISFA-------------------------------------------LN------
Q1DE47_MYXXD/137-227D-----A----S.---..GAAT---VPVR-------------------------------------------VP------
Q11S66_CYTH3/1263-1352D-----A----E.---..GNVV---LNFT-------------------------------------------MP------
Q025N0_SOLUE/854-944D-----A----A.---..GKAV---AKVE-------------------------------------------FP------
A7SSC0_NEMVE/10-101N-----V----T.---..GEKV---ITAQ-------------------------------------------VP------
Q2JJS1_SYNJB/901-991N-----A----D.---..GLAQ---VQVR-------------------------------------------WP------
Q7ULY0_RHOBA/1286-1375D-----E----N.---..GAVK---MKFT-------------------------------------------MP------
Q2IJH5_ANADE/1222-1312D-----A----E.---..GRAT---VRFT-------------------------------------------VP------
Q1D840_MYXXD/1246-1336G-----A----D.---..GSAT---LEFT-------------------------------------------VP------
Q1IT69_KORVE/868-958D-----A----S.---..GMAT---AKLS-------------------------------------------FP------
Q7MT05_PORGI/1146-1236D-----E----R.---..GEVS---WSFT-------------------------------------------LP------
OVOS_CHICK/748-838S-----.----T.---..GKAS---VSYT-------------------------------------------IP------
Y984_THEMA/714-802.-----H----N.---..GTAR---VSFK-------------------------------------------VP------
A6LJB2_THEM4/653-737.-----.----..---....NE---ISLK-------------------------------------------TP------
Q9VLT3_DROME/939-1030.-----P----H.---..GRYI---FNVE-------------------------------------------VP------
Q7QGN1_ANOGA/635-726G-----S----S.---..GSLK---LTEV-------------------------------------------VP------
A6L1P0_BACV8/1146-1235N-----E----K.---..GEVS---ISFV-------------------------------------------LP------
A8F825_THELT/720-808.-----K----N.---..KTAT---VEFK-------------------------------------------IP------
A5UX85_ROSS1/1485-1575D-----D----N.---..GMAQ---FSVT-------------------------------------------LP------
Q73KT0_TREDE/1174-1262.-----A----K.---..EKKT---IEFD-------------------------------------------LP------
A6LIC0_PARD8/1134-1223N-----E----E.---..GDVF---VNFT-------------------------------------------LP------
CD109_MOUSE/695-786S-----.----K.---..IYEE---FEVT-------------------------------------------VP------
B4Q6W4_DROSI/635-727G-----A----N.---..GEYV---IRKT-------------------------------------------VP------
B4QA08_DROSI/759-850.-----E----E.---..EVFK---WVKT-------------------------------------------IP------
C3XSF4_BRAFL/154-244.-----D----G.---..GQAV---VPVT-------------------------------------------VP------
E3FS79_STIAD/1202-1290P-----A----N.---..GKLS---LPFQ-------------------------------------------LP------
F1QX13_DANRE/768-861K-----C----S.---.KPSKN---KVTY-------------------------------------------LK------
F1R0S4_DANRE/788-875.-----.----S.---..GSVS---ISKT-------------------------------------------LP------
F1R8N2_DANRE/735-823.-----D----S.---..GSAE---VPVK-------------------------------------------VP------
F1RQW2_PIG/780-867.-----.----..---..HSLQ---LSLL-------------------------------------------LP------
F6TCT8_XENTR/740-830.-----A----D.---..GKAD---LAVT-------------------------------------------VP------
F7CSP0_XENTR/773-869D-----A----NG---.ISTKT---LNVF-------------------------------------------LK------
F7CVI9_XENTR/767-856.-----.----N.---..GLIS---ENVY-------------------------------------------VP------
H2LRL9_ORYLA/415-503.-----.----..---..KEGR---YDLA-------------------------------------------LP------
H2M6N3_ORYLA/762-861N-----C----G.---.STSSV---KNVP-------------------------------------------LQ------
H2UUU6_TAKRU/643-731.-----.----..---..DKGR---YTLA-------------------------------------------LP------
H3CLD7_TETNG/732-828D-----R----DG---.MATKN---LDSA-------------------------------------------LP------
H3D959_TETNG/731-828C-----P----S.---..TSVK---RNIP-------------------------------------------LQ------
H3DA42_TETNG/714-803.-----D----A.---..GSVD---LDKT-------------------------------------------VP------
H3DA56_TETNG/728-816.-----E----S.---..GETD---VALT-------------------------------------------VP------
H3DDC7_TETNG/573-663S-----E----T.---..GQAE---LRLD-------------------------------------------VP------
H3DHK0_TETNG/619-707.-----E----N.---..IWTS---DKMS-------------------------------------------VP------
H3DL28_TETNG/714-814S-----C----K.---.TTSLE---KTFP-------------------------------------------LQ------
CO5_HUMAN/772-859.-----.----..---..RRKQ---LQFA-------------------------------------------LP------
Q5LHC2_BACFN/1165-1253N-----V----Q.---..GEVS---FSFR-------------------------------------------MP------
Q5ZUX7_LEGPH/1263-1351.-----D----S.---..TDRQ---LSYQ-------------------------------------------IP------
Q7PMK4_ANOGA/645-736.-----S----S.---..GSAT---TKES-------------------------------------------VP------
Y4489_PSEAE/857-944D-----A----Q.---..GKAS---FSFR-------------------------------------------MP------
Q9VLY7_DROME/697-787.-----S----D.---..GRNS---IHRR-------------------------------------------IP------
R4GGS2_CHICK/726-814.-----.----..---..GTAR---LSVL-------------------------------------------LP------
R5UFN1_9BACE/1152-1240N-----E----Q.---..GEVS---FSFT-------------------------------------------MP------
R6X5P5_9PORP/1138-1223D-----E----A.---..GDVA---FSFT-------------------------------------------MP------
R7EM63_9BACE/1203-1287N-----E----Q.---..GELA---FSFT-------------------------------------------MP------

PF02960

K1_HHV8P/160-279E-----T----HT---VSVSSTTGFRTFA-------------------------------------------TA------

PF03921

ICAM3_HUMAN/30-119N-----C----ST---DCPSSEKIALETS-------------------------------------------LS------
ICAM2_HUMAN/24-114N-----C----ST---TCNQPEVGGLETS-------------------------------------------LD------
ICAM2_MOUSE/22-114N-----C----ST---NCAAPDMGGLETP-------------------------------------------TN------
ICAM1_HUMAN/24-115T-----C----ST---SCDQPKLLGIETP-------------------------------------------LP------
ICAM1_MOUSE/24-114N-----C----SS---SCKEDLSLGLETQ-------------------------------------------WL------

PF02480

GE_PSHV1/44-516A-----A----SWRPEYNFTYEWYAVPYD-----GYCATMRLFEACLYHPSAPACLDPAGHRGCVVGTMTHDDL------
GE_HHV2H/57-501A-----H----DD.GPYAMDVVWMRFDVP-----SSCADMRIYEACLYHPQLPECLSPAD.APCAVSS..WAYR------
GE_HHV11/59-506A-----H----DD.QTYSMDVVWLRFDVP-----TSCAEMRIYESCLYHPQLPECLSPAD.APCAAST..WTSR------
GE_VZVD/193-615I-----H----E..APFDLLLEWLYVPID-----PTCQPMRLYSTCLYHPNAPQCLSHMN.SGCTFTSPHLAQR------
GE_GAHVM/41-479P-----S----P..EIFTLEFRVLFLRYN-----PTCKFVTIYEPCIFHPKEPECITTAEQSVCHFASNIDILQ------

PF01537

K4P3S4_9ALPH/66-190R-----H----AR..AYNATVIWYKIESG.......CA----------------------------------RP------
Q86788_FHV1/60-176.-----.----.....ADATIAWTFDLGT.......CQ----------------------------------IP------
Q67644_ILTV/108-239K-----E----KGG.PFEASVVWFYVIKGDDGEDKYC.----------------------------------.P------
GD_SUHVR/56-181H-----R----RP..TYRAHVAWYRIADG.......CA----------------------------------HL------
GD_EHV1D/129-252A-----Q----KT...YSARLTWFKIMPT.......CA----------------------------------TP------
Q89634_FHV1/69-193S-----Q----KK..TYNATISWFKVTQG.......CE----------------------------------YP------
O41524_9ALPH/49-174V-----Q----KKK.FYNASLSWFKVGDD.......CT----------------------------------YP------
GD_HHV1P/82-206D-----V----RKQ.PYNLTIAWFRMGGN.......CA----------------------------------IP------
GD_CHV1/81-206A-----T----RSDARYNLTVAWYRTSDD.......CA----------------------------------IP------
Q67648_9ALPH/79-203M-----G----RR..KYDALVAWFVLGRA.......CG----------------------------------RP------
Q77L58_MEHV1/64-188M-----G----RR..KYDATVAWFVLGKM.......CA----------------------------------RL------
O90421_9ALPH/53-169.-----.----.....VNATIAWYYDLGI.......CR----------------------------------AP------
Q5FBC8_9ALPH/54-170.-----.----.....VNASIAWFFDFGA.......CR----------------------------------MP------
O39306_EHV4/54-170.-----.----.....INASIAWFFDFGN.......CR----------------------------------MP------
Q91E41_9ALPH/52-168.-----.----.....VNASIGWSFDFDK.......CQ----------------------------------VP------
O41523_9ALPH/53-168.-----.----.....VNATIGWSFDLG........CQ----------------------------------IP------
O39504_9ALPH/64-183.-----.----.....DVVDVGWAYQDGD.......CM----------------------------------VP------
Q6X201_9ALPH/66-185.-----.----.....AVIDAGWVYQNGD.......CM----------------------------------IP------
Q87093_CHV1/74-190.-----.----.....FAARVAYYRVGPG......GCR----------------------------------RP------
Q69367_9ALPH/73-189.-----.----.....YAARVAYYRVDAG......GCR----------------------------------RP------
A7U885_HHV2/81-195.-----.----.....YAARVTYYRL.TR......ACR----------------------------------QP------
Q9QPU9_9ALPH/70-184.-----.----.....YDSTVVYYSV.SG......NTR----------------------------------RP------

PF05326

Q99N75_MOUSE/3-124-------N.------------------.------WNN-----------------------------------PLSLDMIV
Q9D2X6_MOUSE/3-124-------N.------------------.------RNN-----------------------------------LLSLNLKV
Q76I99_MOUSE/3-123-------N.------------------.------RNK-----------------------------------SLSLNRRL
PIP_RAT/1-126-------NE------------------T------IPQ-----------------------------------PLLFQLNV
PIP_RABIT/3-126-------S.------------------.------IWK-----------------------------------VIQMDLQM
PIP_CAVPO/3-126-------D.------------------.------TRR-----------------------------------TIILSTEL
PIP_BOVIN/3-127-------DT------------------T------SRQ-----------------------------------LMTMDLQM
E9PX96_MOUSE/10-142-------NE------------------P------RNY-----------------------------------TLTLNMKI
G1QRT8_NOMLE/4-126-------N.------------------.------TRK-----------------------------------IIIKDFDI
G7P1H3_MACFA/4-126-------N.------------------.------TRR-----------------------------------IIIQNFEI
PIP_MOUSE/2-126-------DE------------------N------VRK-----------------------------------PLLIEIDV

PF15028

PTCRA_RAT/20-147-------DS------------------L------VWF-----------------------------------SGGNG---
G1QXF2_NOMLE/20-146-------DN------------------P------IWF-----------------------------------SAGNG---
PTCRA_BOVIN/31-157-------ES------------------P------IWF-----------------------------------SAGNG---
G3WD30_SARHA/20-146-------DG------------------S------IWF-----------------------------------SSGNG---
M3YPD2_MUSPF/40-162-------GG------------------P------IWF-----------------------------------SAGNG---
H0VKD6_CAVPO/20-147-------DS------------------P------VWF-----------------------------------SAGNG---
G1U7X8_RABIT/20-147-------AS------------------P------IWF-----------------------------------SAGNG---

PF09085

W5PFN9_SHEEP/105-212-------DT------------------L------SMS-----------------------------------LLLGGREL
H0WQ95_OTOGA/112-222-------DA------------------L------SFS-----------------------------------LILGDREL
G5E838_MOUSE/110-220-------NS------------------L------SFA-----------------------------------LLLGEQRL
G1PL68_MYOLU/112-219-------DV------------------L------SLS-----------------------------------LLLGDQEL
I3LSA9_PIG/49-158-------DV------------------F------SMS-----------------------------------LLLGDQEL
M3W8G7_FELCA/115-224-------EA------------------L------SLS-----------------------------------LLLGDREL
MADCA_HUMAN/113-224-------NA------------------L------SFS-----------------------------------LLVGGQEL
F7BUG9_MONDO/130-238-------SR------------------L------TFA-----------------------------------WYQGDEKL
I3N840_SPETR/111-217-------DT------------------L------SFS-----------------------------------LLLGNREL
L8Y2P3_TUPCH/565-674-------DT------------------L------SFS-----------------------------------LLLGDLEL
G3HF34_CRIGR/110-220-------DI------------------L------SFA-----------------------------------LLLGEQSL

PF11465

CD244_HUMAN/22-127-------DS------------------I------AWK-----------------------------------KLLP.SQN
CD244_RAT/22-128-------VS------------------I------EWK-----------------------------------KKT..GHQ
CD244_MOUSE/22-129-------VS------------------V------QWK-----------------------------------KTEQGSHR

PF01688

GI_HHV2H/8-165-------LR------------------V------FGE-----------------------------------LHFVGAQV
GI_GAHVM/2-157-------..------------------V------RGQ-----------------------------------LLFLGDQT
GI_PSHV1/10-157-------..------------------V------GAR-----------------------------------LVFLGDQR
GI_VZVD/7-164-------..------------------I------KGQ-----------------------------------LVFIGEQL
GI_HHV11/8-165-------LL------------------I------LGE-----------------------------------LRFVGDQV

PF10430

F8W3C8_DANRE/7-103EFPRPQGSV--L------A--------L------GQE--F-P------------------------------HTEPR.PH
W5M5U9_LEPOC/23-114.......QL--P------S--------F------GRD--L-T------------------------------SQDQQ..G
W5KIA3_ASTMX/20-110.......SS--L------S--------L------GRD--F-P------------------------------RSEPEIPT
Q80YS4_MOUSE/24-118.......EP--I------T--------I------GRD--F-E------------------------------ALMNQHQD
G1KU09_ANOCA/38-132.......DS--I------K--------I------GRD--Y-D------------------------------ALMNQHPS
F7EC20_XENTR/25-118.......EA--I------T--------I------VRD--T-D------------------------------TILSQSQE
H0YT27_TAEGU/25-119.......ES--I------T--------I------GRD--Q-E------------------------------GVANQHRE

PF08204

O57240_9POXV/2-124-------PT--K------Y--------I------RWK--L-D------------------------------NHDILTYN
CD47_BOVIN/8-140-------TE--L------Y--------V------RWK--F-K------------------------------GENIFIFD
Q9DHI5_YLDV/7-104-------..--.------.--------I------EWK--F-N------------------------------NKVILNNN
CD47_HUMAN/8-142-------TE--V------Y--------V------KWK--F-K------------------------------GRDIYTFD
Q8JTQ3_LSDV/14-122-------GN--V------T--------I------NWF--F-N------------------------------NYPLFKKN
Q5ZL65_CHICK/8-141-------SS--M------H--------V------SWK--R-Q------------------------------GQVIFSFN
Q9Q8V0_RFVKA/10-120-------NS--I------H--------V------KWL--F-Y------------------------------TMDDTISN
Q9D9W5_MOUSE/8-139-------NE--L------F--------L------KWK--F-G------------------------------QDIIFVFD
Q8V3H1_SWPV1/6-113-------SD--I------H--------V------NWS--L-N------------------------------NHNINHKH
Q6TUP1_YMTV5/1-98-------..--.------.--------V------EWR--F-N------------------------------NKVIFYSN
A8VKH9_PIG/8-140-------SE--L------Y--------V------KWK--F-K------------------------------GKDIFIFD
B2CWN5_9POXV/1-111-------NS--V------H--------V------KWL--F-D------------------------------TMYDTISN

PF16680

W5KJS3_ASTMX/45-112-------E.--.------.--------I------TWG--P-K------------------------------NIVGDG..
H9GCG3_ANOCA/63-138-------SE--P------.--------F------TWE--K-D------------------------------GHVLDDHK
K7GSE2_PIG/39-114-------..--.------.--------I------RWF--K-D------------------------------GKEICSLN
CD3D_RAT/30-103-------..--.------.--------I------RHL--D-G------------------------------SVERWLT.
H2NFG8_PONAB/39-114-------..--.------.--------I------TWF--K-D------------------------------GKMIGFLT
CD3E_PIG/42-118-------EK--.------.--------M------TWK--R-N------------------------------DMQIYESY
G5BHL4_HETGA/19-92-------..--.------.--------V------TWL--D-G------------------------------TVGTKRA.
G3WJY6_SARHA/44-120-------S.--.------.--------V------QWI--A-G------------------------------EMVLNETK
F7F8D9_MONDO/35-112-------T.--.------.--------V------EWI--K-E------------------------------GMILKETK
I3MMT1_SPETR/36-114-------GT--.------.--------I------NWE--R-N------------------------------DGKLEGEN
F6X8V5_ORNAN/39-109-------..--.------.--------A------TWF--K-G------------------------------DQFLDSQS
L5KJW9_PTEAL/39-116-------..--.------.--------I------KWY--K-D------------------------------RKEIISLS
F7CUQ0_HORSE/39-110-------..--.------.--------V------TWF--K-D------------------------------GVNISGRE
E2RHB8_CANFA/39-114-------..--.------.--------I------KWF--E-D------------------------------GKERTLPK
M3WFR1_FELCA/39-114-------..--.------.--------V------KWF--Q-D------------------------------GKEMAPHK
CD3E_MOUSE/35-110-------N.--.------.--------L------KWE--K-N------------------------------GQELPQKH
U3ISR2_ANAPL/34-103-------..--.------.--------V------IWF--K-D------------------------------NQRIANTT
F7F8B6_MONDO/49-121-------..--.------.--------F------SWM--D-L------------------------------EESSNKSH
G1M3D4_AILME/39-114-------..--.------.--------V------RWF--K-D------------------------------GKQITSFH
J9NXV0_CANFA/30-103-------..--.------.--------V------LRI--E-G------------------------------TMGIQLP.
CD3G_SHEEP/9-84-------..--.------.--------I------TWL--K-D------------------------------MKEISSGD
D4A5M2_RAT/30-105-------N.--.------.--------L------KWE--K-N------------------------------DKVLPDKN
G5BHL3_HETGA/37-113-------DP--.------.--------I------KWE--K-I------------------------------DGEESGEN
L5M0Z4_MYODS/24-101-------EQ--.------.--------I------KWE--R-N------------------------------GVQLTDQQ
W5MH99_LEPOC/35-109-------PD--S------.--------Y------TWK--K-D------------------------------GNKKDNKD
F7CSX8_HORSE/46-120-------E.--.------.--------L------VWE--I-N------------------------------DKK.SDKK
H0VN41_CAVPO/30-103-------..--.------.--------V------QWL--G-G------------------------------TVGIRQE.
G3U502_LOXAF/18-89-------..--.------.--------I------TWI--E-G------------------------------TKGKLFS.
M3XJR7_LATCH/43-115-------..--.------.--------I------KWK--K-D------------------------------DKELPKEL
G3IMA2_CRIGR/9-82-------..--.------.--------I------VHL--E-G------------------------------TAEEWFA.
F7FPX1_CALJA/30-103-------..--.------.--------I------TWV--E-G------------------------------TVGTLLT.
F1N9E2_CHICK/34-109-------QK--P------N--------Y------LWK--K-G------------------------------KEELGNMR
H3BFR3_LATCH/32-111-------N.--.------.--------V------QWK--K-D------------------------------GEEILSNR
H0UW68_CAVPO/43-116-------P.--.------.--------I------EWK--K-D------------------------------NKVIPNEN
W5PGT3_SHEEP/36-112-------G.--.------.--------I------QWK--R-N------------------------------NEQMKGHN
I3MVU8_SPETR/39-109-------..--.------.--------V------MWL--E-G------------------------------TVGTQLA.
CD3E_BOVIN/36-113-------E.--.------.--------I------HWK--Q-N------------------------------DEQMKGYT
G1SDA6_RABIT/30-103-------..--.------.--------I------KCM--E-G------------------------------TKGILLA.
M3XZE1_MUSPF/30-101-------..--.------.--------I------EWW--E-G------------------------------T..QPLP.
M3WFR0_FELCA/39-111-------..--.------.--------I------IRM--E-G------------------------------TMGTLFR.
CD3E_FELCA/47-124-------ES--.------.--------I------KWE--R-N------------------------------GDLLPNEY
G3T784_LOXAF/30-104-------..--.------.--------I------TVL--E-G------------------------------TNGKLLS.
CD3D_MOUSE/30-103-------..--.------.--------V------MHL--D-G------------------------------TVEGWFA.
G3T782_LOXAF/35-111-------..--.------.--------I------QWE--H-N------------------------------KVLLRAE.
F1M9F8_RAT/39-114-------..--.------.--------I------TWL--K-D------------------------------GHRISPPN
Q3LRP4_CALJA/42-120-------E.--.------.--------I------KWL--V-N------------------------------SQNKEGHE
L5M0W2_MYODS/39-112-------..--.------.--------I------TWF--K-D------------------------------GKEIVTTN
B4F6W6_XENTR/31-102-------..--.------.--------V------IWK--H-N------------------------------NEIIEANN
W5PHC2_SHEEP/30-99-------..--.------.--------I------TLL--Q-G------------------------------TAGQEVS.
CD3D_BOVIN/30-100-------..--.------.--------I------TLL--Q-G------------------------------TEGQEVSG
I6LI21_MUSPF/32-108-------NS--.------.--------I------TWE--K-N------------------------------GEAIKGAN
H0W6D3_CAVPO/39-114-------..--.------.--------I------TWL--K-D------------------------------GNIINSTN
F7D784_MONDO/39-114-------L.--.------.--------I------IWK--K-N------------------------------NVLINGVE
G7NCB9_MACMU/42-120-------E.--.------.--------V------QWQ--H-N------------------------------GKNKEDSG
G1STZ2_RABIT/39-114-------..--.------.--------I------KWL--K-D------------------------------GQEVKFRN
G8JL01_BOVIN/15-90-------..--.------.--------I------TWL--K-D------------------------------VEQIGSGD
K7GLV9_PIG/30-103-------..--.------.--------I------IWL--Q-G------------------------------TEGELLS.
F6WI60_MACMU/30-103-------..--.------.--------V------TWV--E-G------------------------------TMGTLLT.
L5M0S8_MYODS/30-101-------..--.------.--------I------TWL--E-G------------------------------TMGIKLQ.
G1MXZ8_MELGA/33-102-------..--.------.--------.------..E--K-E------------------------------GEEVLENT
H0YPP3_TAEGU/33-105-------KN--.------.--------I------TWW--R-D------------------------------GSTVGHEA
H0X808_OTOGA/42-120-------D.--.------.--------I------NWA--K-K------------------------------DQELKDYK
M3ZL37_XIPMA/31-110-------..--.------.--------V------TWH--K-E------------------------------KSKNPETS
G3WK56_SARHA/41-113-------..--.------.--------Y------SWM--H-L------------------------------EKSSDDYP
G3T785_LOXAF/39-113-------..--.------.--------V------KWF--K-D------------------------------DKEINTLN
G3WKI7_SARHA/39-113-------E.--.------.--------I------IWK--K-N------------------------------DLTINGVD
CD3G_MOUSE/39-114-------..--.------.--------I------KWL--K-D------------------------------GSIISPLN
G1SRV6_RABIT/14-92-------GD--.------.--------I------HWG--K-D------------------------------EKSLPDTD
G1M3E8_AILME/39-111-------..--.------.--------I------ILV--E-G------------------------------TMGTPLS.
G1R705_NOMLE/42-120-------E.--.------.--------I------VWQ--H-N------------------------------DKIIKNYD
CD3E_CANFA/47-124-------DN--.------.--------I------KWE--K-N------------------------------DNLVEGAS
H0X0C4_OTOGA/30-103-------..--.------.--------I------TWL--T-G------------------------------TMGTFLA.
F6QRU0_XENTR/52-121-------..--.------.--------I------IMN--K-A------------------------------KTELAKQG
L5KKM4_PTEAL/24-101-------GT--.------.--------I------IWE--K-D------------------------------GKPRRTNE
L9KSF6_TUPCH/19-94-------..--.------.--------I------IWF--K-D------------------------------GKNISSLS
M3XZF4_MUSPF/39-112-------..--.------.--------I------TWY--K-D------------------------------GKPENSSN
I3MMT3_SPETR/39-114-------..--.------.--------I------QWF--K-D------------------------------SPNTLVQN
F7CIT2_HORSE/30-97-------..--.------.--------I------MQV--E-G------------------------------TMGTPYKG
G1M3G6_AILME/47-123-------EN--.------.--------L------KWE--K-D------------------------------NVLLTDFH

PF00047

OX2G_RAT/34-136-------EP--L------I--------V------TWQ--K-K------------------------------KAVGPENM
CEAM1_HUMAN/331-411-------TG--I------S--------I------RWF--F-K------------------------------NQSLPSSE
IGHM_CHICK/220-311-------DG--L------E--------V------SWW--K-E------------------------------KGGKLETA
IL6RA_MOUSE/30-107-------GN--V------T--------I------HWV--Y-S------------------------------GSQNREWT
KI2S5_HUMAN/132-213-------SY--D------M--------Y------HLS--R-E------------------------------GEAHERRL
NRG_DROME/525-609-------LE--I------E--------I------DWW--K-D------------------------------GQSIDFEA
TIE1_MOUSE/127-208-------KQ--T------D--------V------IWK--N-N------------------------------GSYFNTLD
KI2S5_HUMAN/32-115-------MF--E------H--------F------LLH--R-E------------------------------GTFNHTLR
IGHE_MOUSE/209-300-------KN--V------N--------V------TWN--Q-E------------------------------KKTSVSAS
CSF1R_FELCA/207-293-------VN--F------D--------V------SLR--H-G------------------------------DTKLTISQ
TIE1_MOUSE/353-439-------VR--G------S--------M------KLR--K-P------------------------------DGTMLLST
NTRK3_HUMAN/214-299-------PL--P------D--------V------DWI--V-T------------------------------GLQSINTH
MUCM_RABIT/11-105-------SS--V------T--------F------SWS--F-K------------------------------NNSEISSR
KIT_HUMAN/216-305-------SS--V------Y--------S------TWK--R-E------------------------------NSQTKLQE
FLT3_MOUSE/256-346-------HG--F------G--------L------TWE--L-E------------------------------DKALEEGS
SEM3E_MOUSE/585-669-------LQ--A------K--------V------IWF--V-Q------------------------------KGRDVRKE
FCGR1_MOUSE/204-284-------PG--L------Q--------L------HFS--F-Y------------------------------VGSKILE.
FGFR1_CHICK/37-115-------DV--Q------S--------I------NWV--R-D------------------------------GVQLPENN
PGFRB_HUMAN/37-115-------..--A------P--------V------VWE--R-M------------------------------SQEPPQEM
PTPRM_HUMAN/189-275-------VA--G------D--------R------LWL--Q-G------------------------------IDVRDAPL
CD4_MOUSE/25-127-------KI--T------V--------F------TWK--F-S------------------------------DQRKILGQ
OPCM_RAT/227-311-------PM--A------E--------F------QWF--K-E------------------------------DTRLATGL
IGHD_HUMAN/173-264-------KD--A------H--------L------TWE--V-A------------------------------GKVPTGGV
V055_FOWPN/31-121-------DK--V------I--------V------AWQ--Q-G------------------------------DGEVTQGI
DIG1_CAEEL/310-389-------PF--P------D--------I------YWF--K-N------------------------------QKVNTDGP
CD33_HUMAN/146-227-------TP--P------I--------F------SWL--S-A------------------------------APTSLGPR
NRG_DROME/251-332-------PL--P------Q--------T------VWS--K-D------------------------------GQRIQWSD
DIG1_CAEEL/1822-1903-------PL--P------Q--------V------KWI--K-A------------------------------GNYEIDPS
IL1R2_HUMAN/241-341-------PL--T------T--------M------LWW--T-A------------------------------NDTHIESA
VCAM1_HUMAN/229-306-------PA--P------E--------I------FWS--K-K------------------------------LDNGNLQH
OX2G_MOUSE/143-229-------PA--P------A--------I------SWK--G-T------------------------------GTGIENST
KI3L1_HUMAN/32-110-------RF--N------N--------F------MLY--K-E------------------------------DRIHIPIF
THY1_HUMAN/21-119-------SP--I------Q--------Y------EFS--L-T------------------------------RETKKHVL
IL1BP_VACCW/228-322-------TD--A------D--------V------FWI--S-N------------------------------GMYYEEDD

PF16758

UL14_HCMVM/48-234-------RV--H------L--------C------YWP--E-I------------------------------VRSLVVDA
UL141_HCMVM/51-241-------RA--R------F--------C------RSH--D-G------------------------------SDELILDA

PF13927

B4JUY8_DROGR/56-147-------PR--P.....LR--------V......AWE--W.G------------------------------SLRLEAGS
Q9E8G3_9ADEN/418-485-------SV--K.....TT--------L......SYD--G..------------------------------.......K
Q14VV5_RAHV1/122-191-------..--......ST--------I......SWL--E.N------------------------------GGILS..D
Q05KR2_RAT/225-316-------TD--L.....VY--------W......KWN--G.S------------------------------EI.....E
D2GWX3_AILME/205-296-------IS--D......Y--------V......YWK--W.N------------------------------GSLIDEED
Q9TV71_HORSE/225-316-------FT--D......F--------V......YWR--W.N------------------------------GSLIDDSD
Q5R5D6_PONAB/81-172-------LS--D.....IA--------Y.......WK--W.N------------------------------GSVIDEDD
B3RNX0_TRIAD/137-219-------PR--P......T--------I......VWT--R.Y------------------------------ND.....G
Q4RP84_TETNG/334-402-------GS--H.......--------.......NWI--K.S------------------------------TT.....T
Q7TPQ6_MOUSE/37-119-------AP--G.....IS--------V......YPS--Q..------------------------------.V.....T
Q64861_9ADEN/137-203-------PA--V.....VK--------F.........--...------------------------------........
Q16X13_AEDAE/196-289-------PK--N.....TP--------F......QYC--R.F------------------------------VT.....P
B7Z4Y8_HUMAN/87-162-------PK--P......K--------V......QWR--D.H------------------------------QG.....Q
A9Y0V1_9CICH/291-381-------PH--I.....TK--------H......RWD--T.P------------------------------TS.....P
B4F6P7_XENTR/145-216-------PV--NVT...PS--------V......TWY--K.D------------------------------CI.....S
A4JYH8_DANRE/212-293-------NF--Y.....YN--------V......TWT--H.S------------------------------SRMLPKAE
Q8AXU0_ONCMY/214-296-------NF--N.....YN--------V......TWN--Y.S------------------------------SKKRFTIE
A9Y0V0_9CICH/193-275-------NF--Y.....YN--------V......TWK--Y.T------------------------------TKSGPKIT
Q4RZA3_TETNG/179-261-------NF--N.....YN--------V......TWN--Y.T------------------------------TKSVSMRH
B0WE60_CULQU/104-184-------PN--A.....KR--------F......YWR--F.E------------------------------NS.....E
Q675X8_OIKDI/328-400-------QP--S.....TI--------L.........--...------------------------------........
A7RZM7_NEMVE/164-243-------DT--T.....TK--------F......IWR--N.Q------------------------------AI.....G
C3PU48_HELVI/65-147-------PK--P......K--------I......VWK--T.Q------------------------------LR.....S
Q9E8F9_9ADEN/415-478-------LV--E.....TR--------I......IYE--D.N------------------------------VI......
VS10L_MOUSE/484-552-------PA--A.......--------.......SLQ--F.Q------------------------------GLPEGVRA
Q17P33_AEDAE/147-237-------DA--T.....NK--------I......VWM--Q.M------------------------------LD.....D
Q5M7A8_XENLA/139-209-------SS--A.....LS--------Y......SWM--Y.R------------------------------HK.....E
B5JJ62_9BACT/373-440-------LI--P.....AT--------I......QWY--K..------------------------------.D.....D
A8KB70_DANRE/141-217-------VS--A.....VS--------L......SWY--K.G------------------------------NSVLSSIS
A8E4T3_DANRE/125-204-------VS--A.....VS--------L......SWY--K.G------------------------------NSILSSIS
Q6PUA9_AMBME/211-289-------HG--R.......--------.......SLK--G.S------------------------------SEHAVASK
Q6P6Y9_XENLA/207-286-------FS--S.....VK--------A......QWL--D.A------------------------------KEGVTKQA
B4F6V0_XENTR/207-287-------FS--T.....VK--------A......QWL--D.A------------------------------RDMESTER
A7LKP4_HORSE/132-214-------RA--P.....IH--------F......TIE--K.H------------------------------DLDTKGFR
Q5GAK1_9VIRU/122-188-------HF--A.....PS--------L......SWN--S.M------------------------------VA.....G
Q5CZQ8_DANRE/218-294-------PE--S.....DK--------L......KYL--I.M------------------------------ES.....G
Q16ZU2_AEDAE/151-229-------PL--N.....CE--------I......KWK--V.C------------------------------GIVIEKDS
B3MMJ5_DROAN/141-228-------KP--A.....VE--------L......SWY--V.N------------------------------GEIAEPQK
Q25177_HYDVU/232-308-------SP--S.....ST--------I......EWY--S.G------------------------------DSLLLVCK
VS10L_MOUSE/388-462-------RP--P.....AD--------I......AWS--L.A------------------------------DP.....T
B5JL51_9BACT/220-289-------SP--P.....MS--------Y......QWY--R..------------------------------.D.....Y
B9XJC2_PEDPL/341-410-------PM--S.....VQ--------.......WWH--N..------------------------------.......G
B4A6E2_SALNE/162-234-------VS--P.....YT--------Y......VWK--K.D------------------------------.......G
B9XRA3_PEDPL/769-839-------AL--P.....VS--------Y......FWS--L..------------------------------.N.....G
B9XFJ5_PEDPL/981-1051-------ST--P.....VT--------Y......SLA--L.N------------------------------GA.....N
Q11WJ8_CYTH3/1793-1868-------GP--T.....LT--------Y......QWK--R.N------------------------------GT.....N
B9XK99_PEDPL/434-502-------SQ--P.....FA--------Y......QWK--L.N------------------------------.......G
B9XNF4_PEDPL/912-982-------TP--P.....IA--------Y......QWT--R..------------------------------.N.....G
B9XJC2_PEDPL/171-239-------SE--P.....FS--------Y......QWL--F.K------------------------------GV......
B9XIT4_PEDPL/501-570-------QG--P.....FT--------Y......QWL--FN.------------------------------GTNLTGAT
B9XNF4_PEDPL/1266-1335-------QQ--P.....LN--------Y......QWK--F.N------------------------------GTPIAGAN
Q8QFN4_SALSA/217-311-------ES--E.....SF--------M......FWT--V.D------------------------------GR.....H
MILR1_HUMAN/127-200-------SL--P.....IN--------Y......TFF--E.N------------------------------HV.....A
I0AZP8_9POXV/264-344-------VD--D.....VL--------I......DWE--N.P------------------------------SGWIIGLD
B1NA53_XENLA/215-283-------NR--K.......--------.......LWF--Q.L------------------------------LREDKTVE
A7SRI5_NEMVE/60-138-------PV--P.....TV--------E......LYK--D.S------------------------------KV.....I
Q58EM0_DANRE/46-124-------PA--P......V--------L......QWS--S.E------------------------------PA.....S
B4F6P7_XENTR/242-336-------RN--D.......--------V......WWT--V.D------------------------------GKKLEENT
Q5FW36_XENTR/237-331-------PI--V.......--------.......WWL--A.N------------------------------DSYIDEFF
IL1R2_MOUSE/248-342-------SS--N.....TI--------V......WWL--A.N------------------------------STFISAAY
Q9N2H5_HORSE/236-330-------QW--T.....TD--------L......WWM--A.N------------------------------NTNIDIAY
B5KH15_TETNG/127-187-------PH--PSSRQTPE--------I......HWL--D.P------------------------------QG.....E
Q5BKG7_XENTR/123-200-------GS--N.....IT--------Y......TWS--A.D------------------------------SM.....E
Q8AXT5_SALSA/239-334-------ED--N.....CH--------V......WWE--M.N------------------------------GV.....K
Q4VWU3_XENLA/180-252-------ST--E.....LR--------F......VFN--K.D------------------------------GR.....S
A7TDK3_NEMVE/95-165-------PL--N.....TK--------I......TWK--N.L------------------------------PN.....H
A4JYL8_DANRE/119-181-------KT--Q.....LQ--------Y......KWS--G..------------------------------........
Q4S0F0_TETNG/121-184-------QP--E.....VE--------Y......MWV--F..------------------------------.......D
A6NJE8_HUMAN/286-359-------SL--R.....TL--------Y......RFY--H.E------------------------------GVPLRHKS
GP42_RAT/114-188-------SL--P.....IL--------Y......SFY--M.D------------------------------GE.....I
FCRL6_HUMAN/206-280-------SP--P.....IL--------Y......SFY--L.D------------------------------EKIVGNHS
FCRL1_MOUSE/116-189-------SP--P.....IF--------Y......QFY--H.E------------------------------SIILGNSS
D2I2T6_AILME/288-361-------SP--P.....IL--------Y......RFY--H.E------------------------------NVTLGNIS
A7SAT9_NEMVE/170-237-------PP--A.......--------.......TYE--F.S------------------------------RG.....S
Q98173_MCV1/178-253-------DA--Q.....LR--------ITGNFPPSSL--R.S------------------------------TL.....H
C3KJI3_ANOFI/124-193-------AR--P.....VT--------Y......SWK--I.G------------------------------DK.....D
ILRL1_HUMAN/211-307-------QF--L.....AA--------V......LWQ--L.N------------------------------GTKITDFG
ILRL1_RAT/216-311-------VA--V.......--------.......LWQ--I.N------------------------------KTRIGSFG
B5XCQ4_SALSA/120-188-------AE--P.....VT--------Y......SWK--V.G------------------------------EG.....A
B5XDA6_SALSA/115-177-------SV--D.....VN--------V......VWS--H..------------------------------.N.....R
Q4SQP9_TETNG/121-187-------.W--E.......--------.......SWV--S.S------------------------------VC.....N
Q676C3_OIKDI/705-769-------PT--P......K--------V......EWI--D..------------------------------.......E
IRPL2_HUMAN/241-335-------GP--M.......--------I......YWM--K.G------------------------------EKFIEELA
B0R0J8_DANRE/123-187-------PK--P......I--------I......SWK--H..------------------------------........
Q3SZI9_BOVIN/149-216-------ND--N.....VS--------F......RWQ--V..------------------------------.A.....G
B4E1U5_HUMAN/83-150-------DD--N.....VS--------F......RWE--A..------------------------------.L.....G
B5XGJ4_SALSA/128-200-------VK--D.....TN--------L......SWE--P.E------------------------------AAFEDAFW
Q18PG4_MOUSE/127-196-------GE--N.....VT--------Y......SWK--A.V------------------------------GQ.....G
Q6NZB6_MOUSE/352-421-------GN--N.....VT--------Y......TWM--P.L------------------------------QN.....K
D2I0U5_AILME/321-390-------GH--N.....VT--------Y......RWT--P.L------------------------------PK.....G
LY9_HUMAN/362-431-------GN--T.....VM--------Y......TWT--P.L------------------------------QK.....E
SLAF5_HUMAN/134-197-------EK--N.....VT--------Y......NWS--P.L------------------------------GE......