Sequence alignment for CL0012

PF00125

H2AV3_ORYSJ/1-106MAGKGGKGLLAAKT--T............................AAKSA--EKDKGKKAPVSRSSR--------A----
H2BV_BOVIN/1-99MARNVTKRNKRC..--.............................RGHQK--AIYKKKSHSSSESGL--------R----
Q8LK76_MAIZE/18-152KKLQFERSGGASTS--ATPERAAGTGGRAA.SGGDSVKKTKPRHRWRPGT--VALREIRKYQKSTEP--------L----
H32_HUMAN/1-132MARTKQTARKSTGG--KAPRKQLATKAAR..KSAPATGGVKKPHRYRPGT--VALREIRRYQKSTEL--------L----
A8B678_GIAIC/10-148ARNTGHRRREISGR--NMIPGVVVNARQSR.SKLSSDPFSSVPRRPARVS--HMEREIYHYQHNVDT--------L----
Q8IL74_PLAF7/1-103MNLKNNEND.....--............................DTNNFW--KEQLFEICNMSPEDL--------K----
A8BYH2_GIAIC/11-146RSKSVHVNTARKGQ--HAPRKTILSKKTVA.RKAISKSEKAVTRRARPGS--QVRKEITNMQRRVTS--------V----
A8B471_GIAIC/44-178MARTKHTARKTTSA--TKAPRKTIARKAAR.KTASSTSGIKKTGRKKQGM--VAVKEIKKYQKSTDL--------L----
H2BWT_HUMAN/23-145MATASAMAGPSSET--TSEEQLITQEP.......KEANSTTSQKQSKQRK--RGRHGPRRCHSNCRG--------D----
Q23429_CAEEL/1-104MARLKQRPNRILN.--.............................TSTKT--SSAKKKKKRISRSTR--------S----
H2B2_ARATH/87-215DRDESSPQPPETPV--EVRDEPSPQPPETP.ASKSEGTLKKTDKVEKKQE--NKKKKKKKKRDDLAG--------D----
Q7XV46_ORYSJ/162-290KLLASQLEERLPGS--NLPPRYVFRHDTLH.ISIAKVLILLNCAKLTASV--LIMSAARKSAPTTGG--------V----
H3L_ENCCU/1-130MSRTKQTASKALGG--KAPRKGISAKSIP...SSGCSPAMPKRTRFKAGA--LALKEIRKYQKSTDL--------L----
CENPA_DANRE/7-140AHKRKPSTPRRRSP--PASLPPPAGSRTRR.HSGPSGSSPRKKHKFRPGT--RALMEIRKYQKSTGL--------L----
HAP5_YEAST/94-225DNGNSDGADGEMDE--DDEEYDVFRNVGQG.LVGHYKEIMIRYWQELINE--IESTNEPGSEHQDDF--------K----
Q19649_CAEEL/1-114MAGKKNLSGVCRKS--CTQP....................VRSYPFHSGT--VALREIRKQQQSTEL--------L----
H31_ENCCU/1-135MARTKQSARKTTGG--KAPRKQLSAKSARK.GVSPASSAGAKKSRYRPGS--VALKEIRRYQKSTDF--------L----
CENPA_CANGA/101-236HVESEEENKRLPEK--YSLDKYVKRSRKQR.DHRHIVAKPKEKRNFAPSK--LAMYEIEKYQRSTAL--------L----
Q7PVU9_ANOGA/47-178QAREDALLYVESLC--LRLLATLCAKPPPHTVMDVEDRIIRTFPTPIDRW--ALGEARETIDKSKKK--------K----
Q7RRA6_PLAYO/1-103MNNNNMNSN.....--............................DMNTFW--KNQLDDITNITPEEL--------K----
H2A8_ARATH/1-97MVCNTN........--.............................ILKDV--STKISAFENVRMIMV--------E----
CENPA_SCHPO/1-118MAKKSLMAEPGDPI--PRP......................RKKRYRPGT--TALREIRKYQRSTDL--------L----
CENPA_MOUSE/1-127MGPRRKPQTPRRRP--SSPAPGPSRQ.........SSSVGSQTLRRRQKF--MWLKEIKTLQKSTDL--------L----
HCP3L_CAEEL/122-257INVGNRNDTDGTNG--RNGSRAGSSSSDRV.RMIAGRNRISKTRRYRPGQ--KALEEIRKYQESEDL--------L----
H2BV_MOUSE/1-100MAKPTFKRQCYIK.--.............................RHLRP--LYRKHSRCSSINLGH--------G----
Q9DAB5_MOUSE/72-200EKLEKKPKKDKREK--AKPKKKPEQENREQ.ETPEQEKPEVQRRRSLHQS--IREDERRARLIRRRK--------N----
Q8IDZ1_PLAF7/32-167RTVHHGISSKTTNI--NRPSVNRGGINEVA.QKNLHRTNIRKPHRYRPGV--LALKEIRAYQASTQL--------L----
A4H675_LEIBR/1-126MSRTKETARTKRSI--TAKKSKKAPS........AVSGLKKVHRRWRPGT--CAIREIRRYQKSTEL--------L----
A8BI78_GIAIC/1-100MSKVETKRLM....--...............................KKT--EAGDKGDAKRKHKRH--------E----
Q387X7_TRYB2/34-135.....ENTPPQKRH--H...........................RWRPGT--VALREIRRLQSSTDF--------L----

PF00808

NFYB9_ARATH/62-127------------------------------------------------------------------Q--------Y----
HJA2_METJA/2-65------------------------------------------------------------------A--------E----
NFYB4_ARATH/6-71------------------------------------------------------------------R--------L----
Q20237_CAEEL/64-128------------------------------------------------------------------A--------K----
Q9V452_DROME/18-83------------------------------------------------------------------T--------F----
NFYB5_ARATH/54-119------------------------------------------------------------------R--------L----
HAF2_ARCFU/2-65------------------------------------------------------------------A--------E----
Q9FHS0_ARATH/10-74------------------------------------------------------------------P--------E----
NC2B_HUMAN/11-75------------------------------------------------------------------L--------T----
HAP3_KLULA/25-90------------------------------------------------------------------R--------W----
HAF1_ARCFU/6-69------------------------------------------------------------------V--------E----
Q9LN09_ARATH/108-172------------------------------------------------------------------I--------K----
HAP3_SCHPO/10-75------------------------------------------------------------------N--------L----
NC2B_SCHPO/10-75------------------------------------------------------------------L--------S----
Q9LHG0_ARATH/7-71------------------------------------------------------------------T--------R----
O17072_CAEEL/108-174------------------------------------------------------------------M--------S----
O45550_CAEEL/20-84------------------------------------------------------------------I--------G----
NC2B_ARATH/14-79------------------------------------------------------------------A--------S----
O17286_CAEEL/64-129------------------------------------------------------------------R--------F----
B4I7U0_DROSE/10-74------------------------------------------------------------------A--------R----
E3GWR6_METFV/1-64------------------------------------------------------------------M--------E----
F1SVE7_METKA/4-65------------------------------------------------------------------.--------E----
G7YA03_CLOSI/51-116------------------------------------------------------------------.--------F----
HARB_PYRFU/3-65------------------------------------------------------------------.--------E----
Q2UK39_ASPOR/46-111------------------------------------------------------------------R--------W----
U6EAE9_9EURY/2-65------------------------------------------------------------------A--------E----
W5LMM0_ASTMX/39-103------------------------------------------------------------------Q--------E----

PF02969

TAF6L_HUMAN/9-73-----------------------------------------------------------------FV--------E----
TAF6_SCHPO/3-68-----------------------------------------------------------------LT--------V----
Q8LRG9_ORYSJ/1-68-----------------------------------------------------------------MS--------I----
TAF6_YEAST/9-74-----------------------------------------------------------------TI--------W----
TAF6_ARATH/1-68-----------------------------------------------------------------MS--------I----
TAF6_DROME/18-83-----------------------------------------------------------------GS--------S----
TAF6_HUMAN/11-76-----------------------------------------------------------------NT--------V----
Q9GZI6_CAEEL/24-85-----------------------------------------------------------------TP--------I----
A4IHX4_XENTR/9-74-----------------------------------------------------------------NT--------L----

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
TAF12_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
TA12B_ARATH/529-596--------------------------------------------------------------------------------

PF04719

G8BSR2_TETPH/139-219---------------------------------------------LLVNN--LDEDQTNRFEVFHRT--------S----
J8Q476_SACAR/129-209---------------------------------------------LLVTN--LDKDQTNRFEVFHRT--------S----
E3LZD0_CAERE/217-303---------------------------------------------VLIAN--FSTEQLDRYAAFRRS--------K----
I1G7M7_AMPQE/71-156---------------------------------------------LLVSA--FSSQQLDQYEIFRRA--------T----
L8Y753_TUPCH/78-161---------------------------------------------ILVSS--FSEEQLNRYKMYHRS--------A----
A9CRT7_ENTBH/59-144---------------------------------------------KSVND--MDSSEQQRYETFRRS--------N----
TAF11_SCHPO/95-179---------------------------------------------YLLES--FDEEQMQRYEVFRRA--------N----
U1MIS9_ASCSU/191-271---------------------------------------------VLVAN--FSQEQLARYECFRRS--------S----
H2PF83_PONAB/98-183---------------------------------------------ALLSA--MSEEQLARYEVYRRS--------A----
U5DIY7_AMBTC/83-168---------------------------------------------AILSQ--LTEEQMSRYESFRRS--------G----
A7SYY0_NEMVE/3-89---------------------------------------------LLVSS--FSEDQLNRYEMYRRA--------A----
F4QDB0_DICFS/307-393---------------------------------------------TLFDQ--FSEEQQTRYEFYRRS--------S----
F2UQ02_SALR5/216-306---------------------------------------------ILMAS--FTEEQRIRHESYRRS--------R----
X6MJW9_RETFI/615-701---------------------------------------------..LSQ--MDEKQWRRYEMFLKS--------K----
M7SAZ2_EUTLA/196-303---------------------------------------------....H--MDRRQFVRYEVWHGA--------T----
U4LM69_PYROM/116-201---------------------------------------------ILLEA--FDADQNSRYESFRRA--------N----
A0A0D2WMQ7_CAPO3/375-460---------------------------------------------LLVDA--FTPEQLHRYECYRRS--------G----
T1EEK4_HELRO/30-115---------------------------------------------VLVSN--FSEDQLNRYEMYRRA--------T----
C4VAX6_NOSCE/48-132---------------------------------------------.AIDD--LSEEDLHRYETFRRS--------N----
E4XD21_OIKDI/168-253---------------------------------------------KLINN--FSEEQINRYEMYRRS--------C----
L2GN22_VITCO/62-146---------------------------------------------.AISE--MNEADLQRNETFKRS--------K----
R0MGZ1_NOSB1/32-117---------------------------------------------QIINE--MSEDELLRYETFRRS--------N----
S7W8C8_SPRLO/66-151---------------------------------------------KLVTN--MSTEEEARYESFRRS--------G----
I2H2Q9_TETBL/217-297---------------------------------------------LLINN--LDNEQTNRFEVFHRT--------S----
E5S4W4_TRISP/310-396---------------------------------------------LLVSN--FSKEQLSRYEMFRRS--------V----
Q8SSE1_ENCCU/49-130---------------------------------------------....T--MSEEELHRYEKFRGS--------G----
C7YV21_NECH7/171-283---------------------------------------------MLVEA--FDSQQYNRYELWRAA--------K----
A0A068YK50_ECHMU/153-237---------------------------------------------.LMAH--FNDDQLSRFESYRRA--------T----
A4RSC0_OSTLU/31-116---------------------------------------------ELLKT--FTPSQMERYECFRRS--------N----
L5KZB3_PTEAL/96-181---------------------------------------------LLVSS--LSEEQLNRYEMYGRS--------A----
E9G9V1_DAPPU/3-88---------------------------------------------VLVSN--FTEEQLDRYEMYRRS--------A----
R4XFB3_TAPDE/83-168---------------------------------------------ILLDS--FNQGQMARYEVFRRV--------K----
D7KI82_ARALL/38-124---------------------------------------------TILSQ--FTEDQMSRYESFRRS--------A----
U5GY91_USTV1/142-223---------------------------------------------VLLEH--FDATQMDRYEAYRRS--------G----
C1MKX3_MICPC/31-118---------------------------------------------ELVNI--FTEEQMNRYESYRRS--------S----
A8XSJ7_CAEBR/205-291---------------------------------------------LLIAN--LTREQLDRYEAFRKS--------K----
E1ZAD2_CHLVA/141-221---------------------------------------------....I--LTEQQLDRYSAFRRS--------S----
S2JU45_MUCC1/162-247---------------------------------------------VLLEN--FSDDQLQRYEGYRRS--------A----
E3MIY3_CAERE/191-279---------------------------------------------ILLGN--MSTQQLEQYTAYRRS--------R----
F1N372_BOVIN/106-191---------------------------------------------TLVAA--MSKEQLNRYEVFRRS--------A----
C4R2G1_PICPG/131-213---------------------------------------------LLLEN--FDQDQMTRYEFFRRA--------N----
J9F669_WUCBA/184-270---------------------------------------------ILVAN--FSAEQLARYECFRRS--------S----
L0P7W8_PNEJ8/44-128---------------------------------------------ILLDS--FNEDQMRRYEIFRRA--------N----
G8BAE4_CANPC/112-196---------------------------------------------LLITN--FTNDQMERFEAYRRS--------T----
U9U4H6_RHIID/1-86---------------------------------------------MLLDN--FSEEQLKRYEVYRRS--------A----
C1FD46_MICSR/15-101---------------------------------------------.LLSQ--FTSEQMTRYECYRRS--------S----
F4RU01_MELLP/124-208---------------------------------------------VLLDH--FDPQQMDRYTEYRNS--------G----
D8U9I9_VOLCA/104-190---------------------------------------------EVFDS--LTEEQKNRYEVFMRS--------S----
D0MZ49_PHYIT/4-97---------------------------------------------.LMES--LPEAEARRHEQFRRS--------H----
D8Q789_SCHCM/34-118---------------------------------------------VLMDE--FSPEQYDRFEAYRRH--------A----
G1X2K3_ARTOA/165-253---------------------------------------------VLMDN--FDEDQMARYEAYRRG--------T----
A5E0E2_LODEL/102-187---------------------------------------------LLITN--LTNDQMERFEFYRRL--------T----
E3KAK5_PUCGT/154-238---------------------------------------------ILLEH--FDAQQMDRYSEYRNS--------G----
D3BH07_POLPA/351-436---------------------------------------------.LFTH--FTEEQQTRYEFYRRS--------S----
D7MFL1_ARALL/108-194---------------------------------------------TILSQ--FTEDQMSRYESFRRS--------A----
T1K7I1_TETUR/31-116---------------------------------------------VLVSN--FSEEQLNRYEMFRRA--------S----
Q21417_CAEEL/223-311---------------------------------------------VLVAN--FSQEQIERYEVYRKS--------S----
G8ZM97_TORDC/124-204---------------------------------------------LLVTN--LDEQQTNRFEVFHRT--------S----
G0N3L8_CAEBE/259-348---------------------------------------------ILLAN--MSKEQFDRYQAFRSS--------R----
F6RBM6_HORSE/104-189---------------------------------------------ILLSS--LSEEQQNRYEMYRRS--------A----
H8Z9C9_NEMS1/29-110---------------------------------------------....N--LTEDELKRYVKFRRT--------G----
G1Q8Z6_MYOLU/112-198---------------------------------------------ALLAS--FSEEQLTRYEVYRRS--------A----
D2UZ99_NAEGR/128-213---------------------------------------------..LSR--PDHPQYDRYENFTRS--------T----
N1JBX9_BLUG1/169-278---------------------------------------------LLTRA--FNQEQWQRYEAWRSS--------K----
D5GP56_TUBMM/110-214---------------------------------------------VLLDS--FDSQQTQRYEAFRRA--------N----
R9API2_WALI9/115-199---------------------------------------------ILLQH--FSPEQLQRYEVYRRA--------A----
K1VFG9_TRIAC/88-179---------------------------------------------....M--LDEEQGKRFDAFRSA--------V----
G0MKU9_CAEBE/228-314---------------------------------------------LLIGN--FSNEQLDRYIAFRRS--------K----
G0RHL6_HYPJQ/171-281---------------------------------------------MLVEA--FDPVQYDRYEFWRAA--------K----
T1JEW6_STRMM/68-153---------------------------------------------VLVSN--FTEEQLNCYEMFRRS--------A----
B3RLJ9_TRIAD/97-184---------------------------------------------LLVAS--FTEEQHNRYEMYRRA--------A----
A7TJ92_VANPO/131-211---------------------------------------------LLVTN--LDSEQTNRFEVFHRT--------S----
F6ZW75_MONDO/112-197---------------------------------------------ILVSS--FSEEQLNRYEMYRRS--------A----
G7YQE8_CLOSI/176-260---------------------------------------------.LLAH--FDEEQLNRFETFRRA--------T----
A9TN16_PHYPA/2-85---------------------------------------------..LAT--FTPEQMSRYECYRRS--------G----
V5ERX6_PSEBG/318-398---------------------------------------------.....--MDEDQLDRHMASRRG--------A----
F0ZHF9_DICPU/3-88---------------------------------------------TLIQH--FNEEQQTRFEYYKRS--------S----
Q6C5I4_YARLI/75-169---------------------------------------------ILMKN--FDTEQMNRYEVFRRA--------N----
H2AVS4_KAZAF/119-199---------------------------------------------LLVLN--LDSEQNNRFEVFHRT--------S----
F4P958_BATDJ/139-226---------------------------------------------ALLDT--FNPEQLQRYEVYRRA--------H----
I3LCD0_PIG/5-84---------------------------------------------.....--.SQELLDCYEVYHQP--------A----
C5DW95_ZYGRC/143-223---------------------------------------------LLVTN--LDEEQTNRFEVFHRT--------A----
F0YMR8_AURAN/16-102---------------------------------------------QILAR--MTPGEEDRFEHYRRS--------R----
G4T5W0_PIRID/119-203---------------------------------------------LLLQS--MSAEQAERFDVFKRS--------G----
L2GVP8_VAVCU/44-128---------------------------------------------.IVDQ--MSEPQLHRYESFRRS--------G----
M7X6R7_RHOT1/147-228---------------------------------------------VLLEH--FDEQQMDRYEAYRRS--------G----
M0VAS1_HORVD/23-109---------------------------------------------ALLSQ--FTEDQMNRYESFRRS--------G----
H2VS66_CAEJA/143-227---------------------------------------------ILLAN--LSKSQLERYEVYRRS--------N----
G8Y8I3_PICSO/93-173---------------------------------------------LLIAN--FSNEQMERFESYRRM--------T----
Q20361_CAEEL/127-213---------------------------------------------LLIAN--FSNEQLDRYTAFKRS--------R----
Q20563_CAEEL/238-326---------------------------------------------VLLSN--FSQEQLERYESYRRS--------S----
F7EW92_MACMU/101-184---------------------------------------------.FVSS--FSVEQLNHYEMYCHS--------V----
J9D6K1_EDHAE/39-124---------------------------------------------KIIDN--MTEEELRRYETFRRA--------G----
U1LV83_ASCSU/82-168---------------------------------------------LLVAN--FSPEQLERFECYRQS--------S----
D8S5E3_SELML/3-84---------------------------------------------....R--FTADQLDRYEHYRRS--------G----
A8WMG0_CAEBR/206-294---------------------------------------------VLLKN--FSKEQFDRYEVFRQS--------K----

PF09415

S8AJY0_DACHA/43-119-------------------------------------------------------------PELLAK--------L----
H2Y0F9_CIOIN/14-82-------------------------------------------------------------....VK--------L----
F4PWS8_DICFS/16-84-------------------------------------------------------------PKTVES--------I----
U4L209_PYROM/8-85-------------------------------------------------------------PELLTR--------M----
S2JD38_MUCC1/10-90-------------------------------------------------------------PDTVSK--------V----
G8ZRF3_TORDC/7-88-------------------------------------------------------------KETIAR--------T----
R4G9G6_ANOCA/14-83-------------------------------------------------------------KETVNK--------L----
G8JU54_ERECY/11-91-------------------------------------------------------------SDTIAR--------I----
G8BUI6_TETPH/12-107-------------------------------------------------------------KDTIAR--------I----
CENPX_MOUSE/9-78-------------------------------------------------------------KELVSR--------L----
G3VAX2_SARHA/10-79-------------------------------------------------------------KELVNK--------L----
A2QA97_ASPNC/140-216-------------------------------------------------------------PKLLTR--------L----
C5FBD6_ARTOC/119-203-------------------------------------------------------------.KLVTT--------I----
F4IBV2_ARATH/19-86-------------------------------------------------------------......--------.----
J7R3U2_KAZNA/11-81-------------------------------------------------------------RETLSR--------I----
S3C6N7_OPHP1/96-166-------------------------------------------------------------PALLSR--------L----
I2H406_TETBL/18-116-------------------------------------------------------------ENTIAR--------I----
Q75CS7_ASHGO/15-95-------------------------------------------------------------TDTIAR--------L----
G3AIK0_SPAPN/11-75-------------------------------------------------------------VATIAR--------I----
B5YLU9_THAPS/32-130-------------------------------------------------------------....RK--------C----
Q5ACP8_CANAL/20-84-------------------------------------------------------------VTTIAR--------L----
M3AN04_PSEFD/55-133-------------------------------------------------------------QALLLR--------L----
MHF2_SCHPO/11-88-------------------------------------------------------------.NTLAR--------I----
C5GM46_AJEDR/141-227-------------------------------------------------------------SKLLTT--------L----
H2APT8_KAZAF/5-78-------------------------------------------------------------KETISR--------I----
Q0V0M7_PHANO/101-176-------------------------------------------------------------APLLAR--------L----
K1WR03_MARBU/195-277-------------------------------------------------------------TDLINV--------L----
W1QJI5_OGAPD/10-100-------------------------------------------------------------ATTIAR--------L----
G4MKQ9_MAGO7/208-274-------------------------------------------------------------PELLRR--------L----
H6C4D9_EXODN/199-279-------------------------------------------------------------..LIHH--------I----
H9J3A8_BOMMO/594-658-------------------------------------------------------------..VIKE--------L----
Q20071_CAEEL/7-77-------------------------------------------------------------QSTVRS--------M----
Q6FQU7_CANGA/72-149-------------------------------------------------------------QDTIAR--------V----
E9GIB9_DAPPU/22-88-------------------------------------------------------------...IHE--------L----
G2XBK4_VERDV/82-147-------------------------------------------------------------.GLVAN--------L----
E4V2E6_ARTGP/125-209-------------------------------------------------------------.KLITT--------I----
G6CZ62_DANPL/23-97-------------------------------------------------------------QDIVKE--------L----
M2MLI9_BAUCO/155-233-------------------------------------------------------------QPLLVR--------L----
E9D3R3_COCPS/119-204-------------------------------------------------------------PKLLAA--------I----
K0KS96_WICCF/11-97-------------------------------------------------------------ITTLSR--------L----
G0W3G5_NAUDC/38-122-------------------------------------------------------------.ETIEK--------I----
F0X7C4_GROCL/120-187-------------------------------------------------------------PELLTR--------L----
B6QBK2_TALMQ/143-222-------------------------------------------------------------PKLLTT--------I----
G1TJ11_RABIT/10-79-------------------------------------------------------------KELVSK--------L----
M3XKW5_LATCH/12-81-------------------------------------------------------------KETVGK--------L----
A0A0D2X498_CAPO3/11-80-------------------------------------------------------------PALIEK--------I----
MHF2_YEAST/4-80-------------------------------------------------------------KEALIK--------I----
B2B1H7_PODAN/183-249-------------------------------------------------------------PELLSK--------I----
U7PLY7_SPOS1/145-215-------------------------------------------------------------PALLAQ--------L----
CENPX_CHICK/10-79-------------------------------------------------------------KETVER--------L----
C5DYA6_ZYGRC/44-121-------------------------------------------------------------KETIVR--------I----
B6K2J4_SCHJY/11-87-------------------------------------------------------------.NTLAR--------I----
U1FW45_ENDPU/107-189-------------------------------------------------------------.ALVHT--------L----
T0KKN5_COLGC/82-148-------------------------------------------------------------PELLTR--------L----
R1G6G1_BOTPV/122-198-------------------------------------------------------------TKLLNR--------L----
N1PUX0_DOTSN/38-117-------------------------------------------------------------QPLLLR--------L----
Q5BES3_EMENI/391-467-------------------------------------------------------------PKLLTR--------L----
C0NEG5_AJECG/148-230-------------------------------------------------------------.KLLTT--------L----
C4R695_PICPG/8-103-------------------------------------------------------------KTTLAR--------L----
H2ZDL5_CIOSA/5-77-------------------------------------------------------------PEFVTQ--------L----
F4RQY9_MELLP/27-105-------------------------------------------------------------.....R--------L----
J8Q3Z8_SACAR/4-80-------------------------------------------------------------KEALIK--------I----
L8FPN4_PSED2/71-142-------------------------------------------------------------PALLST--------L----
B6GVY1_PENRW/139-217-------------------------------------------------------------SKLLTR--------L----
G2RGB0_THITE/132-198-------------------------------------------------------------PELLTR--------I----
B2WK03_PYRTR/118-193-------------------------------------------------------------RPLLAR--------L----
R7YKC5_CONA1/128-205-------------------------------------------------------------PRLLTR--------L----
C5E218_LACTC/7-86-------------------------------------------------------------SDTIAR--------I----
G2XS27_BOTF4/167-238-------------------------------------------------------------NDLLSK--------I----
G3J304_CORMM/69-135-------------------------------------------------------------KDLLTR--------I----
A7TL11_VANPO/9-87-------------------------------------------------------------KETIAR--------L----
Q6BJ85_DEBHA/17-82-------------------------------------------------------------IATIAR--------L----
B7Q7G6_IXOSC/43-109-------------------------------------------------------------TKTIQE--------L----
A2DLP6_TRIVA/13-80-------------------------------------------------------------KAIIES--------A----
I1G6Y8_AMPQE/9-78-------------------------------------------------------------QETVLQ--------I----
CENPX_BOVIN/10-79-------------------------------------------------------------KELVSK--------L----
M7PB04_PNEMU/14-89-------------------------------------------------------------PQTIAK--------I----
Q7SC05_NEUCR/138-213-------------------------------------------------------------SELLTR--------L----
M3CP67_SPHMS/5-99-------------------------------------------------------------QPLLLR--------L----
Q6CSZ2_KLULA/7-78-------------------------------------------------------------STTIAR--------I----
G3PAR2_GASAC/9-78-------------------------------------------------------------KETVSK--------L----
M1W1I7_CLAP2/71-137-------------------------------------------------------------KDLLTR--------V----
A7E683_SCLS1/185-253-------------------------------------------------------------PDLLSK--------I----
S3E4I6_GLAL2/122-193-------------------------------------------------------------VDLLQV--------L----
E7F1X6_DANRE/12-81-------------------------------------------------------------KETVAK--------L----

PF02269

SUPT3_HUMAN/106-198------------------------------------------------------------------I--------S----
Q17957_CAEEL/27-116------------------------------------------------------------------H--------V----
SPT3_YEAST/5-96------------------------------------------------------------------H--------K----
SPT3_SCHPO/8-99------------------------------------------------------------------S--------K----
TAF13_YEAST/9-101------------------------------------------------------------------N--------L----
TAF13_HUMAN/30-119------------------------------------------------------------------R--------L----

PF15510

F1S2W8_PIG/1-88----------------------------------------------------MAPTTTVSQRKLIKR--------K----
H0VLK4_CAVPO/1-103----------------------------------------------------MALSSTISQRKHIKR--------R----
G1P8B1_MYOLU/1-88----------------------------------------------------MAVAATISQRKRIKR--------K----
CENPW_MOUSE/1-86----------------------------------------------------MAPSTTVTRR..VKR--------K----

PF05236

C5DTC1_ZYGRC/143-382MSDVLFSAGVDIRE--EEALLNSSV.....................NASK..SH.LQSTDVKIPSHP....--.PF----
M7NV88_PNEMU/67-333LQDALISAGVDIKE--EEHNMSRSY.....................DYVF..GSNVIPLEEDRTKMT....--.DF----
D6WBP3_TRICA/521-763INDVAAMGGVNLAE--ETQKIL..........................GS...TEFVGTQIRSCKEE....--.IM----
K4A5I4_SETIT/609-902LNDVTAVSGVNLRE--EEEQLF.SA...................PKEESR..VSEAARRVVQLEEEK....--.LI----
T1I5P6_RHOPR/767-1015INDVAAMGGVNLAE--ESQRIL..........................GS...TEFVGTQIRSCKDE....--.IF----
M0SNT6_MUSAM/533-830LNDVTAVSGVDLRE--EEEQLL.SG...................LKEENQ..TSEATRRVVQEEEER....--.LL----
G3P6F4_GASAC/373-619INDVASMAGVNLSE--ESANIL..........................AT..NSRLVGVVTHSCKDE....--.AF----
I3JJV8_ORENI/483-731INDVTSMAGVNLRE--ENAQIL...............................TSTVGAVVQSCQDQ....--.LF----
U3I7K9_ANAPL/493-741INDVTSMAGVNLSE--ESECIL..........................AT..NSELIGTVIRSCADE....--.PF----
D7KBU1_ARALL/454-706FNDVTAVSGINLRE--EEKRLLGSG...................PKNNGG..VSKACRRIVHEEEER....--.TI----
J5S578_SACK1/142-381MQDVLFSAGIDVRE--EEALLNSSI.....................NASK..SQ.VQANNVRVPKHL....--.PF----
TAF4_CANAL/87-358LNDAIAAAGVDIQQ--EEEILLQQQ...................LNRKSAEGMASNLKSVIRSSKSP....--.PF----
G8YJH0_PICSO/203-470LNDALVAAGVDLQQ--EEELLMQQQ...................MNRSNR..YNLSQTGLYRQPQRE.DVG--SLL----
TAF4_SCHPO/81-360LQDALISCGIQLKE--EELNLSTSF....................YDPSS..LNTFALTTEDRSRKS....--.DF----
I3KPC9_ORENI/575-820INDVASMAGVNLNE--ENARIL..........................AT..SSELVGTKIRSCKDE....--.SF----
TAF4_PICGU/190-450LNDALAAAGVDIGR--EEELLQQQQ...................YNRAPR..INVQQPSYLQSRPARQIQR--TPF----
M0SKQ5_MUSAM/574-867LNDVTAVSGVNLRE--EEEQLL.SG...................LKEESR..ASEATRRIVQEEEER....--.LL----
G3NEU9_GASAC/420-666INDVASMAGVNLRE--ENARIL...............................TSGVGSVVQSCQDQ....--.LF----
E0VZS5_PEDHC/676-918INDVAAMGGVNLAE--ESQRIL..........................GS...TQFVGTQIRSVKDE....--.IF----
B7Q4N4_IXOSC/208-450INDVAAMGGVNLVE--ESQRIL..........................AS..NAEIVGTQIRSCKDE....--.NF----
B9R722_RICCO/615-914LNDVTAVSGVNLRE--EEEQLF.SG...................SKEDSR..VSEASRRVVQEEEER....--.LI----
G6DIJ0_DANPL/686-929INDVAAMGGVNLAE--ESQRIL..........................GS...TEMIGAQIRSCKDE....--.TL----
F7EHC8_XENTR/534-780INDVTSMAGVNLSE--ESACIL..........................AA..NSELVGAVIRSCKDE....--.PF----
H2RT50_TAKRU/514-763INDVASMAGVNLTE--ESANIL..........................AT..NSELVGTVTRSCKDE....--.TF----
W5M1R8_LEPOC/787-1038INDVASMAGVNLNE--ESARIL..........................AT..NSDLVGTQIRSCKDE....--.AF----
T1FTH5_HELRO/544-819INDVATMGGVNLNE--ETRNIL..........................SV..TSILSTGQLRSCTEE....--.SF----
A0A0D2WR67_CAPO3/190-452.NDLLAVAGVD.EE--AENELL........................KQSF..TLRRPEKVVVIPVEP....--.QF----
W1NU21_AMBTC/662-960LNDVTAVSGVNLRE--EEEQLF.ST...................PKEESR..ASEATRRVVQEEEER....--.MI----
B9GNQ9_POPTR/71-368LNDVTAVSGVNLRE--EEEQLF.SG...................TKEDSR..VSEASRRVVQEEEER....--.LI----
E7FFQ2_DANRE/723-973INDVASMAGVNLNE--ENARIL..........................AT..GSELVGTQIRSCKDE....--.AF----
H2L3K0_ORYLA/605-850INDVASMAGVNLNE--ENARIL..........................AT..SSEIVGTKIRSCKDE....--.FF----
K7KI24_SOYBN/610-904LNDVTAVSGVDLRE--EEEQLF.SG...................PKEDSR..ASEAFRRVVQEEEER....--.LI----
G3B181_CANTC/150-404LNDALAAAGVDIQR--EEELLMQQQ......................LSR..VPQQPQFNQQRVAVS....--.QF----
C5XNJ0_SORBI/244-537LNDVTAVSGVNIRE--EEEQLL.SA...................PKEESL..ASQEARRIAQEEEEN....--.LF----
I1PCN0_ORYGL/485-769LNDVTAVSGVNLRE--EEEQLF.SA...................PKEESR..VSEAARMVVQLEEEK....--.LI----
F1MMS1_BOVIN/382-630INDVASMAGVNLSE--ESARIL..........................AT..NSELVGTLTRSCKDE....--.TF----
G1PVA9_MYOLU/499-743INDVTFMAGVNLNE--ESARIL..........................AT..NSELVGTLIQSCEDE....--.PF----
S8C696_DACHA/73-449LSDVLFSTGVDLQA--EEQYLYNDTTPAASFNASASISALQGGIAAEQRQ..INREEAENSGKLRHA...N--DPF----
H9J304_BOMMO/664-908INDVAAMGGVNLAE--ESQRIL..........................GS...TEMIGTQIRSCKDE....--.YL----
H2Z376_CIOSA/119-363INDVASMAGVNLSE--ESARIL..........................AT..NSELVGTQTRSCQDD....--.AV----
F6GZN3_VITVI/617-915LNDVTAVSGVNLRE--EEEQLF.SG...................PKEDSR..VSEASRRVVQEEEER....--.LI----
G8BJL6_CANPC/98-365LNDAIAAAGVNIHE--EEELLLQQQ...................SLRKNE..ATNEKNVLSRAPKVS....--.PF----
K1RCI1_CRAGI/298-543INDVATMGGVNLSE--ESKNIL..........................AS..NADFIGTQIRSCKDE....--.AF----
I2GXP5_TETBL/134-374MQDVLFSAGVNIRE--EEALLNSSV.....................NASK..SQSSQLANMRSPDHP....--.PF----
B9S3E1_RICCO/582-871LNDVTAVSGVNLRE--EEEQLF.SG...................SKEDSR..VSEASRRVVQEEEER....--.LI----
H0UW54_CAVPO/615-857INDVTSMAGVNLSE--ENACIL..........................QT..NSELVGTLIQSCKDE....--.PF----
TAF4B_ARATH/537-850LNDVTAVSGVNLRE--EEEQLF.SG...................AKEDGR..VSEASRRVVHEEEER....--.LI----
J3LQ37_ORYBR/535-819LNDVTAVSGVNLRE--EEEQLF.SA...................PKEESR..VSEAARKVVQLEEEK....--.LI----
I3KWV8_ORENI/407-653INDVASMAGVNLSE--ESANIL..........................AT..NSITVGAVTHSCKDE....--.AF----
M4EMP1_BRARP/541-789FNDVTELSGINLME--EERELLSSL...................TKNNSR..VFKSFRRVAYEEEGR....--.TI----
A4V201_DROME/605-848INDVAAMGGVNLAE--ESQRIL..........................GC...TENIGTQIRSCKDE....--.VF----
H2M8N2_ORYLA/617-857INDVASMAGVNLSE--ESARIL..........................AT..SSELVGMVTRSCKDE....--.AF----
G0VIS5_NAUCC/90-331MQDVLFSAGVDIRE--EEALLNSSI.....................IASK..NK.INTMDVRIPSHP....--.PF----
W5GVI9_WHEAT/53-337LNDVTAVSGVNLRE--EEEQLL.SA...................PKEESP..ATEAARRIVQEEEEN....--.LF----
G3PQM9_GASAC/391-639INDVASMAGVNLSE--ESDRIL..........................AT..NSELVGAVTRSCKDE....--.AF----
C4Y8U4_CLAL4/268-540LNDALAAAGVDIQR--EEELLSIQN.....................NRTA..INLHQQQFANRQRQTFGPM--GSF----
W5K1S8_ASTMX/771-1019INDVASMAGVNLNE--ENARIL..........................AT..GSELVGTQIRSCKDE....--.TF----
V8PJL5_OPHHA/553-793INDVASMAGVNLNE--EYECIL..........................AT..NSEAISTVLCSCPEK....--.LL----
L0PEJ0_PNEJ8/49-310LQDALVSAG....E--EEHNMSRSY.....................DYGF..GSNTLSFEEDRTKIT....--.DF----
K7M5P3_SOYBN/628-925LNDVTAVSGVDLRE--EEEQLF.SG...................PKEDSR..VSEASRKAVQEEEER....--.LI----
TAF4_VANPO/177-416MSDVLFSAGVDIRE--EEALLTSSV.....................AASK..TQ.SQPAAVNIPEHP....--.PF----
U4LUM8_PYROM/80-504LADALTSAGIDLKE--EEARLAQFSNTGFQHGYNVDPYTGQPLSAEDAMR..IEHRRRAALKANHLN....--DPF----
A9T9V3_PHYPA/958-1273LNDVTAVSGVNLRE--EEEQLL.AG...................PKEESR..TTEAMRKFVQEEEER....--.LF----
TAF4_LODEL/264-545LNDAIAAAGVDIQK--EEELLQQRQ...................LNRKPG..APSEKQDGSKSQTQV....--.PL----
I1P2Q6_ORYGL/422-717LNDVTAVSGVNLRE--EEEQLL.SA...................PKEESW..ASEEARKIAQEEDGK....--.LF----
A3LYF3_PICST/20-289LNDAIAAAGVDIQR--EEELLTIQQ....................TRTTD..VSRDLRQFLRSSKPP....--.AF----
H2TWF2_TAKRU/390-638INDVASMAGVNLSE--ESANIL..........................AT..NSELVGVVTHSCKDE....--.AF----
I1GQP3_BRADI/540-832LNDVTAVSGVNLRE--EEEQLF.SA...................PKDESR..VSEAARKVVQLEEER....--.LI----
B6JWG5_SCHJY/81-363LQDALTSFGFNLKE--EEMNLSTSL....................YDASN..LNTFALTTEDRSRKS....--.DF----
J7RYU5_KAZNA/69-318MQDVLFSAGVDIKE--EEALLQTST................NLSKKKLSQ..QRNAAADAVMMPPHQ....--.PF----
G1KA85_ANOCA/600-840INDVTSMAGVNLSE--ESACIL..........................TS..HSEAVGSVIQSCPEE....--.LL----
W5MGZ3_LEPOC/596-844INDVASMAGVNLSE--ENARIL..........................AT..NSELVGSIIRSCRDE....--.PF----
C5M753_CANTT/145-418LNDAIAAAGVDIQQ--EEEILLQQQ...................LNRKSTDGMTSNLKNVIKSSKPP....--.SF----
H3D4Z0_TETNG/401-649INDVASMAGVNLTE--ESANIL..........................AT..NSELVGTVTRSCKDE....--.MF----
T1K318_TETUR/429-680INDVAAMGGVNLVE--ESQRIL..........................AT..NAEFVGAQIRSCKDE....--.NF----
W4XKE1_STRPU/729-985INDVASMAGVNLSE--ESARIL..........................AT..NEAFVGTQLRSCEDE....--.KF----
G1XJL7_ARTOA/79-445LTDVLFSTGVDLQA--EEQYLYND.TPAASF..AGLHSSLSGGVSAEERA..LNRQEAEASGKLRHG...Q--DPF----
K4BUP2_SOLLC/622-920LNDVTAVSGVNLRE--EEEQLF.SG...................PKEDSR..VSEASRRVVQEEEER....--.LI----
TAF4_DEBHA/241-517LNDALAAAGVDIQH--EEELLMQQH...................LNRSSR..FPSAQQPPRQRFAQT....--.SL----
Q177Z6_AEDAE/263-506INDVAAMGGVNLAE--ETQRIL..........................GS...TEFVGTQIRSCKDE....--.IF----
TAF4_ARATH/463-712FNDVTAVSGINLRE--EEKQLLDSG...................PKKNDR..VSKAYRRLVHGEEER....--.TL----

PF09123

E6X1K6_NITSE/9-146LEALFRKAASLDID..KGHAKEITDIIEKKLVDFLIAAERNANLNGRDIIWEADLPITKGLQETIIEFKKL..EEE----
F4CZA8_PSEUX/10-146FERFFREVGGLNID..KQDIRRYRQFVDEMIDDIAITGRNAAKRNGRDVIAPADLPITKGIQERMREFDKL..DVA----
L0J5M6_MYCSM/10-146FERFFRSVASVKID..KNDVRRFREFVDEQIDDIAIAGRNSAKSNGRDVVVPQDLPITKGVQERIREFDKL..EEA----
Q0S1W3_RHOJR/9-146FQRFFRAAAGLQVD..RNDLKRYTDFIDDKIYDVILIGKASAKANLRDVIEPWDLPITKGLQESIHRFEKL..DEE----
B9L7D5_NAUPA/10-146IEAVFKKAASLELD..KSKADRIIDIVEKKFHDLLLVAVEKTGYNGRDVIQPADMPLTRGFEESIREFKKL..EEE----
Q8U348_PYRFU/11-150LQRILEKTCELAVT..KPMAERMMEIVERKLADLFEVAYENATAENSETIKMRHIPITKGFRSSMNLFRAVIEDEN----
Q826G1_STRAW/61-198FERFFRAAASLDVD..KNDLKRYGDFVDAKLYDLLVVGQASAKANGRDTVEPWDLPITKGLQESIHRFRQL..DEE----
D0MI80_RHOM4/10-147FERLFRMAAGLDVD..KDDLKRLSEFVRQKIYDLLLAAQATAEANGRDIIEVHDLPITNGLRESIRAFEAL..DTE----
Q0RZB3_RHOJR/9-146FQRLFRRAAGIDVD..GTDLTRYNAVVTRKLYDLLLAGQASAASHRRYIIEPEDLPITPGMQTNIRIFASF..EHR----
E3J762_FRASU/9-146FERFFRTAAGLDVD..KNDLKRHNEFVNDKLYDLLVIARATAKANLRDVIEPWDLPITKGLQESIHRFRRL..DEE----
Q0RMJ7_FRAAA/4-141FERFFRIAAGLDMD..KNDVKRYGDFVNNKVYDLLLMAQATAKANVRDVIEPWDLPITKGLQESIHHFRDL..DEE----
C0QQA2_PERMH/9-146IEALMRKAAGLDIE..KSKVKEITDIVEKKLYDLLLIGERNANYNNREVIWESDIPLTKGFLESMKKFVKL..EEE----
Q0SK49_RHOJR/18-157FADIFRDVASLGVV..REDFHRFDDVVTAKLYDLLLVAQESAAAQHRHIVEPTDLPITRGLQENIGLFREL..GPG----
B2IWP7_NOSP7/9-146FERFFRTVAGLDVD..KNDLKRYSDFVNHKTYDLLLRGQATAKANGRDIIEPFDVPITKGLEERIHNFKEI..NEE----
Q1AY81_RUBXD/9-146FERLFRAAAGLDVD..KDDLKRYSDFVNKKLYDLLLVGQAAASANGRDVIEPWDLPITRGLEESIDEFRGL..EEE----
Y328_AQUAE/32-168LDHYFRTELDIDLT..DETIELLLNSVKAAFGKLFYGAEQRARWNGRDFIALADLNITKALEEHIKNFQKI..EQD----
D2RF04_ARCPA/11-150LKKILEDTCELDVY..KAEASKMMDIVERKLADLFEVAYDKARAEGREMIMFRDLPLTKGFLNSMELFRKAIERQN----
C8XFC4_NAKMY/8-143.KKFFREAGDINVD..KSDIARFRAFVDQKIDDIAVSARDNAHWNNRDVIAPQDLPITKGLQERMREFGKL..ETA----
Y616_AQUAE/19-164IEKLFREEVGLDIKEHKDKAEQISETVVEIYEELLRKGIENANYNGRDYVSYYDLPITEDLERYMNRFIQDRGEEV----
A6Q0X2_NITSB/9-145LEELFRRGASLDIK..KGHAKEVTDIVEQKLYDLLLMGQKAAKYNNRDVIWKYDLPITKGLEETINEFKKL..EQE----
E4U5U8_OCEP5/8-145FERLFRIAASLDVD..KDDLKRLSDFLGKKIYDLLVVAERNAKYNARDVIYEPDLPVTKGLQETIREFEQM..DVA----
Y1509_METJA/11-150LKKIMKTTCEIDLY..KTEAEDIMDVVEKKLADLFEVAHRNAKEENAKIIKMRHIPLTKGFLNSMELFRSVIEEEN----
W5WDS1_9PSEU/9-147FERFFRAAAGLHMD..KSDLKRYQDFLDRNVHDLFVAAGVTAKANGRDVIEPADLPITKGLQECVREFRKL..DEE----
Q5SI95_THET8/8-145FERLFRQAAGLDVD..KNDLKRVSDFLRNKLYDLLAVAERNAKYNGRDLIFEPDLPIAKGLQETLQEFRRM..DTA----
C5CB24_MICLC/10-147FERLFREAAGLDVD..KNDLARLNDFVRQKVYDLLLAAQATAKDNQRDVIQLHDLPLTLGFKESMRAFDGL..DTA----
G2NZ66_STRVO/9-146FERFFRAAAGLDVD..KNDLKRYSDFVNDKLYDLLLIAEATAKANTRDVILPWDLPITKGLQESIHRFRAL..DQE----
H3ZJQ7_THELN/11-150LEKILEKTCELALT..KPRAEEMMDIVEKKLADLFEVAYENAIAEGSDTIKLRHLPLTKGFKNSMNLFRAVIRDEK----

PF02291

M7WDK4_RHOT1/10-135-------------------------------------------------------------QPVLPR--------D....
G2X9P3_VERDV/76-227-------------------------------------------------------------SAPRPR--------D....
F4QEA6_DICFS/134-255-------------------------------------------------------------NLDEPR--------D....
A5DHC0_PICGU/7-133-------------------------------------------------------------SSAVPR--------D....
E4XZ10_OIKDI/7-128-------------------------------------------------------------GNKLPS--------D....
U9T6J2_RHIID/13-134-------------------------------------------------------------KDQVPR--------D....
E0VC09_PEDHC/9-130-------------------------------------------------------------SKNVPK--------D....
E3JXG9_PUCGT/27-152-------------------------------------------------------------VPSTPR--------D....
J9K8F0_ACYPI/7-128-------------------------------------------------------------KNNMPK--------D....
K0KLS6_WICCF/12-133-------------------------------------------------------------EPVVPR--------D....
TAF9_ENCCU/5-126-------------------------------------------------------------ENLAPR--------D....
R7YZF5_CONA1/62-198-------------------------------------------------------------LSKRPR--------D....
F9X6Q8_ZYMTI/40-177-------------------------------------------------------------QSKRPR--------D....
A7RR68_NEMVE/23-144-------------------------------------------------------------ARSTPK--------D....
T1J4R5_STRMM/4-125-------------------------------------------------------------PKSNPK--------D....
H2WNP3_CAEJA/16-136-------------------------------------------------------------EGQFSK--------E....
G3BAU9_CANTC/20-152-------------------------------------------------------------SSIVPR--------D....
K5XAX2_AGABU/11-134-------------------------------------------------------------AENLPS--------T....
Q0U291_PHANO/54-190-------------------------------------------------------------TSKRPR--------D....
J9KWC1_ACYPI/6-127-------------------------------------------------------------GKHTPK--------D....
D5GLV0_TUBMM/51-182-------------------------------------------------------------GSKKPR--------D....
O45784_CAEEL/16-136-------------------------------------------------------------TDGHSK--------E....
D6RGK3_HUMAN/9-130-------------------------------------------------------------PKSMPK--------D....
M2LVQ3_BAUCO/53-191-------------------------------------------------------------SAKRPR--------D....
A0A068YBD1_ECHMU/4-129-------------------------------------------------------------SEQRPK--------DQLSV
H3HBI0_PHYRM/27-144-------------------------------------------------------------ADVQPL--------D....
A8JFR8_CHLRE/13-135-------------------------------------------------------------DGAQPQ--------D....
G4VC88_SCHMA/11-131-------------------------------------------------------------NEVLPP--------S....
W5JA98_ANODA/20-141-------------------------------------------------------------VKHIPK--------D....
B6JY17_SCHJY/8-131-------------------------------------------------------------FSKTPK--------D....
T5AQB6_OPHSC/37-184-------------------------------------------------------------SDPRPR--------D....
S3DWR3_GLAL2/53-199-------------------------------------------------------------LGKRPR--------D....
F0XDG5_GROCL/91-244-------------------------------------------------------------PSVKPR--------D....
M9M9Y9_PSEA3/14-139-------------------------------------------------------------RGPVPR--------D....
X6M053_RETFI/52-182-------------------------------------------------------------DEAIPV--------P....
F6QLU5_CIOIN/11-132-------------------------------------------------------------NKNLPK--------D....
S8AFN1_DACHA/32-161-------------------------------------------------------------ASRRPR--------D....
F2U4U6_SALR5/62-197-------------------------------------------------------------PLTMPR--------T....
T1KVK8_TETUR/5-124-------------------------------------------------------------KESSPR--------D....
M2Z663_PSEFD/12-149-------------------------------------------------------------TSKRPR--------D....
R4XCN9_TAPDE/5-126-------------------------------------------------------------KESKPR--------D....
I1C775_RHIO9/8-129-------------------------------------------------------------QPPQPR--------D....
B8M2Z2_TALSN/57-194-------------------------------------------------------------KWRRPR--------D....
G8YQE8_PICSO/25-155-------------------------------------------------------------SNPVPR--------D....
B4I6J9_DROSE/15-136-------------------------------------------------------------IKHVPK--------D....
T1KVL0_TETUR/5-124-------------------------------------------------------------KKKLPK--------D....
B9GKT8_POPTR/5-126-------------------------------------------------------------EEDMPR--------D....
B2AYL6_PODAN/47-193-------------------------------------------------------------TAPRPR--------E....
G6DDM8_DANPL/13-134-------------------------------------------------------------SKHLPK--------D....
G4MYK2_MAGO7/63-209-------------------------------------------------------------PAPRPR--------D....
W1QJI0_OGAPD/7-140-------------------------------------------------------------NEEVPR--------D....
F8PNX7_SERL3/10-135-------------------------------------------------------------SDSLPP--------S....
L8G882_PSED2/42-184-------------------------------------------------------------YDKRPR--------D....
C4QZS5_PICPG/5-140-------------------------------------------------------------QAAIPR--------D....
A5E2M9_LODEL/42-174-------------------------------------------------------------EAIVPR--------D....
C3YVK1_BRAFL/4-125-------------------------------------------------------------KMTAPK--------D....
B3RUC6_TRIAD/1-120-------------------------------------------------------------.KNYPK--------D....
T1F9J6_HELRO/4-125-------------------------------------------------------------NKTVSR--------D....
X1WZN5_ACYPI/6-127-------------------------------------------------------------GNRMPK--------D....
TAF9_SCHPO/10-133-------------------------------------------------------------SIKGPK--------D....
A0A0D2U2T2_CAPO3/6-128-------------------------------------------------------------ERYLPK--------A....
E7KGY2_YEASA/26-152-------------------------------------------------------------QEETPR--------D....
F0ZC88_DICPU/5-126-------------------------------------------------------------NLDEPR--------D....
N1JGY7_BLUG1/48-193-------------------------------------------------------------QGKRPR--------D....
V5FLB7_BYSSN/57-217-------------------------------------------------------------KSRRPR--------D....
M5E687_MALS4/16-141-------------------------------------------------------------PVPVPR--------D....
E9E8P1_METAQ/45-192-------------------------------------------------------------SDPRPR--------D....
D8R9T7_SELML/1-121-------------------------------------------------------------.EDIPR--------D....
B8N413_ASPFN/62-215-------------------------------------------------------------KSRRPR--------D....
J4UWI4_BEAB2/51-198-------------------------------------------------------------AAPRPR--------D....
D7EL47_TRICA/12-135-------------------------------------------------------------PKNIPK--------D....
B6TMH7_MAIZE/21-145-------------------------------------------------------------VADEPR--------D....
T1GRU2_MEGSC/18-139-------------------------------------------------------------VKHVPK--------D....
G4TF77_PIRID/740-863-------------------------------------------------------------AAALPQ--------S....
T1HLJ8_RHOPR/5-126-------------------------------------------------------------TKQCPK--------D....
S7W8Z3_SPRLO/3-124-------------------------------------------------------------ETTAPR--------E....
H1VNB3_COLHI/89-239-------------------------------------------------------------SAPRPR--------D....
G0VC63_NAUCC/9-147-------------------------------------------------------------QEDTPR--------D....
B7QAZ8_IXOSC/4-125-------------------------------------------------------------AKSTPK--------D....
A1CP04_ASPCL/76-234-------------------------------------------------------------KSRRPR--------D....
H6BPD0_EXODN/52-203-------------------------------------------------------------SARRPR--------D....
L2GPL4_VITCO/4-123-------------------------------------------------------------ENLAPR--------D....
J9DF67_EDHAE/5-126-------------------------------------------------------------ENNVPR--------D....
R8BG98_TOGMI/62-215-------------------------------------------------------------AAPRPR--------D....
E9GIC2_DAPPU/2-123-------------------------------------------------------------STKIPR--------D....
C4Y633_CLAL4/18-146-------------------------------------------------------------SAVVPR--------D....
A9U4J1_PHYPA/4-124-------------------------------------------------------------EDDMPR--------D....
H8Z9U3_NEMS1/5-126-------------------------------------------------------------DNLAPR--------D....
U5HA82_USTV1/43-172-------------------------------------------------------------HDLLPR--------D....
Q6CIP5_KLULA/8-131-------------------------------------------------------------TLDTPR--------D....
D8TZ69_VOLCA/12-134-------------------------------------------------------------DSSQPQ--------D....
G2R3D3_THITE/87-230-------------------------------------------------------------AAPRPR--------D....
M2SP85_COCH5/66-203-------------------------------------------------------------TSKRPR--------D....
K7IPE7_NASVI/11-132-------------------------------------------------------------VKHVPK--------D....
K1VDX8_TRIAC/5-130-------------------------------------------------------------SKTIPR--------D....
B7XHH0_ENTBH/5-125-------------------------------------------------------------ENFLPR--------D....
D2V9Z9_NAEGR/1-120-------------------------------------------------------------.QNVPK--------D....
M7NV69_PNEMU/9-133-------------------------------------------------------------QKRIPR--------D....
I4Y606_WALMC/4-128-------------------------------------------------------------VKPVPR--------T....

PF07524

SPT7_SCHPO/707-783-------------------------------------------------------------KPLAHD--------V----
TAF8_DANRE/32-108-------------------------------------------------------------QLARRR--------T----
TAF3_SCHPO/7-83-------------------------------------------------------------DELYFS--------L----
ST65G_HUMAN/151-230-------------------------------------------------------------WHSCRQ--------L----
Q9VP40_DROME/6-77-------------------------------------------------------------EVLATV--------L----
Q9SA19_ARATH/24-100-------------------------------------------------------------AEFSFS--------L----
TAF8_HUMAN/29-106-------------------------------------------------------------YHLARR--------R----
Q7YTH5_CAEEL/66-142-------------------------------------------------------------NEAYHN--------V----
B4IIW5_DROSE/4-80-------------------------------------------------------------DRYASD--------L----
Q7S5N4_NEUCR/52-123-------------------------------------------------------------.GLAKN--------G----
TAF8_ARATH/24-100-------------------------------------------------------------YEFSHA--------A----

PF17027

R0KLX4_NOSB1/8-119---------------------------------------------------------------KILK--------L----
R0KSL2_NOSB1/8-119---------------------------------------------------------------KILK--------L----
Y551_ENCCU/8-126---------------------------------------------------------------KILR--------L----
C4V862_NOSCE/8-123---------------------------------------------------------------KILK--------L----
B7XJZ3_ENTBH/37-159---------------------------------------------------------------KILR--------L----
H8ZFK0_NEMS1/19-158---------------------------------------------------------------KVLQ--------A----
I3EGR5_NEMP3/9-149---------------------------------------------------------------KVLQ--------A----
S7XQD0_SPRLO/8-121---------------------------------------------------------------KIIS--------L----

PF15511

F1S2K5_PIG/453-556-------------------------------------------------------------RPRPDP--------Y----
Q0V6N5_PHANO/384-501-------------------------------------------------------------RGLEYP--------S----
G5EH18_MAGO7/443-551-------------------------------------------------------------YGHSCP--------S----
B8MMW5_TALSN/360-468-------------------------------------------------------------HGIPVP--------L----
Q4WWL8_ASPFU/372-480-------------------------------------------------------------HGIPVP--------N----
Q2H4H2_CHAGB/380-487-------------------------------------------------------------YGIEYP--------S----
H6BTF1_EXODN/377-486-------------------------------------------------------------HGEMVP--------S----
F7C6J3_ORNAN/443-546-------------------------------------------------------------RPPRTP--------G----
B6K2P7_SCHJY/365-468-------------------------------------------------------------RTHAND--------C----
F0XUM0_GROCL/440-548-------------------------------------------------------------HGIEYP--------S----
CENPT_RAT/407-510-------------------------------------------------------------RHHQDP--------Y----

PF15630

A3GI04_PICST/11-91-------------------------------------------------------------SQLKST--------V----
A7RMQ5_NEMVE/23-98-------------------------------------------------------------QRLKAA--------L----
A7TEH2_VANPO/17-91-------------------------------------------------------------AQLKGK--------L----
B2W5N7_PYRTR/12-87-------------------------------------------------------------ERLKSA--------L----
B3DJV8_DANRE/9-84-------------------------------------------------------------QRLKAA--------V----
B3RZC1_TRIAD/15-90-------------------------------------------------------------QRLKAA--------L----
B6JX09_SCHJY/4-85-------------------------------------------------------------ERFKAE--------I----
B6QUS3_TALMQ/14-92-------------------------------------------------------------ERFKSA--------L----
B7PXV9_IXOSC/11-86-------------------------------------------------------------MCLKAA--------V----
C4Y931_CLAL4/26-101-------------------------------------------------------------TRLKAS--------I----
C5DNB5_LACTC/22-96-------------------------------------------------------------PQLKGK--------L----
C5G144_ARTOC/13-88-------------------------------------------------------------KQLKAM--------L----
C7YTU2_NECH7/15-94-------------------------------------------------------------HRLKAA--------L----
D3B378_POLPA/165-243-------------------------------------------------------------TKLKQS--------F----
D5GA13_TUBMM/32-107-------------------------------------------------------------QRLKSA--------L----
D7FWQ8_ECTSI/32-105-------------------------------------------------------------LALRAA--------L----
E4ZQ21_LEPMJ/13-88-------------------------------------------------------------ERLKSA--------L----
A0A0D2UKN4_CAPO3/14-89-------------------------------------------------------------ARIKAS--------V----
E9ECA7_METAQ/10-85-------------------------------------------------------------ERLKSA--------L----
F0XLX6_GROCL/7-82-------------------------------------------------------------QELKAA--------L----
F4PRK1_DICFS/235-311-------------------------------------------------------------TKLKQA--------L----
F4RWE9_MELLP/40-115-------------------------------------------------------------EALKSA--------I----
F7DQN4_XENTR/13-88-------------------------------------------------------------QRLKAA--------V----
F7VU88_SORMK/11-86-------------------------------------------------------------ERLKSA--------L----
F9WY71_ZYMTI/13-88-------------------------------------------------------------ERLKSA--------L----
G0V9K8_NAUCC/14-94-------------------------------------------------------------TRLKAK--------I----
G3BEG3_CANTC/8-83-------------------------------------------------------------SQLKSA--------V----
G3PEU4_GASAC/26-101-------------------------------------------------------------QRLKAA--------V----
G3VT77_SARHA/17-92-------------------------------------------------------------KNLKAA--------L----
G4LYK5_SCHMA/9-84-------------------------------------------------------------SEYKAE--------L----
G4MZ92_MAGO7/9-84-------------------------------------------------------------ERLKAA--------L----
G6DRA0_DANPL/11-86-------------------------------------------------------------KKVRVA--------L----
G8YL18_PICSO/12-89-------------------------------------------------------------SQLKSA--------V----
H1VQ95_COLHI/11-86-------------------------------------------------------------ERLKAA--------L----
H2LES2_ORYLA/10-85-------------------------------------------------------------QRLKAA--------V----
H2N958_PONAB/17-92-------------------------------------------------------------QRLKAA--------V----
H6C6E0_EXODN/12-87-------------------------------------------------------------KKLRSA--------L----
H9J6V9_BOMMO/11-84-------------------------------------------------------------QRLRAA--------L----
I1FQJ7_AMPQE/21-96-------------------------------------------------------------QRLKAA--------L----
Q54PV0_DICDI/238-315-------------------------------------------------------------DKIKQS--------L----
Q6BIJ2_DEBHA/13-90-------------------------------------------------------------SQLKSA--------I----
J3KG50_COCIM/15-89-------------------------------------------------------------.RLKAE--------L----

PF00125

H2AV3_ORYSJ/1-106GLQ---------FPVGR-IHR..QLKQ......RT-----Q----------A----NGR----VG-------AT--A---
H2BV_BOVIN/1-99NYS---------LYINR-VLK..EVVP........-----.----------.----QKG----IS-------SR--T---
Q8LK76_MAIZE/18-152IPF---------APFVR-VVR..ELTNF....VTN-----G----------K----VER----YT-------AE--A---
H32_HUMAN/1-132IRK---------LPFQR-LVR..EIA......QDF-----K----------T----DLR----FQ-------SS--A---
A8B678_GIAIC/10-148IQK---------LPFAR-LVQ..ELVEQIAQRDGS-----K----------G----PYR----FQ-------GM--A---
Q8IL74_PLAF7/1-103IHN---------LPISR-.IK..KIMKE...DDEI-----K----------S----NQM----VS-------AD--T---
A8BYH2_GIAIC/11-146IPI---------ACFQR-LVR..DITCS...LPSG-----G----------N----EIR----FQ-------AQ--A---
A8B471_GIAIC/44-178IRK---------LPFSK-LVR..DIVTS....GLS-----K----------S----DIR----FQ-------GA--A---
H2BWT_HUMAN/23-145SFA---------TYFRR-VLK..QVHQ........-----.----------.----GLS----LS-------RE--A---
Q23429_CAEEL/1-104GLT---------FPVGR-IHR..KLRE......TT-----R----------G----KQR----IS-------AG--A---
H2B2_ARATH/87-215EYR---------RYVYK-VMK..QVHP........-----.----------.----DLG----IT-------SK--A---
Q7XV46_ORYSJ/162-290KKP---------HRYPP-WKR............CS-----S----------T----DLR----FQ-------SH--A---
H3L_ENCCU/1-130IRK---------RPFQR-MVR..DLC.......KG-----R----------E----GVR----FQ-------AS--A---
CENPA_DANRE/7-140LRK---------APFSR-LVR..EVCQ.....MFS-----R----------E----HMM----WQ-------GY--A---
HAP5_YEAST/94-225SHS---------LPFAR-.IR..KVMK......TD-----E----------D----VKM----IS-------AE--A---
Q19649_CAEEL/1-114IPR---------SRFER-LVK..ELA......QDF-----V----------T----DLI----FR-------KD--A---
H31_ENCCU/1-135IRR---------LPFQR-ACR..SVVKE....CSN-----A----------T----DIR----FQ-------GP--A---
CENPA_CANGA/101-236IQK---------IPFAK-LVK..EVTEE...FAGE-----S----------Q----DLR----WQ-------SM--A---
Q7PVU9_ANOGA/47-178PV.---------LPVDR-VHT..LLQK.......E-----V----------L----QYK----ID-------SS--V---
Q7RRA6_PLAYO/1-103THQ---------LPISR-.IK..KIMKE...DDKI-----K----------N----SQM----IS-------AD--T---
H2A8_ARATH/1-97GEM---------FQVAR-IHK..QLKN......RV-----S----------A----HSS----VG-------AT--D---
CENPA_SCHPO/1-118IQR---------LPFSR-IVR..EISSEFVANFST-----D----------V----GLR----WQ-------ST--A---
CENPA_MOUSE/1-127FRK---------KPFSM-VVR..EICEK....FSR-----G----------V----DFW----WQ-------AQ--A---
HCP3L_CAEEL/122-257IPK---------APFAR-LVR..EIMQT...STPF-----S----------S----DLR----IR-------SD--A---
H2BV_MOUSE/1-100NYS---------LYINR-VLK..EVVP........-----.----------.----NRG----IS-------SY--S---
Q9DAB5_MOUSE/72-200SFA---------IYFPK-VLK..NIHV........-----.----------.----GLS----LS-------QR--S---
Q8IDZ1_PLAF7/32-167IPK---------IPFVR-VVK..EITRL...FELP-----D----------E----QFR----YT-------PE--A---
A4H675_LEIBR/1-126MQC---------APFQR-LVR..EVSS......AQ-----K----------E----GLR----FQ-------SS--A---
A8BI78_GIAIC/1-100TYA---------TYIYK-VLRSENIRS......EA-----D----------T----DLG----IS-------NK--G---
Q387X7_TRYB2/34-135IQR---------APFRR-FLR..EVVS......NL-----K----------D----SYR----MS-------AA--C---

PF00808

NFYB9_ARATH/62-127MPI---------ANVIR-IMR-----------KTL-----P----------S----HAK--..IS-------DD--A---
HJA2_METJA/2-65LPV---------APFER-ILK-----------KA.-----.----------G----AER--..VS-------RA--A---
NFYB4_ARATH/6-71LPI---------ANVGR-LMK-----------QIL-----P----------S----NAK--..IS-------KE--A---
Q20237_CAEEL/64-128IQP---------TRIKK-VMQ-----------SD.-----E----------D----IGR--..MV-------QS--V---
Q9V452_DROME/18-83LPL---------SRVRT-IMK-----------SS.-----M----------D----TGL--..IT-------NE--V---
NFYB5_ARATH/54-119LPI---------ANVGR-IMK-----------NIL-----P----------A----NAK--..VS-------KE--A---
HAF2_ARCFU/2-65LPM---------APVDR-LIR-----------KA.-----.----------G----AER--..VS-------AD--A---
Q9FHS0_ARATH/10-74FPI---------GRVKK-IMK-----------LD.-----K----------D----INK--..IN-------SE--A---
NC2B_HUMAN/11-75IPR---------AAINK-MIK-----------ETL-----P----------N----VR.--..VA-------ND--A---
HAP3_KLULA/25-90LPI---------NNVAR-LMK-----------NTL-----P----------A----TTK--..VS-------KD--A---
HAF1_ARCFU/6-69LPL---------APVER-LLR-----------KA.-----.----------G----ASR--..VS-------ED--A---
Q9LN09_ARATH/108-172FPM---------NRIRR-IMR-----------SD.-----N----------S----APQ--..IM-------QD--A---
HAP3_SCHPO/10-75LPI---------ANVAR-IMK-----------SAL-----P----------E----NAK--..IS-------KE--A---
NC2B_SCHPO/10-75LPK---------ATVQK-MVS-----------DIL-----P----------V----DLT--..FT-------KE--A---
Q9LHG0_ARATH/7-71FPA---------ARIKK-IMQ-----------AD.-----E----------D----VGK--..IA-------LA--V---
O17072_CAEEL/108-174VPM---------ARVKK-IMR-----------ID.-----D----------D----VRN--FMIA-------SD--A---
O45550_CAEEL/20-84LPQ---------KGINQ-IIK-----------EVV-----P----------E----MR.--..IA-------NE--S---
NC2B_ARATH/14-79LPK---------ATMTK-IIK-----------EML-----P----------P----DVR--..VA-------RD--A---
O17286_CAEEL/64-129LPI---------ANVVR-IMK-----------TQM-----D----------P----QAK--..LA-------KD--A---
B4I7U0_DROSE/10-74FPA---------GRIKK-IMQ-----------SD.-----E----------E----IGK--..VA-------QA--V---
E3GWR6_METFV/1-64LPI---------APIGR-IIK-----------DA.-----.----------G----AER--..VS-------DD--A---
F1SVE7_METKA/4-65LPK---------AAIER-IFR-----------QG.-----I----------G----ERR--..LS-------QD--A---
G7YA03_CLOSI/51-116LPI---------ANVAK-IMK-----------RAV-----P----------G----NGK--.VIA-------KD--A---
HARB_PYRFU/3-65LPI---------APVDR-LIR-----------KA.-----.----------G----AQR--..VS-------EQ--A---
Q2UK39_ASPOR/46-111LPI---------ANVAR-IMK-----------LAL-----P----------D----NAK--..IA-------KE--A---
U6EAE9_9EURY/2-65LPI---------APVGR-IIK-----------NA.-----.----------G----AQR--..IS-------DD--A---
W5LMM0_ASTMX/39-103LPL---------ARIKK-IMK-----------LD.-----E----------D----VKM--..IS-------AE--A---

PF02969

TAF6L_HUMAN/9-73IPR---------ESVRL-MAE-------------S-----T----------G----L.E----LS-------DE--V---
TAF6_SCHPO/3-68WNI---------ESIKD-VAE-------------M-----L----------G----IGN----LA-------DE--P---
Q8LRG9_ORYSJ/1-68VPK---------ETIEV-IGQ-------------S-----V----------G----IAN----LP-------AD--V---
TAF6_YEAST/9-74SPQ---------DTVKD-VAE-------------S-----L----------G----LEN----IN-------DD--V---
TAF6_ARATH/1-68VPK---------ETVEV-IAQ-------------S-----I----------G----ITN----LL-------PE--A---
TAF6_DROME/18-83ISA---------ESMKV-IAE-------------S-----I----------G----VGS----LS-------DD--A---
TAF6_HUMAN/11-76LPS---------ESMKV-VAE-------------S-----M----------G----IAQ----IQ-------EE--T---
Q9GZI6_CAEEL/24-85FTQ---------TA...-.AE-------------M-----L----------G----ITS----LN-------TE--A---
A4IHX4_XENTR/9-74LPS---------ESMKV-IAE-------------S-----V----------G----VSQ----MS-------EE--T---

PF03847

TAF12_YEAST/416-488-SK---------RKLRE-LVK------------TVGIDEGD----------G----ETV----ID-------GD--V---
TAF12_SCHPO/344-411-SK---------RKLHD-LLQ------------QI.....D----------S----EEK----IE-------PE--V---
TAF12_DROME/93-160-TK---------PRLTE-LVR------------EV.....D----------T----TTQ----LD-------ED--V---
Q9VR21_DROME/67-133-SK---------TNMLQ-FVQ------------KI.....D----------A----NSS----LD-------DQ--G---
TAF12_ARATH/401-468-GK---------RSIHE-LLQ------------QI.....D----------P----SEK----LD-------PE--V---
TAF12_HUMAN/59-126-TK---------KKLQD-LVR------------EV.....D----------P----NEQ----LD-------ED--V---
Q9U226_CAEEL/233-297-..---------.KLDD-LMQ------------QI.....S----------S----TTV----LE-------EN--V---
TA12B_ARATH/529-596-GK---------RKIQD-LVS------------QV.....D----------V----HAK----LD-------PD--V---

PF04719

G8BSR2_TETPH/139-219LNK---------AQVKK-LAN-------------------T----------V....LNQ..N.IS-------EN--I...
J8Q476_SACAR/129-209LNK---------TQVKK-LAS-------------------T----------V....TNQ..T.VS-------EN--I...
E3LZD0_CAERE/217-303FNK---------PAVKN-IIA-------------------Q----------A....TGS..A.VS-------DP--L...
I1G7M7_AMPQE/71-156FQK---------STVKK-LMQ-------------------S----------V....SGG..T.VS-------QN--V...
L8Y753_TUPCH/78-161FPK---------AAIKR-LIQ-------------------S----------I....TGP..S.VS-------QN--V...
A9CRT7_ENTBH/59-144FVK---------GAIKK-YIN-------------------N----------V....IGQ..A.VN-------PN--I...
TAF11_SCHPO/95-179LNK---------TNVKK-LAN-------------------Q----------I....LNQ..S.VT-------PN--V...
U1MIS9_ASCSU/191-271FPK---------STIRR-LIQ-------------------Q----------F....TGV..T.PG-------QN--V...
H2PF83_PONAB/98-183FPK---------ARIAG-LMQ-------------------S----------I....TGS..S.VS-------EN--A...
U5DIY7_AMBTC/83-168FQK---------ATMRR-LLQ-------------------N----------I....AGC..P.IS-------MP--M...
A7SYY0_NEMVE/3-89FPK---------AAIKR-LMQ-------------------G----------V....TGG..TSIP-------PN--V...
F4QDB0_DICFS/307-393FNR---------ANIKK-VMQ-------------------A----------V....IPS..TNVN-------QN--S...
F2UQ02_SALR5/216-306FDP---------KVLRK-VVG-------------------R----------AHQSLAST..AEKR-------RT--V...
X6MJW9_RETFI/615-701LEP---------IPIKQ-IMA-------------------K----------SLGMDSYR..M.IT-------DK--M...
M7SAZ2_EUTLA/196-303LRM---------ADVKR-HIN-------------------S----------V....TSQ..S.CP-------VN--V...
U4LM69_PYROM/116-201LNK---------AAVKK-LAN-------------------S----------V....LSQ..S.VT-------AN--V...
A0A0D2WMQ7_CAPO3/375-460FPR---------AVIRK-VMQ-------------------Q----------Q....LNS..A.VS-------IP--S...
T1EEK4_HELRO/30-115FPK---------ASIRR-LMQ-------------------T----------V....SGT..S.VS-------QN--V...
C4VAX6_NOSCE/48-132FPK---------NVVKK-FIA-------------------S----------V....IGQ..A.VN-------PN--M...
E4XD21_OIKDI/168-253FQK---------NQIKR-LMT-------------------M----------T....TPC..T.VH-------QH--V...
L2GN22_VITCO/62-146FPK---------SAIKK-HIS-------------------S----------I....IGQ..A.VN-------PN--M...
R0MGZ1_NOSB1/32-117FPK---------GVIKK-FIS-------------------S----------V....IGQ..A.VN-------PN--L...
S7W8C8_SPRLO/66-151FGK---------NITRK-IVS-------------------E----------I....LNQ..A.CN-------PN--F...
I2H2Q9_TETBL/217-297LNK---------TQIKK-LAN-------------------T----------V....TNQ..N.IT-------EN--I...
E5S4W4_TRISP/310-396FPK---------PFIRK-IIQ-------------------Q----------T....TGY..A.AS-------AN--V...
Q8SSE1_ENCCU/49-130FPK---------AAIKK-YIS-------------------S----------V....IGQ..A.VN-------PN--F...
C7YV21_NECH7/171-283LAD---------SVVKR-VVN-------------------A----------T....VSQ..S.VP-------QN--V...
A0A068YK50_ECHMU/153-237FTK---------SAVSR-LIQ-------------------S----------V....AQT..S.FS-------QN--V...
A4RSC0_OSTLU/31-116LSK---------TMLRR-LFK-------------------A----------A....SGV..T.LN-------AN--G...
L5KZB3_PTEAL/96-181FRR---------EAVKR-VIQ-------------------R----------A....SGT..T.VS-------QK--V...
E9G9V1_DAPPU/3-88FPK---------AAIKR-LMQ-------------------T----------I....TGC..S.IS-------QN--V...
R4XFB3_TAPDE/83-168LNT---------LSVKR-LAN-------------------A----------I....LSQ..T.LP-------QN--I...
D7KI82_ARALL/38-124FKK---------SDMEK-LVQ-------------------R----------I....TGG..PKID-------DT--M...
U5GY91_USTV1/142-223LNK---------AVIRR-LVN-------------------S----------V....LQQ..S.VS-------AP--I...
C1MKX3_MICPC/31-118LPK---------SVLKR-IFQ-------------------S----------F....TGT..V.LN-------SN--G...
A8XSJ7_CAEBR/205-291FRR---------QPIKN-IIT-------------------E----------V....TGS..A.PT-------ET--V...
E1ZAD2_CHLVA/141-221LKK---------GIQLL-MIK-------------------T----------L....GGA....PN-------AK--A...
S2JU45_MUCC1/162-247LNR---------TNVKR-LVS-------------------Q----------V....LNQ..Q.CS-------QT--M...
E3MIY3_CAERE/191-279FQK---------STIRK-LVK-------------------E----------F....TGG..MNVN-------DN--V...
F1N372_BOVIN/106-191FPK---------STIKH-LIQ-------------------A----------V....AGT..P.VS-------QN--V...
C4R2G1_PICPG/131-213VNK---------SVAKR-IVQ-------------------S----------V....LGQ..S.IN-------NN--V...
J9F669_WUCBA/184-270FPK---------SAIRK-LIQ-------------------Q----------A....TGV..T.PG-------HN--V...
L0P7W8_PNEJ8/44-128LDR---------SSFRR-MVN-------------------S----------M....LNQ..S.IT-------PN--I...
G8BAE4_CANPC/112-196INK---------PGVKR-ICN-------------------G----------V....VGH..S.VS-------QV--I...
U9U4H6_RHIID/1-86LSK---------PNVKR-MVG-------------------Q----------I....LGH..P.CS-------HN--M...
C1FD46_MICSR/15-101LPK---------SILKR-LFQ-------------------T----------V....TST..A.PP-------PN--G...
F4RU01_MELLP/124-208LAK---------GSVRK-LAN-------------------S----------V....LQQ..S.VS-------ER--I...
D8U9I9_VOLCA/104-190LPK---------PKMKK-LMQ-------------------A----------I....LLN..AVPN-------EK--A...
D0MZ49_PHYIT/4-97FER---------GAIKR-CMA-------------------Q----------AIHECSAS..DKKD-------PN--VTNV
D8Q789_SCHCM/34-118LPK---------QAVRK-VIQ-------------------Q----------T....VGQ..Q.VS-------QP--V...
G1X2K3_ARTOA/165-253LQK---------SAVKK-VAN-------------------L----------V....LGQ..S.IS-------AN--V...
A5E0E2_LODEL/102-187INK---------GGIKR-ICN-------------------G----------V....VGH..S.IP-------QV--L...
E3KAK5_PUCGT/154-238LAK---------ANVRK-LAN-------------------T----------I....LQQ..S.VT-------DR--V...
D3BH07_POLPA/351-436LNR---------ANVKK-VMQ-------------------G----------V....ITT..P.VN-------QT--S...
D7MFL1_ARALL/108-194LQR---------PQMKK-LLI-------------------G----------V....TGS..QKIG-------MP--M...
T1K7I1_TETUR/31-116FPK---------ASVKR-LMQ-------------------S----------I....TGC..S.VS-------QN--V...
Q21417_CAEEL/223-311FKK---------STIKR-LIN-------------------E----------F....TGG..IDLG-------KK--V...
G8ZM97_TORDC/124-204LNK---------TQVKK-IAG-------------------M----------V....INQ..S.VT-------EN--I...
G0N3L8_CAEBE/259-348FKK---------SDITR-LIK-------------------E----------Y....TNN..AKIP-------AT--V...
F6RBM6_HORSE/104-189FRQ---------ETMRS-LIQ-------------------T----------T....AGR..S.VS-------QN--V...
H8Z9C9_NEMS1/29-110FNK---------GGIRK-FVS-------------------Q----------V....LDQ..T.CN-------PN--F...
G1Q8Z6_MYOLU/112-198FPR---------AAIGC-VVQ-------------------S----------A....AGG..APVE-------RN--A...
D2UZ99_NAEGR/128-213F.K---------PVMKR-LIN-------------------N----------S....TST..PSTN-------KN--V...
N1JBX9_BLUG1/169-278LSD---------SVVRR-IVN-------------------Q----------T....LSQ..S.AP-------QQ--V...
D5GP56_TUBMM/110-214LNK---------AAVKK-LAN-------------------Q----------V....LSQ..S.VT-------AG--V...
R9API2_WALI9/115-199LNK---------STIRK-LCN-------------------Q----------T....LNQ..S.VS-------QN--V...
K1VFG9_TRIAC/88-179IPK---------AVVKK-LLW-------------------T----------KADAQLNK..DLYD-------QH--IPNN
G0MKU9_CAEBE/228-314FTR---------QVIKN-VIS-------------------E----------V....TGK..P.TS-------DP--I...
G0RHL6_HYPJQ/171-281LSE---------AVVKR-VVN-------------------A----------T....VSQ..S.VP-------QM--V...
T1JEW6_STRMM/68-153FPK---------AAIKR-LMQ-------------------S----------I....TGC..T.VS-------QN--V...
B3RLJ9_TRIAD/97-184FPK---------SIVKR-LIQ-------------------N----------V....AGSGAS.VP-------QN--V...
A7TJ92_VANPO/131-211LNK---------SQVKK-LAG-------------------T----------V....INQ..S.VT-------EN--I...
F6ZW75_MONDO/112-197FPK---------ATIKR-LIQ-------------------T----------I....TGT..L.VS-------QN--V...
G7YQE8_CLOSI/176-260FAK---------ASVRR-LIQ-------------------S----------V....ASC..A.VS-------QN--V...
A9TN16_PHYPA/2-85FQR---------ANMRR-LLQ-------------------S----------V....SGG..P.VS-------VP--M...
V5ERX6_PSEBG/318-398LNK---------TSVRK-LVN-------------------H----------V....LSQ..S.VS-------QH--V...
F0ZHF9_DICPU/3-88FQR---------ANIKK-VMQ-------------------S----------V....LSA..P.VN-------QT--S...
Q6C5I4_YARLI/75-169INR---------PGVKK-LAN-------------------A----------V....LNQ..S.IT-------AN--V...
H2AVS4_KAZAF/119-199LNK---------SQVKK-LAS-------------------T----------V....CNQ..T.IS-------EN--I...
F4P958_BATDJ/139-226LPK---------SSMRK-YLQ-------------------N----------I....VGG..I.VP-------AS--V...
I3LCD0_PIG/5-84FPR---------ANQRH-LIQ-------------------S----------M....AGS..L.IA-------QN--I...
C5DW95_ZYGRC/143-223LSK---------TQVKK-IAG-------------------M----------V....INQ..S.VT-------EN--M...
F0YMR8_AURAN/16-102FNR---------TGISQ-IMR-------------------R----------S....LADDAR.VD-------EN--S...
G4T5W0_PIRID/119-203LNK---------AAIKR-VAA-------------------Q----------S....DHQ....MS-------NG--V...
L2GVP8_VAVCU/44-128FLK---------VNIKK-LVN-------------------N----------V....LNQ..A.CN-------PN--F...
M7X6R7_RHOT1/147-228LTK---------SSVRK-LVN-------------------Q----------V....LQQ..S.VS-------PS--I...
M0VAS1_HORVD/23-109FQK---------SNMKK-LLA-------------------S----------I....TGS..QKIS-------MP--T...
H2VS66_CAEJA/143-227FKK---------ASIKK-LIG-------------------D----------V....TGT..A.PS-------DQ--L...
G8Y8I3_PICSO/93-173VNK---------PGIKK-VCT-------------------S----------V....LNH..S.LP-------QN--I...
Q20361_CAEEL/127-213FNR---------RIIKN-VIT-------------------R----------T....TGQ..I.PS-------DP--L...
Q20563_CAEEL/238-326FQK---------STIRR-LIS-------------------Q----------Y....TGG..VNVG-------QS--V...
F7EW92_MACMU/101-184FPK---------AAIKR-PIQ-------------------S----------I....SGT..S.MS-------QN--V...
J9D6K1_EDHAE/39-124FNK---------GGIRK-ICN-------------------S----------I....LNQ..S.CN-------PN--F...
U1LV83_ASCSU/82-168FPR---------RKVRR-LIR-------------------Q----------S....TGQ..N.PS-------EN--F...
D8S5E3_SELML/3-84FPK---------TQMRR-LVQ-------------------N----------V....AGC..S.IS-------VP--M...
A8WMG0_CAEBR/206-294FQR---------TMIRR-LMK-------------------K----------F....TNN..APFP-------EG--A...

PF09415

S8AJY0_DACHA/43-119LKN---------.FIED-.EG-------------------.----------.----.TK----IS-------GA..A---
H2Y0F9_CIOIN/14-82LEK---------.HFTD-QNS-------------------.----------.----.TK----IS-------TKDGT---
F4PWS8_DICFS/16-84LRL---------.AIKD-..K-------------------.----------.----.IK----IS-------KE..S---
U4L209_PYROM/8-85LQE---------.FSDD-.KR-------------------.----------.----.TR----IS-------SA..A---
S2JD38_MUCC1/10-90FKS---------.SFKN-.QN-------------------.----------.----.SR----LN-------KE..A---
G8ZRF3_TORDC/7-88FQV---------GAFEN-.ES-------------------.----------.----.TN----IT-------DE..T---
R4G9G6_ANOCA/14-83LQL---------.YFKD-.DK-------------------.----------.----.TR----VS-------GD..A---
G8JU54_ERECY/11-91FQL---------CSFTQ-.DS-------------------.----------.----.TR----IT-------ED..T---
G8BUI6_TETPH/12-107LQL---------ESFGE-.E.-------------------.----------.----.TR----IS-------AE..S---
CENPX_MOUSE/9-78LHL---------.HFRD-.CK-------------------.----------.----.TK----VS-------GD..A---
G3VAX2_SARHA/10-79LYL---------.HFKD-.DR-------------------.----------.----.CK----VS-------GD..A---
A2QA97_ASPNC/140-216LHH---------.HFQN-.EK-------------------.----------.----.TK----IA-------KD..A---
C5FBD6_ARTOC/119-203LHE---------IAFKK-.KK-------------------.----------.----.TR----IT-------KD..A---
F4IBV2_ARATH/19-86IWA---------RRFRE-RER-------------------S----------D----AID----AT-------EA..E---
J7R3U2_KAZNA/11-81LTQ---------.SFKN-.KS-------------------.----------.----.TT----ID-------DQ..A---
S3C6N7_OPHP1/96-166LSH---------.FFQN-.HK-------------------G----------T----PTR----LT-------QD..A---
I2H406_TETBL/18-116LQT---------SSFVD-.EN-------------------.----------.----.TR----IT-------KN..T---
Q75CS7_ASHGO/15-95FHT---------CSFTQ-.DS-------------------.----------.----.TK----IT-------ED..A---
G3AIK0_SPAPN/11-75FRE---------LSFKN-.DS-------------------.----------.----.TR----IT-------MD..T---
B5YLU9_THAPS/32-130LQL---------HH...-.PY-------------------.----------.----.QK----IA-------SD..A---
Q5ACP8_CANAL/20-84FKE---------LSFKD-.PQ-------------------.----------.----.TR----IT-------LS..T---
M3AN04_PSEFD/55-133LHE---------.SFQD-.KN-------------------.----------.----.TK----ID-------KH..A---
MHF2_SCHPO/11-88LTL---------.YFSS-EKG-------------------.----------.----.TK----IT-------PS..A---
C5GM46_AJEDR/141-227LHR---------.HFQD-.DK-------------------.----------.----.TK----IA-------KD..A---
H2APT8_KAZAF/5-78LLN---------KLNEN-GEN-------------------.----------.----.FS----IN-------TE..T---
Q0V0M7_PHANO/101-176LYE---------.NFED-.PN-------------------.----------.----.TQ----IQ-------KG..A---
K1WR03_MARBU/195-277LHS---------.FFKQ-.PG-------------------.----------.----.SR----IT-------KD..A---
W1QJI5_OGAPD/10-100FHT---------VAFDD-.KS-------------------.----------.----.IK----IS-------HK..T---
G4MKQ9_MAGO7/208-274LHE---------.AFDK-.DT-------------------.----------.----.TR----VS-------KE..A---
H6C4D9_EXODN/199-279MQA---------.QFTT-PEK-------------------.----------.----.TT----VS-------AD..A---
H9J3A8_BOMMO/594-658LEN---------.HFQE-.SK-------------------.----------.----.TK----IA-------PH..A---
Q20071_CAEEL/7-77LIV---------ARRGK-.KR-------------------.----------.----.LN----LD-------PD..A---
Q6FQU7_CANGA/72-149LQV---------AAFKD-.KK-------------------.----------.----.TR----IE-------SD..V---
E9GIB9_DAPPU/22-88MKM---------.YTTN-.HK-------------------.----------.----.TK----IG-------NE..A---
G2XBK4_VERDV/82-147LKE---------.MFAR-.EE-------------------.----------.----.TR----MT-------EG..A---
E4V2E6_ARTGP/125-209LHE---------VAFKK-.QK-------------------.----------.----.TR----VT-------KD..G---
G6CZ62_DANPL/23-97LKS---------.SFQD-.SQ-------------------.----------.----.TK----LS-------CE..A---
M2MLI9_BAUCO/155-233LHE---------.HFVD-.KQ-------------------.----------.----.TK----ID-------KH..A---
E9D3R3_COCPS/119-204IHH---------.HMKS-.KG-------------------.----------E----KMR----IT-------KD..A---
K0KS96_WICCF/11-97FQT---------AVFEH-.ED-------------------.----------.----.SK----IT-------QQ..T---
G0W3G5_NAUDC/38-122LRS---------ESFQN-.KD-------------------.----------.----.TT----IT-------KE..T---
F0X7C4_GROCL/120-187LHH---------.FFSK-.PN-------------------.----------.----.SR----IT-------QD..A---
B6QBK2_TALMQ/143-222LHH---------.HFQN-.KK-------------------.----------.----.TK----IT-------KD..A---
G1TJ11_RABIT/10-79LHL---------.HFKN-.DK-------------------.----------.----.TK----VS-------GD..V---
M3XKW5_LATCH/12-81LSL---------.YFTD-.DK-------------------.----------.----.IR----VS-------SD..A---
A0A0D2X498_CAPO3/11-80FEQ---------.SWGG-.RK-------------------.----------.----.LR----TA-------SD..S---
MHF2_YEAST/4-80LSQ---------NE.GG-.ND-------------------.----------.----.MK----IA-------DE..V---
B2B1H7_PODAN/183-249VHE---------.LFEH-.KE-------------------.----------.----.TK----IT-------KD..A---
U7PLY7_SPOS1/145-215LHH---------.FFQN-.PN-------------------G----------T----ATR----LT-------QD..A---
CENPX_CHICK/10-79LRL---------.HFRD-.GR-------------------.----------.----.TR----VN-------GD..A---
C5DYA6_ZYGRC/44-121LKL---------QAFEH-.ES-------------------.----------.----.TT----IT-------EE..T---
B6K2J4_SCHJY/11-87LTL---------.YFSP-ENR-------------------.----------.----.TK----IT-------PT..A---
U1FW45_ENDPU/107-189LNY---------.HFGD-.KD-------------------.----------.----KTR----IA-------QD..A---
T0KKN5_COLGC/82-148LHE---------.FFEK-.DD-------------------.----------.----.TR----LS-------KD..A---
R1G6G1_BOTPV/122-198LHE---------.GFED-.ED-------------------.----------.----.MR----IG-------KE..A---
N1PUX0_DOTSN/38-117IHE---------.GFAD-.KN-------------------.----------.----.TK----ID-------KQ..A---
Q5BES3_EMENI/391-467LHH---------.HFRS-.EK-------------------.----------.----.TK----IA-------KD..A---
C0NEG5_AJECG/148-230LHR---------.HFQD-.DK-------------------.----------.----.TK----IT-------KD..A---
C4R695_PICPG/8-103FHT---------VAFEE-.PD-------------------.----------.----.TR----IS-------SK..T---
H2ZDL5_CIOSA/5-77LQK---------.YFSD-SDR-------------------.----------.----.IK----IN-------TNDST---
F4RQY9_MELLP/27-105SSL---------EATSE-.PP-------------------.----------.----.PK----IN-------DA..A---
J8Q3Z8_SACAR/4-80LGQ---------NN.GG-.KD-------------------.----------.----.MK----ID-------EK..V---
L8FPN4_PSED2/71-142LTE---------.FFAD-.ER-------------------.----------.----.TR----IS-------RG..A---
B6GVY1_PENRW/139-217LHQ---------.HFQN-.EK-------------------.----------.----.TK----VA-------KD..A---
G2RGB0_THITE/132-198LHE---------.FFEK-.EG-------------------.----------.----.TR----IT-------RD..A---
B2WK03_PYRTR/118-193LLE---------.NFDD-.PN-------------------.----------.----.MQ----IQ-------TG..A---
R7YKC5_CONA1/128-205LHE---------.GFED-.KD-------------------.----------.----.IK----IG-------KE..A---
C5E218_LACTC/7-86FQT---------CSFKD-.DS-------------------.----------.----.TR----IT-------ES..T---
G2XS27_BOTF4/167-238MHE---------.LFAE-.PN-------------------.----------.----.TR----IS-------KE..A---
G3J304_CORMM/69-135LHD---------.LFEK-.DA-------------------.----------.----.TR----VS-------RD..A---
A7TL11_VANPO/9-87LET---------SSFEH-.SS-------------------.----------.----.TR----IT-------ED..V---
Q6BJ85_DEBHA/17-82FQT---------SAFKN-.EK-------------------.----------.----.TR----IT-------QK..T---
B7Q7G6_IXOSC/43-109MLM---------.GFQD-.EK-------------------.----------.----.TK----MN-------AQ..A---
A2DLP6_TRIVA/13-80LAD---------.QNDD-.QK-------------------.----------.----.LR----IP-------PT..T---
I1G6Y8_AMPQE/9-78LKS---------.NFSD-.SK-------------------.----------.----.TK----VN-------ND..A---
CENPX_BOVIN/10-79LHL---------.HFKD-.KK-------------------.----------.----.TK----VS-------GD..A---
M7PB04_PNEMU/14-89FSL---------.AFTD-.PT-------------------.----------.----.TK----IS-------AS..A---
Q7SC05_NEUCR/138-213LYE---------.FFES-.DK-------------------.----------.----.TK----IT-------KD..A---
M3CP67_SPHMS/5-99LHE---------.GFHH-.KD-------------------.----------.----.TK----ID-------TR..A---
Q6CSZ2_KLULA/7-78LQT---------EGFQD-.SN-------------------.----------.----.TR----IT-------EE..C---
G3PAR2_GASAC/9-78LSS---------.FFKE-.DK-------------------.----------.----.TR----LS-------GD..A---
M1W1I7_CLAP2/71-137LHE---------.FFTK-.DA-------------------.----------.----.TR----IS-------RD..A---
A7E683_SCLS1/185-253IHE---------.LFTE-.QN-------------------.----------.----.SR----IS-------KE..A---
S3E4I6_GLAL2/122-193LQQ---------.FFTK-.PE-------------------.----------.----.TR----IR-------KD..A---
E7F1X6_DANRE/12-81LSR---------.SFRE-.DK-------------------.----------.----.TR----VS-------SD..A---

PF02269

SUPT3_HUMAN/106-198FAT---------ELQSM-MYS-----------------------------------LGDARRPLH-------ET------
Q17957_CAEEL/27-116LRR---------DLRSM-VYG-----------------------------------FGDDKEPYD-------KT------
SPT3_YEAST/5-96YRV---------EIQQM-MFV-----------------------------------SGEINDPPV-------ET------
SPT3_SCHPO/8-99YRV---------EIQQM-MFI-----------------------------------LGEVQDPLP-------ET------
TAF13_YEAST/9-101FNK---------DVSSL-LYA-----------------------------------YGDVPQPLQ-------AT------
TAF13_HUMAN/30-119FSK---------ELRCM-MYG-----------------------------------FGDDQNPYT-------ES------

PF15510

F1S2W8_PIG/1-88APR---------GFLKR-VFK-----------------------------------RRKPHLRLT-------TD--S---
H0VLK4_CAVPO/1-103APR---------GFLRR-VFK-----------------------------------RQKPHLRLE-------KH--G---
G1P8B1_MYOLU/1-88APR---------GFLRR-VFK-----------------------------------RRKPHLRLE-------AS--C---
CENPW_MOUSE/1-86APR---------AFLKR-TLK-----------------------------------QKKPHLGLG-------RC--C---

PF05236

C5DTC1_ZYGRC/143-382LHP---------DQVNQ-FMR-------------------K----------V----CKEQN..FSQNF....AKNPE...
M7NV88_PNEMU/67-333LNP---------IPLND-LIY-------------------R----------I----AISNS..LK.......TIDPD...
D6WBP3_TRICA/521-763CSM---------GPLQQ-KIR-------------------Q----------I----VMKHG..LD.......EPSAD...
K4A5I4_SETIT/609-902LQK---------GPLAR-KLA-------------------E----------I----MRKCN..LK.......VIGTD...
T1I5P6_RHOPR/767-1015LHS---------VPLVN-KIA-------------------Q----------I----ANKYG..LE.......EPALD...
M0SNT6_MUSAM/533-830LQQ---------ASLRK-KLS-------------------D----------I----MFKCS..LK.......NIGGD...
G3P6F4_GASAC/373-619LSF---------SVLQK-TMQ-------------------E----------I----GRRHG..VT.......DLGAE...
I3JJV8_ORENI/483-731LST---------QPVLS-RIL-------------------H----------T----GQALG..VT.......DVGPE...
U3I7K9_ANAPL/493-741LSS---------EALQK-KIL-------------------N----------I----GKRHD..IM.......ELNSD...
D7KBU1_ARALL/454-706LQK---------ILLKR-KLT-------------------E----------I----MAKSG..LK.......HIDHD...
J5S578_SACK1/142-381LHP---------EQVSI-YMK-------------------K----------I----GKEQN..FNLAF....TKNPD...
TAF4_CANAL/87-358LHN---------YHLAA-FID-------------------K----------V----AKQNG..IQQNF....LMDGE...
G8YJH0_PICSO/203-470LNP---------YHLAV-YMQ-------------------R----------V----SKENG..IQQNF....FQDPE...
TAF4_SCHPO/81-360LNS---------FVLMQ-TVS-------------------N----------I----VNLHR..LK.......SMDSD...
I3KPC9_ORENI/575-820LPS---------GLLLR-RIL-------------------D----------T----AKKFG..VS.......EVPPE...
TAF4_PICGU/190-450LNS---------YHLGT-FMQ-------------------R----------V----ARENG..VLQSF....MSDNE...
M0SKQ5_MUSAM/574-867LLK---------APLQR-KLS-------------------D----------I----MLKCG..LK.......NIGGD...
G3NEU9_GASAC/420-666LSP---------SLVLS-RIL-------------------L----------S----GRAFA..VT.......DVGPN...
E0VZS5_PEDHC/676-918LHS---------IPLQN-KIR-------------------Q----------I----VSNHG..LD.......EPSSE...
B7Q4N4_IXOSC/208-450LFT---------NPLQR-RIT-------------------S----------V----AVKYG..IE.......EIPSD...
B9R722_RICCO/615-914LQK---------TPLQK-KLA-------------------E----------I----MVKCG..LK.......NINND...
G6DIJ0_DANPL/686-929VPM---------AVMQA-RIR-------------------A----------V----SLRHG..LE.......EPPAE...
F7EHC8_XENTR/534-780LFT---------SALQN-RIL-------------------D----------I----GKRHD..IK.......ELNSD...
H2RT50_TAKRU/514-763LSP---------SLLGH-RAL-------------------E----------I----GKKFG..VG.......ELGAD...
W5M1R8_LEPOC/787-1038LPS---------GLLHK-RIL-------------------E----------T----AKKFG..VT.......EVPAE...
T1FTH5_HELRO/544-819LDQ---------HLLSK-FVS-------------------T----------I----AQRKG..LS.......TVQPD...
A0A0D2WR67_CAPO3/190-452INR---------ENITR-KVQ-------------------Q----------V----ASAAG..LF.......IEDLD...
W1NU21_AMBTC/662-960LQK---------GPLQK-KIV-------------------E----------I----MAKCK..LK.......STGND...
B9GNQ9_POPTR/71-368LQK---------KPLQK-KLG-------------------E----------I----MAKCG..LK.......NIGND...
E7FFQ2_DANRE/723-973LPA---------SLLHK-RLL-------------------E----------T----AKKFG..VT.......EVSME...
H2L3K0_ORYLA/605-850LPA---------DVLHR-RIL-------------------D----------T----ARKLG..VT.......EVPAD...
K7KI24_SOYBN/610-904LQK---------APLQR-KLI-------------------E----------I----ITECG..LK.......SMSDD...
G3B181_CANTC/150-404LNP---------YHVNT-YMQ-------------------K----------S----ARENG..VLQNF....LQDPE...
C5XNJ0_SORBI/244-537LRK---------GPLLK-KLA-------------------E----------I----ARKCD..LK.......NISGD...
I1PCN0_ORYGL/485-769LQK---------GPLKK-KLA-------------------E----------I----MRKCN..LK.......SIGSD...
F1MMS1_BOVIN/382-630LLP---------APLQR-RIL-------------------E----------I----GKKHG..IT.......ELHPD...
G1PVA9_MYOLU/499-743LFI---------GALQR-RIL-------------------D----------I----GRKHD..IT.......ELSSE...
S8C696_DACHA/73-449LSN---------SNLQA-KIH-------------------Q----------K----LVDQR..LGS......SGNPDH..
H9J304_BOMMO/664-908VPT---------SVMQA-RVK-------------------A----------I----IARHN..LD.......EPTGE...
H2Z376_CIOSA/119-363LNP---------AVLQK-RMT-------------------E----------V----AARNP.TIQ.......HIHAD...
F6GZN3_VITVI/617-915LQK---------APLQK-KLA-------------------E----------I----MARCS..LK.......NISND...
G8BJL6_CANPC/98-365LNP---------YHLAA-FLG-------------------K----------V----AKTHQ..INQNF....LEDGD...
K1RCI1_CRAGI/298-543LYH---------GPLLA-RIT-------------------A----------I----AKKHG..ID.......DISSD...
I2GXP5_TETBL/134-374LHP---------DQLAM-FMK-------------------K----------I----SNEQN..FPQNF....SRSPD...
B9S3E1_RICCO/582-871LQK---------TPLQK-KVA-------------------E----------I----MAKCG..LK.......YINSD...
H0UW54_CAVPO/615-857LFI---------GALQK-RIL-------------------D----------I----GKKHD..IT.......EFNSD...
TAF4B_ARATH/537-850LQK---------NPLQR-KLA-------------------E----------I----MAKAG..LK.......QISND...
J3LQ37_ORYBR/535-819LQK---------GPLTK-RLA-------------------E----------I----MRKCN..LK.......SMGSD...
I3KWV8_ORENI/407-653LSY---------AILQR-KML-------------------E----------I----GRRYG..VT.......ELSPE...
M4EMP1_BRARP/541-789LQK---------APLQR-KLA-------------------G----------I----MAKSG..IK.......HIKDD...
A4V201_DROME/605-848LNL---------PSLQA-RIR-------------------A----------I----TSEAG..LD.......EPSQD...
H2M8N2_ORYLA/617-857LST---------PSLTR-IAL-------------------E----------I----GKKFG..VS.......ELGTD...
G0VIS5_NAUCC/90-331LHP---------DQVAR-FMQ-------------------R----------V----AKEQQRRTRQDF....SKYPE...
W5GVI9_WHEAT/53-337LQK---------GPLLK-KLA-------------------E----------I----VLKSN..LK.......NAGAD...
G3PQM9_GASAC/391-639LST---------ALLAR-RAL-------------------E----------I----GRKFG..VS.......ELGPD...
C4Y8U4_CLAL4/268-540LHP---------YHVAL-FMN-------------------R----------T----ARENG..VAQNF....MVDPE...
W5K1S8_ASTMX/771-1019LQA---------NLLHK-RMI-------------------E----------I----ARTFG..VN.......EIGGD...
V8PJL5_OPHHA/553-793LSS---------EELQK-RIL-------------------K----------K----GKRHD..IM.......EVNSD...
L0PEJ0_PNEJ8/49-310LNP---------IPLND-LIY-------------------R----------I----AISNS..LK.......TIDPE...
K7M5P3_SOYBN/628-925LQK---------APLQK-KLI-------------------D----------I----MAKCG..LK.......GMSND...
TAF4_VANPO/177-416LHP---------DQVAA-FMK-------------------K----------A----SKEQN..FNQNF....AKQGE...
U4LUM8_PYROM/80-504LHP---------NVLAG-ILA-------------------N----------K----TRTEN..CNQFVFDASGAGHD...
A9T9V3_PHYPA/958-1273LER---------GPLRA-KAQ-------------------A----------I----AAKCG..LR.......SVSED...
TAF4_LODEL/264-545LNP---------YHLSA-FLA-------------------K----------V----SKTHQ..IHQNF....LEDGN...
I1P2Q6_ORYGL/422-717LQK---------GPLLK-KLA-------------------A----------I----VPKCN..LK.......SIGGD...
A3LYF3_PICST/20-289LNP---------YHVAS-FMN-------------------R----------V----ARENG..VQQNF....LQDGD...
H2TWF2_TAKRU/390-638LST---------SLLQR-RIL-------------------E----------I----GRKYG..VT.......DLGAE...
I1GQP3_BRADI/540-832LQK---------GPLTK-KLA-------------------E----------L----MRRYD..LK.......SIGSD...
B6JWG5_SCHJY/81-363LNS---------FALIQ-TVN-------------------R----------I----VSMHR..LK.......GIDPE...
J7RYU5_KAZNA/69-318LHP---------DQVLA-TMR-------------------K----------A----SKDAQ..FNSNFISSSNKKAD...
G1KA85_ANOCA/600-840LSS---------DVLQK-KII-------------------E----------I----GKKHG..IT.......EVNSD...
W5MGZ3_LEPOC/596-844LLT---------AILQK-RIL-------------------E----------T----GKKYG..IS.......DVTLD...
C5M753_CANTT/145-418LNN---------YHLAA-FMD-------------------K----------V----AKENG..IQQNF....LMDGE...
H3D4Z0_TETNG/401-649LSP---------SLLSR-RAL-------------------E----------I----GKKFG..VS.......ELGAD...
T1K318_TETUR/429-680LFT---------NPLQN-RIN-------------------E----------I----AKKNG..LD.......DVLSD...
W4XKE1_STRPU/729-985LHK---------TPLQH-CMS-------------------K----------I----CTKHG..IS.......DAAPA...
G1XJL7_ARTOA/79-445LHR---------EKLLG-QTH-------------------Q----------K----LVKER..I........SSNADHTA
K4BUP2_SOLLC/622-920LQK---------IPLQK-KLT-------------------E----------I----MAKCG..LK.......SMSSD...
TAF4_DEBHA/241-517FSP---------YHVAA-FMQ-------------------R----------V----ARENG..VMQNF....YQDAE...
Q177Z6_AEDAE/263-506LHM---------SALQA-KIR-------------------G----------I----VARHG..LE.......EPSSE...
TAF4_ARATH/463-712LQK---------IPLQR-KLT-------------------E----------I----MGKSG..LK.......HIDHD...

PF09123

E6X1K6_NITSE/9-146IDV.........QDVLN-YLT-------------------T----------I.PPLKYPLAADLE-------AK------
F4CZA8_PSEUX/10-146PDV.........RELLR-SDM-------------------R----------R.PPSDVTFGEDTE-------DL------
L0J5M6_MYCSM/10-146DEI.........RELLR-QVV-------------------R----------Q.PPGDVTFAEDTD-------RL------
Q0S1W3_RHOJR/9-146IEL.........QPLLD-QLT-------------------A----------R.PPLDVALSEETE-------QR------
B9L7D5_NAUPA/10-146VDL.........KDVLL-YLE-------------------Q----------I.PPLKYPISKELE-------EV------
Q8U348_PYRFU/11-150IKI.........EPILD-YVL-------------------R----------K.IPADKPLEEEVI-------NE------
Q826G1_STRAW/61-198VEL.........KPILE-QLA-------------------A----------H.PPLDRTPTQETE-------ER------
D0MI80_RHOM4/10-147LEL.........EPILE-HLA-------------------E----------L.PPLRLGYSYEVE-------TE------
Q0RZB3_RHOJR/9-146IEL.........ERILA-QLA-------------------L----------Y.PPLDRIPATETK-------AL------
E3J762_FRASU/9-146IEL.........SPILE-QIA-------------------A----------R.PPLEIALSEDTS-------TR------
Q0RMJ7_FRAAA/4-141IEL.........RPILE-QIA-------------------A----------R.PPLDLALSDDTA-------AR------
C0QQA2_PERMH/9-146IAI.........EDVLN-FLA-------------------T----------M.PPLKYPLEAELE-------KR------
Q0SK49_RHOJR/18-157LRV.........DPIVE-RLA-------------------D----------Y.PPLDGILATETR-------SG------
B2IWP7_NOSP7/9-146IEL.........KPILD-YMT-------------------T----------R.PLLDLDYSKETE-------AR------
Q1AY81_RUBXD/9-146LEL.........RPILE-QLA-------------------A----------L.PPLRLDYSAETE-------GR------
Y328_AQUAE/32-168MGV.........DELLE-YIA-------------------F----------I.PPVEMNVGEDLK-------SE------
D2RF04_ARCPA/11-150VDV.........EPIKK-FVL-------------------K----------G.LPVDAPLQDELV-------DE------
C8XFC4_NAKMY/8-143GDM.........RDWIG-QTL-------------------R----------R.PPGDVTFGEETE-------DV------
Y616_AQUAE/19-164LKAFVDYLAKLEEELLK-AEE-------------------A----------L.PPLD....EELH-------QK------
A6Q0X2_NITSB/9-145IEL.........KDILE-RLA-------------------T----------Y.PPL.LELEAELE-------KS------
E4U5U8_OCEP5/8-145PEL.........EPVLD-HLA-------------------G----------L.PPLDLEVSDDVR-------AL------
Y1509_METJA/11-150IVA.........ETIKK-YVM-------------------K----------K.IPGDLPLDDIVV-------DN------
W5WDS1_9PSEU/9-147LDV.........APMLA-QVI-------------------A----------LPPPLHLTIGTDAR-------DR------
Q5SI95_THET8/8-145LEL.........KPVLD-ALA-------------------A----------L.PPLDLEVAEDVR-------NL------
C5CB24_MICLC/10-147LEL.........QPILD-QLV-------------------A----------L.PPLDLAYSYEME-------AE------
G2NZ66_STRVO/9-146IEL.........KPILD-QLT-------------------A----------H.PALDRMPDADTE-------AR------
H3ZJQ7_THELN/11-150VEI.........EPIRK-FVL-------------------A----------S.IPAEMPLEEELV-------DE------

PF02291

M7WDK4_RHOT1/10-135AR-----------LIAL-ILA-------------------A----------A----.GAE..DCE-------EG--V---
G2X9P3_VERDV/76-227AR-----------MIEL-LLT-------------------S----------Q----.GVT..AYE-------SR--V---
F4QEA6_DICFS/134-255AR-----------VIKN-ILK-------------------T----------M----.GVQ..QHD-------SR--V---
A5DHC0_PICGU/7-133VR-----------LLHL-IFA-------------------T----------Q----.GVS..SYQ-------DH--V---
E4XZ10_OIKDI/7-128EL-----------AMRA-ILK-------------------D----------M----.GVT..EYE-------PR--V---
U9T6J2_RHIID/13-134SR-----------VMQL-ILQ-------------------A----------A----.GVE..EYE-------PK--V---
E0VC09_PEDHC/9-130AQ-----------VIMS-ILK-------------------D----------M----.GVS..DFE-------PQ--T---
E3JXG9_PUCGT/27-152AR-----------IIAL-LLA-------------------S----------M----.GVQ..SAS-------EG--V---
J9K8F0_ACYPI/7-128SQ-----------IIVS-MME-------------------D----------L----.GIV..EYD-------QQ--V---
K0KLS6_WICCF/12-133VR-----------ILHL-ILA-------------------S----------Q----.SIQ..SYE-------DH--V---
TAF9_ENCCU/5-126AK-----------VISV-ILR-------------------S----------L----.GIE..ECE-------PK--V---
R7YZF5_CONA1/62-198AR-----------LIHL-VLA-------------------A----------Q----.GVT..AYQ-------ER--V---
F9X6Q8_ZYMTI/40-177AR-----------LIHL-VLS-------------------S----------L----.GIH..SYQ-------ER--V---
A7RR68_NEMVE/23-144AL-----------VMAA-ILK-------------------E----------M----.GIS..DYE-------PR--V---
T1J4R5_STRMM/4-125AL-----------VMAA-ILK-------------------D----------M----.GII..DYE-------PR--V---
H2WNP3_CAEJA/16-136AQ-----------SIMG-LLT-------------------E----------G----.GIT..EYD-------PR--V---
G3BAU9_CANTC/20-152VR-----------LLHL-IFA-------------------T----------Q----.GIQ..NYE-------DH--V---
K5XAX2_AGABU/11-134AR-----------AIAL-LLS-------------------A----------T----PSIQ..DVQ-------PS--V---
Q0U291_PHANO/54-190AR-----------LIHM-ILA-------------------N----------M----.GVH..VYT-------ER--V---
J9KWC1_ACYPI/6-127TQ-----------IIVS-IMK-------------------D----------L----.GIV..EYE-------PQ--V---
D5GLV0_TUBMM/51-182AR-----------IIHL-ILS-------------------S----------L----.GVT..SYQ-------ER--V---
O45784_CAEEL/16-136AL-----------AVIS-MLH-------------------E----------C----.GIQ..EFD-------PR--V---
D6RGK3_HUMAN/9-130AQ-----------MMAQ-ILK-------------------D----------M----.GIT..EYE-------PR--V---
M2LVQ3_BAUCO/53-191AR-----------TIHL-VLS-------------------S----------L----.GIT..SYQ-------ER--V---
A0A068YBD1_ECHMU/4-129LS-----------VIKS-IFE-------------------D----------F----.NLV..GLP-------ED--V---
H3HBI0_PHYRM/27-144VL-----------SMQQ-LLE-------------------S----------M----.GAD..KFE-------PR--V---
A8JFR8_CHLRE/13-135VA-----------TMHA-LLR-------------------S----------M----.GVE..EFE-------PR--V---
G4VC88_SCHMA/11-131LA-----------AVRE-IFS-------------------E----------F----.NVS..EVS-------DE--I---
W5JA98_ANODA/20-141AQ-----------VVMS-ILK-------------------E----------L----.GVQ..DYE-------PR--V---
B6JY17_SCHJY/8-131AR-----------LIHL-IMT-------------------S----------L----.GVP..AYS-------QS--V---
T5AQB6_OPHSC/37-184AR-----------LVEL-LLT-------------------S----------Q----.GVT..AYE-------QR--V---
S3DWR3_GLAL2/53-199AR-----------LIHM-LLS-------------------S----------L----.QVS..AYQ-------ER--V---
F0XDG5_GROCL/91-244VR-----------TMEL-LLT-------------------A----------Q----.GVT..SYE-------TR--V---
M9M9Y9_PSEA3/14-139AR-----------LIAL-ILA-------------------S----------M----.GVS..DVE-------PA--V---
X6M053_RETFI/52-182YQ-----------MALN-ILS-------------------E----------M----.KVQ..EYE-------PK--V---
F6QLU5_CIOIN/11-132AE-----------TIIA-VLQ-------------------D----------M----.GVT..EYE-------PK--V---
S8AFN1_DACHA/32-161AR-----------TIHL-MLA-------------------S----------M----.GVT..AYQ-------ER--V---
F2U4U6_SALR5/62-197AK-----------SIIQ-ILQ-------------------D----------M----.GIP..YFE-------PL--V---
T1KVK8_TETUR/5-124FG-----------VITS-ILK-------------------E----------M----.GIN..EYE-------PK--V---
M2Z663_PSEFD/12-149AR-----------LIHA-ILS-------------------N----------L----.GIH..SYQ-------ER--V---
R4XCN9_TAPDE/5-126TR-----------LIHL-LLS-------------------S----------L----.NVS..AYE-------EN--V---
I1C775_RHIO9/8-129AR-----------LISL-ILQ-------------------S----------L----.GVE..DYD-------PK--V---
B8M2Z2_TALSN/57-194AR-----------LIHM-LLA-------------------S----------L----.GVT..AYQ-------ER--V---
G8YQE8_PICSO/25-155VR-----------LLHL-IFA-------------------T----------Q----.GIQ..NYQ-------DH--V---
B4I6J9_DROSE/15-136AQ-----------VIMS-ILK-------------------E----------L----.NIQ..EYE-------PR--V---
T1KVL0_TETUR/5-124SG-----------IIIS-LMK-------------------E----------I----.GIT..EFE-------LK--A---
B9GKT8_POPTR/5-126AK-----------IVKS-LLK-------------------S----------M----.GVE..DYE-------PR--V---
B2AYL6_PODAN/47-193SR-----------TIEL-LLL-------------------A----------Q----.GVT..TFE-------PR--V---
G6DDM8_DANPL/13-134AQ-----------VIMS-IMK-------------------E----------I----.GIT..DYE-------PR--V---
G4MYK2_MAGO7/63-209AR-----------TIEL-LLT-------------------A----------Q----.GVT..AFE-------PR--V---
W1QJI0_OGAPD/7-140VR-----------LLHL-IFA-------------------T----------Q----.GIQ..SYQ-------DH--V---
F8PNX7_SERL3/10-135AR-----------SIAL-LLA-------------------S----------T----PTVQ..DAQ-------PG--V---
L8G882_PSED2/42-184AR-----------LIHL-LLT-------------------S----------L----.GIS..AYQ-------ER--V---
C4QZS5_PICPG/5-140VR-----------LLHL-IFA-------------------T----------Q----.NIY..SYQ-------DH--V---
A5E2M9_LODEL/42-174VR-----------LLHL-IFA-------------------T----------Q----.GIQ..NYQ-------DH--V---
C3YVK1_BRAFL/4-125AQ-----------VMAA-VLK-------------------D----------M----.GVT..DYE-------PR--V---
B3RUC6_TRIAD/1-120AL-----------VIAT-ILK-------------------E----------M----.GVR..DYE-------PR--V---
T1F9J6_HELRO/4-125FQ-----------MMMN-IMK-------------------D----------M----.GIT..DYE-------PG--V---
X1WZN5_ACYPI/6-127SQ-----------TIVS-MMN-------------------D----------L----.GIR..EYE-------QQ--V---
TAF9_SCHPO/10-133VR-----------LIHL-ILS-------------------S----------L----.GVP..SYS-------QT--V---
A0A0D2U2T2_CAPO3/6-128VR-----------SMRD-ILR-------------------A----------M----.GAE..QYD-------ER--V---
E7KGY2_YEASA/26-152VR-----------LLHL-LLA-------------------S----------Q----.SIH..QYE-------DQ--V---
F0ZC88_DICPU/5-126AR-----------VIKS-ILK-------------------T----------M----.GVQ..AHD-------PR--V---
N1JGY7_BLUG1/48-193AR-----------LIHL-LLS-------------------S----------M----.GCT..AYQ-------ER--V---
V5FLB7_BYSSN/57-217AR-----------LIHM-LLA-------------------S----------Q----.GVT..AYQ-------ER--V---
M5E687_MALS4/16-141IR-----------LVSL-ILA-------------------S----------M----.GIE..DVE-------PA--V---
E9E8P1_METAQ/45-192AR-----------LIEL-LLT-------------------S----------Q----.GVT..AYE-------QR--V---
D8R9T7_SELML/1-121AR-----------VVRS-IMR-------------------S----------M----.GVA..EYE-------PR--V---
B8N413_ASPFN/62-215VR-----------LIHM-LLA-------------------S----------L----.GVT..AYQ-------ER--V---
J4UWI4_BEAB2/51-198AR-----------LIEL-LLT-------------------S----------Q----.GVT..SYE-------QR--V---
D7EL47_TRICA/12-135GQ-----------VVMS-IMK-------------------E----------M----.GIT..EYE-------PK--T---
B6TMH7_MAIZE/21-145AR-----------VVRE-LLR-------------------S----------M----.GLREGEYE-------PR--V---
T1GRU2_MEGSC/18-139AQ-----------VIIS-IMK-------------------E----------L----.GVT..DYE-------PR--V---
G4TF77_PIRID/740-863AR-----------AIAL-LLA-------------------S----------T----PSVV..DAP-------PR--V---
T1HLJ8_RHOPR/5-126GL-----------VIIS-MLK-------------------E----------L----.GIS..NYE-------PR--V---
S7W8Z3_SPRLO/3-124AK-----------IVSI-ILR-------------------S----------I----.GID..ECE-------PQ--V---
H1VNB3_COLHI/89-239AR-----------MIEL-LLT-------------------S----------Q----.GVT..SYE-------SR--V---
G0VC63_NAUCC/9-147VR-----------LLHL-LLA-------------------A----------Q----.SIH..QYE-------DQ--V---
B7QAZ8_IXOSC/4-125AQ-----------VMGA-ILK-------------------D----------M----.GIT..EYE-------PR--V---
A1CP04_ASPCL/76-234VR-----------LIHM-LLA-------------------S----------L----.GVT..AYQ-------ER--V---
H6BPD0_EXODN/52-203HR-----------LIHL-LLA-------------------S----------H----.GIT..AYQ-------QR--V---
L2GPL4_VITCO/4-123AK-----------VISI-ILR-------------------S----------L----.GIE..ECE-------PK--V---
J9DF67_EDHAE/5-126AR-----------VISL-ILR-------------------S----------L----.GIE..ECS-------PK--V---
R8BG98_TOGMI/62-215QR-----------TLEL-LLT-------------------A----------Q----.GVT..AFE-------AR--V---
E9GIC2_DAPPU/2-123AL-----------VIQA-ILK-------------------D----------M----.GIT..EYE-------PR--V---
C4Y633_CLAL4/18-146VR-----------LLHL-MFA-------------------T----------Q----.GIQ..NYQ-------DH--V---
A9U4J1_PHYPA/4-124AK-----------TVKT-ILE-------------------S----------M----.GVT..RFE-------PR--V---
H8Z9U3_NEMS1/5-126AK-----------IISL-ILR-------------------S----------V----.GIE..ECE-------PK--V---
U5HA82_USTV1/43-172AR-----------LIAL-LLA-------------------A----------N----.GAS..DAE-------PA--V---
Q6CIP5_KLULA/8-131VR-----------LLHL-LLA-------------------S----------Q----.SVL..QYE-------DK--V---
D8TZ69_VOLCA/12-134VS-----------TIHQ-LLR-------------------S----------M----.GVD..DFE-------PR--V---
G2R3D3_THITE/87-230AR-----------TIEL-LLT-------------------A----------Q----.GVT..SFE-------QR--V---
M2SP85_COCH5/66-203AR-----------LIHL-ILA-------------------N----------M----.GVH..AYT-------ER--V---
K7IPE7_NASVI/11-132AQ-----------VIVS-IMK-------------------D----------M----.GIA..DYE-------PK--V---
K1VDX8_TRIAC/5-130GR-----------LLAL-ILA-------------------S----------K----.GIQ..DAD-------ER--V---
B7XHH0_ENTBH/5-125AK-----------IISA-ILR-------------------S----------L----.GIE..ECE-------PK--V---
D2V9Z9_NAEGR/1-120AI-----------IVEK-ILQ-------------------S----------M----.GIN..EFE-------PR--V---
M7NV69_PNEMU/9-133AR-----------IVHL-ILA-------------------S----------L----.GVE..AYQ-------QN--V---
I4Y606_WALMC/4-128AH-----------LISL-ILA-------------------S----------K----.GIN..DAP-------PA--T---

PF07524

SPT7_SCHPO/707-783LK.---------KLCTI-ILF-------------------H----------A-----GFE--SFQ-------MG--A---
TAF8_DANRE/32-108LQ.---------VVVSA-LLT-------------------E----------C-----GFD--SAE-------KA--V---
TAF3_SCHPO/7-83MR.---------IFCSQ-TLR-------------------A----------A-----GID--RTK-------VS--L---
ST65G_HUMAN/151-230LY.---------QAVAT-ILA-------------------H----------A-----GFD--CAN-------ES--V---
Q9VP40_DROME/6-77DN.---------LLASK-NCE-------------------V----------V-----D.D--VLR-------QS--M---
Q9SA19_ARATH/24-100TK.---------IAVSQ-ICQ-------------------S----------I-----GYK--ATD-------AS--A---
TAF8_HUMAN/29-106TLQ---------VVVSS-LLT-------------------E----------A-----GFE--SAE-------KA--S---
Q7YTH5_CAEEL/66-142LE.---------QIVTA-MCY-------------------K----------S-----GFD--DIE-------EG--A---
B4IIW5_DROSE/4-80AL.---------VVVAQ-ITQ-------------------T----------I-----GYS--CSL-------SA--P---
Q7S5N4_NEUCR/52-123LR.---------RSIAL-ALE-------------------T----------V-----GFD--GAT-------PE--A---
TAF8_ARATH/24-100AK.---------AAVAQ-VCE-------------------S----------V-----GYE--NFK-------DP--A---

PF17027

R0KLX4_NOSB1/8-119-------------SIAE-IVM-------------------Q----------S-----GFE--RIS-------EQ--A---
R0KSL2_NOSB1/8-119-------------SIAE-IVM-------------------Q----------S-----GFE--RIS-------EQ--A---
Y551_ENCCU/8-126-------------AVVE-ILS-------------------Q----------S-----GFD--KTA-------DQ--A---
C4V862_NOSCE/8-123-------------CISE-VCL-------------------Q----------I-----GFE--RIS-------EQ--S---
B7XJZ3_ENTBH/37-159-------------SIVE-ILL-------------------Q----------L-----GFE--KCS-------EE--S---
H8ZFK0_NEMS1/19-158-------------VVVE-ILN-------------------Q----------V-----GFE--RTS-------KQ--S---
I3EGR5_NEMP3/9-149-------------VIVE-ILN-------------------Q----------V-----GFE--RTS-------KQ--S---
S7XQD0_SPRLO/8-121-------------CVTE-ILI-------------------Q----------K-----GYE--AVT-------NN--S---

PF15511

F1S2K5_PIG/453-556..-----------.KAG-LNH-------------------YAKLFSF----Y----...AKMPME-------RK--A---
Q0V6N5_PHANO/384-501.F-----------PAAS-VKK-------------------LALGFMK----S----QG.SKGQLN-------KE--S---
G5EH18_MAGO7/443-551.L-----------PAPV-VKR-------------------LAETIAR----T----SGIGNAKIT-------PE--T---
B8MMW5_TALSN/360-468.L-----------PTGV-VKR-------------------LAARFAR----T----GAGTKAKIN-------KE--T---
Q4WWL8_ASPFU/372-480.M-----------PVGV-VRK-------------------LATRFAR----A----RAGSKTKIS-------KA--T---
Q2H4H2_CHAGB/380-487.L-----------PPAV-VKR-------------------LAQNFAK----A----GG.IKGKIT-------PD--A---
H6BTF1_EXODN/377-486.L-----------PTSL-IKR-------------------VAIDASS----R----LGIRKPRLG-------RE--H---
F7C6J3_ORNAN/443-546..-----------.SAL-LSH-------------------YAKIFGF----Y----...AKMPVE-------KA--A---
B6K2P7_SCHJY/365-468FL-----------PTIA-IRK-------------------LAHRF..----.----...SSRKLS-------AS--A---
F0XUM0_GROCL/440-548.L-----------PVGV-VKR-------------------IGQMFAQ----G----SAAGKTKLS-------PD--T---
CENPT_RAT/407-510..-----------.KAG-LSH-------------------YVKLFSF----H----...TKMPVE-------KA--A---

PF15630

A3GI04_PICST/11-91YL-----------TVAK.MVE-------------------E..Q.LAK..HT----KNTETVVAT-------PI--F---
A7RMQ5_NEMVE/23-98HY-----------TVGK.ICE-------------------E..T.GA....E----AGLT...FS-------RQ--F---
A7TEH2_VANPO/17-91WY-----------CIERQVNE-------------------E..T.PF....D----T..V...CS-------AK--F---
B2W5N7_PYRTR/12-87WY-----------SIGQ.FID-------------------E..K.SL....E----NDLN...AT-------PQ--Y---
B3DJV8_DANRE/9-84HY-----------TVGS.LCQ-------------------H..I.AE....D----CEKQ...IT-------KQ--T---
B3RZC1_TRIAD/15-90HY-----------AVGK.KCE-------------------E..I.GE....E----LQVE...FS-------KQ--M---
B6JX09_SCHJY/4-85FH-----------VTQQ.VCN-------------------N..T.AA....E----LSES...ES-------KR--V---
B6QUS3_TALMQ/14-92WL-----------AIGK.IVD-------------------E..E.TM....Q----LGVN...AT-------PQ--F---
B7PXV9_IXOSC/11-86HY-----------TVGQ.ITE-------------------A..V.GQ....A----EGTV...VG-------RP--V---
C4Y931_CLAL4/26-101YL-----------SVAK.AVE-------------------E..K.TA....E----LKVA...AS-------PS--F---
C5DNB5_LACTC/22-96WY-----------CLEQ.LVK-------------------K....EL....P----SDIS...YS-------PK--F---
C5G144_ARTOC/13-88WY-----------TLGN.LTR-------------------E..H.AD....L----FDTE...VT-------PQ--F---
C7YTU2_NECH7/15-94WY-----------AVGQ.IVD-------------------E..Q.SL....I----RNRN...AT-------PQ--F---
D3B378_POLPA/165-243QF-----------TVAK.ICE-------------------R.EIEKL....P----NKTT...VT-------PH--A---
D5GA13_TUBMM/32-107WF-----------SIGK.IVD-------------------E..E.IL....Q----LNVN...AT-------PQ--F---
D7FWQ8_ECTSI/32-105HY-----------SVGE.VCS-------------------G..E.......N----GKIA...MT-------GS--A---
E4ZQ21_LEPMJ/13-88WY-----------SIGQ.FVD-------------------E..E.CL....T----CDLN...AT-------PQ--F---
A0A0D2UKN4_CAPO3/14-89HY-----------TVGK.ICQ-------------------R..E.ES....E----MGVK...CS-------KQ--F---
E9ECA7_METAQ/10-85WF-----------AVGQ.IVD-------------------E..E.CL....R----RNRN...AT-------PQ--F---
F0XLX6_GROCL/7-82WS-----------VVGE.MVD-------------------Q..E.SI....K----QNRN...TT-------PQ--F---
F4PRK1_DICFS/235-311QY-----------SVAR.ISE-------------------R..E.TE....S----NHRI...VT-------HQ--A---
F4RWE9_MELLP/40-115WY-----------TVAQ.IVQ-------------------E..E.EI....D----LQRS...AT-------EP--F---
F7DQN4_XENTR/13-88HY-----------IVGS.LCQ-------------------E..V.AD....D----KEVH...FS-------KQ--A---
F7VU88_SORMK/11-86WF-----------AIGK.MVD-------------------D..E.SL....R----RNMN...AT-------PQ--F---
F9WY71_ZYMTI/13-88WY-----------AVGK.IVD-------------------E..V.TL....S----QGLN...AS-------PH--F---
G0V9K8_NAUCC/14-94WC-----------SIENQVKE-------------------E..L.QTMNSGS----TRIT...VS-------NK--F---
G3BEG3_CANTC/8-83FL-----------MVSR.IVE-------------------Q..E.VA....R----LGVH...ST-------PM--F---
G3PEU4_GASAC/26-101HY-----------TVGC.LCQ-------------------R..M.GD....E----HRRP...FS-------RQ--V---
G3VT77_SARHA/17-92HY-----------TVGS.ICQ-------------------E..A.AE....A----KGVR...FT-------KP--T---
G4LYK5_SCHMA/9-84HY-----------RCTK.IAQ-------------------E..I.SN....K----EQCE...VN-------MD--I---
G4MZ92_MAGO7/9-84WF-----------AVGK.IVD-------------------E..E.TM....K----KQRN...AT-------PQ--F---
G6DRA0_DANPL/11-86HR-----------DVNK.ICT-------------------D..T.CH....Y----NGFS...IN-------SG--P---
G8YL18_PICSO/12-89YL-----------SVSR.IVE-------------------E.EISSL....D----GNVS...AT-------PT--F---
H1VQ95_COLHI/11-86WF-----------AVGK.IVD-------------------E..E.SI....K----QDCN...AT-------PQ--F---
H2LES2_ORYLA/10-85HF-----------TTGR.ICQ-------------------K..M.GE....D----HRKE...FS-------RQ--T---
H2N958_PONAB/17-92HY-----------TVGC.LCE-------------------E..V.AL....D----KEMQ...FS-------KQ--T---
H6C6E0_EXODN/12-87WF-----------QIGK.IVD-------------------E..E.SI....N----LGVN...AT-------PQ--F---
H9J6V9_BOMMO/11-84KR-----------DVTA.ICL-------------------E..S.TV....G----L..E...IT-------KP--A---
I1FQJ7_AMPQE/21-96HY-----------SIGK.TYE-------------------E..I.AS....D----HGMK...VS-------RE--M---
Q54PV0_DICDI/238-315HY-----------SVIK.VSE-------------------E..Q.AN....K----FNVG...IT-------KE--T---
Q6BIJ2_DEBHA/13-90YL-----------MVSK.MVE-------------------QDLT.NI....D----KEIS...AT-------PT--F---
J3KG50_COCIM/15-89WK-----------ALRR.MVR-------------------D..Q.VD....E----EDVD...IT-------PS--F---

PF00125

H2AV3_ORYSJ/1-106-A------VY---------------SAAILE----------YL----TA-EV-LELAG-NASK-------D---------
H2BV_BOVIN/1-99-I------DI---------------INTMIN----------DM----FE-RI-STEAC-NLMY-------Y---------
Q8LK76_MAIZE/18-152-L------LA---------------LQEAAE----------FH----LI-EL-FEMAN-LCAI-------H---------
H32_HUMAN/1-132-V------MA---------------LQEASE----------AY----LV-GL-FEDTN-LCAI-------H---------
A8B678_GIAIC/10-148-M------EA---------------LQSATE----------EY----IV-EL-FSTAL-LATY-------H---------
Q8IL74_PLAF7/1-103-P------VL---------------LAKACE----------LF----IM-EL-TSNAW-KYTE-------E---------
A8BYH2_GIAIC/11-146-I------GA---------------LQEASE----------AM----LS-QV-LGDCQ-ILAN-------H---------
A8B471_GIAIC/44-178-V------EA---------------LQESAE----------NY----II-SL-FVDTQ-LCAE-------H---------
H2BWT_HUMAN/23-145-V------SV---------------MDSLVH----------DI----LD-RI-ATEAG-RLAR-------S---------
Q23429_CAEEL/1-104-S------VF---------------MAATLE----------YL----TT-EL-MEMSA-IAAN-------E---------
H2B2_ARATH/87-215-M------TV---------------VNMFMG----------DM----FE-RI-AQEAA-RLSD-------Y---------
Q7XV46_ORYSJ/162-290-V------LA---------------LQEAAE----------AY----LV-GL-FEDTN-LCAI-------H---------
H3L_ENCCU/1-130-I------VA---------------FQEAVE----------NF----LT-SL-MEDAY-RCVL-------H---------
CENPA_DANRE/7-140-L------MA---------------LQEAAE----------AF----MV-RL-FSDAN-LCAI-------H---------
HAP5_YEAST/94-225-P------II---------------FAKACE----------IF----IT-EL-TMRAW-CVAE-------R---------
Q19649_CAEEL/1-114-I------DA---------------LQAAVE----------DY----LV-EL-FRLGN-LCAI-------K---------
H31_ENCCU/1-135-L------AS---------------IQEALE----------VY----LV-GL-FEDAM-LCAY-------H---------
CENPA_CANGA/101-236-I------LA---------------LQEASE----------AY----LV-GL-LEHTN-LLAL-------H---------
Q7PVU9_ANOGA/47-178-S------LF---------------LVAVLE----------YI----SA-DI-LKLAG-YYVK-------N---------
Q7RRA6_PLAYO/1-103-P------VL---------------LAKACE----------LF----IM-EF-TKYAW-KYTE-------E---------
H2A8_ARATH/1-97-V------VY---------------MTSILE----------YL----TT-EV-LQLAE-NTSK-------D---------
CENPA_SCHPO/1-118-L------QC---------------LQEAAE----------AF----LV-HL-FEDTN-LCAI-------H---------
CENPA_MOUSE/1-127-L------LA---------------LQEAAE----------AF----LI-HL-FEDAY-LLSL-------H---------
HCP3L_CAEEL/122-257-I------NA---------------LQEASE----------AL----LV-QM-FDGSS-LISA-------H---------
H2BV_MOUSE/1-100-V------DI---------------MNILIN----------DI----FE-RI-ATEAC-QQMF-------L---------
Q9DAB5_MOUSE/72-200-V------NI---------------LDSFVK----------DM----FE-RI-ASEAS-FLAR-------Q---------
Q8IDZ1_PLAF7/32-167-L------LA---------------LQTASE----------AY----LV-SL-FEDAY-LCSL-------H---------
A4H675_LEIBR/1-126-I------LA---------------IQEATE----------AY----IV-SL-LADTN-LACI-------H---------
A8BI78_GIAIC/1-100-M------EV---------------MNSLVN----------DL----FE-RI-ASEAS-NLAK-------I---------
Q387X7_TRYB2/34-135-V------DA---------------IQEATE----------TY----IT-SV-FMDAN-LCTL-------H---------

PF00808

NFYB9_ARATH/62-127-K------ET---------------IQECVS----------EY----IS-FV-TGEAN.ERCQ-------R---------
HJA2_METJA/2-65-A------EY---------------LAEAVE----------EI----AL-EI-AKEAV.ELAK-------H---------
NFYB4_ARATH/6-71-K------QT---------------VQECAT----------EF----IS-FV-TCEAS.EKCH-------R---------
Q20237_CAEEL/64-128-P------VS---------------IGRAME----------HF----AE-KF-LQAAA.EATQ-------F---------
Q9V452_DROME/18-83-L------FL---------------MTKCTE----------LF----VR-HL-AGAAYTEEFG-------Q---------
NFYB5_ARATH/54-119-K------ET---------------MQECVS----------EF----IS-FV-TGEAS.DKCH-------K---------
HAF2_ARCFU/2-65-V------EK---------------MVEVLE----------DY----AI-TV-AKKAV.EIAK-------H---------
Q9FHS0_ARATH/10-74-L------HV---------------ITYSTE----------LF----LH-FL-AEKSA.VVTA-------E---------
NC2B_HUMAN/11-75-R------EL---------------VVNCCT----------EF----IH-LI-SSEAN.EICN-------K---------
HAP3_KLULA/25-90-K------EC---------------MQECVS----------EF----IS-FV-TSEAC.DRCT-------S---------
HAF1_ARCFU/6-69-K------VE---------------LAKAIE----------EY----AM-QI-GKKAA.ELAK-------H---------
Q9LN09_ARATH/108-172-V------FL---------------VNKATE----------MF----IE-RF-SEEAY.DSSV-------K---------
HAP3_SCHPO/10-75-K------DC---------------VQDCVS----------EF----IS-FV-TGEAS.EQCT-------Q---------
NC2B_SCHPO/10-75-R------DL---------------LIECCV----------EF----IH-LV-SSEAN.EICE-------K---------
Q9LHG0_ARATH/7-71-P------VL---------------VSKSLE----------LF----LQ-DL-CDRTY.EITL-------E---------
O17072_CAEEL/108-174-P------IF---------------MAQAAE----------FF----IE-EM-TAMGW.QYVS-------E---------
O45550_CAEEL/20-84-R------DM---------------INACCV----------EF----VK-HI-AREAQ.RIAS-------Q---------
NC2B_ARATH/14-79-Q------DL---------------LIECCV----------EF----IN-LV-SSESN.DVCN-------K---------
O17286_CAEEL/64-129-K------EC---------------AQECVS----------EF----IS-FI-ASEAA.EICN-------I---------
B4I7U0_DROSE/10-74-P------VI---------------ISRTLE----------LF----VE-SL-LTKTL.RITN-------A---------
E3GWR6_METFV/1-64-R------IT---------------LAKILE----------EM----GR-DI-ASEAI.KLAR-------H---------
F1SVE7_METKA/4-65-K------DT---------------IYDFVP----------TM----AE-YV-ANAAK.SVLD-------A---------
G7YA03_CLOSI/51-116-K------EC---------------VQECVS----------EF----IS-FI-TSEAA.ERCQ-------A---------
HARB_PYRFU/3-65-A------KV---------------LAEHLE----------EK----AI-EI-AKKAV.DLAK-------H---------
Q2UK39_ASPOR/46-111-K------EC---------------MQECVS----------EF----IS-FI-TSEAS.EKCQ-------Q---------
U6EAE9_9EURY/2-65-K------EA---------------LAKALE----------EK----GE-EL-AKKAV.ELAK-------H---------
W5LMM0_ASTMX/39-103-P------VL---------------FAKAAQ----------IF----IT-EL-TLRAW.IHTE-------D---------

PF02969

TAF6L_HUMAN/9-73-A------AL---------------LAEDVC----------YR----LR-EA-TQNSS-QFMK-------H---------
TAF6_SCHPO/3-68-A------AA---------------IAMDLE----------YR----IH-QV-VQEAT-KFMV-------H---------
Q8LRG9_ORYSJ/1-68-S------AA---------------LAPDVE----------YR----LR-EI-MQEAI-KCMR-------H---------
TAF6_YEAST/9-74-L------KA---------------LAMDVE----------YR----IL-EI-IEQAV-KFKR-------H---------
TAF6_ARATH/1-68-A------LM---------------LAPDVE----------YR----VR-EI-MQEAI-KCMR-------H---------
TAF6_DROME/18-83-A------KE---------------LAEDVS----------IK----LK-RI-VQDAA-KFMN-------H---------
TAF6_HUMAN/11-76-C------QL---------------LTDEVS----------YR----IK-EI-AQDAL-KFMH-------M---------
Q9GZI6_CAEEL/24-85-A------EL---------------LEFLSR----------EK----LK-EI-VRLSA-KWTQ-------K---------
A4IHX4_XENTR/9-74-C------QM---------------LAQEVS----------FR----IK-EV-TQDAL-KFMH-------V---------

PF03847

TAF12_YEAST/416-488-E------EL---------------LLDLAD----------DF----VT-NV-TAFSC-RLAK-------H---------
TAF12_SCHPO/344-411-E------EL---------------LLEIAD----------EF----VE-SV-TNFAC-RLAK-------H---------
TAF12_DROME/93-160-E------EL---------------LLQIID----------DF----VE-DT-VKSTS-AFAK-------H---------
Q9VR21_DROME/67-133-C------DM---------------MARIAD----------AF----VN-DI-SMRIV-KLAK-------Y---------
TAF12_ARATH/401-468-E------DI---------------LSDIAE----------DF----VE-SI-TTFGC-SLAK-------H---------
TAF12_HUMAN/59-126-E------EM---------------LLQIAD----------DF----IE-SV-VTAAC-QLAR-------H---------
Q9U226_CAEEL/233-297-K------DV---------------LVEYAD----------DF----VS-SL-IDKAC-KMIK-------N---------
TA12B_ARATH/529-596-E------DL---------------LLEVAD----------DF----ID-SV-TSFAC-SLAK-------H---------

PF04719

G8BSR2_TETPH/139-219.R------VF---------------LQSIGK----------VF----AG-EI-IELAMQVRMK-------W..-------
J8Q476_SACAR/129-209.R------VF---------------LQAIGK----------IY----AG-EI-IELAMVVKNK-------W..-------
E3LZD0_CAERE/217-303.A------LA---------------VGGLAK----------LF----VG-EL-VEEAVELRDA-------S..-------
I1G7M7_AMPQE/71-156.V------IA---------------MAGMAK----------VY----VG-EI-VEAACEARDK-------M..-------
L8Y753_TUPCH/78-161.V------IA---------------LSGISK----------VL----IE-EV-VEEALDVCEK-------W..-------
A9CRT7_ENTBH/59-144.V------IG---------------ISGLAK----------VF----IG-EL-VIEALAVQKE-------F..-------
TAF11_SCHPO/95-179.A------IV---------------ISGFSK----------VF----VG-EI-VELARKIQDQ-------W..-------
U1MIS9_ASCSU/191-271.V------IA---------------VAGLAK----------VF----A.-..-...ALDIQLR-------M..-------
H2PF83_PONAB/98-183.A------IA---------------MAGIAK----------VF----VG-EV-VEEALDVCEM-------W..-------
U5DIY7_AMBTC/83-168.T------IV---------------MSGIAK----------MF----VG-EL-VETGRVVMTE-------R..-------
A7SYY0_NEMVE/3-89.V------IA---------------MAGIAK----------VF----VG-EV-VEEACDVMEK-------S..-------
F4QDB0_DICFS/307-393.V------II---------------MAGITK----------VF----VG-EL-VELSRTIMEE-------W..-------
F2UQ02_SALR5/216-306.L------TV---------------LGALAK----------VH----VG-EI-VETALDVQKE-------W..-------
X6MJW9_RETFI/615-701.C------IV---------------MQALCK----------SV----VM-DL-VLTSREVQKE-------E..-------
M7SAZ2_EUTLA/196-303.Q------QM---------------MQVVCK----------MY----LG-DV-VEEARRVQQE-------WAD-------
U4LM69_PYROM/116-201.G------TV---------------ICGFSK----------VF----TG-EI-IELALQIQRQ-------W..-------
A0A0D2WMQ7_CAPO3/375-460.V------IV---------------MAGIAK----------VF----VG-EI-IEQARDVMVE-------R..-------
T1EEK4_HELRO/30-115.V------IA---------------MSGIAK----------VF----AG-EI-VETALDIQEQ-------W..-------
C4VAX6_NOSCE/48-132.V------IA---------------VSGLAK----------IY----VG-EM-VELAKQVQEE-------K..-------
E4XD21_OIKDI/168-253.S------IA---------------VAGIAK----------VF----VG-EL-VEEALKVADA-------Q..-------
L2GN22_VITCO/62-146.I------IA---------------VAGLSK----------VF----VG-EM-VEEAKKIQQE-------M..-------
R0MGZ1_NOSB1/32-117.V------IA---------------VSGLAK----------VY----VG-EM-VGLARIIQKE-------R..-------
S7W8C8_SPRLO/66-151.L------IS---------------VSGISK----------IF----VG-EM-VDEALKIQKQ-------W..-------
I2H2Q9_TETBL/217-297.R------VF---------------LQAIGK----------MY----ID-DL-IEISMEVRNK-------W..-------
E5S4W4_TRISP/310-396.V------IA---------------MAGIAK----------VF----VG-EL-IEEALDVRDL-------W..-------
Q8SSE1_ENCCU/49-130.V------IA---------------VCGLAK----------VF----VG-EM-IEIAKAVQEE-------R..-------
C7YV21_NECH7/171-283.S------TA---------------VKAVAK----------LF----AG-EI-IEAARNVQAE-------WIT-------
A0A068YK50_ECHMU/153-237.V------IA---------------MAGITK----------VF----VG-EL-VETALDYKEE-------L..-------
A4RSC0_OSTLU/31-116.L------II---------------LAGVSK----------MF----VG-EM-VETAREIMKS-------R..-------
L5KZB3_PTEAL/96-181.V------IA---------------MSGLAK----------VF----VG-EV-VEEALDVCQR-------W..-------
E9G9V1_DAPPU/3-88.V------IA---------------MAGIAK----------VF----VG-EV-VEEALDVMEQ-------W..-------
R4XFB3_TAPDE/83-168.A------VV---------------IAGSGK----------VF----VS-EI-VERARHVQRI-------R..-------
D7KI82_ARALL/38-124.N------IV---------------VRGITK----------MF----VG-DL-VETARVVMRE-------R..-------
U5GY91_USTV1/142-223.L------TI---------------VRGFAK----------VF----VG-EV-VEKARSVANH-------D..-------
C1MKX3_MICPC/31-118.V------IV---------------LAAVGK----------LF----IG-EL-VELAREVADS-------H..-------
A8XSJ7_CAEBR/205-291.A------LA---------------ISALAK----------MF----IG-EI-VEEAVEIRDA-------S..-------
E1ZAD2_CHLVA/141-221.L------IA---------------LSSVTK----------SF----VD-DL-VAAAIGVAAE-------R..-------
S2JU45_MUCC1/162-247.A------FV---------------VAGFSK----------VY----VG-EI-VEKAKEIMEE-------W..-------
E3MIY3_CAERE/191-279.V------IT---------------IGALAK----------ML----VG-DI-VEEALDIRDL-------K..-------
F1N372_BOVIN/106-191.V------IA---------------MSGMAK----------VF----VG-EV-VEEALDVCEK-------W..-------
C4R2G1_PICPG/131-213.A------LL---------------VSTVSK----------MF----VG-EM-VEKAKEVQSR-------R..-------
J9F669_WUCBA/184-270.I------IA---------------VAGLAK----------VF----AG-EL-VEEALDIRER-------M..-------
L0P7W8_PNEJ8/44-128.C------IV---------------ISGFVK----------VF----IG-EI-IEKARDIQQQ-------W..-------
G8BAE4_CANPC/112-196.A------TV---------------MAGVAK----------SF----IS-EI-ISKSFEVQER-------D..-------
U9U4H6_RHIID/1-86.S------IV---------------VAGFAK----------VF----VG-EI-VEKALDVRQE-------W..-------
C1FD46_MICSR/15-101.L------II---------------LAAVGK----------LF----VG-EL-VEKARQVADE-------E..-------
F4RU01_MELLP/124-208.T------IV---------------VRGFAK----------VF----VG-EM-VEKALEVQKR-------R..-------
D8U9I9_VOLCA/104-190.V------IA---------------MCGISK----------LF----VG-EL-VELARVCASQ-------E..-------
D0MZ49_PHYIT/4-97MA------IV---------------MSGMTK----------VF----VG-EI-TAEARRIMEK-------N..-------
D8Q789_SCHCM/34-118.A------QI---------------VAGFAK----------VF----VG-EI-VEKARAVQRR-------R..-------
G1X2K3_ARTOA/165-253.A------SA---------------IGGFSK----------IF----AG-EM-VERAKEIQKA-------W..-------
A5E0E2_LODEL/102-187.A------TV---------------LAGVSK----------LF----VS-EI-ISGAFEVQER-------E..-------
E3KAK5_PUCGT/154-238.T------IV---------------IRGFAK----------VF----VG-HM-VEQALEVQKR-------R..-------
D3BH07_POLPA/351-436.A------II---------------MAGISK----------VF----VG-EI-VETARSIMEE-------W..-------
D7MFL1_ARALL/108-194.I------IV---------------VCGIAK----------MF----VG-EL-VETARVVMAE-------R..-------
T1K7I1_TETUR/31-116.V------IA---------------ISGVAK----------VF----AG-EV-VEEALDVMEK-------L..-------
Q21417_CAEEL/223-311.D------IA---------------VAGLAK----------VL----VG-EI-VEEALDIRDL-------D..-------
G8ZM97_TORDC/124-204.R------VF---------------LQAIGK----------LY----AG-EI-IELALDVRQK-------W..-------
G0N3L8_CAEBE/259-348.V------TA---------------IGGLAK----------LV----VG-EL-VEEALDLREA-------VE.-------
F6RBM6_HORSE/104-189.V------IA---------------MSGMAK----------VF----VG-EV-VEEALDVCER-------W..-------
H8Z9C9_NEMS1/29-110.S------IV---------------LSGIAK----------VF----VA-EM-VEEAKEVQEE-------W..-------
G1Q8Z6_MYOLU/112-198.L------IA---------------MAGLAK----------VF----VG-EV-VEEALDVCER-------W..-------
D2UZ99_NAEGR/128-213.E------IT---------------IAGIAK----------VY----VG-EL-VELSKTIQKE-------W..-------
N1JBX9_BLUG1/169-278.I------LA---------------VRSVAK----------IF----AG-DI-IERSRKVQTE-------WL.-------
D5GP56_TUBMM/110-214.G------TA---------------ICGFSK----------VF----TG-EI-VELALKVQKE-------W..-------
R9API2_WALI9/115-199.S------II---------------VSGFSK----------VF----VG-EI-VEKARQVQQS-------W..-------
K1VFG9_TRIAC/88-179LT------AV---------------VAGMVK----------IF----VA-DV-VETAREMQPH-------S..-------
G0MKU9_CAEBE/228-314.A------VA---------------IAGLTK----------LF----VG-EI-VEEAVELRDA-------L..-------
G0RHL6_HYPJQ/171-281.A------TA---------------VKAVAK----------LF----AG-EI-IEGARSVQAE-------WIL-------
T1JEW6_STRMM/68-153.V------IA---------------MSGIAK----------VF----VG-EV-IEDSLDVMEG-------L..-------
B3RLJ9_TRIAD/97-184.V------IA---------------MSGIAK----------VF----VG-ES-VELALDIKEK-------W..-------
A7TJ92_VANPO/131-211.R------VF---------------LQAVGK----------IF----AG-EI-IELALDARQK-------W..-------
F6ZW75_MONDO/112-197.V------IA---------------MSGICK----------VF----VG-EV-IVEALDVCEK-------W..-------
G7YQE8_CLOSI/176-260.V------IA---------------IAGMTK----------VY----IG-EI-VEEALDYKER-------L..-------
A9TN16_PHYPA/2-85.T------IV---------------ISGIAK----------MF----VG-EL-VEMGRIVMTE-------R..-------
V5ERX6_PSEBG/318-398.A------MV---------------VSGVAK----------IF----VG-EI-VEKAREIQAM-------R..-------
F0ZHF9_DICPU/3-88.A------IV---------------MGGIAK----------VF----VG-EI-VELARTIMEE-------W..-------
Q6C5I4_YARLI/75-169.A------VV---------------LSGISK----------VF----IG-EI-IEKAKDVQLR-------M..-------
H2AVS4_KAZAF/119-199.R------VF---------------LQAIGK----------VY----VG-EI-IELALDVRKK-------W..-------
F4P958_BATDJ/139-226.G------II---------------VGGCGK----------LF----VG-EI-VEEALNYMEE-------I..-------
I3LCD0_PIG/5-84.V------IA---------------MSCVAK----------IF----IG-EV-VAETLDMCQK-------R..-------
C5DW95_ZYGRC/143-223.R------VF---------------LQAVGK----------IY----AG-EI-IELALVVREK-------W..-------
F0YMR8_AURAN/16-102.A------VV---------------VAALAK----------MF----VG-DL-VSAARTTRAA-------R..-------
G4T5W0_PIRID/119-203.A------QL---------------VAGVGK----------IF----VG-EI-MAKARDVQYR-------R..-------
L2GVP8_VAVCU/44-128.I------IA---------------VSGVAK----------VF----VG-EM-VCKAKEVQER-------W..-------
M7X6R7_RHOT1/147-228.L------TV---------------VRGFAK----------VF----VG-EI-VEKARSVSQH-------P..-------
M0VAS1_HORVD/23-109.T------IV---------------VSGIAK----------MF----VG-EV-IETARIIMSE-------R..-------
H2VS66_CAEJA/143-227.V------LA---------------IRSLTK----------MF----VG-DL-VEEAVELRAI-------Q..-------
G8Y8I3_PICSO/93-173.S------VV---------------LAGLSK----------SF----LG-EI-ITRALAVQEK-------E..-------
Q20361_CAEEL/127-213.A------LA---------------VAGLTK----------MF----IG-DL-VEEAVELRGA-------L..-------
Q20563_CAEEL/238-326.V------IA---------------IAGLAK----------VF----VG-EV-VEEALDIRDI-------N..-------
F7EW92_MACMU/101-184.V------IA---------------.SGLSK----------VF----VW-EV-VEAALDVCQK-------W..-------
J9D6K1_EDHAE/39-124.I------LS---------------VAGIAK----------VF----AG-EV-IEAALEAQEE-------W..-------
U1LV83_ASCSU/82-168.T------IA---------------VAGLAK----------LF----IG-EL-IEEALDIAER-------L..-------
D8S5E3_SELML/3-84.S------IV---------------MSGLAK----------MF----VG-DV-IETARIIMSE-------Q..-------
A8WMG0_CAEBR/206-294.V------IA---------------VASLAK----------MV----VG-DI-VEEALDIRDA-------K..-------

PF09415

S8AJY0_DACHA/43-119-I------KT---------------VGEYMH----------LF----LT-EA-VYRAV-SNRR.......DGD-------
H2Y0F9_CIOIN/14-82-G------RK---------------CAELLS----------VF----VA-EA-ASRAA-KQAE.......NED-------
F4PWS8_DICFS/16-84-T------QL---------------TAAYLE----------WM----IA-EC-FKRMT-KQAE.......IDE-------
U4L209_PYROM/8-85-L------SA---------------LTEYFS----------TF----IR-EA-IWRSA-EMRK.......NEA-------
S2JD38_MUCC1/10-90-L------QL---------------SCEFLR----------LF----TV-EA-LHRAS-EEQD.......RIE-------
G8ZRF3_TORDC/7-88-V------GM---------------MQKYME----------VF----VR-EA-VLRSS-ANKE.......QIK-------
R4G9G6_ANOCA/14-83-L------LL---------------MAEMLK----------VF----VQ-EA-AARGA-RQAE.......TED-------
G8JU54_ERECY/11-91-I------TL---------------TEKYIK----------LF----VR-EA-VLRSL-ENKD.......KVK-------
G8BUI6_TETPH/12-107-V------GI---------------LQKYME----------LF----VR-EA-VLRSI-ENRE.......QKQ-------
CENPX_MOUSE/9-78-L------QL---------------MAEFLR----------IF----VL-EA-AVRGV-WQAQ.......AED-------
G3VAX2_SARHA/10-79-L------QL---------------MVEMLK----------IF----VQ-EA-AARAI-RQAQ.......AED-------
A2QA97_ASPNC/140-216-N------TV---------------VAKYVD----------VF----VR-EA-LARAA-F.ER.......SEA-------
C5FBD6_ARTOC/119-203-V------KL---------------FAKYIE----------SF----AS-EA-VGRSI-EEKR.......AIN-------
F4IBV2_ARATH/19-86-V------AL---------------GTTKKN----------RL----AS-EA-VQRAA-IIAE.......AEG-------
J7R3U2_KAZNA/11-81-L------TS---------------VQKYVE----------TY----VQ-EI-ILRSL-ENKD.......LGV-------
S3C6N7_OPHP1/96-166-H------AS---------------IDKYME----------IF----IR-EA-VARSV-A.AR.......TD.-------
I2H406_TETBL/18-116-V------TK---------------LQKYME----------LF----IR-EA-ALRSL-ENKE.......EQI-------
Q75CS7_ASHGO/15-95-V------TL---------------VERYMK----------LF----IR-EA-VLRSL-ENKE.......KVK-------
G3AIK0_SPAPN/11-75-L------EL---------------SSEYIK----------LF----IN-EA-IIRSN-QERL.......DEG-------
B5YLU9_THAPS/32-130-V------DL---------------SSELLK----------LL----VV-EA-RRRAA-IEAECDAAVSDTGN-------
Q5ACP8_CANAL/20-84-L------EL---------------SSEYIK----------LF----IN-EA-IIRAN-EERI.......DEG-------
M3AN04_PSEFD/55-133-I------QV---------------FQKYVE----------IF----VR-ET-LARCT-L.DK.......KEA-------
MHF2_SCHPO/11-88-L------EL---------------ITQYLR----------IY----SK-EA-VCRAY-EEKK.......NSI-------
C5GM46_AJEDR/141-227-G------RV---------------VAKYVD----------IF----VR-EA-LARAA-Y.ER.......TEG-------
H2APT8_KAZAF/5-78-V------ES---------------VTKYTD----------VL----IE-EM-VLRSL-ENKE.......NIA-------
Q0V0M7_PHANO/101-176-M------NL---------------VEKYME----------IF----VR-EA-FARAK-Q.ER.......ELS-------
K1WR03_MARBU/195-277-N------AA---------------VGRYIE----------TF----VR-EG-VARAE-W.AR.......ENG-------
W1QJI5_OGAPD/10-100-L------LL---------------VSEYIK----------LF----TS-EA-IVRSN-VERL.......EEG-------
G4MKQ9_MAGO7/208-274-N------AA---------------VARYFD----------IF----VQ-EA-IARTA-A.ER.......N..-------
H6C4D9_EXODN/199-279-R------AL---------------FGMYIE----------IF----VK-EC-IRRCV-DEKK.......DRE-------
H9J3A8_BOMMO/594-658-L------ML---------------LADVAK----------CL----VT-ET-CLRAV-KQAQ.......REG-------
Q20071_CAEEL/7-77-L------AV---------------LTALIN----------LL----AQ-ES-VARAA-QSAA.......NTG-------
Q6FQU7_CANGA/72-149-V------DA---------------LQRYID----------VF----AR-EA-VLRSI-EHHD.......ASQ-------
E9GIB9_DAPPU/22-88-V------TA---------------VNEIML----------KF----LN-EV-VWRAM-NQAH.......NEG-------
G2XBK4_VERDV/82-147-S------LA---------------AARYID----------VF----VR-EA-IARCV-H.ER.......E..-------
E4V2E6_ARTGP/125-209-V------KL---------------FTKYIE----------SF----VT-EA-VSRSI-EEKR.......ASN-------
G6CZ62_DANPL/23-97-L------SL---------------MTEIAK----------LL----VM-ET-CLRAA-DLAN.......SGN-------
M2MLI9_BAUCO/155-233-V------RV---------------LQKYME----------VF----VR-EA-IARAA-V.GK.......REA-------
E9D3R3_COCPS/119-204-N------RL---------------YAKYID----------IF----VK-EA-VARAI-H.ER.......REK-------
K0KS96_WICCF/11-97-L------EL---------------SSEYLK----------MF----IR-EA-ILRAN-DVRE.......NPK-------
G0W3G5_NAUDC/38-122-I------LM---------------IQRYMD----------LF----IK-EA-VIRSY-ENKV.......ATQ-------
F0X7C4_GROCL/120-187-N------TS---------------VGKYME----------IF----IR-EA-VARSM-A.ER.......RD.-------
B6QBK2_TALMQ/143-222-N------EV---------------VAKYMN----------IF----VR-EA-LARAA-F.ER.......ADA-------
G1TJ11_RABIT/10-79-L------QL---------------TAELLR----------IF----TM-EA-PVHRV-WQAQ.......AED-------
M3XKW5_LATCH/12-81-V------LL---------------MKEMVN----------IF----VR-EA-AARAA-KQAH.......AED-------
A0A0D2X498_CAPO3/11-80-T------RL---------------TAEFMR----------VF----VI-EA-MGRAA-SVAK.......AEG-------
MHF2_YEAST/4-80-V------PM---------------IQKYLD----------IF----ID-EA-VLRSL-QSHK.......DIN-------
B2B1H7_PODAN/183-249-N------NA---------------LSGYMD----------VF----VR-EA-IARAA-A.ER.......K..-------
U7PLY7_SPOS1/145-215-H------AS---------------VNKYIE----------IF----IR-EA-VARSV-A.ER.......GN.-------
CENPX_CHICK/10-79-L------LL---------------MAELLK----------VF----VR-EA-AARAA-RQAQ.......AED-------
C5DYA6_ZYGRC/44-121-V------TM---------------LQKYLE----------VF----VR-EA-VQRSV-ANKD.......SQG-------
B6K2J4_SCHJY/11-87-L------TL---------------IAQYLK----------IY----TK-EA-VCRAY-EDKK.......EKM-------
U1FW45_ENDPU/107-189-K------AV---------------IGKYID----------TF----VR-EA-IARSA-F.ER.......QGK-------
T0KKN5_COLGC/82-148-N------AA---------------AGKYMD----------VF----VR-EA-IARCV-H.ER.......P..-------
R1G6G1_BOTPV/122-198-M------AV---------------ASKYVE----------TF----VR-EA-LARAI-Y.ER.......EEA-------
N1PUX0_DOTSN/38-117-I------QV---------------FHKYVE----------VF----VR-EA-IARTR-A.EK.......EEA-------
Q5BES3_EMENI/391-467-N------AV---------------VAKYID----------VF----VR-EA-VARAA-FERS.......EAQ-------
C0NEG5_AJECG/148-230-V------RA---------------LAKYVD----------IF----VR-EA-LARAS-Y.ER.......AEG-------
C4R695_PICPG/8-103-L------EL---------------SIEYLK----------IF----TK-EA-VIRAD-EVRR.......DRN-------
H2ZDL5_CIOSA/5-77-A------KL---------------CADLLT----------VF----VC-EA-ATRAA-NQAG.......NED-------
F4RQY9_MELLP/27-105-L------HL---------------SVEYLR----------LF----TI-EL-IHRAN-EAAG.......GSE-------
J8Q3Z8_SACAR/4-80-I------PM---------------IQKYLD----------IF----VE-EA-ALRSL-QSHK.......DAS-------
L8FPN4_PSED2/71-142-D------KA---------------VGKYME----------TF----VR-EA-IARAA-Y.ER.......GGD-------
B6GVY1_PENRW/139-217-N------NV---------------VAKYVD----------VF----VR-EA-IARAA-Y.ER.......AES-------
G2RGB0_THITE/132-198-N------AA---------------VARYMD----------VF----VR-EA-IARAA-V.ER.......A..-------
B2WK03_PYRTR/118-193-M------KL---------------VGKYID----------IF----VT-EA-FLRSK-D.ER.......ESA-------
R7YKC5_CONA1/128-205-M------AV---------------VGKYME----------TF----VR-EA-LARAA-F.ER.......EEV-------
C5E218_LACTC/7-86-L------SL---------------VDAYLE----------VF----VR-EA-LLRSI-ENKE.......QVK-------
G2XS27_BOTF4/167-238-N------KA---------------VGKYMD----------TF----VR-EA-IARVR-YTER.......GSG-------
G3J304_CORMM/69-135-N------AA---------------VGKYVD----------VF----VR-EA-IARSA-V.EK.......R..-------
A7TL11_VANPO/9-87-V------EG---------------LQKYME----------LF----VR-EA-IMRSI-ETKA.......KLE-------
Q6BJ85_DEBHA/17-82-L------QL---------------SSEYIK----------LF----IN-EA-LIRSN-EERL.......AEG-------
B7Q7G6_IXOSC/43-109-L------KL---------------TCEILR----------LL----AH-EG-AARAS-MQAK.......LQG-------
A2DLP6_TRIVA/13-80-V------EL---------------IAEYLR----------CV----VV-EA-TERAA-DVAG.......DEK-------
I1G6Y8_AMPQE/9-78-L------KL---------------MKKYVD----------IL----VL-ET-VFRTI-DQAK.......IEQ-------
CENPX_BOVIN/10-79-L------QL---------------VAELLK----------IF----VV-EA-AIRSV-RQAQ.......AEG-------
M7PB04_PNEMU/14-89-L------TL---------------CSEYIR----------IF----CK-EA-IWRAA-ASKR.......EHE-------
Q7SC05_NEUCR/138-213-N------EA---------------VARYVD----------IF----VR-EA-IARSV-V.ER.......EGG-------
M3CP67_SPHMS/5-99-L------GM---------------VQQYVE----------IF----VR-EM-IARCV-A.EK.......KER-------
Q6CSZ2_KLULA/7-78-M------QL---------------LEPYIE----------LF----VR-EG-VLRSL-ENKA.......DML-------
G3PAR2_GASAC/9-78-V------LL---------------MTEMLK----------IF----VQ-EA-AVRSQ-KQAE.......SED-------
M1W1I7_CLAP2/71-137-N------AA---------------VGKYMD----------IF----VR-EA-IARAA-V.EK.......N..-------
A7E683_SCLS1/185-253-N------KT---------------VGKYMD----------VF----VR-EA-VTRI.-..WD.......ADG-------
S3E4I6_GLAL2/122-193-Q------AA---------------VGRYME----------TF----VR-EG-IARCV-W.AR.......SEL-------
E7F1X6_DANRE/12-81-V------VL---------------VAEMLK----------VF----VE-EA-TRRAI-KQAS.......SED-------

PF02269

SUPT3_HUMAN/106-198-A------VL---------------VEDVVH----------TQ----LI-NL-LQQAAEVSQL-----------------
Q17957_CAEEL/27-116-L------DT---------------LEAIVL----------NY----IK-EL-CQLAMKVGKP-----------------
SPT3_YEAST/5-96-T------SL---------------IEDIVR----------GQ----VI-EI-LLQSNKTAHL-----------------
SPT3_SCHPO/8-99-T------QL---------------VEELIR----------GQ----VM-EM-LIQANELALR-----------------
TAF13_YEAST/9-101-V------QC---------------LDELVS----------GY----LV-DV-CTNAFHTAQN-----------------
TAF13_HUMAN/30-119-V------DI---------------LEDLVI----------EF----IT-EM-THKAMSIGRQ-----------------

PF15510

F1S2W8_PIG/1-88-D------LL...............VHLNCL----------LF----VH-RL-AEESRANACE-----------------
H0VLK4_CAVPO/1-103-D------VLVSVGFSSLFTFSLLKVHLNFL----------LF----VH-RL-AEEARINACE-----------------
G1P8B1_MYOLU/1-88-D------LL...............VHLNCL----------LF----IR-RL-AEEARTDACK-----------------
CENPW_MOUSE/1-86-D------LL...............IHLNCL----------LF----IQ-RL-AEESRTNACE-----------------

PF05236

C5DTC1_ZYGRC/143-382IL------RM---------------MSSACE----------SY----MR-DV-ITNSLIISRH-------RRK.AVKINS
M7NV88_PNEMU/67-333IG------PL---------------LALSLR----------DR----MA-NL-LSDMIVLSRH-------RTA.SLPVNR
D6WBP3_TRICA/521-763VA------AC---------------ISHAAQ----------ER----LK-NL-IEKLAIITGH-------RLD.IVKKDL
K4A5I4_SETIT/609-902VE------RC---------------LSMCVE----------ER----LR-GF-ISDIIRFSKQ-------RVD.VEKSRH
T1I5P6_RHOPR/767-1015VA------AL---------------VSHATQ----------ER----LK-TF-VEKLAVIAEH-------RID.LNKADP
M0SNT6_MUSAM/533-830VE------RC---------------LSMCVE----------ER----LK-GL-ICYLIRLSKQ-------RVD.LEKSRH
G3P6F4_GASAC/373-619VV------NF---------------VSHATQ----------HR----LM-DL-LEKVSQVALQ-------KNL.NSKEDG
I3JJV8_ORENI/483-731VV------AL---------------VSHATQ----------EF----LR-GL-LEKLTVMAEH-------RKT.TLKQNS
U3I7K9_ANAPL/493-741VV------NL---------------ISHATQ----------ER----LR-GL-LEKLTVIAQH-------RVS.THKGSD
D7KBU1_ARALL/454-706VE------RC---------------LSLCVE----------ER----MR-GL-LSNIIRISKQ-------RTD.AEKCRN
J5S578_SACK1/142-381IL------NM---------------MSSACE----------NY----MR-DI-LTNAIIISRH-------RRK.AVKINS
TAF4_CANAL/87-358ML------EL---------------ISAACE----------TW----LS-NL-ATKTIILSRH-------RRR.GIPVI.
G8YJH0_PICSO/203-470LL------EL---------------MSSSCE----------DW----LS-HI-ITKTIILSRH-------RRR.GM....
TAF4_SCHPO/81-360IH------AL---------------ISMAVR----------DY----LA-NL-LQKMIVESHH-------RTS.QLHTDN
I3KPC9_ORENI/575-820VV------NL---------------VSHATQ----------SR----LR-TL-LEKVSAIAQH-------RTD.GGKDEE
TAF4_PICGU/190-450LL------EL---------------MSASCE----------QW----IS-HI-ATKTVLLSRH-------RRR.GIPAL.
M0SKQ5_MUSAM/574-867VE------RC---------------LSMCVE----------ER----LK-GL-ISYLIRLSKQ-------RVD.IEKSRH
G3NEU9_GASAC/420-666VV------AL---------------VSHATQ----------EC----LR-GL-LEKLTVMAEH-------RKA.GLKEDL
E0VZS5_PEDHC/676-918VA------SL---------------VSHACQ----------ER----LK-TL-IEKLACIAEH-------RID.VIKLDS
B7Q4N4_IXOSC/208-450VV------AL---------------ISHATQ----------ER----LK-SL-VQKLGIVAEH-------RLE.NIKSDS
B9R722_RICCO/615-914VE------RC---------------LSLCVE----------ER----MR-GL-ISTLIRLSKQ-------RVD.AEKSRH
G6DIJ0_DANPL/686-929VG------AL---------------LSHALQ----------ER----LK-SL-LEKLAVISQH-------RIDTHVKMDS
F7EHC8_XENTR/534-780VM------NL---------------VSHATQ----------ER----LR-GL-IEKLTLAAQH-------RST.NYKQSD
H2RT50_TAKRU/514-763VV------RY---------------ISHAAQ----------QR----LQ-DL-LEKVSHVAQL-------RSH.ILKEDG
W5M1R8_LEPOC/787-1038AV------NF---------------ISHATQ----------ER----LR-TV-LEKVTIIAQH-------RME.TYKDDE
T1FTH5_HELRO/544-819SI------NM---------------LSMAVK----------EK----LK-TI-LEQLSVLSEH-------RTE.IYKNEK
A0A0D2WR67_CAPO3/190-452VN------EF---------------LGHALE----------LY----LR-NI-LEKLFVISEH-------RYE.VFRTLY
W1NU21_AMBTC/662-960VE------RC---------------LSMCVE----------ER----MR-GL-ISNLIRISKQ-------RVD.IEKPRH
B9GNQ9_POPTR/71-368VG------RC---------------LSLCVE----------ER----MR-GL-ISDLIRLSKQ-------RVD.AEKPRH
E7FFQ2_DANRE/723-973TV------TL---------------ISHATQ----------SR----LR-SM-LEKVSAVAQH-------RAD.SCKDED
H2L3K0_ORYLA/605-850VV------NV---------------VSHATQ----------FR----LR-SL-LEKVSVVAQH-------RAD.AVKDED
K7KI24_SOYBN/610-904LE------RC---------------LSLCVE----------ER----MR-GV-ISNVIRMSKQ-------RVD.LEKTRH
G3B181_CANTC/150-404VL------EI---------------MSASCE----------RW----IS-DI-VAKTIVMARH-------RQN.SAPIG.
C5XNJ0_SORBI/244-537VE------HC---------------LSMCVE----------ER----LR-RL-ISTLIRVSKQ-------RID.TEKTGH
I1PCN0_ORYGL/485-769VE------RC---------------LSMCVE----------ER----LR-GF-ISNTIRLSKQ-------RVD.LEKSRH
F1MMS1_BOVIN/382-630VV------SY---------------VSHATQ----------QR----LQ-NL-VEKISETAQQ-------KNF.SYKDDD
G1PVA9_MYOLU/499-743AV------SL---------------ISHATQ----------ER----LR-GL-LEKLTTIARH-------RMT.AYKTSE
S8C696_DACHA/73-449FS------EL---------------ISIAIQ----------ER----MR-EL-VTTATVYARH-------RRQ.GNTLKG
H9J304_BOMMO/664-908VA------AL---------------ISHAVQ----------ER----LK-NL-IEKLAVIAQH-------RIDHFIKSDS
H2Z376_CIOSA/119-363AV------KF---------------LSCAAE----------TR----IK-DL-LEKLASVVCH-------RMT.NFKEED
F6GZN3_VITVI/617-915VE------RC---------------LSLCVE----------ER----LR-GF-ISNLIRLSKQ-------RAD.VEKPRH
G8BJL6_CANPC/98-365ML------NL---------------VSGACE----------TW----IA-QI-ASKAITISRH-------RRRGGVLTT.
K1RCI1_CRAGI/298-543VA------NL---------------VSHATQ----------ER----LR-DL-LEKLDTIAEH-------RIE.IYKMNE
I2GXP5_TETBL/134-374IL------NL---------------VSSVCE----------AY----MK-DI-ITNALVISRH-------RRK.AVKINS
B9S3E1_RICCO/582-871VE------RC---------------LSLCVE----------ER----MR-GL-VSTLIRLSKQ-------RID.AEKPKH
H0UW54_CAVPO/615-857AV------NL---------------ISHATQ----------ER----LR-GL-LEKLTTIAQH-------RMT.TYKASE
TAF4B_ARATH/537-850VE------RC---------------LSLCVE----------ER----MR-GL-LSHIIRLSKQ-------RVD.AEKSRH
J3LQ37_ORYBR/535-819VD------RC---------------LSMCVE----------ER----LR-GF-ISNAIRLSKQ-------RVD.LEKSRH
I3KWV8_ORENI/407-653VV------NY---------------VSHAAQ----------QR----LQ-NI-LEKVSQVAQQ-------KNI.TFKEDN
M4EMP1_BRARP/541-789VE------RC---------------LSLCVE----------ER----MR-VL-LSKIIRTSKQ-------RTD.PEKCRN
A4V201_DROME/605-848VA------VL---------------ISHACQ----------ER----LK-NI-VEKLAVIAEH-------RID.VIKLDP
H2M8N2_ORYLA/617-857VI------SY---------------ISHATQ----------QR----LQ-NL-LEKVSQVAHH-------KNV.TLKEDE
G0VIS5_NAUCC/90-331LL------SM---------------MSTACE----------TY----MR-DI-LTNALVISRH-------RRR.AIKLNA
W5GVI9_WHEAT/53-337VG------RC---------------LSMCVE----------ER----LR-RF-ISTLIRVSKQ-------RTD.AEKTGH
G3PQM9_GASAC/391-639AA------NF---------------IAHATQ----------QR----LR-HL-LERVSLVAQH-------RNG.TFKEDE
C4Y8U4_CLAL4/268-540ML------DF---------------MSAACK----------EW----LS-SI-VMKTIALARH-------RRR.GIPAF.
W5K1S8_ASTMX/771-1019VV------SL---------------VSHAAE----------VR----LR-SM-LENVTALAQH-------RAD.SCKDEE
V8PJL5_OPHHA/553-793VL------NL---------------ISHATQ----------ER----LR-GL-LEKLTLIAQH-------RIR.TYKGND
L0PEJ0_PNEJ8/49-310VA------PL---------------LALSLR----------NR----MA-GL-LSDMIILSKH-------RTT.SPPINK
K7M5P3_SOYBN/628-925VE------KC---------------LSLCVE----------ER----MR-GL-ISNLIRISKQ-------RVD.FEKTRH
TAF4_VANPO/177-416IL------QM---------------ISSSCE----------NY----MR-DI-ITNTIVISRH-------RRK.AVKVNS
U4LUM8_PYROM/80-504IV------TL---------------LSLAAS----------ER----LK-TL-LTRSTALAKV-------RRR.......
A9T9V3_PHYPA/958-1273VE------RC---------------ISMAAE----------ER----VR-SM-LYKLIKYSKQ-------RCD.VEKDAH
TAF4_LODEL/264-545LL------NL---------------ISDACE----------DW----LS-HI-ASKALILSRH-------RRR.GTQFS.
I1P2Q6_ORYGL/422-717VE------HC---------------LSMCVE----------ER----LR-RF-ISTLIRVSKQ-------RID.TEKSGH
A3LYF3_PICST/20-289LL------EL---------------MSASCE----------MW----LS-SI-LGKTVLLSRH-------RRR.GIPQP.
H2TWF2_TAKRU/390-638VV------KY---------------VSHATQ----------QR----LQ-NL-LEKVSLVAQQ-------RHI.SFKEDD
I1GQP3_BRADI/540-832VE------RC---------------LSMCVE----------ER----LR-GF-ISNIIRLSKQ-------RVD.VEKSRH
B6JWG5_SCHJY/81-363IH------AL---------------ISMSAR----------DY----LA-NL-IQKMMVESNH-------RTT.VVDTKR
J7RYU5_KAZNA/69-318VL------AV---------------VSSACE----------YY----MR-DI-VTNALVISRH-------RRR.GVQLNT
G1KA85_ANOCA/600-840VL------NL---------------ISHATQ----------KR----LR-GL-LEKLTVIAQH-------RMV.TYKEND
W5MGZ3_LEPOC/596-844VV------SL---------------VSHAAQ----------EH----LR-EL-IEKLTVIAHH-------RKI.TYK.DD
C5M753_CANTT/145-418ML------EL---------------VSAACE----------TW----LS-RL-ATKTMMLSRH-------RRR.GIPKI.
H3D4Z0_TETNG/401-649VI------SY---------------ISHATQ----------NR----LL-NL-LEKVSHVAQL-------KNH.NLKEDG
T1K318_TETUR/429-680VV------SL---------------VSHAAQ----------ER----LK-TL-VEKLGIIAEH-------RME.NFKNDP
W4XKE1_STRPU/729-985VL------DV---------------VSLAVQ----------ER----LK-KV-VEQLSVISQH-------RLE.IYRNDT
G1XJL7_ARTOA/79-445LA------EL---------------LSIAAQ----------EH----IR-EL-LTTATQYAQY-------RRR.GNTVKG
K4BUP2_SOLLC/622-920VE------RC---------------LSLCVE----------ER----MR-GL-ISSLIRLSKQ-------RVD.IEKSRH
TAF4_DEBHA/241-517LL------EL---------------MSTSCE----------NW----LS-NI-ITKTIILSRH-------RRR.GIPTI.
Q177Z6_AEDAE/263-506VA------VL---------------ISHACQ----------ER----LK-NI-VEKLAVVAEH-------RID.IIKVDP
TAF4_ARATH/463-712VE------RC---------------LSLCVE----------ER----MR-GL-LFNIIRISKQ-------RTD.AEKCRN

PF09123

E6X1K6_NITSE/9-146-L------PE---------------LTGAIL----------VV----MA-RI-MKEIDRESR.-----------------
F4CZA8_PSEUX/10-146-L------PE---------------LFGGMS----------VA----LA-RS-FKVIDPRLV.-----------------
L0J5M6_MYCSM/10-146-L------PE---------------LFGGLS----------IA----LA-RS-FRVIDTTVS.-----------------
Q0S1W3_RHOJR/9-146-L------PL---------------IAGGLS----------VA----LA-HT-FVTVEPDRK.-----------------
B9L7D5_NAUPA/10-146-L------PE---------------YIGALM----------LI----VA-RV-LKQIGAHKK.-----------------
Q8U348_PYRFU/11-150-L------PI---------------ITGTLF----------VL----IG-RV-IKALHPEVR.-----------------
Q826G1_STRAW/61-198-Y------PE---------------IIGGLS----------VA----LA-ET-FKILYPDVK.-----------------
D0MI80_RHOM4/10-147-L------PR---------------LVGALT----------VA----LA-RA-FKILDPEVK.-----------------
Q0RZB3_RHOJR/9-146-F------PD---------------IVGGLS----------VA----PA-RT-LAIVHPGIA.-----------------
E3J762_FRASU/9-146-L------PL---------------IAGGLS----------LA----LA-EA-FTILEPDVR.-----------------
Q0RMJ7_FRAAA/4-141-L------PL---------------IVGGLS----------LA----LA-RA-FTIIEPELK.-----------------
C0QQA2_PERMH/9-146-L------PE---------------IVGTLI----------YI----LA-LL-IKEIAPGER.-----------------
Q0SK49_RHOJR/18-157-L------AD---------------ITGGLS----------VA----LA-RT-FRVVYPELRT-----------------
B2IWP7_NOSP7/9-146-L------SD---------------IVGGLS----------VA----LA-RT-FKIIDPALK.-----------------
Q1AY81_RUBXD/9-146-F------PE---------------IVGGLS----------LA----LA-RT-FRLLDPEVK.-----------------
Y328_AQUAE/32-168-Y------RN---------------IMGGLL----------LM----HA-DV-IKKATGERK.-----------------
D2RF04_ARCPA/11-150-L------PI---------------ITGTLF----------VL----IG-RV-IKALHPDVE.-----------------
C8XFC4_NAKMY/8-143-L------TE---------------VFGGLS----------VG----LA-RS-FRIVDPEVS.-----------------
Y616_AQUAE/19-164-K------AD---------------ILGGIM----------LM----FA-SV-AKQINGDRK.-----------------
A6Q0X2_NITSB/9-145-L------PE---------------IVGGLT----------LV----LA-RI-MKKLDEENR.-----------------
E4U5U8_OCEP5/8-145-L------PK---------------LAGALV----------VA----AA-RV-IRELDPDVK.-----------------
Y1509_METJA/11-150-L------PL---------------ITGTIF----------IV----VG-RV-IKALHEDIE.-----------------
W5WDS1_9PSEU/9-147-L------PA---------------IAGGLS----------VA----LA-RA-FPLVAPSVK.-----------------
Q5SI95_THET8/8-145-L------PE---------------LAGALV----------VA----YA-RV-LKELDPALK.-----------------
C5CB24_MICLC/10-147-S------PR---------------LVGGLT----------VA----LA-RA-FKILDPKVK.-----------------
G2NZ66_STRVO/9-146-Y------PE---------------IIGGLS----------LA----LA-QT-FKIVYPDLK.-----------------
H3ZJQ7_THELN/11-150-L------PI---------------ITGTLF----------VL----IG-RV-IKALHPEIR.-----------------

PF02291

M7WDK4_RHOT1/10-135-V------RM---------------LVEFAH..........RY----TS-DV-LTDSLLYA-E-----------------
G2X9P3_VERDV/76-227-P------LL---------------LLDFAY..........RH----TS-SI-LNDALHLS-A-----------------
F4QEA6_DICFS/134-255-V------NQ---------------LMEFMY..........KY----VY-EV-LQDSMVYS-E-----------------
A5DHC0_PICGU/7-133-P------LQ---------------LMDFAH..........RY----TT-SV-LKDALVYN-D-----------------
E4XZ10_OIKDI/7-128-V------QQ---------------MLEFSY..........RY----TT-EV-LEEAKLYS-N-----------------
U9T6J2_RHIID/13-134-V------QQ---------------LLEFAH..........RY----TV-DV-IQDASAYA-E-----------------
E0VC09_PEDHC/9-130-I------IQ---------------LLEFTY..........RY----IT-TT-LEDARVYA-T-----------------
E3JXG9_PUCGT/27-152-V------RV---------------LMEFAH..........RY----TV-DI-LSDALVYA-E-----------------
J9K8F0_ACYPI/7-128-L------NH---------------FLEFNY..........RY----TT-QL-LEDAKALS-N-----------------
K0KLS6_WICCF/12-133-P------LQ---------------LMDFAHSEFERTRLPVNF----IL-TL-IPGSKI..-.-----------------
TAF9_ENCCU/5-126-I------IQ---------------LLEFAY..........RY----TT-DV-LEDALLFA-K-----------------
R7YZF5_CONA1/62-198-P------LQ---------------LLDFAY..........RY----TS-GV-LSDALAVS-A-----------------
F9X6Q8_ZYMTI/40-177-P------LQ---------------LLDFAY..........RY----TS-GV-LSDSLRLS-A-----------------
A7RR68_NEMVE/23-144-V------NQ---------------MLEFTY..........RY----IT-TV-LDDAKVYS-S-----------------
T1J4R5_STRMM/4-125-I------NQ---------------MLEFAY..........RY----VT-NI-LDDGRVFC-T-----------------
H2WNP3_CAEJA/16-136-V------SM---------------LMDVQY..........AV----TT-KI-LEMASGLS-R-----------------
G3BAU9_CANTC/20-152-P------IQ---------------LMDFAH..........RY----TK-AV-LKDALTYN-D-----------------
K5XAX2_AGABU/11-134-L------HQ---------------LLEFSH..........RY----TA-QV-LTDASVYS-E-----------------
Q0U291_PHANO/54-190-P------LQ---------------LLDFAY..........RY----TS-SI-LSDAQSYE-P-----------------
J9KWC1_ACYPI/6-127-L------NH---------------LLEFNH..........RY----TT-LL-LDDAKTFS-N-----------------
D5GLV0_TUBMM/51-182-P------LM---------------LMDFAY..........RY----TS-SV-LQDALLFS-D-----------------
O45784_CAEEL/16-136-V------SM---------------LMDVQY..........AV----TS-KI-LQMSSGLS-R-----------------
D6RGK3_HUMAN/9-130-I------NQ---------------MLEFAF..........RY----VT-TI-LDDAKIYS-S-----------------
M2LVQ3_BAUCO/53-191-P------LQ---------------LLDFAY..........RY----TS-GL-LSDSLRLA-S-----------------
A0A068YBD1_ECHMU/4-129-Y------NH---------------VLDIIS..........KY----TG-EI-LVDAKYNA-L-----------------
H3HBI0_PHYRM/27-144-V------AQ---------------LQEFVH..........RY----VT-EI-LVDAQEYS-M-----------------
A8JFR8_CHLRE/13-135-V------NQ---------------LMDFMY..........KY----TT-DV-LLDAEVFS-E-----------------
G4VC88_SCHMA/11-131-C------TR---------------VLDVLY..........RH----TC-DV-IEEAKAVS-H-----------------
W5JA98_ANODA/20-141-I------NQ---------------LLEFTY..........RY----VT-CI-LDDAKIYA-N-----------------
B6JY17_SCHJY/8-131-P------LQ---------------LLTFAH..........RY----TQ-QI-IQDSHVYA-E-----------------
T5AQB6_OPHSC/37-184-P------LL---------------LLDFAY..........RH----TS-SI-LSDALHLS-G-----------------
S3DWR3_GLAL2/53-199-P------VQ---------------LLDFAY..........RH----SS-SI-LCDALHLS-S-----------------
F0XDG5_GROCL/91-244-P------QL---------------LLDFAY..........RH----TS-AI-LSDALHLS-A-----------------
M9M9Y9_PSEA3/14-139-L------LQ---------------LLEFAH..........RY----TY-DV-LSDALVYA-D-----------------
X6M053_RETFI/52-182-L------DM---------------LSDFIY..........NH----II-KI-LSEAKINA-H-----------------
F6QLU5_CIOIN/11-132-V------HQ---------------LLEFTY..........RY----IS-EV-LDEAKVYA-N-----------------
S8AFN1_DACHA/32-161-P------LA---------------LMDIAY..........RY----TS-SI-LQDALLYW-D-----------------
F2U4U6_SALR5/62-197-V------PQ---------------LLEFCQ..........RY----IH-SM-LEDGTRLA-E-----------------
T1KVK8_TETUR/5-124-V------NQ---------------LLEFTY..........RY----VT-TV-LEDARIYS-Q-----------------
M2Z663_PSEFD/12-149-P------LQ---------------LLDFAY..........RY----TS-GV-LNDSLRLS-A-----------------
R4XCN9_TAPDE/5-126-P------LQ---------------LLTFAH..........HY----VH-SA-LTDAQMFQ-D-----------------
I1C775_RHIO9/8-129-V------HQ---------------LLEFAH..........RY----TT-DV-LQDSLIYA-E-----------------
B8M2Z2_TALSN/57-194-P------LQ---------------LLDFAY..........RY----TS-ST-LQDAAHLA-M-----------------
G8YQE8_PICSO/25-155-P------LQ---------------LMDFAF..........RY----ST-SV-FRDAAVYN-D-----------------
B4I6J9_DROSE/15-136-V------NQ---------------LLEFTF..........RY----VT-CI-LDDAKVYA-N-----------------
T1KVL0_TETUR/5-124-V------NQ---------------LLEFAY..........RY----VT-DI-LEDARLYS-V-----------------
B9GKT8_POPTR/5-126-V------HQ---------------FLELWY..........RY----VV-DV-LTDAQVYS-E-----------------
B2AYL6_PODAN/47-193-P------LL---------------LLDFAY..........RH----TS-SV-LSDALHLS-A-----------------
G6DDM8_DANPL/13-134-L------NQ---------------LLEFTY..........RY----VT-SV-LEDARVFA-N-----------------
G4MYK2_MAGO7/63-209-P------LL---------------LLDFAY..........RH----TA-AV-LSDALHLA-G-----------------
W1QJI0_OGAPD/7-140-P------LQ---------------LMDFAY..........RY----TC-GI-LQDAVLYN-D-----------------
F8PNX7_SERL3/10-135-L------HQ---------------LLEFAH..........RY----TA-QI-LSDAQVYA-E-----------------
L8G882_PSED2/42-184-P------LQ---------------LLDFAY..........RH----TS-AI-LADALHLS-S-----------------
C4QZS5_PICPG/5-140-P------LQ---------------LMDFAY..........RY----TT-GT-LQDATIYS-D-----------------
A5E2M9_LODEL/42-174-P------LQ---------------LMDFAH..........RY----TR-GV-LKDALVYN-E-----------------
C3YVK1_BRAFL/4-125-I------NQ---------------MLEFTY..........RY----VT-DI-FENARVYS-T-----------------
B3RUC6_TRIAD/1-120-V------SQ---------------LLELIY..........RY----VS-DI-LDDAAIYS-N-----------------
T1F9J6_HELRO/4-125-V------NQ---------------LVEFTY..........RY----VT-EM-LDDAKMFA-N-----------------
X1WZN5_ACYPI/6-127-L------NH---------------LLEFNY..........RY----TS-LI-LEEAKACS-T-----------------
TAF9_SCHPO/10-133-P------LQ---------------LLTFAH..........RY----TQ-QL-IQDSQVYA-E-----------------
A0A0D2U2T2_CAPO3/6-128-I------QQ---------------LLEFMH..........RY----VA-SV-NDEAKRYA-A-----------------
E7KGY2_YEASA/26-152-P------LQ---------------LMDFAH..........RY----TQ-GV-LKDALVYN-D-----------------
F0ZC88_DICPU/5-126-V------NQ---------------LLEFMY..........KY----VF-EV-LQDSIVYS-E-----------------
N1JGY7_BLUG1/48-193-P------LQ---------------LLDFAY..........RH----SS-SI-LSDALHLS-S-----------------
V5FLB7_BYSSN/57-217-P------LQ---------------LLDFAY..........RY----TS-SV-LQDAVHLA-T-----------------
M5E687_MALS4/16-141-L------VQ---------------LLEFAH..........RY----TT-QV-LQDALVYA-D-----------------
E9E8P1_METAQ/45-192-P------LL---------------LLDFAY..........RY----TS-SI-LSDALHLS-G-----------------
D8R9T7_SELML/1-121-V------NQ---------------FLDMWY..........RY----VA-EV-LGDAQAYS-E-----------------
B8N413_ASPFN/62-215-P------LQ---------------LLDFAY..........RY----TS-GV-LQDAVHLA-T-----------------
J4UWI4_BEAB2/51-198-P------LL---------------LLDFAY..........RH----TS-SI-LNDALHLS-G-----------------
D7EL47_TRICA/12-135-I------VQ---------------LTEFIY..........RY----AT-SI-LEEARMYA-N-----------------
B6TMH7_MAIZE/21-145-V------HQ---------------FLDLAY..........RY----VG-DV-LGDAQVYA-D-----------------
T1GRU2_MEGSC/18-139-I------NQ---------------LLEFTY..........RY----VT-CI-LDDAKVFA-N-----------------
G4TF77_PIRID/740-863-L------QM---------------LMEFAH..........RY----TV-QV-LMDAQVFA-E-----------------
T1HLJ8_RHOPR/5-126-V------NQ---------------LLEFAT..........RY----VS-CV-LDDARAFA-N-----------------
S7W8Z3_SPRLO/3-124-I------VQ---------------ILEFLY..........KY----SV-DV-MEDALLYA-E-----------------
H1VNB3_COLHI/89-239-P------LL---------------LLDFAY..........RH----TS-SI-LSDAIYLS-A-----------------
G0VC63_NAUCC/9-147-P------LQ---------------LMDFAH..........RY----AR-GI-LKDAMVYN-D-----------------
B7QAZ8_IXOSC/4-125-I------NQ---------------MLEFTY..........RY----VT-NI-LDDARLFS-A-----------------
A1CP04_ASPCL/76-234-P------LQ---------------LLDFAY..........RY----TS-GV-LQDAVHLA-T-----------------
H6BPD0_EXODN/52-203-P------LQ---------------LMDFAY..........RY----TS-SV-LSDALHIQ-N-----------------
L2GPL4_VITCO/4-123-I------VQ---------------LLEFAY..........KY----SC-DV-LEDALLYA-K-----------------
J9DF67_EDHAE/5-126-I------IQ---------------LLEFSY..........KY----AT-EI-LEDASIYA-E-----------------
R8BG98_TOGMI/62-215-P------LL---------------LLDFAY..........RH----TS-SV-LSDALHLS-A-----------------
E9GIC2_DAPPU/2-123-I------NQ---------------LLEFIY..........RY----VT-TV-LDDAKAYA-N-----------------
C4Y633_CLAL4/18-146-P------LQ---------------LMDFAH..........RY----TT-SI-LKDALAYN-D-----------------
A9U4J1_PHYPA/4-124-I------NQ---------------FLDLWY..........RY----VV-DV-LGDAQTYA-E-----------------
H8Z9U3_NEMS1/5-126-I------LQ---------------FLEVAY..........KY----FI-EA-VEDAILYA-E-----------------
U5HA82_USTV1/43-172-I------RM---------------LVEFAH..........RY----TA-DI-VSDALVYA-E-----------------
Q6CIP5_KLULA/8-131-P------LQ---------------LMDFAH..........RY----TK-GV-LKDAIAYR-E-----------------
D8TZ69_VOLCA/12-134-V------NQ---------------LMDFMY..........KY----TT-DI-LLDAEVFS-E-----------------
G2R3D3_THITE/87-230-P------LL---------------LLDFAY..........RH----TA-SV-LSDALHLS-A-----------------
M2SP85_COCH5/66-203-P------LQ---------------LLDFAY..........RY----TS-SI-LSDALSYE-P-----------------
K7IPE7_NASVI/11-132-I------NQ---------------LLEFTY..........RY----VT-CI-LDDSKVYA-N-----------------
K1VDX8_TRIAC/5-130-I------HQ---------------LLDFAY..........RY----TG-DV-LQQAQALA-D-----------------
B7XHH0_ENTBH/5-125-I------IQ---------------LLEFAY..........KY----ST-SV-LLDAASYA-K-----------------
D2V9Z9_NAEGR/1-120-I------EQ---------------LLELVY..........RY----IT-EV-IEDSYVYM-D-----------------
M7NV69_PNEMU/9-133-P------LQ---------------LLTFAH..........RY----TH-QV-LQDALVYS-D-----------------
I4Y606_WALMC/4-128-I------HM---------------LLDFAN..........RY----TH-EV-LSDSLVYS-E-----------------

PF07524

SPT7_SCHPO/707-783-L------DA---------------LTEIAA----------DY----MA-KM-GAVMDQYL..-----------------
TAF8_DANRE/32-108-V------ET---------------LTEMMQ----------SY----IT-EV-GRCAKANC.E-----------------
TAF3_SCHPO/7-83-L------NS---------------FTDITI----------RY----IR-LL-SETAMAKA.E-----------------
ST65G_HUMAN/151-230-L------ET---------------LTDVAH----------EY----CL-KF-TKL.LRFAVD-----------------
Q9VP40_DROME/6-77-L------EL---------------LRGKF.----------..----.R-EI-ARQTTNWS.N-----------------
Q9SA19_ARATH/24-100-L------NT---------------LTLTTT----------KF----LQ-SL-AELASSFS.N-----------------
TAF8_HUMAN/29-106-V------ET---------------LTEMLQ----------SY----IS-EI-GRSAKSYC.E-----------------
Q7YTH5_CAEEL/66-142-L------ET---------------LMLLFH----------SY----IK-RI-GEQ.SRFACE-----------------
B4IIW5_DROSE/4-80-L------EL---------------LQDILQ----------KF----VQ-EF-ARDMHGHM.E-----------------
Q7S5N4_NEUCR/52-123-I------ES---------------FTIMTE----------TY----LH-SL-TEEVKVFA.N-----------------
TAF8_ARATH/24-100-L------ES---------------LSGFAL----------QY----IL-QL-GKTATSFA.N-----------------

PF17027

R0KLX4_NOSB1/8-119-L------NI---------------LGDLFK----------FY----SE-RI-LEKIKK..-.-----------------
R0KSL2_NOSB1/8-119-L------NI---------------LGDLFK----------FY----SE-QI-LEKIKK..-.-----------------
Y551_ENCCU/8-126-L------NV---------------LTDILR----------YY----IE-HL-GCRMRR..-.-----------------
C4V862_NOSCE/8-123-L------NI---------------LSDLLK----------YY----II-KI-SLQINK..-.-----------------
B7XJZ3_ENTBH/37-159-L------NI---------------FTEILE----------YY----IE-KI-TDIIYKFR-E-----------------
H8ZFK0_NEMS1/19-158-L------QI---------------IIDLVF----------SQ----IN-QK-LLRVKDIL-S-----------------
I3EGR5_NEMP3/9-149-L------QV---------------ILDLVF----------SH----IN-KQ-LLIIKRIL-S-----------------
S7XQD0_SPRLO/8-121-I------ST---------------LTDILA----------FY----LE-KI-TQKIAE..-.-----------------

PF15511

F1S2K5_PIG/453-556-V------EM---------------VEECLD----------KY----FQ-HL-CGDLEAFA-A-----------------
Q0V6N5_PHANO/384-501-L------NA---------------LVKVTD----------DF----FE-QI-GIDLAAYA-Q-----------------
G5EH18_MAGO7/443-551-L------QA---------------LMQSTE----------WF----FE-QM-GDDLRALA-H-----------------
B8MMW5_TALSN/360-468-L------AA---------------IEQASE----------WF----FE-QA-SEDLAAYS-K-----------------
Q4WWL8_ASPFU/372-480-L------AA---------------IEQASA----------WY----FE-QV-SEDLAAYS-K-----------------
Q2H4H2_CHAGB/380-487-M------KS---------------IMQASD----------WF----FE-QM-SEDLQAYA-K-----------------
H6BTF1_EXODN/377-486-M------QA---------------LEQATE----------WF----FE-QV-GDDLAAYS-D-----------------
F7C6J3_ORNAN/443-546-Y------KV---------------VEKSLD----------RY----FR-QL-GDDLEVFT-S-----------------
B6K2P7_SCHJY/365-468-M------DH---------------LVSISN----------KF----MS-QM-LHDLETYA-D-----------------
F0XUM0_GROCL/440-548-V------AA---------------LTTASD----------WF----FE-QV-GVDLERYS-K-----------------
CENPT_RAT/407-510-L------EM---------------VEKCLD----------EY----FQ-RL-CNDLEVFA-A-----------------

PF15630

A3GI04_PICST/11-91-I......AS---------------LVDLVY----------NQ....IV.NL.GEDLELFA-Q-----------------
A7RMQ5_NEMVE/23-98-V......AA---------------LTETSY----------RQ....CE.SF.AVDLELFA-K-----------------
A7TEH2_VANPO/17-91-I......NA---------------LVELCY----------IQ....LV.EM.GKDLEMFS-R-----------------
B2W5N7_PYRTR/12-87-I......GA---------------LTELVY----------TQ....IA.NT.ARDLEVFS-K-----------------
B3DJV8_DANRE/9-84-I......AA---------------IAETAF----------RQ....CD.IF.AKDLEAFA-R-----------------
B3RZC1_TRIAD/15-90-I......FA---------------LTECTF----------KQ....SE.VI.ATDLEAFA-R-----------------
B6JX09_SCHJY/4-85-VVDELFCVG---------------VTEMVW----------EQ....IK.VL.AKDVEMFA-E-----------------
B6QUS3_TALMQ/14-92-I......GA---------------LTEMVW----------AQ....IE.SV.SQDLEAFA-K-----------------
B7PXV9_IXOSC/11-86-V......AA---------------LTELVW----------KH....AA.RT.AADLEALA-K-----------------
C4Y931_CLAL4/26-101-V......AS---------------LVELVF----------NQ....LV.SV.GEDLELFA-D-----------------
C5DNB5_LACTC/22-96-I......NA---------------LVELCF----------TQ....LV.DI.GGDLEAFA-R-----------------
C5G144_ARTOC/13-88-I......AG---------------LVEITW----------AQ....LE.TV.GQDLEMFA-N-----------------
C7YTU2_NECH7/15-94-I......GA---------------LTELVW----------AQIGRALE.NV.ATDLETFS-N-----------------
D3B378_POLPA/165-243-I......KT---------------VSELIY----------QI....AKKEV.SRDLAMFS-K-----------------
D5GA13_TUBMM/32-107-I......GA---------------LTEMVW----------AQ....IE.NV.SRDLESFA-R-----------------
D7FWQ8_ECTSI/32-105-V......ST---------------LAEVVF----------KF....SE.SL.ALDLRVFA-K-----------------
E4ZQ21_LEPMJ/13-88-I......GA---------------LTELVY----------TQ....IA.NT.SHDLELFS-A-----------------
A0A0D2UKN4_CAPO3/14-89-L......AA---------------LAELTY----------GK....CG.SL.ASDLESFA-K-----------------
E9ECA7_METAQ/10-85-I......GA---------------LTEMVW----------TQ....IE.NV.AVDLESFA-N-----------------
F0XLX6_GROCL/7-82-I......GA---------------LADMVW----------TQ....IE.SV.ALDLESFS-R-----------------
F4PRK1_DICFS/235-311-I......NA---------------LSHLMY----------RL....LKNNI.SKDLFLYC-K-----------------
F4RWE9_MELLP/40-115-V......AS---------------LTDLVY----------AQ....CE.TL.ALDLKAFA-A-----------------
F7DQN4_XENTR/13-88-I......AA---------------ISEITF----------RQ....CG.GF.CVVLLVFK-K-----------------
F7VU88_SORMK/11-86-I......GA---------------LTELVW----------TQ....IE.NV.AIDLETFS-Q-----------------
F9WY71_ZYMTI/13-88-I......GG---------------LSELVA----------AK....IS.AV.STDLEAFA-Q-----------------
G0V9K8_NAUCC/14-94-I......NS---------------LMELCY----------LQ....LD.NL.GSDLERFA-H-----------------
G3BEG3_CANTC/8-83-T......AS---------------LVELTT----------NQ....LL.NL.GEDLEAFA-H-----------------
G3PEU4_GASAC/26-101-V......AA---------------ITETAF----------RQ....CD.VF.AKDLEAFA-R-----------------
G3VT77_SARHA/17-92-I......AA---------------ISEVTF----------RQ....CE.HF.AKDLEMFA-R-----------------
G4LYK5_SCHMA/9-84-I......CL---------------MTELIF----------RF....HQ.IL.ATDLETFS-R-----------------
G4MZ92_MAGO7/9-84-I......GA---------------LTDMVF----------TQ....IE.NV.AKDLESFS-S-----------------
G6DRA0_DANPL/11-86-M......AI---------------VAGLVY----------KK....LI.TY.GLDLEAFA-K-----------------
G8YL18_PICSO/12-89-V......AA---------------LVDLVY----------NQ....LI.NL.GEDLESFA-R-----------------
H1VQ95_COLHI/11-86-I......GA---------------LTEMVW----------AQ....IE.SV.AGDLESFS-R-----------------
H2LES2_ORYLA/10-85-V......AA---------------IAETAF----------RQ....CD.IF.AKDLEAFA-R-----------------
H2N958_PONAB/17-92-I......AA---------------ISELTF----------RQ....CE.NF.AKDLEMFA-R-----------------
H6C6E0_EXODN/12-87-I......GS---------------LMELVW----------AQ....IG.NA.AIDLEAFA-K-----------------
H9J6V9_BOMMO/11-84-M......DL---------------ILELIY----------KK....LS.VY.ASDLEVFA-R-----------------
I1FQJ7_AMPQE/21-96-M......AA---------------VTEMVY----------EQ....CR.LV.SHDLELFA-K-----------------
Q54PV0_DICDI/238-315-M......SS---------------LSELIF----------NV....TK.DLVSKDLVSFA-Q-----------------
Q6BIJ2_DEBHA/13-90-V......AS---------------LVELVY----------NQ....LL.NL.GEDLELFA-N-----------------
J3KG50_COCIM/15-89-L......IA---------------MTEMVW----------DR....IA.DT.TDDLIMFA-K-----------------

PF00125

H2AV3_ORYSJ/1-106--------------------------------------------------------------------------------
H2BV_BOVIN/1-99--------------------------------------------------------------------------------
Q8LK76_MAIZE/18-152--------------------------------------------------------------------------------
H32_HUMAN/1-132--------------------------------------------------------------------------------
A8B678_GIAIC/10-148--------------------------------------------------------------------------------
Q8IL74_PLAF7/1-103--------------------------------------------------------------------------------
A8BYH2_GIAIC/11-146--------------------------------------------------------------------------------
A8B471_GIAIC/44-178--------------------------------------------------------------------------------
H2BWT_HUMAN/23-145--------------------------------------------------------------------------------
Q23429_CAEEL/1-104--------------------------------------------------------------------------------
H2B2_ARATH/87-215--------------------------------------------------------------------------------
Q7XV46_ORYSJ/162-290--------------------------------------------------------------------------------
H3L_ENCCU/1-130--------------------------------------------------------------------------------
CENPA_DANRE/7-140--------------------------------------------------------------------------------
HAP5_YEAST/94-225--------------------------------------------------------------------------------
Q19649_CAEEL/1-114--------------------------------------------------------------------------------
H31_ENCCU/1-135--------------------------------------------------------------------------------
CENPA_CANGA/101-236--------------------------------------------------------------------------------
Q7PVU9_ANOGA/47-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/1-103--------------------------------------------------------------------------------
H2A8_ARATH/1-97--------------------------------------------------------------------------------
CENPA_SCHPO/1-118--------------------------------------------------------------------------------
CENPA_MOUSE/1-127--------------------------------------------------------------------------------
HCP3L_CAEEL/122-257--------------------------------------------------------------------------------
H2BV_MOUSE/1-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/72-200--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/32-167--------------------------------------------------------------------------------
A4H675_LEIBR/1-126--------------------------------------------------------------------------------
A8BI78_GIAIC/1-100--------------------------------------------------------------------------------
Q387X7_TRYB2/34-135--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------
B4I7U0_DROSE/10-74--------------------------------------------------------------------------------
E3GWR6_METFV/1-64--------------------------------------------------------------------------------
F1SVE7_METKA/4-65--------------------------------------------------------------------------------
G7YA03_CLOSI/51-116--------------------------------------------------------------------------------
HARB_PYRFU/3-65--------------------------------------------------------------------------------
Q2UK39_ASPOR/46-111--------------------------------------------------------------------------------
U6EAE9_9EURY/2-65--------------------------------------------------------------------------------
W5LMM0_ASTMX/39-103--------------------------------------------------------------------------------

PF02969

TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
TAF6_ARATH/1-68--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------
A4IHX4_XENTR/9-74--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
TAF12_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
TA12B_ARATH/529-596--------------------------------------------------------------------------------

PF04719

G8BSR2_TETPH/139-219--------------------------------------------------------------------------------
J8Q476_SACAR/129-209--------------------------------------------------------------------------------
E3LZD0_CAERE/217-303--------------------------------------------------------------------------------
I1G7M7_AMPQE/71-156--------------------------------------------------------------------------------
L8Y753_TUPCH/78-161--------------------------------------------------------------------------------
A9CRT7_ENTBH/59-144--------------------------------------------------------------------------------
TAF11_SCHPO/95-179--------------------------------------------------------------------------------
U1MIS9_ASCSU/191-271--------------------------------------------------------------------------------
H2PF83_PONAB/98-183--------------------------------------------------------------------------------
U5DIY7_AMBTC/83-168--------------------------------------------------------------------------------
A7SYY0_NEMVE/3-89--------------------------------------------------------------------------------
F4QDB0_DICFS/307-393--------------------------------------------------------------------------------
F2UQ02_SALR5/216-306--------------------------------------------------------------------------------
X6MJW9_RETFI/615-701--------------------------------------------------------------------------------
M7SAZ2_EUTLA/196-303--------------------------------------------------------------------------------
U4LM69_PYROM/116-201--------------------------------------------------------------------------------
A0A0D2WMQ7_CAPO3/375-460--------------------------------------------------------------------------------
T1EEK4_HELRO/30-115--------------------------------------------------------------------------------
C4VAX6_NOSCE/48-132--------------------------------------------------------------------------------
E4XD21_OIKDI/168-253--------------------------------------------------------------------------------
L2GN22_VITCO/62-146--------------------------------------------------------------------------------
R0MGZ1_NOSB1/32-117--------------------------------------------------------------------------------
S7W8C8_SPRLO/66-151--------------------------------------------------------------------------------
I2H2Q9_TETBL/217-297--------------------------------------------------------------------------------
E5S4W4_TRISP/310-396--------------------------------------------------------------------------------
Q8SSE1_ENCCU/49-130--------------------------------------------------------------------------------
C7YV21_NECH7/171-283--------------------------------------------------------------------------------
A0A068YK50_ECHMU/153-237--------------------------------------------------------------------------------
A4RSC0_OSTLU/31-116--------------------------------------------------------------------------------
L5KZB3_PTEAL/96-181--------------------------------------------------------------------------------
E9G9V1_DAPPU/3-88--------------------------------------------------------------------------------
R4XFB3_TAPDE/83-168--------------------------------------------------------------------------------
D7KI82_ARALL/38-124--------------------------------------------------------------------------------
U5GY91_USTV1/142-223--------------------------------------------------------------------------------
C1MKX3_MICPC/31-118--------------------------------------------------------------------------------
A8XSJ7_CAEBR/205-291--------------------------------------------------------------------------------
E1ZAD2_CHLVA/141-221--------------------------------------------------------------------------------
S2JU45_MUCC1/162-247--------------------------------------------------------------------------------
E3MIY3_CAERE/191-279--------------------------------------------------------------------------------
F1N372_BOVIN/106-191--------------------------------------------------------------------------------
C4R2G1_PICPG/131-213--------------------------------------------------------------------------------
J9F669_WUCBA/184-270--------------------------------------------------------------------------------
L0P7W8_PNEJ8/44-128--------------------------------------------------------------------------------
G8BAE4_CANPC/112-196--------------------------------------------------------------------------------
U9U4H6_RHIID/1-86--------------------------------------------------------------------------------
C1FD46_MICSR/15-101--------------------------------------------------------------------------------
F4RU01_MELLP/124-208--------------------------------------------------------------------------------
D8U9I9_VOLCA/104-190--------------------------------------------------------------------------------
D0MZ49_PHYIT/4-97--------------------------------------------------------------------------------
D8Q789_SCHCM/34-118--------------------------------------------------------------------------------
G1X2K3_ARTOA/165-253--------------------------------------------------------------------------------
A5E0E2_LODEL/102-187--------------------------------------------------------------------------------
E3KAK5_PUCGT/154-238--------------------------------------------------------------------------------
D3BH07_POLPA/351-436--------------------------------------------------------------------------------
D7MFL1_ARALL/108-194--------------------------------------------------------------------------------
T1K7I1_TETUR/31-116--------------------------------------------------------------------------------
Q21417_CAEEL/223-311--------------------------------------------------------------------------------
G8ZM97_TORDC/124-204--------------------------------------------------------------------------------
G0N3L8_CAEBE/259-348--------------------------------------------------------------------------------
F6RBM6_HORSE/104-189--------------------------------------------------------------------------------
H8Z9C9_NEMS1/29-110--------------------------------------------------------------------------------
G1Q8Z6_MYOLU/112-198--------------------------------------------------------------------------------
D2UZ99_NAEGR/128-213--------------------------------------------------------------------------------
N1JBX9_BLUG1/169-278--------------------------------------------------------------------------------
D5GP56_TUBMM/110-214--------------------------------------------------------------------------------
R9API2_WALI9/115-199--------------------------------------------------------------------------------
K1VFG9_TRIAC/88-179--------------------------------------------------------------------------------
G0MKU9_CAEBE/228-314--------------------------------------------------------------------------------
G0RHL6_HYPJQ/171-281--------------------------------------------------------------------------------
T1JEW6_STRMM/68-153--------------------------------------------------------------------------------
B3RLJ9_TRIAD/97-184--------------------------------------------------------------------------------
A7TJ92_VANPO/131-211--------------------------------------------------------------------------------
F6ZW75_MONDO/112-197--------------------------------------------------------------------------------
G7YQE8_CLOSI/176-260--------------------------------------------------------------------------------
A9TN16_PHYPA/2-85--------------------------------------------------------------------------------
V5ERX6_PSEBG/318-398--------------------------------------------------------------------------------
F0ZHF9_DICPU/3-88--------------------------------------------------------------------------------
Q6C5I4_YARLI/75-169--------------------------------------------------------------------------------
H2AVS4_KAZAF/119-199--------------------------------------------------------------------------------
F4P958_BATDJ/139-226--------------------------------------------------------------------------------
I3LCD0_PIG/5-84--------------------------------------------------------------------------------
C5DW95_ZYGRC/143-223--------------------------------------------------------------------------------
F0YMR8_AURAN/16-102--------------------------------------------------------------------------------
G4T5W0_PIRID/119-203--------------------------------------------------------------------------------
L2GVP8_VAVCU/44-128--------------------------------------------------------------------------------
M7X6R7_RHOT1/147-228--------------------------------------------------------------------------------
M0VAS1_HORVD/23-109--------------------------------------------------------------------------------
H2VS66_CAEJA/143-227--------------------------------------------------------------------------------
G8Y8I3_PICSO/93-173--------------------------------------------------------------------------------
Q20361_CAEEL/127-213--------------------------------------------------------------------------------
Q20563_CAEEL/238-326--------------------------------------------------------------------------------
F7EW92_MACMU/101-184--------------------------------------------------------------------------------
J9D6K1_EDHAE/39-124--------------------------------------------------------------------------------
U1LV83_ASCSU/82-168--------------------------------------------------------------------------------
D8S5E3_SELML/3-84--------------------------------------------------------------------------------
A8WMG0_CAEBR/206-294--------------------------------------------------------------------------------

PF09415

S8AJY0_DACHA/43-119--------------------------------------------------------------------------------
H2Y0F9_CIOIN/14-82--------------------------------------------------------------------------------
F4PWS8_DICFS/16-84--------------------------------------------------------------------------------
U4L209_PYROM/8-85--------------------------------------------------------------------------------
S2JD38_MUCC1/10-90--------------------------------------------------------------------------------
G8ZRF3_TORDC/7-88--------------------------------------------------------------------------------
R4G9G6_ANOCA/14-83--------------------------------------------------------------------------------
G8JU54_ERECY/11-91--------------------------------------------------------------------------------
G8BUI6_TETPH/12-107--------------------------------------------------------------------------------
CENPX_MOUSE/9-78--------------------------------------------------------------------------------
G3VAX2_SARHA/10-79--------------------------------------------------------------------------------
A2QA97_ASPNC/140-216--------------------------------------------------------------------------------
C5FBD6_ARTOC/119-203--------------------------------------------------------------------------------
F4IBV2_ARATH/19-86--------------------------------------------------------------------------------
J7R3U2_KAZNA/11-81--------------------------------------------------------------------------------
S3C6N7_OPHP1/96-166--------------------------------------------------------------------------------
I2H406_TETBL/18-116--------------------------------------------------------------------------------
Q75CS7_ASHGO/15-95--------------------------------------------------------------------------------
G3AIK0_SPAPN/11-75--------------------------------------------------------------------------------
B5YLU9_THAPS/32-130--------------------------------------------------------------------------------
Q5ACP8_CANAL/20-84--------------------------------------------------------------------------------
M3AN04_PSEFD/55-133--------------------------------------------------------------------------------
MHF2_SCHPO/11-88--------------------------------------------------------------------------------
C5GM46_AJEDR/141-227--------------------------------------------------------------------------------
H2APT8_KAZAF/5-78--------------------------------------------------------------------------------
Q0V0M7_PHANO/101-176--------------------------------------------------------------------------------
K1WR03_MARBU/195-277--------------------------------------------------------------------------------
W1QJI5_OGAPD/10-100--------------------------------------------------------------------------------
G4MKQ9_MAGO7/208-274--------------------------------------------------------------------------------
H6C4D9_EXODN/199-279--------------------------------------------------------------------------------
H9J3A8_BOMMO/594-658--------------------------------------------------------------------------------
Q20071_CAEEL/7-77--------------------------------------------------------------------------------
Q6FQU7_CANGA/72-149--------------------------------------------------------------------------------
E9GIB9_DAPPU/22-88--------------------------------------------------------------------------------
G2XBK4_VERDV/82-147--------------------------------------------------------------------------------
E4V2E6_ARTGP/125-209--------------------------------------------------------------------------------
G6CZ62_DANPL/23-97--------------------------------------------------------------------------------
M2MLI9_BAUCO/155-233--------------------------------------------------------------------------------
E9D3R3_COCPS/119-204--------------------------------------------------------------------------------
K0KS96_WICCF/11-97--------------------------------------------------------------------------------
G0W3G5_NAUDC/38-122--------------------------------------------------------------------------------
F0X7C4_GROCL/120-187--------------------------------------------------------------------------------
B6QBK2_TALMQ/143-222--------------------------------------------------------------------------------
G1TJ11_RABIT/10-79--------------------------------------------------------------------------------
M3XKW5_LATCH/12-81--------------------------------------------------------------------------------
A0A0D2X498_CAPO3/11-80--------------------------------------------------------------------------------
MHF2_YEAST/4-80--------------------------------------------------------------------------------
B2B1H7_PODAN/183-249--------------------------------------------------------------------------------
U7PLY7_SPOS1/145-215--------------------------------------------------------------------------------
CENPX_CHICK/10-79--------------------------------------------------------------------------------
C5DYA6_ZYGRC/44-121--------------------------------------------------------------------------------
B6K2J4_SCHJY/11-87--------------------------------------------------------------------------------
U1FW45_ENDPU/107-189--------------------------------------------------------------------------------
T0KKN5_COLGC/82-148--------------------------------------------------------------------------------
R1G6G1_BOTPV/122-198--------------------------------------------------------------------------------
N1PUX0_DOTSN/38-117--------------------------------------------------------------------------------
Q5BES3_EMENI/391-467--------------------------------------------------------------------------------
C0NEG5_AJECG/148-230--------------------------------------------------------------------------------
C4R695_PICPG/8-103--------------------------------------------------------------------------------
H2ZDL5_CIOSA/5-77--------------------------------------------------------------------------------
F4RQY9_MELLP/27-105--------------------------------------------------------------------------------
J8Q3Z8_SACAR/4-80--------------------------------------------------------------------------------
L8FPN4_PSED2/71-142--------------------------------------------------------------------------------
B6GVY1_PENRW/139-217--------------------------------------------------------------------------------
G2RGB0_THITE/132-198--------------------------------------------------------------------------------
B2WK03_PYRTR/118-193--------------------------------------------------------------------------------
R7YKC5_CONA1/128-205--------------------------------------------------------------------------------
C5E218_LACTC/7-86--------------------------------------------------------------------------------
G2XS27_BOTF4/167-238--------------------------------------------------------------------------------
G3J304_CORMM/69-135--------------------------------------------------------------------------------
A7TL11_VANPO/9-87--------------------------------------------------------------------------------
Q6BJ85_DEBHA/17-82--------------------------------------------------------------------------------
B7Q7G6_IXOSC/43-109--------------------------------------------------------------------------------
A2DLP6_TRIVA/13-80--------------------------------------------------------------------------------
I1G6Y8_AMPQE/9-78--------------------------------------------------------------------------------
CENPX_BOVIN/10-79--------------------------------------------------------------------------------
M7PB04_PNEMU/14-89--------------------------------------------------------------------------------
Q7SC05_NEUCR/138-213--------------------------------------------------------------------------------
M3CP67_SPHMS/5-99--------------------------------------------------------------------------------
Q6CSZ2_KLULA/7-78--------------------------------------------------------------------------------
G3PAR2_GASAC/9-78--------------------------------------------------------------------------------
M1W1I7_CLAP2/71-137--------------------------------------------------------------------------------
A7E683_SCLS1/185-253--------------------------------------------------------------------------------
S3E4I6_GLAL2/122-193--------------------------------------------------------------------------------
E7F1X6_DANRE/12-81--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF15510

F1S2W8_PIG/1-88--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------
CENPW_MOUSE/1-86--------------------------------------------------------------------------------

PF05236

C5DTC1_ZYGRC/143-382................................................................................
M7NV88_PNEMU/67-333................................................................................
D6WBP3_TRICA/521-763RYE.............................................................................
K4A5I4_SETIT/609-902RFY.............................................................................
T1I5P6_RHOPR/767-1015RYE.............................................................................
M0SNT6_MUSAM/533-830RFV.............................................................................
G3P6F4_GASAC/373-619KYE.............................................................................
I3JJV8_ORENI/483-731WHT.............................................................................
U3I7K9_ANAPL/493-741KYI.............................................................................
D7KBU1_ARALL/454-706RTF.............................................................................
J5S578_SACK1/142-381................................................................................
TAF4_CANAL/87-358......................................NKKSGSSS..................................
G8YJH0_PICSO/203-470................................FGNAAKNKKPPVN...................................
TAF4_SCHPO/81-360Y...............................................................................
I3KPC9_ORENI/575-820RYE.............................................................................
TAF4_PICGU/190-450.....................................KNKKLAANQ..................................
M0SKQ5_MUSAM/574-867RFV.............................................................................
G3NEU9_GASAC/420-666WHA.............................................................................
E0VZS5_PEDHC/676-918RYE.............................................................................
B7Q4N4_IXOSC/208-450RYE.............................................................................
B9R722_RICCO/615-914RTV.............................................................................
G6DIJ0_DANPL/686-929RYE.............................................................................
F7EHC8_XENTR/534-780RYL.............................................................................
H2RT50_TAKRU/514-763RHE.............................................................................
W5M1R8_LEPOC/787-1038WYE.............................................................................
T1FTH5_HELRO/544-819LLT.............................................................................
A0A0D2WR67_CAPO3/190-452PTT.............................................................................
W1NU21_AMBTC/662-960RSF.............................................................................
B9GNQ9_POPTR/71-368QTL.............................................................................
E7FFQ2_DANRE/723-973LYE.............................................................................
H2L3K0_ORYLA/605-850LYE.............................................................................
K7KI24_SOYBN/610-904RTV.............................................................................
G3B181_CANTC/150-404......................................KSKTT.....................................
C5XNJ0_SORBI/244-537RLV.............................................................................
I1PCN0_ORYGL/485-769RIY.............................................................................
F1MMS1_BOVIN/382-630RYE.............................................................................
G1PVA9_MYOLU/499-743NYI.............................................................................
S8C696_DACHA/73-449LGEWADIAFGETEGRNGRLRSEQLEGDTAPSPGGVISRKRSFAVANATSQTPRQP.........................
H9J304_BOMMO/664-908RYE.............................................................................
H2Z376_CIOSA/119-363HYK.............................................................................
F6GZN3_VITVI/617-915RSI.............................................................................
G8BJL6_CANPC/98-365......................................SKKNGTISS.................................
K1RCI1_CRAGI/298-543RFE.............................................................................
I2GXP5_TETBL/134-374................................................................................
B9S3E1_RICCO/582-871RTV.............................................................................
H0UW54_CAVPO/615-857NYI.............................................................................
TAF4B_ARATH/537-850RTF.............................................................................
J3LQ37_ORYBR/535-819RIY.............................................................................
I3KWV8_ORENI/407-653NYE.............................................................................
M4EMP1_BRARP/541-789RIC.............................................................................
A4V201_DROME/605-848RYE.............................................................................
H2M8N2_ORYLA/617-857RCE.............................................................................
G0VIS5_NAUCC/90-331................................................................................
W5GVI9_WHEAT/53-337RLV.............................................................................
G3PQM9_GASAC/391-639RCE.............................................................................
C4Y8U4_CLAL4/268-540......................................NNKNGNSGGKPKSIPP..........................
W5K1S8_ASTMX/771-1019TLE.............................................................................
V8PJL5_OPHHA/553-793KYI.............................................................................
L0PEJ0_PNEJ8/49-310................................................................................
K7M5P3_SOYBN/628-925RTV.............................................................................
TAF4_VANPO/177-416................................................................................
U4LUM8_PYROM/80-504...PQTTITGEWADKIAGATTEGGTNAASSSPKNNLKSEKKTSFALSFAESLLTRPPTGSFSATGLGSPPPPGSLATSTA
A9T9V3_PHYPA/958-1273STV.............................................................................
TAF4_LODEL/264-545......................................LKKGGLSSLTQLS.............................
I1P2Q6_ORYGL/422-717RLV.............................................................................
A3LYF3_PICST/20-289.................................TNAKNGKKASSNANS................................
H2TWF2_TAKRU/390-638NYE.............................................................................
I1GQP3_BRADI/540-832QFY.............................................................................
B6JWG5_SCHJY/81-363L...............................................................................
J7RYU5_KAZNA/69-318................................................................................
G1KA85_ANOCA/600-840NYT.............................................................................
W5MGZ3_LEPOC/596-844GYV.............................................................................
C5M753_CANTT/145-418......................................GKRSGSSS..................................
H3D4Z0_TETNG/401-649RHE.............................................................................
T1K318_TETUR/429-680HYE.............................................................................
W4XKE1_STRPU/729-985RYE.............................................................................
G1XJL7_ARTOA/79-445MGDWADIAFGESEGRDGRLKTELSEGENIDSPSGSVSRKRSFAQANSSSILPRTP.........................
K4BUP2_SOLLC/622-920RTI.............................................................................
TAF4_DEBHA/241-517.................................TNTKQNKKTASSSASMSNP............................
Q177Z6_AEDAE/263-506RYE.............................................................................
TAF4_ARATH/463-712RTF.............................................................................

PF09123

E6X1K6_NITSE/9-146--------------------------------------------------------------------------------
F4CZA8_PSEUX/10-146--------------------------------------------------------------------------------
L0J5M6_MYCSM/10-146--------------------------------------------------------------------------------
Q0S1W3_RHOJR/9-146--------------------------------------------------------------------------------
B9L7D5_NAUPA/10-146--------------------------------------------------------------------------------
Q8U348_PYRFU/11-150--------------------------------------------------------------------------------
Q826G1_STRAW/61-198--------------------------------------------------------------------------------
D0MI80_RHOM4/10-147--------------------------------------------------------------------------------
Q0RZB3_RHOJR/9-146--------------------------------------------------------------------------------
E3J762_FRASU/9-146--------------------------------------------------------------------------------
Q0RMJ7_FRAAA/4-141--------------------------------------------------------------------------------
C0QQA2_PERMH/9-146--------------------------------------------------------------------------------
Q0SK49_RHOJR/18-157--------------------------------------------------------------------------------
B2IWP7_NOSP7/9-146--------------------------------------------------------------------------------
Q1AY81_RUBXD/9-146--------------------------------------------------------------------------------
Y328_AQUAE/32-168--------------------------------------------------------------------------------
D2RF04_ARCPA/11-150--------------------------------------------------------------------------------
C8XFC4_NAKMY/8-143--------------------------------------------------------------------------------
Y616_AQUAE/19-164--------------------------------------------------------------------------------
A6Q0X2_NITSB/9-145--------------------------------------------------------------------------------
E4U5U8_OCEP5/8-145--------------------------------------------------------------------------------
Y1509_METJA/11-150--------------------------------------------------------------------------------
W5WDS1_9PSEU/9-147--------------------------------------------------------------------------------
Q5SI95_THET8/8-145--------------------------------------------------------------------------------
C5CB24_MICLC/10-147--------------------------------------------------------------------------------
G2NZ66_STRVO/9-146--------------------------------------------------------------------------------
H3ZJQ7_THELN/11-150--------------------------------------------------------------------------------

PF02291

M7WDK4_RHOT1/10-135--------------------------------------------------------------------------------
G2X9P3_VERDV/76-227--------------------------------------------------------------------------------
F4QEA6_DICFS/134-255--------------------------------------------------------------------------------
A5DHC0_PICGU/7-133--------------------------------------------------------------------------------
E4XZ10_OIKDI/7-128--------------------------------------------------------------------------------
U9T6J2_RHIID/13-134--------------------------------------------------------------------------------
E0VC09_PEDHC/9-130--------------------------------------------------------------------------------
E3JXG9_PUCGT/27-152--------------------------------------------------------------------------------
J9K8F0_ACYPI/7-128--------------------------------------------------------------------------------
K0KLS6_WICCF/12-133--------------------------------------------------------------------------------
TAF9_ENCCU/5-126--------------------------------------------------------------------------------
R7YZF5_CONA1/62-198--------------------------------------------------------------------------------
F9X6Q8_ZYMTI/40-177--------------------------------------------------------------------------------
A7RR68_NEMVE/23-144--------------------------------------------------------------------------------
T1J4R5_STRMM/4-125--------------------------------------------------------------------------------
H2WNP3_CAEJA/16-136--------------------------------------------------------------------------------
G3BAU9_CANTC/20-152--------------------------------------------------------------------------------
K5XAX2_AGABU/11-134--------------------------------------------------------------------------------
Q0U291_PHANO/54-190--------------------------------------------------------------------------------
J9KWC1_ACYPI/6-127--------------------------------------------------------------------------------
D5GLV0_TUBMM/51-182--------------------------------------------------------------------------------
O45784_CAEEL/16-136--------------------------------------------------------------------------------
D6RGK3_HUMAN/9-130--------------------------------------------------------------------------------
M2LVQ3_BAUCO/53-191--------------------------------------------------------------------------------
A0A068YBD1_ECHMU/4-129--------------------------------------------------------------------------------
H3HBI0_PHYRM/27-144--------------------------------------------------------------------------------
A8JFR8_CHLRE/13-135--------------------------------------------------------------------------------
G4VC88_SCHMA/11-131--------------------------------------------------------------------------------
W5JA98_ANODA/20-141--------------------------------------------------------------------------------
B6JY17_SCHJY/8-131--------------------------------------------------------------------------------
T5AQB6_OPHSC/37-184--------------------------------------------------------------------------------
S3DWR3_GLAL2/53-199--------------------------------------------------------------------------------
F0XDG5_GROCL/91-244--------------------------------------------------------------------------------
M9M9Y9_PSEA3/14-139--------------------------------------------------------------------------------
X6M053_RETFI/52-182--------------------------------------------------------------------------------
F6QLU5_CIOIN/11-132--------------------------------------------------------------------------------
S8AFN1_DACHA/32-161--------------------------------------------------------------------------------
F2U4U6_SALR5/62-197--------------------------------------------------------------------------------
T1KVK8_TETUR/5-124--------------------------------------------------------------------------------
M2Z663_PSEFD/12-149--------------------------------------------------------------------------------
R4XCN9_TAPDE/5-126--------------------------------------------------------------------------------
I1C775_RHIO9/8-129--------------------------------------------------------------------------------
B8M2Z2_TALSN/57-194--------------------------------------------------------------------------------
G8YQE8_PICSO/25-155--------------------------------------------------------------------------------
B4I6J9_DROSE/15-136--------------------------------------------------------------------------------
T1KVL0_TETUR/5-124--------------------------------------------------------------------------------
B9GKT8_POPTR/5-126--------------------------------------------------------------------------------
B2AYL6_PODAN/47-193--------------------------------------------------------------------------------
G6DDM8_DANPL/13-134--------------------------------------------------------------------------------
G4MYK2_MAGO7/63-209--------------------------------------------------------------------------------
W1QJI0_OGAPD/7-140--------------------------------------------------------------------------------
F8PNX7_SERL3/10-135--------------------------------------------------------------------------------
L8G882_PSED2/42-184--------------------------------------------------------------------------------
C4QZS5_PICPG/5-140--------------------------------------------------------------------------------
A5E2M9_LODEL/42-174--------------------------------------------------------------------------------
C3YVK1_BRAFL/4-125--------------------------------------------------------------------------------
B3RUC6_TRIAD/1-120--------------------------------------------------------------------------------
T1F9J6_HELRO/4-125--------------------------------------------------------------------------------
X1WZN5_ACYPI/6-127--------------------------------------------------------------------------------
TAF9_SCHPO/10-133--------------------------------------------------------------------------------
A0A0D2U2T2_CAPO3/6-128--------------------------------------------------------------------------------
E7KGY2_YEASA/26-152--------------------------------------------------------------------------------
F0ZC88_DICPU/5-126--------------------------------------------------------------------------------
N1JGY7_BLUG1/48-193--------------------------------------------------------------------------------
V5FLB7_BYSSN/57-217--------------------------------------------------------------------------------
M5E687_MALS4/16-141--------------------------------------------------------------------------------
E9E8P1_METAQ/45-192--------------------------------------------------------------------------------
D8R9T7_SELML/1-121--------------------------------------------------------------------------------
B8N413_ASPFN/62-215--------------------------------------------------------------------------------
J4UWI4_BEAB2/51-198--------------------------------------------------------------------------------
D7EL47_TRICA/12-135--------------------------------------------------------------------------------
B6TMH7_MAIZE/21-145--------------------------------------------------------------------------------
T1GRU2_MEGSC/18-139--------------------------------------------------------------------------------
G4TF77_PIRID/740-863--------------------------------------------------------------------------------
T1HLJ8_RHOPR/5-126--------------------------------------------------------------------------------
S7W8Z3_SPRLO/3-124--------------------------------------------------------------------------------
H1VNB3_COLHI/89-239--------------------------------------------------------------------------------
G0VC63_NAUCC/9-147--------------------------------------------------------------------------------
B7QAZ8_IXOSC/4-125--------------------------------------------------------------------------------
A1CP04_ASPCL/76-234--------------------------------------------------------------------------------
H6BPD0_EXODN/52-203--------------------------------------------------------------------------------
L2GPL4_VITCO/4-123--------------------------------------------------------------------------------
J9DF67_EDHAE/5-126--------------------------------------------------------------------------------
R8BG98_TOGMI/62-215--------------------------------------------------------------------------------
E9GIC2_DAPPU/2-123--------------------------------------------------------------------------------
C4Y633_CLAL4/18-146--------------------------------------------------------------------------------
A9U4J1_PHYPA/4-124--------------------------------------------------------------------------------
H8Z9U3_NEMS1/5-126--------------------------------------------------------------------------------
U5HA82_USTV1/43-172--------------------------------------------------------------------------------
Q6CIP5_KLULA/8-131--------------------------------------------------------------------------------
D8TZ69_VOLCA/12-134--------------------------------------------------------------------------------
G2R3D3_THITE/87-230--------------------------------------------------------------------------------
M2SP85_COCH5/66-203--------------------------------------------------------------------------------
K7IPE7_NASVI/11-132--------------------------------------------------------------------------------
K1VDX8_TRIAC/5-130--------------------------------------------------------------------------------
B7XHH0_ENTBH/5-125--------------------------------------------------------------------------------
D2V9Z9_NAEGR/1-120--------------------------------------------------------------------------------
M7NV69_PNEMU/9-133--------------------------------------------------------------------------------
I4Y606_WALMC/4-128--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------
B4IIW5_DROSE/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/52-123--------------------------------------------------------------------------------
TAF8_ARATH/24-100--------------------------------------------------------------------------------

PF17027

R0KLX4_NOSB1/8-119--------------------------------------------------------------------------------
R0KSL2_NOSB1/8-119--------------------------------------------------------------------------------
Y551_ENCCU/8-126--------------------------------------------------------------------------------
C4V862_NOSCE/8-123--------------------------------------------------------------------------------
B7XJZ3_ENTBH/37-159--------------------------------------------------------------------------------
H8ZFK0_NEMS1/19-158--------------------------------------------------------------------------------
I3EGR5_NEMP3/9-149--------------------------------------------------------------------------------
S7XQD0_SPRLO/8-121--------------------------------------------------------------------------------

PF15511

F1S2K5_PIG/453-556--------------------------------------------------------------------------------
Q0V6N5_PHANO/384-501--------------------------------------------------------------------------------
G5EH18_MAGO7/443-551--------------------------------------------------------------------------------
B8MMW5_TALSN/360-468--------------------------------------------------------------------------------
Q4WWL8_ASPFU/372-480--------------------------------------------------------------------------------
Q2H4H2_CHAGB/380-487--------------------------------------------------------------------------------
H6BTF1_EXODN/377-486--------------------------------------------------------------------------------
F7C6J3_ORNAN/443-546--------------------------------------------------------------------------------
B6K2P7_SCHJY/365-468--------------------------------------------------------------------------------
F0XUM0_GROCL/440-548--------------------------------------------------------------------------------
CENPT_RAT/407-510--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_TALMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
A0A0D2UKN4_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_ZYMTI/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------
J3KG50_COCIM/15-89--------------------------------------------------------------------------------

PF00125

H2AV3_ORYSJ/1-106--------------------------------------------------------------------------------
H2BV_BOVIN/1-99--------------------------------------------------------------------------------
Q8LK76_MAIZE/18-152--------------------------------------------------------------------------------
H32_HUMAN/1-132--------------------------------------------------------------------------------
A8B678_GIAIC/10-148--------------------------------------------------------------------------------
Q8IL74_PLAF7/1-103--------------------------------------------------------------------------------
A8BYH2_GIAIC/11-146--------------------------------------------------------------------------------
A8B471_GIAIC/44-178--------------------------------------------------------------------------------
H2BWT_HUMAN/23-145--------------------------------------------------------------------------------
Q23429_CAEEL/1-104--------------------------------------------------------------------------------
H2B2_ARATH/87-215--------------------------------------------------------------------------------
Q7XV46_ORYSJ/162-290--------------------------------------------------------------------------------
H3L_ENCCU/1-130--------------------------------------------------------------------------------
CENPA_DANRE/7-140--------------------------------------------------------------------------------
HAP5_YEAST/94-225--------------------------------------------------------------------------------
Q19649_CAEEL/1-114--------------------------------------------------------------------------------
H31_ENCCU/1-135--------------------------------------------------------------------------------
CENPA_CANGA/101-236--------------------------------------------------------------------------------
Q7PVU9_ANOGA/47-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/1-103--------------------------------------------------------------------------------
H2A8_ARATH/1-97--------------------------------------------------------------------------------
CENPA_SCHPO/1-118--------------------------------------------------------------------------------
CENPA_MOUSE/1-127--------------------------------------------------------------------------------
HCP3L_CAEEL/122-257--------------------------------------------------------------------------------
H2BV_MOUSE/1-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/72-200--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/32-167--------------------------------------------------------------------------------
A4H675_LEIBR/1-126--------------------------------------------------------------------------------
A8BI78_GIAIC/1-100--------------------------------------------------------------------------------
Q387X7_TRYB2/34-135--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------
B4I7U0_DROSE/10-74--------------------------------------------------------------------------------
E3GWR6_METFV/1-64--------------------------------------------------------------------------------
F1SVE7_METKA/4-65--------------------------------------------------------------------------------
G7YA03_CLOSI/51-116--------------------------------------------------------------------------------
HARB_PYRFU/3-65--------------------------------------------------------------------------------
Q2UK39_ASPOR/46-111--------------------------------------------------------------------------------
U6EAE9_9EURY/2-65--------------------------------------------------------------------------------
W5LMM0_ASTMX/39-103--------------------------------------------------------------------------------

PF02969

TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
TAF6_ARATH/1-68--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------
A4IHX4_XENTR/9-74--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
TAF12_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
TA12B_ARATH/529-596--------------------------------------------------------------------------------

PF04719

G8BSR2_TETPH/139-219--------------------------------------------------------------------------------
J8Q476_SACAR/129-209--------------------------------------------------------------------------------
E3LZD0_CAERE/217-303--------------------------------------------------------------------------------
I1G7M7_AMPQE/71-156--------------------------------------------------------------------------------
L8Y753_TUPCH/78-161--------------------------------------------------------------------------------
A9CRT7_ENTBH/59-144--------------------------------------------------------------------------------
TAF11_SCHPO/95-179--------------------------------------------------------------------------------
U1MIS9_ASCSU/191-271--------------------------------------------------------------------------------
H2PF83_PONAB/98-183--------------------------------------------------------------------------------
U5DIY7_AMBTC/83-168--------------------------------------------------------------------------------
A7SYY0_NEMVE/3-89--------------------------------------------------------------------------------
F4QDB0_DICFS/307-393--------------------------------------------------------------------------------
F2UQ02_SALR5/216-306--------------------------------------------------------------------------------
X6MJW9_RETFI/615-701--------------------------------------------------------------------------------
M7SAZ2_EUTLA/196-303--------------------------------------------------------------------------------
U4LM69_PYROM/116-201--------------------------------------------------------------------------------
A0A0D2WMQ7_CAPO3/375-460--------------------------------------------------------------------------------
T1EEK4_HELRO/30-115--------------------------------------------------------------------------------
C4VAX6_NOSCE/48-132--------------------------------------------------------------------------------
E4XD21_OIKDI/168-253--------------------------------------------------------------------------------
L2GN22_VITCO/62-146--------------------------------------------------------------------------------
R0MGZ1_NOSB1/32-117--------------------------------------------------------------------------------
S7W8C8_SPRLO/66-151--------------------------------------------------------------------------------
I2H2Q9_TETBL/217-297--------------------------------------------------------------------------------
E5S4W4_TRISP/310-396--------------------------------------------------------------------------------
Q8SSE1_ENCCU/49-130--------------------------------------------------------------------------------
C7YV21_NECH7/171-283--------------------------------------------------------------------------------
A0A068YK50_ECHMU/153-237--------------------------------------------------------------------------------
A4RSC0_OSTLU/31-116--------------------------------------------------------------------------------
L5KZB3_PTEAL/96-181--------------------------------------------------------------------------------
E9G9V1_DAPPU/3-88--------------------------------------------------------------------------------
R4XFB3_TAPDE/83-168--------------------------------------------------------------------------------
D7KI82_ARALL/38-124--------------------------------------------------------------------------------
U5GY91_USTV1/142-223--------------------------------------------------------------------------------
C1MKX3_MICPC/31-118--------------------------------------------------------------------------------
A8XSJ7_CAEBR/205-291--------------------------------------------------------------------------------
E1ZAD2_CHLVA/141-221--------------------------------------------------------------------------------
S2JU45_MUCC1/162-247--------------------------------------------------------------------------------
E3MIY3_CAERE/191-279--------------------------------------------------------------------------------
F1N372_BOVIN/106-191--------------------------------------------------------------------------------
C4R2G1_PICPG/131-213--------------------------------------------------------------------------------
J9F669_WUCBA/184-270--------------------------------------------------------------------------------
L0P7W8_PNEJ8/44-128--------------------------------------------------------------------------------
G8BAE4_CANPC/112-196--------------------------------------------------------------------------------
U9U4H6_RHIID/1-86--------------------------------------------------------------------------------
C1FD46_MICSR/15-101--------------------------------------------------------------------------------
F4RU01_MELLP/124-208--------------------------------------------------------------------------------
D8U9I9_VOLCA/104-190--------------------------------------------------------------------------------
D0MZ49_PHYIT/4-97--------------------------------------------------------------------------------
D8Q789_SCHCM/34-118--------------------------------------------------------------------------------
G1X2K3_ARTOA/165-253--------------------------------------------------------------------------------
A5E0E2_LODEL/102-187--------------------------------------------------------------------------------
E3KAK5_PUCGT/154-238--------------------------------------------------------------------------------
D3BH07_POLPA/351-436--------------------------------------------------------------------------------
D7MFL1_ARALL/108-194--------------------------------------------------------------------------------
T1K7I1_TETUR/31-116--------------------------------------------------------------------------------
Q21417_CAEEL/223-311--------------------------------------------------------------------------------
G8ZM97_TORDC/124-204--------------------------------------------------------------------------------
G0N3L8_CAEBE/259-348--------------------------------------------------------------------------------
F6RBM6_HORSE/104-189--------------------------------------------------------------------------------
H8Z9C9_NEMS1/29-110--------------------------------------------------------------------------------
G1Q8Z6_MYOLU/112-198--------------------------------------------------------------------------------
D2UZ99_NAEGR/128-213--------------------------------------------------------------------------------
N1JBX9_BLUG1/169-278--------------------------------------------------------------------------------
D5GP56_TUBMM/110-214--------------------------------------------------------------------------------
R9API2_WALI9/115-199--------------------------------------------------------------------------------
K1VFG9_TRIAC/88-179--------------------------------------------------------------------------------
G0MKU9_CAEBE/228-314--------------------------------------------------------------------------------
G0RHL6_HYPJQ/171-281--------------------------------------------------------------------------------
T1JEW6_STRMM/68-153--------------------------------------------------------------------------------
B3RLJ9_TRIAD/97-184--------------------------------------------------------------------------------
A7TJ92_VANPO/131-211--------------------------------------------------------------------------------
F6ZW75_MONDO/112-197--------------------------------------------------------------------------------
G7YQE8_CLOSI/176-260--------------------------------------------------------------------------------
A9TN16_PHYPA/2-85--------------------------------------------------------------------------------
V5ERX6_PSEBG/318-398--------------------------------------------------------------------------------
F0ZHF9_DICPU/3-88--------------------------------------------------------------------------------
Q6C5I4_YARLI/75-169--------------------------------------------------------------------------------
H2AVS4_KAZAF/119-199--------------------------------------------------------------------------------
F4P958_BATDJ/139-226--------------------------------------------------------------------------------
I3LCD0_PIG/5-84--------------------------------------------------------------------------------
C5DW95_ZYGRC/143-223--------------------------------------------------------------------------------
F0YMR8_AURAN/16-102--------------------------------------------------------------------------------
G4T5W0_PIRID/119-203--------------------------------------------------------------------------------
L2GVP8_VAVCU/44-128--------------------------------------------------------------------------------
M7X6R7_RHOT1/147-228--------------------------------------------------------------------------------
M0VAS1_HORVD/23-109--------------------------------------------------------------------------------
H2VS66_CAEJA/143-227--------------------------------------------------------------------------------
G8Y8I3_PICSO/93-173--------------------------------------------------------------------------------
Q20361_CAEEL/127-213--------------------------------------------------------------------------------
Q20563_CAEEL/238-326--------------------------------------------------------------------------------
F7EW92_MACMU/101-184--------------------------------------------------------------------------------
J9D6K1_EDHAE/39-124--------------------------------------------------------------------------------
U1LV83_ASCSU/82-168--------------------------------------------------------------------------------
D8S5E3_SELML/3-84--------------------------------------------------------------------------------
A8WMG0_CAEBR/206-294--------------------------------------------------------------------------------

PF09415

S8AJY0_DACHA/43-119--------------------------------------------------------------------------------
H2Y0F9_CIOIN/14-82--------------------------------------------------------------------------------
F4PWS8_DICFS/16-84--------------------------------------------------------------------------------
U4L209_PYROM/8-85--------------------------------------------------------------------------------
S2JD38_MUCC1/10-90--------------------------------------------------------------------------------
G8ZRF3_TORDC/7-88--------------------------------------------------------------------------------
R4G9G6_ANOCA/14-83--------------------------------------------------------------------------------
G8JU54_ERECY/11-91--------------------------------------------------------------------------------
G8BUI6_TETPH/12-107--------------------------------------------------------------------------------
CENPX_MOUSE/9-78--------------------------------------------------------------------------------
G3VAX2_SARHA/10-79--------------------------------------------------------------------------------
A2QA97_ASPNC/140-216--------------------------------------------------------------------------------
C5FBD6_ARTOC/119-203--------------------------------------------------------------------------------
F4IBV2_ARATH/19-86--------------------------------------------------------------------------------
J7R3U2_KAZNA/11-81--------------------------------------------------------------------------------
S3C6N7_OPHP1/96-166--------------------------------------------------------------------------------
I2H406_TETBL/18-116--------------------------------------------------------------------------------
Q75CS7_ASHGO/15-95--------------------------------------------------------------------------------
G3AIK0_SPAPN/11-75--------------------------------------------------------------------------------
B5YLU9_THAPS/32-130--------------------------------------------------------------------------------
Q5ACP8_CANAL/20-84--------------------------------------------------------------------------------
M3AN04_PSEFD/55-133--------------------------------------------------------------------------------
MHF2_SCHPO/11-88--------------------------------------------------------------------------------
C5GM46_AJEDR/141-227--------------------------------------------------------------------------------
H2APT8_KAZAF/5-78--------------------------------------------------------------------------------
Q0V0M7_PHANO/101-176--------------------------------------------------------------------------------
K1WR03_MARBU/195-277--------------------------------------------------------------------------------
W1QJI5_OGAPD/10-100--------------------------------------------------------------------------------
G4MKQ9_MAGO7/208-274--------------------------------------------------------------------------------
H6C4D9_EXODN/199-279--------------------------------------------------------------------------------
H9J3A8_BOMMO/594-658--------------------------------------------------------------------------------
Q20071_CAEEL/7-77--------------------------------------------------------------------------------
Q6FQU7_CANGA/72-149--------------------------------------------------------------------------------
E9GIB9_DAPPU/22-88--------------------------------------------------------------------------------
G2XBK4_VERDV/82-147--------------------------------------------------------------------------------
E4V2E6_ARTGP/125-209--------------------------------------------------------------------------------
G6CZ62_DANPL/23-97--------------------------------------------------------------------------------
M2MLI9_BAUCO/155-233--------------------------------------------------------------------------------
E9D3R3_COCPS/119-204--------------------------------------------------------------------------------
K0KS96_WICCF/11-97--------------------------------------------------------------------------------
G0W3G5_NAUDC/38-122--------------------------------------------------------------------------------
F0X7C4_GROCL/120-187--------------------------------------------------------------------------------
B6QBK2_TALMQ/143-222--------------------------------------------------------------------------------
G1TJ11_RABIT/10-79--------------------------------------------------------------------------------
M3XKW5_LATCH/12-81--------------------------------------------------------------------------------
A0A0D2X498_CAPO3/11-80--------------------------------------------------------------------------------
MHF2_YEAST/4-80--------------------------------------------------------------------------------
B2B1H7_PODAN/183-249--------------------------------------------------------------------------------
U7PLY7_SPOS1/145-215--------------------------------------------------------------------------------
CENPX_CHICK/10-79--------------------------------------------------------------------------------
C5DYA6_ZYGRC/44-121--------------------------------------------------------------------------------
B6K2J4_SCHJY/11-87--------------------------------------------------------------------------------
U1FW45_ENDPU/107-189--------------------------------------------------------------------------------
T0KKN5_COLGC/82-148--------------------------------------------------------------------------------
R1G6G1_BOTPV/122-198--------------------------------------------------------------------------------
N1PUX0_DOTSN/38-117--------------------------------------------------------------------------------
Q5BES3_EMENI/391-467--------------------------------------------------------------------------------
C0NEG5_AJECG/148-230--------------------------------------------------------------------------------
C4R695_PICPG/8-103--------------------------------------------------------------------------------
H2ZDL5_CIOSA/5-77--------------------------------------------------------------------------------
F4RQY9_MELLP/27-105--------------------------------------------------------------------------------
J8Q3Z8_SACAR/4-80--------------------------------------------------------------------------------
L8FPN4_PSED2/71-142--------------------------------------------------------------------------------
B6GVY1_PENRW/139-217--------------------------------------------------------------------------------
G2RGB0_THITE/132-198--------------------------------------------------------------------------------
B2WK03_PYRTR/118-193--------------------------------------------------------------------------------
R7YKC5_CONA1/128-205--------------------------------------------------------------------------------
C5E218_LACTC/7-86--------------------------------------------------------------------------------
G2XS27_BOTF4/167-238--------------------------------------------------------------------------------
G3J304_CORMM/69-135--------------------------------------------------------------------------------
A7TL11_VANPO/9-87--------------------------------------------------------------------------------
Q6BJ85_DEBHA/17-82--------------------------------------------------------------------------------
B7Q7G6_IXOSC/43-109--------------------------------------------------------------------------------
A2DLP6_TRIVA/13-80--------------------------------------------------------------------------------
I1G6Y8_AMPQE/9-78--------------------------------------------------------------------------------
CENPX_BOVIN/10-79--------------------------------------------------------------------------------
M7PB04_PNEMU/14-89--------------------------------------------------------------------------------
Q7SC05_NEUCR/138-213--------------------------------------------------------------------------------
M3CP67_SPHMS/5-99--------------------------------------------------------------------------------
Q6CSZ2_KLULA/7-78--------------------------------------------------------------------------------
G3PAR2_GASAC/9-78--------------------------------------------------------------------------------
M1W1I7_CLAP2/71-137--------------------------------------------------------------------------------
A7E683_SCLS1/185-253--------------------------------------------------------------------------------
S3E4I6_GLAL2/122-193--------------------------------------------------------------------------------
E7F1X6_DANRE/12-81--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF15510

F1S2W8_PIG/1-88--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------
CENPW_MOUSE/1-86--------------------------------------------------------------------------------

PF05236

C5DTC1_ZYGRC/143-382...................GRRSETSVALKSIAMNQKKEEERRVK....KRVA..............LGLEKEDL.....
M7NV88_PNEMU/67-333...................KIIDNVGKILEDINIKEKDKEEKRRAQVLSKKL............EEENRMDKQTL.....
D6WBP3_TRICA/521-763....................VTNDVKGQLKFLEEVDRAERKRHEE...................LEREMLLRAAK.....
K4A5I4_SETIT/609-902...................PLSSDVRSHIMRVNREAKEQWEKKQA...................EDAERIRKQNDYMQG.
T1I5P6_RHOPR/767-1015....................ITQDVRSQLKCLEEIDKAERKRHEE...................QERELLLRAAK.....
M0SNT6_MUSAM/533-830....................ITSDVRHQILLMNQKAKEEWDKKQA...................EECDKLRKVNE...M.
G3P6F4_GASAC/373-619....................PSSNVRAQLKFFEQLDQLEKQRKEE...................QEREILLKAAK.....
I3JJV8_ORENI/483-731....................QVGDVRSQLRFLEAIETLEKKKRDE...................EERERVLRFAR.....
U3I7K9_ANAPL/493-741....................VSSDTRAQLRFLEKLDHLEKQRKDE...................EEREMLLRAAK.....
D7KBU1_ARALL/454-706....................ITSDIRKEINEMNQKVKEEWEKKRA...................................
J5S578_SACK1/142-381...................GRRSEVSMALRAIALIQKKEEERRVK....KRIA..............LGLEKEDY.....
TAF4_CANAL/87-358...................VPRSEISKELRSLALKQKEMEEKRVN....KRVM..............LGLEKSTK.....
G8YJH0_PICSO/203-470...................TQRSELSRELRNIALKQKELEEKRVA....KRVA..............LGIEKDPS.....
TAF4_SCHPO/81-360...................KQVDNVRQTLANFAYKEYESEERRRTVLNIRRA............EHEARLAELNS.....
I3KPC9_ORENI/575-820....................QTSDVRSQLRFFEQLERLEKQRKDE...................QEREMLLKAAK.....
TAF4_PICGU/190-450...................IPRSEVSKELRNLALKQKELEEQRVS....RRIL..............LGLENKDA.....
M0SKQ5_MUSAM/574-867....................ITSDVRRQILLANQKTKEEWDKKQA...................EESEKLRKVNE...M.
G3NEU9_GASAC/420-666....................KVSDVRSQLRFLEEVESLKKKRRDE...................EEREHMLRLAR.....
E0VZS5_PEDHC/676-918....................VVQDVKGQLKFLEELDRVERKRHEE...................QERELLLRAAK.....
B7Q4N4_IXOSC/208-450....................VTQDVKAQLKFLEELDRLEKKRHEE...................QEREILLRAAK.....
B9R722_RICCO/615-914....................ITSDVRQQIMTMNQKAREEWERKQA....................EAEKLRKVNE...P.
G6DIJ0_DANPL/686-929....................VTQDVKGQLKFLEELDRVDKKRRED...................SEREMLLRAAK.....
F7EHC8_XENTR/534-780....................KYSDVRAQLKFLEQLEHLEKQRRNE...................EEREMLLRAAK.....
H2RT50_TAKRU/514-763....................QVSDVRAQLKFFEQLDQLERQRKEE...................QEREILLKAAK.....
W5M1R8_LEPOC/787-1038....................QATDVRSQLKFFEQLERIEKQRKDE...................EEREILLKAAK.....
T1FTH5_HELRO/544-819....................LKSEVKRQMKFRQEIARLEGERVRE...................IESQAIMKAAK.....
A0A0D2WR67_CAPO3/190-452....................TTSEPKRLLTLLQRVDAAREAARQE...................HEREAILRAFK.....
W1NU21_AMBTC/662-960....................TTSDVRRQILSMNRRAKEDWEKKQA...................EEAEKLRKLNE...T.
B9GNQ9_POPTR/71-368....................ITSDVRQQIMTMNRKAREEWEKRQA....................EAEKLQKVND...P.
E7FFQ2_DANRE/723-973....................QTSDVRTQLKFFEQLEKIEKQRKDD...................EERELLMKAAK.....
H2L3K0_ORYLA/605-850....................QTSDVRAQLRFFEQLERIEKQRKDE...................QEREMLLKAAK.....
K7KI24_SOYBN/610-904....................VTSDVRQQILTMNRKAREEWEKKQA....................ETEKLRKLND...V.
G3B181_CANTC/150-404...................SGKSDMYSELRGLAKKHRELEEQRVE....RRIA..............LGLEKSDD.....
C5XNJ0_SORBI/244-537....................ITSDVGRQILQMNQKAKEEWDKKQA...................EEADKNKKQTE...A.
I1PCN0_ORYGL/485-769...................PLSSDVRSHILRVNREAREQWDKKLA...................EDAERIRKQSD...G.
F1MMS1_BOVIN/382-630....................QASDVRAQLKFFEQLDQIEKQRKDE...................QEREILMRAAK.....
G1PVA9_MYOLU/499-743....................LSSDTRSQLKFLEKLDQLEKQRKDL...................EEREILLKAAK.....
S8C696_DACHA/73-449...................SLVSETAKSLRQIATDERLIEEARIA....ARMARINGTKPGTPAADGAGGDSTNP.....
H9J304_BOMMO/664-908....................VTQDVKGQLKFLEELDRVDKKRRED...................SEREMLLRAAK.....
H2Z376_CIOSA/119-363....................ACSDVKLQLKFLQELDQIEKKKHDE...................AERDILMRVIK.....
F6GZN3_VITVI/617-915....................ITSDIRQQILIMNHKAREEWEKKQA....................EAEKLRKLNE...P.
G8BJL6_CANPC/98-365...................SQRSAVSRELRNIAVKQKELEEKRVS....KRIA..............LGLEKSAN.....
K1RCI1_CRAGI/298-543....................ASTDAKSQLKFLEELDKMEKKRHDD...................QEWEKIMKAAK.....
I2GXP5_TETBL/134-374...................GRRSDVAIALKGMAQLQKKEEERRVK....KRIA..............LGLEKEDY.....
B9S3E1_RICCO/582-871....................ISSDVRQQIMTMNRKAKEEWDKKQA....................ESEMLQKVNE.....
H0UW54_CAVPO/615-857....................LSSDTKSQLKFLEKLDQLEKQRKDL...................EEREMLLKAAR.....
TAF4B_ARATH/537-850....................ITSDIRLQINEMNQKVKEEWEKKQA....................EAEKLKKPSE...SE
J3LQ37_ORYBR/535-819...................PLSSDVRSHILRVNREAREQWEKKLA...................EDAERIRKQND...G.
I3KWV8_ORENI/407-653....................QSSDVRTQLKFFEQLDQLEKQRKEE...................QEREILLKAAK.....
M4EMP1_BRARP/541-789....................ITSDIRKQINEMNQKEKDEQEKKHG...................................
A4V201_DROME/605-848....................PAKDVRGQIKFLEELDKAEQKRHEE...................LEREMLLRAAK.....
H2M8N2_ORYLA/617-857....................QVSDVRGQLKFFEQLDQLEKQRKEE...................QEREILLKAAK.....
G0VIS5_NAUCC/90-331...................GRRSEISMILRNIALKEKKDEEKRVK....KRIA..............LGLEKEDL.....
W5GVI9_WHEAT/53-337....................ITSDVGRQILQMNQKAKEEWDKKQA....................ETDKNKKQTE...D.
G3PQM9_GASAC/391-639....................QASDVRTQLRFFEQLDKAAKVRILA...................QRHNVLLISRQ.....
C4Y8U4_CLAL4/268-540...................SQRSEVSKELRNLALRQKEQEERRVA....KRLA..............LGLEKSDD.....
W5K1S8_ASTMX/771-1019....................QTSDVRTQLKFFEQLERLEKQRKDD...................EEREILLKVAK.....
V8PJL5_OPHHA/553-793....................LSNDTRSQLQFLEQLDQVEKRRKDE...................EEKEQLLRAAK.....
L0PEJ0_PNEJ8/49-310...................KIIDNVGKILEEINNKEKDMEEKRRAQLLSKRL............EEKNKIDKQSS.....
K7M5P3_SOYBN/628-925....................VTSDVRQQIMTINRKVREEWDKKQA....................EAEKIRKLND...V.
TAF4_VANPO/177-416...................GRRSEVAIALKSIAIQQKKDEERRVK....KRIA..............LGLEKEDT.....
U4LUM8_PYROM/80-504TLGGPSATLGAGAPEQPTATLQNATARALRQLKQTEYERDQARQR....KRAKREASLLASGGAPSTPGTPSAPG....A
A9T9V3_PHYPA/958-1273....................VTSDPRRQVLLMKKRAKEAMEKKLA...................DENERLRKLNE.....
TAF4_LODEL/264-545...................QQRSAVSKELRNLALRQKEMEEKRVQ....KRIV..............LGLEKSSG.....
I1P2Q6_ORYGL/422-717....................ITSDVGRQILRMNQKAKEEWDKKQA...................EETDKNKKQNE...V.
A3LYF3_PICST/20-289...................APRSELSKELRNLAVRQKELEERRIS....KRIM..............LGLEKNGA.....
H2TWF2_TAKRU/390-638....................QGSDVRAQLKFFEQLDQLEKQRKEE...................QEREILLKAAK.....
I1GQP3_BRADI/540-832...................PLSSDVRSHILRVNREAREQWERKLA...................EDADRIRKQSD...G.
B6JWG5_SCHJY/81-363...................KQIDNVRQTLASIAHKEYESEERRRAVLNIRRA............EHEARLAEMNA.....
J7RYU5_KAZNA/69-318...................GRRSEVSIALKSIALTQRKEEEKRLK....KRIA..............LGLEKEDV.....
G1KA85_ANOCA/600-840....................VSNDTRAQLTFLEQLDQVEKQRKDE...................EERERLLRAAK.....
W5MGZ3_LEPOC/596-844....................QQSDTRSQLKFLGQLDRLEKQKRDE...................EEREVLLRAAR.....
C5M753_CANTT/145-418...................VPRSEISKELRNLAIKQKELEEKRVS....KRVM..............LGLEKSPN.....
H3D4Z0_TETNG/401-649....................QVCDVRAQLRFFEQLDRLKAAKVTK...................SSRRRPLPAGQ.....
T1K318_TETUR/429-680....................VTQDVRAQTKFLEELDRLEKKRHEE...................QEREMLMRAAK.....
W4XKE1_STRPU/729-985....................PINDVRSQLKFFEQLDALERKRRDE...................QEREILLRAAK.....
G1XJL7_ARTOA/79-445...................SLLSETAKSIRALAMDERMIEEARAA....ARLTRLNGTKTGTPAADGGTGETTNP.....
K4BUP2_SOLLC/622-920....................VTSDVREEIMSINRKAREEWERKQA....................DVEKLQKANE...P.
TAF4_DEBHA/241-517...................ASRSELSKELRNLAAKQKEMEERRVS....KRMA..............LGLEKDGT.....
Q177Z6_AEDAE/263-506....................VTKDVRGQIKFLEELDKAEQKRHEE...................QEREMLMRAAK.....
TAF4_ARATH/463-712....................ITSDIRKEINEMNQKVKEEWEKKHS...................................

PF09123

E6X1K6_NITSE/9-146--------------------------------------------------------------------------------
F4CZA8_PSEUX/10-146--------------------------------------------------------------------------------
L0J5M6_MYCSM/10-146--------------------------------------------------------------------------------
Q0S1W3_RHOJR/9-146--------------------------------------------------------------------------------
B9L7D5_NAUPA/10-146--------------------------------------------------------------------------------
Q8U348_PYRFU/11-150--------------------------------------------------------------------------------
Q826G1_STRAW/61-198--------------------------------------------------------------------------------
D0MI80_RHOM4/10-147--------------------------------------------------------------------------------
Q0RZB3_RHOJR/9-146--------------------------------------------------------------------------------
E3J762_FRASU/9-146--------------------------------------------------------------------------------
Q0RMJ7_FRAAA/4-141--------------------------------------------------------------------------------
C0QQA2_PERMH/9-146--------------------------------------------------------------------------------
Q0SK49_RHOJR/18-157--------------------------------------------------------------------------------
B2IWP7_NOSP7/9-146--------------------------------------------------------------------------------
Q1AY81_RUBXD/9-146--------------------------------------------------------------------------------
Y328_AQUAE/32-168--------------------------------------------------------------------------------
D2RF04_ARCPA/11-150--------------------------------------------------------------------------------
C8XFC4_NAKMY/8-143--------------------------------------------------------------------------------
Y616_AQUAE/19-164--------------------------------------------------------------------------------
A6Q0X2_NITSB/9-145--------------------------------------------------------------------------------
E4U5U8_OCEP5/8-145--------------------------------------------------------------------------------
Y1509_METJA/11-150--------------------------------------------------------------------------------
W5WDS1_9PSEU/9-147--------------------------------------------------------------------------------
Q5SI95_THET8/8-145--------------------------------------------------------------------------------
C5CB24_MICLC/10-147--------------------------------------------------------------------------------
G2NZ66_STRVO/9-146--------------------------------------------------------------------------------
H3ZJQ7_THELN/11-150--------------------------------------------------------------------------------

PF02291

M7WDK4_RHOT1/10-135--------------------------------------------------------------------------------
G2X9P3_VERDV/76-227--------------------------------------------------------------------------------
F4QEA6_DICFS/134-255--------------------------------------------------------------------------------
A5DHC0_PICGU/7-133--------------------------------------------------------------------------------
E4XZ10_OIKDI/7-128--------------------------------------------------------------------------------
U9T6J2_RHIID/13-134--------------------------------------------------------------------------------
E0VC09_PEDHC/9-130--------------------------------------------------------------------------------
E3JXG9_PUCGT/27-152--------------------------------------------------------------------------------
J9K8F0_ACYPI/7-128--------------------------------------------------------------------------------
K0KLS6_WICCF/12-133--------------------------------------------------------------------------------
TAF9_ENCCU/5-126--------------------------------------------------------------------------------
R7YZF5_CONA1/62-198--------------------------------------------------------------------------------
F9X6Q8_ZYMTI/40-177--------------------------------------------------------------------------------
A7RR68_NEMVE/23-144--------------------------------------------------------------------------------
T1J4R5_STRMM/4-125--------------------------------------------------------------------------------
H2WNP3_CAEJA/16-136--------------------------------------------------------------------------------
G3BAU9_CANTC/20-152--------------------------------------------------------------------------------
K5XAX2_AGABU/11-134--------------------------------------------------------------------------------
Q0U291_PHANO/54-190--------------------------------------------------------------------------------
J9KWC1_ACYPI/6-127--------------------------------------------------------------------------------
D5GLV0_TUBMM/51-182--------------------------------------------------------------------------------
O45784_CAEEL/16-136--------------------------------------------------------------------------------
D6RGK3_HUMAN/9-130--------------------------------------------------------------------------------
M2LVQ3_BAUCO/53-191--------------------------------------------------------------------------------
A0A068YBD1_ECHMU/4-129--------------------------------------------------------------------------------
H3HBI0_PHYRM/27-144--------------------------------------------------------------------------------
A8JFR8_CHLRE/13-135--------------------------------------------------------------------------------
G4VC88_SCHMA/11-131--------------------------------------------------------------------------------
W5JA98_ANODA/20-141--------------------------------------------------------------------------------
B6JY17_SCHJY/8-131--------------------------------------------------------------------------------
T5AQB6_OPHSC/37-184--------------------------------------------------------------------------------
S3DWR3_GLAL2/53-199--------------------------------------------------------------------------------
F0XDG5_GROCL/91-244--------------------------------------------------------------------------------
M9M9Y9_PSEA3/14-139--------------------------------------------------------------------------------
X6M053_RETFI/52-182--------------------------------------------------------------------------------
F6QLU5_CIOIN/11-132--------------------------------------------------------------------------------
S8AFN1_DACHA/32-161--------------------------------------------------------------------------------
F2U4U6_SALR5/62-197--------------------------------------------------------------------------------
T1KVK8_TETUR/5-124--------------------------------------------------------------------------------
M2Z663_PSEFD/12-149--------------------------------------------------------------------------------
R4XCN9_TAPDE/5-126--------------------------------------------------------------------------------
I1C775_RHIO9/8-129--------------------------------------------------------------------------------
B8M2Z2_TALSN/57-194--------------------------------------------------------------------------------
G8YQE8_PICSO/25-155--------------------------------------------------------------------------------
B4I6J9_DROSE/15-136--------------------------------------------------------------------------------
T1KVL0_TETUR/5-124--------------------------------------------------------------------------------
B9GKT8_POPTR/5-126--------------------------------------------------------------------------------
B2AYL6_PODAN/47-193--------------------------------------------------------------------------------
G6DDM8_DANPL/13-134--------------------------------------------------------------------------------
G4MYK2_MAGO7/63-209--------------------------------------------------------------------------------
W1QJI0_OGAPD/7-140--------------------------------------------------------------------------------
F8PNX7_SERL3/10-135--------------------------------------------------------------------------------
L8G882_PSED2/42-184--------------------------------------------------------------------------------
C4QZS5_PICPG/5-140--------------------------------------------------------------------------------
A5E2M9_LODEL/42-174--------------------------------------------------------------------------------
C3YVK1_BRAFL/4-125--------------------------------------------------------------------------------
B3RUC6_TRIAD/1-120--------------------------------------------------------------------------------
T1F9J6_HELRO/4-125--------------------------------------------------------------------------------
X1WZN5_ACYPI/6-127--------------------------------------------------------------------------------
TAF9_SCHPO/10-133--------------------------------------------------------------------------------
A0A0D2U2T2_CAPO3/6-128--------------------------------------------------------------------------------
E7KGY2_YEASA/26-152--------------------------------------------------------------------------------
F0ZC88_DICPU/5-126--------------------------------------------------------------------------------
N1JGY7_BLUG1/48-193--------------------------------------------------------------------------------
V5FLB7_BYSSN/57-217--------------------------------------------------------------------------------
M5E687_MALS4/16-141--------------------------------------------------------------------------------
E9E8P1_METAQ/45-192--------------------------------------------------------------------------------
D8R9T7_SELML/1-121--------------------------------------------------------------------------------
B8N413_ASPFN/62-215--------------------------------------------------------------------------------
J4UWI4_BEAB2/51-198--------------------------------------------------------------------------------
D7EL47_TRICA/12-135--------------------------------------------------------------------------------
B6TMH7_MAIZE/21-145--------------------------------------------------------------------------------
T1GRU2_MEGSC/18-139--------------------------------------------------------------------------------
G4TF77_PIRID/740-863--------------------------------------------------------------------------------
T1HLJ8_RHOPR/5-126--------------------------------------------------------------------------------
S7W8Z3_SPRLO/3-124--------------------------------------------------------------------------------
H1VNB3_COLHI/89-239--------------------------------------------------------------------------------
G0VC63_NAUCC/9-147--------------------------------------------------------------------------------
B7QAZ8_IXOSC/4-125--------------------------------------------------------------------------------
A1CP04_ASPCL/76-234--------------------------------------------------------------------------------
H6BPD0_EXODN/52-203--------------------------------------------------------------------------------
L2GPL4_VITCO/4-123--------------------------------------------------------------------------------
J9DF67_EDHAE/5-126--------------------------------------------------------------------------------
R8BG98_TOGMI/62-215--------------------------------------------------------------------------------
E9GIC2_DAPPU/2-123--------------------------------------------------------------------------------
C4Y633_CLAL4/18-146--------------------------------------------------------------------------------
A9U4J1_PHYPA/4-124--------------------------------------------------------------------------------
H8Z9U3_NEMS1/5-126--------------------------------------------------------------------------------
U5HA82_USTV1/43-172--------------------------------------------------------------------------------
Q6CIP5_KLULA/8-131--------------------------------------------------------------------------------
D8TZ69_VOLCA/12-134--------------------------------------------------------------------------------
G2R3D3_THITE/87-230--------------------------------------------------------------------------------
M2SP85_COCH5/66-203--------------------------------------------------------------------------------
K7IPE7_NASVI/11-132--------------------------------------------------------------------------------
K1VDX8_TRIAC/5-130--------------------------------------------------------------------------------
B7XHH0_ENTBH/5-125--------------------------------------------------------------------------------
D2V9Z9_NAEGR/1-120--------------------------------------------------------------------------------
M7NV69_PNEMU/9-133--------------------------------------------------------------------------------
I4Y606_WALMC/4-128--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------
B4IIW5_DROSE/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/52-123--------------------------------------------------------------------------------
TAF8_ARATH/24-100--------------------------------------------------------------------------------

PF17027

R0KLX4_NOSB1/8-119--------------------------------------------------------------------------------
R0KSL2_NOSB1/8-119--------------------------------------------------------------------------------
Y551_ENCCU/8-126--------------------------------------------------------------------------------
C4V862_NOSCE/8-123--------------------------------------------------------------------------------
B7XJZ3_ENTBH/37-159--------------------------------------------------------------------------------
H8ZFK0_NEMS1/19-158--------------------------------------------------------------------------------
I3EGR5_NEMP3/9-149--------------------------------------------------------------------------------
S7XQD0_SPRLO/8-121--------------------------------------------------------------------------------

PF15511

F1S2K5_PIG/453-556--------------------------------------------------------------------------------
Q0V6N5_PHANO/384-501--------------------------------------------------------------------------------
G5EH18_MAGO7/443-551--------------------------------------------------------------------------------
B8MMW5_TALSN/360-468--------------------------------------------------------------------------------
Q4WWL8_ASPFU/372-480--------------------------------------------------------------------------------
Q2H4H2_CHAGB/380-487--------------------------------------------------------------------------------
H6BTF1_EXODN/377-486--------------------------------------------------------------------------------
F7C6J3_ORNAN/443-546--------------------------------------------------------------------------------
B6K2P7_SCHJY/365-468--------------------------------------------------------------------------------
F0XUM0_GROCL/440-548--------------------------------------------------------------------------------
CENPT_RAT/407-510--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_TALMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
A0A0D2UKN4_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_ZYMTI/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------
J3KG50_COCIM/15-89--------------------------------------------------------------------------------

PF00125

H2AV3_ORYSJ/1-106--------------------------------------------------------------------------------
H2BV_BOVIN/1-99--------------------------------------------------------------------------------
Q8LK76_MAIZE/18-152--------------------------------------------------------------------------------
H32_HUMAN/1-132--------------------------------------------------------------------------------
A8B678_GIAIC/10-148--------------------------------------------------------------------------------
Q8IL74_PLAF7/1-103--------------------------------------------------------------------------------
A8BYH2_GIAIC/11-146--------------------------------------------------------------------------------
A8B471_GIAIC/44-178--------------------------------------------------------------------------------
H2BWT_HUMAN/23-145--------------------------------------------------------------------------------
Q23429_CAEEL/1-104--------------------------------------------------------------------------------
H2B2_ARATH/87-215--------------------------------------------------------------------------------
Q7XV46_ORYSJ/162-290--------------------------------------------------------------------------------
H3L_ENCCU/1-130--------------------------------------------------------------------------------
CENPA_DANRE/7-140--------------------------------------------------------------------------------
HAP5_YEAST/94-225--------------------------------------------------------------------------------
Q19649_CAEEL/1-114--------------------------------------------------------------------------------
H31_ENCCU/1-135--------------------------------------------------------------------------------
CENPA_CANGA/101-236--------------------------------------------------------------------------------
Q7PVU9_ANOGA/47-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/1-103--------------------------------------------------------------------------------
H2A8_ARATH/1-97--------------------------------------------------------------------------------
CENPA_SCHPO/1-118--------------------------------------------------------------------------------
CENPA_MOUSE/1-127--------------------------------------------------------------------------------
HCP3L_CAEEL/122-257--------------------------------------------------------------------------------
H2BV_MOUSE/1-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/72-200--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/32-167--------------------------------------------------------------------------------
A4H675_LEIBR/1-126--------------------------------------------------------------------------------
A8BI78_GIAIC/1-100--------------------------------------------------------------------------------
Q387X7_TRYB2/34-135--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------
B4I7U0_DROSE/10-74--------------------------------------------------------------------------------
E3GWR6_METFV/1-64--------------------------------------------------------------------------------
F1SVE7_METKA/4-65--------------------------------------------------------------------------------
G7YA03_CLOSI/51-116--------------------------------------------------------------------------------
HARB_PYRFU/3-65--------------------------------------------------------------------------------
Q2UK39_ASPOR/46-111--------------------------------------------------------------------------------
U6EAE9_9EURY/2-65--------------------------------------------------------------------------------
W5LMM0_ASTMX/39-103--------------------------------------------------------------------------------

PF02969

TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
TAF6_ARATH/1-68--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------
A4IHX4_XENTR/9-74--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
TAF12_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
TA12B_ARATH/529-596--------------------------------------------------------------------------------

PF04719

G8BSR2_TETPH/139-219--------------------------------------------------------------------------------
J8Q476_SACAR/129-209--------------------------------------------------------------------------------
E3LZD0_CAERE/217-303--------------------------------------------------------------------------------
I1G7M7_AMPQE/71-156--------------------------------------------------------------------------------
L8Y753_TUPCH/78-161--------------------------------------------------------------------------------
A9CRT7_ENTBH/59-144--------------------------------------------------------------------------------
TAF11_SCHPO/95-179--------------------------------------------------------------------------------
U1MIS9_ASCSU/191-271--------------------------------------------------------------------------------
H2PF83_PONAB/98-183--------------------------------------------------------------------------------
U5DIY7_AMBTC/83-168--------------------------------------------------------------------------------
A7SYY0_NEMVE/3-89--------------------------------------------------------------------------------
F4QDB0_DICFS/307-393--------------------------------------------------------------------------------
F2UQ02_SALR5/216-306--------------------------------------------------------------------------------
X6MJW9_RETFI/615-701--------------------------------------------------------------------------------
M7SAZ2_EUTLA/196-303--------------------------------------------------------------------------------
U4LM69_PYROM/116-201--------------------------------------------------------------------------------
A0A0D2WMQ7_CAPO3/375-460--------------------------------------------------------------------------------
T1EEK4_HELRO/30-115--------------------------------------------------------------------------------
C4VAX6_NOSCE/48-132--------------------------------------------------------------------------------
E4XD21_OIKDI/168-253--------------------------------------------------------------------------------
L2GN22_VITCO/62-146--------------------------------------------------------------------------------
R0MGZ1_NOSB1/32-117--------------------------------------------------------------------------------
S7W8C8_SPRLO/66-151--------------------------------------------------------------------------------
I2H2Q9_TETBL/217-297--------------------------------------------------------------------------------
E5S4W4_TRISP/310-396--------------------------------------------------------------------------------
Q8SSE1_ENCCU/49-130--------------------------------------------------------------------------------
C7YV21_NECH7/171-283--------------------------------------------------------------------------------
A0A068YK50_ECHMU/153-237--------------------------------------------------------------------------------
A4RSC0_OSTLU/31-116--------------------------------------------------------------------------------
L5KZB3_PTEAL/96-181--------------------------------------------------------------------------------
E9G9V1_DAPPU/3-88--------------------------------------------------------------------------------
R4XFB3_TAPDE/83-168--------------------------------------------------------------------------------
D7KI82_ARALL/38-124--------------------------------------------------------------------------------
U5GY91_USTV1/142-223--------------------------------------------------------------------------------
C1MKX3_MICPC/31-118--------------------------------------------------------------------------------
A8XSJ7_CAEBR/205-291--------------------------------------------------------------------------------
E1ZAD2_CHLVA/141-221--------------------------------------------------------------------------------
S2JU45_MUCC1/162-247--------------------------------------------------------------------------------
E3MIY3_CAERE/191-279--------------------------------------------------------------------------------
F1N372_BOVIN/106-191--------------------------------------------------------------------------------
C4R2G1_PICPG/131-213--------------------------------------------------------------------------------
J9F669_WUCBA/184-270--------------------------------------------------------------------------------
L0P7W8_PNEJ8/44-128--------------------------------------------------------------------------------
G8BAE4_CANPC/112-196--------------------------------------------------------------------------------
U9U4H6_RHIID/1-86--------------------------------------------------------------------------------
C1FD46_MICSR/15-101--------------------------------------------------------------------------------
F4RU01_MELLP/124-208--------------------------------------------------------------------------------
D8U9I9_VOLCA/104-190--------------------------------------------------------------------------------
D0MZ49_PHYIT/4-97--------------------------------------------------------------------------------
D8Q789_SCHCM/34-118--------------------------------------------------------------------------------
G1X2K3_ARTOA/165-253--------------------------------------------------------------------------------
A5E0E2_LODEL/102-187--------------------------------------------------------------------------------
E3KAK5_PUCGT/154-238--------------------------------------------------------------------------------
D3BH07_POLPA/351-436--------------------------------------------------------------------------------
D7MFL1_ARALL/108-194--------------------------------------------------------------------------------
T1K7I1_TETUR/31-116--------------------------------------------------------------------------------
Q21417_CAEEL/223-311--------------------------------------------------------------------------------
G8ZM97_TORDC/124-204--------------------------------------------------------------------------------
G0N3L8_CAEBE/259-348--------------------------------------------------------------------------------
F6RBM6_HORSE/104-189--------------------------------------------------------------------------------
H8Z9C9_NEMS1/29-110--------------------------------------------------------------------------------
G1Q8Z6_MYOLU/112-198--------------------------------------------------------------------------------
D2UZ99_NAEGR/128-213--------------------------------------------------------------------------------
N1JBX9_BLUG1/169-278--------------------------------------------------------------------------------
D5GP56_TUBMM/110-214--------------------------------------------------------------------------------
R9API2_WALI9/115-199--------------------------------------------------------------------------------
K1VFG9_TRIAC/88-179--------------------------------------------------------------------------------
G0MKU9_CAEBE/228-314--------------------------------------------------------------------------------
G0RHL6_HYPJQ/171-281--------------------------------------------------------------------------------
T1JEW6_STRMM/68-153--------------------------------------------------------------------------------
B3RLJ9_TRIAD/97-184--------------------------------------------------------------------------------
A7TJ92_VANPO/131-211--------------------------------------------------------------------------------
F6ZW75_MONDO/112-197--------------------------------------------------------------------------------
G7YQE8_CLOSI/176-260--------------------------------------------------------------------------------
A9TN16_PHYPA/2-85--------------------------------------------------------------------------------
V5ERX6_PSEBG/318-398--------------------------------------------------------------------------------
F0ZHF9_DICPU/3-88--------------------------------------------------------------------------------
Q6C5I4_YARLI/75-169--------------------------------------------------------------------------------
H2AVS4_KAZAF/119-199--------------------------------------------------------------------------------
F4P958_BATDJ/139-226--------------------------------------------------------------------------------
I3LCD0_PIG/5-84--------------------------------------------------------------------------------
C5DW95_ZYGRC/143-223--------------------------------------------------------------------------------
F0YMR8_AURAN/16-102--------------------------------------------------------------------------------
G4T5W0_PIRID/119-203--------------------------------------------------------------------------------
L2GVP8_VAVCU/44-128--------------------------------------------------------------------------------
M7X6R7_RHOT1/147-228--------------------------------------------------------------------------------
M0VAS1_HORVD/23-109--------------------------------------------------------------------------------
H2VS66_CAEJA/143-227--------------------------------------------------------------------------------
G8Y8I3_PICSO/93-173--------------------------------------------------------------------------------
Q20361_CAEEL/127-213--------------------------------------------------------------------------------
Q20563_CAEEL/238-326--------------------------------------------------------------------------------
F7EW92_MACMU/101-184--------------------------------------------------------------------------------
J9D6K1_EDHAE/39-124--------------------------------------------------------------------------------
U1LV83_ASCSU/82-168--------------------------------------------------------------------------------
D8S5E3_SELML/3-84--------------------------------------------------------------------------------
A8WMG0_CAEBR/206-294--------------------------------------------------------------------------------

PF09415

S8AJY0_DACHA/43-119--------------------------------------------------------------------------------
H2Y0F9_CIOIN/14-82--------------------------------------------------------------------------------
F4PWS8_DICFS/16-84--------------------------------------------------------------------------------
U4L209_PYROM/8-85--------------------------------------------------------------------------------
S2JD38_MUCC1/10-90--------------------------------------------------------------------------------
G8ZRF3_TORDC/7-88--------------------------------------------------------------------------------
R4G9G6_ANOCA/14-83--------------------------------------------------------------------------------
G8JU54_ERECY/11-91--------------------------------------------------------------------------------
G8BUI6_TETPH/12-107--------------------------------------------------------------------------------
CENPX_MOUSE/9-78--------------------------------------------------------------------------------
G3VAX2_SARHA/10-79--------------------------------------------------------------------------------
A2QA97_ASPNC/140-216--------------------------------------------------------------------------------
C5FBD6_ARTOC/119-203--------------------------------------------------------------------------------
F4IBV2_ARATH/19-86--------------------------------------------------------------------------------
J7R3U2_KAZNA/11-81--------------------------------------------------------------------------------
S3C6N7_OPHP1/96-166--------------------------------------------------------------------------------
I2H406_TETBL/18-116--------------------------------------------------------------------------------
Q75CS7_ASHGO/15-95--------------------------------------------------------------------------------
G3AIK0_SPAPN/11-75--------------------------------------------------------------------------------
B5YLU9_THAPS/32-130--------------------------------------------------------------------------------
Q5ACP8_CANAL/20-84--------------------------------------------------------------------------------
M3AN04_PSEFD/55-133--------------------------------------------------------------------------------
MHF2_SCHPO/11-88--------------------------------------------------------------------------------
C5GM46_AJEDR/141-227--------------------------------------------------------------------------------
H2APT8_KAZAF/5-78--------------------------------------------------------------------------------
Q0V0M7_PHANO/101-176--------------------------------------------------------------------------------
K1WR03_MARBU/195-277--------------------------------------------------------------------------------
W1QJI5_OGAPD/10-100--------------------------------------------------------------------------------
G4MKQ9_MAGO7/208-274--------------------------------------------------------------------------------
H6C4D9_EXODN/199-279--------------------------------------------------------------------------------
H9J3A8_BOMMO/594-658--------------------------------------------------------------------------------
Q20071_CAEEL/7-77--------------------------------------------------------------------------------
Q6FQU7_CANGA/72-149--------------------------------------------------------------------------------
E9GIB9_DAPPU/22-88--------------------------------------------------------------------------------
G2XBK4_VERDV/82-147--------------------------------------------------------------------------------
E4V2E6_ARTGP/125-209--------------------------------------------------------------------------------
G6CZ62_DANPL/23-97--------------------------------------------------------------------------------
M2MLI9_BAUCO/155-233--------------------------------------------------------------------------------
E9D3R3_COCPS/119-204--------------------------------------------------------------------------------
K0KS96_WICCF/11-97--------------------------------------------------------------------------------
G0W3G5_NAUDC/38-122--------------------------------------------------------------------------------
F0X7C4_GROCL/120-187--------------------------------------------------------------------------------
B6QBK2_TALMQ/143-222--------------------------------------------------------------------------------
G1TJ11_RABIT/10-79--------------------------------------------------------------------------------
M3XKW5_LATCH/12-81--------------------------------------------------------------------------------
A0A0D2X498_CAPO3/11-80--------------------------------------------------------------------------------
MHF2_YEAST/4-80--------------------------------------------------------------------------------
B2B1H7_PODAN/183-249--------------------------------------------------------------------------------
U7PLY7_SPOS1/145-215--------------------------------------------------------------------------------
CENPX_CHICK/10-79--------------------------------------------------------------------------------
C5DYA6_ZYGRC/44-121--------------------------------------------------------------------------------
B6K2J4_SCHJY/11-87--------------------------------------------------------------------------------
U1FW45_ENDPU/107-189--------------------------------------------------------------------------------
T0KKN5_COLGC/82-148--------------------------------------------------------------------------------
R1G6G1_BOTPV/122-198--------------------------------------------------------------------------------
N1PUX0_DOTSN/38-117--------------------------------------------------------------------------------
Q5BES3_EMENI/391-467--------------------------------------------------------------------------------
C0NEG5_AJECG/148-230--------------------------------------------------------------------------------
C4R695_PICPG/8-103--------------------------------------------------------------------------------
H2ZDL5_CIOSA/5-77--------------------------------------------------------------------------------
F4RQY9_MELLP/27-105--------------------------------------------------------------------------------
J8Q3Z8_SACAR/4-80--------------------------------------------------------------------------------
L8FPN4_PSED2/71-142--------------------------------------------------------------------------------
B6GVY1_PENRW/139-217--------------------------------------------------------------------------------
G2RGB0_THITE/132-198--------------------------------------------------------------------------------
B2WK03_PYRTR/118-193--------------------------------------------------------------------------------
R7YKC5_CONA1/128-205--------------------------------------------------------------------------------
C5E218_LACTC/7-86--------------------------------------------------------------------------------
G2XS27_BOTF4/167-238--------------------------------------------------------------------------------
G3J304_CORMM/69-135--------------------------------------------------------------------------------
A7TL11_VANPO/9-87--------------------------------------------------------------------------------
Q6BJ85_DEBHA/17-82--------------------------------------------------------------------------------
B7Q7G6_IXOSC/43-109--------------------------------------------------------------------------------
A2DLP6_TRIVA/13-80--------------------------------------------------------------------------------
I1G6Y8_AMPQE/9-78--------------------------------------------------------------------------------
CENPX_BOVIN/10-79--------------------------------------------------------------------------------
M7PB04_PNEMU/14-89--------------------------------------------------------------------------------
Q7SC05_NEUCR/138-213--------------------------------------------------------------------------------
M3CP67_SPHMS/5-99--------------------------------------------------------------------------------
Q6CSZ2_KLULA/7-78--------------------------------------------------------------------------------
G3PAR2_GASAC/9-78--------------------------------------------------------------------------------
M1W1I7_CLAP2/71-137--------------------------------------------------------------------------------
A7E683_SCLS1/185-253--------------------------------------------------------------------------------
S3E4I6_GLAL2/122-193--------------------------------------------------------------------------------
E7F1X6_DANRE/12-81--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF15510

F1S2W8_PIG/1-88--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------
CENPW_MOUSE/1-86--------------------------------------------------------------------------------

PF05236

C5DTC1_ZYGRC/143-382.........ENKMDSEETL.....................HRASNVTAGLRAG...............SK.KQYGW....
M7NV88_PNEMU/67-333LSGNPEDMDKKKKKKEILSNS...SS......KNLSEDAQKRNTDTTAAIMMG.........SGPNGPGG.KKYSW....
D6WBP3_TRICA/521-763SRSKTEDPEQAKLKAK..ARE...MQ......RVEMEELRQREANATALQAIG..............PRK.KPR.L....
K4A5I4_SETIT/609-902DGNANIDLEKDKNETRASSKH...AK.......EDDDKMRTTAANVAARVAAGGDDMLSKWQLLAERNKQ.RSEGG....
T1I5P6_RHOPR/767-1015SRSKPEDPEQAKLKAK..AKE...MQ......RAEMEELRQREANLTALLAIG..............PRK.KPK.L....
M0SNT6_MUSAM/533-830DGSAGVDAEKDKEEGR..SKT...LK....ANKEEDDKMRATAANVAARAAVGGDDMLSKWQLMAEQARQ.KRD.G....
G3P6F4_GASAC/373-619SRARQEDPEQLRLKQK..AKE...MQ......QQELAQMRQREANLTALAAIG..............PRK.KRKIL....
I3JJV8_ORENI/483-731SRSHAEDPEYQQLKQK..AKE...LQ......QIEEAQLQQREANLAALAAIG..............PRR.KRP.L....
U3I7K9_ANAPL/493-741SRSNKEDPEHLRLKQK..AKE...MQ......QLELAQMQQREANLTALAAIG..............PRK.KRP.L....
D7KBU1_ARALL/454-706GEDKNEENETEKEDQR..SKE...PK....ANKKDEDKKRAKAANVAVHAAVGGDDRFSKWKLMAE.AHQ..........
J5S578_SACK1/142-381.........ENKIDSEETL.....................HRASNVTAGLRAG...............SK.KQYGW....
TAF4_CANAL/87-358DASKNDENGESKAGAEETL.....................HRAANATAAMMTM.............NPGR.KKYSW....
G8YJH0_PICSO/203-470.DSSWNESGSGKADAEETL.....................HRAANATAAMMAN..............PGR.KKYSW....
TAF4_SCHPO/81-360..ASTNEEGSSRRRKEQSSSA...AA......KNISEDAQNRMTNATASIMAG...........SALPSGGKKYSWMATD
I3KPC9_ORENI/575-820SRARQEDPEQARLKQK..AKE...MQ......QQELAQMRQRDANLTALAAIG..............PRK.KRK.L....
TAF4_PICGU/190-450......NSESNKVGAEETL.....................HRAANETAAMMTS...............NK.KKYSW....
M0SKQ5_MUSAM/574-867DGNTGVDAEKDKEDGR..PKA...LK....ANKEEDDKMRATAANVAARAAVGGDDMLSKWQLMAEQARQ.KRE.G....
G3NEU9_GASAC/420-666SRSHTEDPHQQQLKQR..AKE...LQ......QMEEAQLQQREANLAALAAIG..............PRK.KRPLE....
E0VZS5_PEDHC/676-918SRSKSEDPEQVKLKAK..AKE...MQ......RAEMEELRQREANLTALQAIG..............PRK.KPR.L....
B7Q4N4_IXOSC/208-450SRSKMEDPEQLKLKQK..AKE...MQ......KAEMEEMRQREANMTALLAIG..............PRK.KLK.T....
B9R722_RICCO/615-914EGDNGVEGDKEKDDGR..VKA...IKGNIPANKEEDDKMRTTAANVAARAAVGGDDHLSKWQLMAEQARQ.KREGG....
G6DIJ0_DANPL/686-929SRSKNEDPEQAKLKAK..AKE...MQ......RAELEELRQREANLTALQAIG..............PRK.KPR......
F7EHC8_XENTR/534-780SRSNREDPEQLRLKQK..AKEDYVVK......QTSLKMYYAANGCLYMTKVVG..............PQK.KRI.L....
H2RT50_TAKRU/514-763SRSRQEDPEQLRLKQK..AKE...MQ......QQELAQIRHREANLTALAAIG..............PRK.KRK.T....
W5M1R8_LEPOC/787-1038SRSRQEDPEQARLKQK..AKE...MQ......QQELAQMRQRDANLTALAAIG..............PRK.KRK.L....
T1FTH5_HELRO/544-819SRTKTDDPDQLKKKEL..AKK...QQ......MQEMEDKRKEQSNITALAAIG..............PRK.QRS.FTILP
A0A0D2WR67_CAPO3/190-452DRKNLDDEQRER......AKR...LQ......ADADIRSQQRRAN.QALAQVL..............PKSNRPSFL....
W1NU21_AMBTC/662-960EGSVGVDG..EKDEAR..AKA...SK....ANKEEDDKMRTNAANVAARAAVGGDDMLSKWQLMAEQARQ.KREGG....
B9GNQ9_POPTR/71-368EGENGGEGDKEKDEG