Sequence alignment for CL0013

PF00768

D2AEU9_SHIF2/32-265AATTASQP.........EIASGSAMIVDLNTNK---VI------------------------------------------
DACD_ECOLI/25-263IPFSPQPP.........EIHAGSWVLMDYTTGQ---IL------------------------------------------
DACA_ECOLI/35-273KTMIPGVP.........QIDAESYILIDYNSGK---VL------------------------------------------
DACX_STRSK/26-273PATAVTKP.........TIAAVGGYAMNNGTGT---TL------------------------------------------
Q54906_STRPY/17-270ASTVSGEE........YSVTAKHAIAVDLESGK---VL------------------------------------------
DACF_BACSU/26-261DGKRTSEL.........AHEAKSAVLIERDTGK---VL------------------------------------------
DACA_HAEIN/27-263MQFGVTPP.........QITAQTYVLMDYNSGA---IL------------------------------------------
DACB_BACSU/21-251NVNTAHAA........IDVSAKSAIIIDGASGR---VL------------------------------------------
DACC_ECOLI/28-266AEQTVEAP.........SVDARAWILMDYASGK---VL------------------------------------------
DACA_GEOSE/27-286TVKAESAP........LDIRADAAILVDAQTGR---IL------------------------------------------
PBP5_PSEAE/19-261TAVSASPPPKAGLPLQQELASGSALVTDQNTGK---VL------------------------------------------
P72518_STRPN/17-269VSTAVAQD........FTIAAKHAIAVEANTGK---IL------------------------------------------

PF13354

D3R279_CLOB3/167-362--------------------------VSD..QK...LS.-----------------------------------------
C5NV57_9BACL/95-285--------------------------FST..GY...RY.-----------------------------------------
A3DEM2_CLOTH/156-348--------------------------LES..GK...EF.-----------------------------------------
C7IRL1_THEET/200-392--------------------------LNT..GQ...TF.-----------------------------------------
D9TSS5_THETC/196-388--------------------------LNS..GE...TF.-----------------------------------------
B0TAI9_HELMI/87-282--------------------------LEN..GN...QF.-----------------------------------------
D1C5R0_SPHTD/31-238--------------------------APG..GE...TF.-----------------------------------------
C0ZJI1_BREBN/25-238--------------------------QGSAKET...RF.-----------------------------------------
D1CF14_THET1/24-242--------------------------LTQ..GR...EL.-----------------------------------------
C7H338_9FIRM/28-242--------------------------DLR..GS...TV.-----------------------------------------
Q1J1L5_DEIGD/60-275--------------------------LAG..RE...LY.-----------------------------------------
Q9RX82_DEIRA/25-240--------------------------FAG..RE...LY.-----------------------------------------
C1CYR0_DEIDV/25-240--------------------------LDG..TE...LY.-----------------------------------------
D7BH62_MEISD/25-238--------------------------LAT..GE...RF.-----------------------------------------
A4FGH3_SACEN/23-225--------------------------LDE..RE...PV.-----------------------------------------
D1C8L0_SPHTD/32-252--------------------------LTT..GE...EL.-----------------------------------------
Q67QZ3_SYMTH/26-238--------------------------LQT..DE...VI.-----------------------------------------
C6B6H3_RHILS/32-251--------------------------LGT..GE...TI.-----------------------------------------
Q7CSB1_AGRT5/27-246--------------------------LLT..GE...EI.-----------------------------------------
C7PH33_CHIPD/45-252--------------------------LKT..GR...YV.-----------------------------------------
C6Y376_PEDHD/48-255--------------------------LKT..GK...QA.-----------------------------------------
C2G3X8_9SPHI/50-256--------------------------LKT..NK...EV.-----------------------------------------
D2QMG0_SPILD/51-257--------------------------LKT..GV...TV.-----------------------------------------
C1ACM4_GEMAT/56-266--------------------------LET..GE...HL.-----------------------------------------
D3Q045_STANL/73-283--------------------------DDD..GS...LIT-----------------------------------------
D3PY77_STANL/72-283--------------------------DKD..GK...LI.-----------------------------------------
B5HHK2_STRPR/25-261--------------------------IDG..PG...EA.-----------------------------------------
C3JVC0_RHOER/42-274--------------------------IDS..GE...EF.-----------------------------------------
D2ARC0_STRRD/23-261--------------------------VDG..DA...ET.-----------------------------------------
Q6WSB4_9PSEU/29-266--------------------------IDG..TR...RI.-----------------------------------------
D5UMR9_TSUPD/34-269--------------------------VGA..DA...EL.-----------------------------------------
C7Q8V4_CATAD/62-288--------------------------IDT..GA...SV.-----------------------------------------
C3JVV9_RHOER/30-276--------------------------LDG..NL...EI.-----------------------------------------
D3Q9I0_STANL/20-254--------------------------IDD..GR...AL.-----------------------------------------
D7AWL0_NOCDD/28-268--------------------------LRT..GE...EL.-----------------------------------------
BLAB_STRCI/29-280--------------------------LYT..GE...EL.-----------------------------------------
Q769D8_9ACTO/28-268--------------------------LHT..GA...EL.-----------------------------------------
C6WEM7_ACTMD/23-263--------------------------LRT..GQ...EI.-----------------------------------------
A7VJM6_9MICO/21-237--------------------------VDS..GE..RVF.-----------------------------------------
Q6AHF8_LEIXX/31-247--------------------------LST..GE...VL.-----------------------------------------
A4AF02_9ACTN/57-273--------------------------INT..GK...TV.-----------------------------------------
A5CUW5_CLAM3/55-271--------------------------LDS..GD...VV.-----------------------------------------
A3THA9_9MICO/30-246--------------------------LGS..GE...VL.-----------------------------------------
C2D5A8_LACBR/26-222--------------------------VNH..EQ...RL.-----------------------------------------
D3L9M4_OENOE/30-223--------------------------SNS..EN...CF.-----------------------------------------
C9ACN0_ENTCA/30-228--------------------------TPT..EC...LV.-----------------------------------------
Q92FA7_LISIN/23-230--------------------------DGE..KV...LF.-----------------------------------------
C4VQE7_9LACO/23-217--------------------------KNN..QT...IF.-----------------------------------------
D0R6B2_LACJF/24-218--------------------------KNG..KS...IF.-----------------------------------------
C2F946_LACPA/27-227--------------------------DTR..HV...LF.-----------------------------------------
C2JUG5_LACRH/27-227--------------------------DER..QV...LF.-----------------------------------------
Q74HJ8_LACJO/23-220--------------------------YGD..QI...MY.-----------------------------------------
Q1IIZ9_KORVE/54-260--------------------------LTD..NR...EF.-----------------------------------------
B9XGI6_9BACT/30-235--------------------------LTS..ND...RF.-----------------------------------------
D1CAH8_SPHTD/29-234--------------------------LTT..GE...RL.-----------------------------------------
C6JN74_FUSVA/22-213--------------------------DSF..GK...KI.-----------------------------------------
D3A9C2_9CLOT/37-244--------------------------LVT..GE...RA.-----------------------------------------
C3WTB7_9FUSO/29-234--------------------------LNK..NN...GF.-----------------------------------------
C0WAD9_9FIRM/29-233--------------------------LTE..KQ...GF.-----------------------------------------
A6TPV9_ALKMQ/24-228--------------------------MSR..NQ..WVI.-----------------------------------------
Q97MK6_CLOAB/29-233--------------------------LKK.PSN...HI.-----------------------------------------
Q2B497_9BACI/33-237--------------------------YGE..RA...IY.-----------------------------------------
D1BLB4_VEIPT/34-242--------------------------FDD..EEEPTLI.-----------------------------------------
C9M6L1_9BACT/27-241--------------------------PAT..GE...QF.-----------------------------------------
D2RJL4_ACIFV/65-269--------------------------LGT..NQ...SL.-----------------------------------------
C4V1H1_9FIRM/88-292--------------------------PQE..NR...QP.-----------------------------------------
C9LUU8_9FIRM/91-296--------------------------PDD..GN...AP.-----------------------------------------
D3LTR8_9FIRM/96-300--------------------------CKA..GA...LP.-----------------------------------------
A9B776_HERA2/21-222--------------------------SCT..GA...IY.-----------------------------------------
C0WDD8_9FIRM/88-297--------------------------LDT..GE...VF.-----------------------------------------
D2RLG2_ACIFV/74-285--------------------------LEN..DD...V..-----------------------------------------
Q8YNM1_NOSS1/217-419--------------------------LDT..GG...YV.-----------------------------------------
B2J7F0_NOSP7/218-420--------------------------LDT..GN...YV.-----------------------------------------
D7DW46_NOSA0/212-414--------------------------LDT..GA...YV.-----------------------------------------
A0ZAJ6_NODSP/233-435--------------------------LET..GG...YV.-----------------------------------------
A0Z083_LYNSP/220-422--------------------------LDT..GG...YV.-----------------------------------------
B0CCE0_ACAM1/37-239--------------------------PST..GE...YL.-----------------------------------------
B8HLP2_CYAP4/158-360--------------------------LDT..GA...YA.-----------------------------------------
B2IVV4_NOSP7/225-427--------------------------LDT..GD...YL.-----------------------------------------
B8HM72_CYAP4/205-407--------------------------MDN..GN...YV.-----------------------------------------
B7KDD6_CYAP7/166-368--------------------------LDN..GA...YI.-----------------------------------------
A8YG35_MICAE/134-336--------------------------LDN..GA...YA.-----------------------------------------
C7QSD1_CYAP0/172-374--------------------------LDN..GA...YV.-----------------------------------------
Q55897_SYNY3/237-440--------------------------VDN..GQ...FA.-----------------------------------------
Q5N617_SYNP6/75-277--------------------------LDT..GN...YV.-----------------------------------------
B4WI30_9SYNE/252-455--------------------------VDT..GE...YV.-----------------------------------------
Q2JKE0_SYNJB/180-382--------------------------VET..GA...FA.-----------------------------------------
C0GGV0_9FIRM/114-323--------------------------FAT..GE...TL.-----------------------------------------
F1T3K7_9ACTN/155-354--------------------------ASN..GN...YC.-----------------------------------------
Q08XP3_STIAD/57-318--------------------------VTS..GE...EY.-----------------------------------------
A4VI25_PSEU5/54-317--------------------------LGE..DA...EL.-----------------------------------------
A4IY62_FRATW/49-258--------------------------RND..WS...NF.-----------------------------------------
C6YW16_9GAMM/49-258--------------------------RND..NS...NF.-----------------------------------------
A7JMA9_FRANO/43-254--------------------------TDD..KT...NI.-----------------------------------------
C6YWK1_9GAMM/44-255--------------------------TDD..KT...NI.-----------------------------------------
B9EC94_MACCJ/44-253--------------------------LTD..KQ...KL.-----------------------------------------
Q9X6W1_ECOLX/63-282--------------------------IED..NF...KL.-----------------------------------------
B6WTZ1_9DELT/61-280--------------------------TED..GL...CA.-----------------------------------------
C3X8Y4_OXAFO/46-265--------------------------ADG..SE...QA.-----------------------------------------
C3X3G5_OXAFO/49-269--------------------------AGG..TE...RA.-----------------------------------------
C8C144_9ZZZZ/49-267--------------------------YKD..DA....F.-----------------------------------------
B3D802_BURM1/59-267--------------------------TST..GA...RI.-----------------------------------------
A6WDM1_KINRD/35-232--------------------------LLT..GR...RL.-----------------------------------------
Q92Y19_RHIME/54-306--------------------------DEA..SP...AI.-----------------------------------------
B0T712_CAUSK/59-310--------------------------LST..GQ...II.-----------------------------------------
D5VFF5_CAUST/60-304--------------------------LGT..RQ...IW.-----------------------------------------
Q2GBE0_NOVAD/96-299--------------------------VSD..GW...VA.-----------------------------------------
C4VSL3_9LACO/99-291--------------------------LNS..TK...VF.-----------------------------------------
D0DKJ8_9LACO/105-290--------------------------LTN..SS...HF.-----------------------------------------
Q5FIM3_LACAC/104-295--------------------------LNN..SN...RF.-----------------------------------------
C9M3W5_LACHE/79-269--------------------------LNN..SS...RY.-----------------------------------------
D6S2M9_9LACO/93-284--------------------------KNS..NN...SA.-----------------------------------------
Q55G30_DICDI/66-270--------------------------FKS..FS...IL.-----------------------------------------
C3BL34_9BACI/43-240--------------------------AER..QN...IV.-----------------------------------------
C2QCU8_BACCE/29-226--------------------------TKN..ER...VI.-----------------------------------------
C2Z8Y6_BACCE/25-222--------------------------TKN..GN...IV.-----------------------------------------
C2PG18_BACCE/23-220--------------------------TKF..ED...II.-----------------------------------------
B0AK42_BACAN/23-220--------------------------TKN..NR...IV.-----------------------------------------
C2VCY9_BACCE/29-226--------------------------TKN..EC...II.-----------------------------------------
Q112T9_TRIEI/199-405--------------------------NLQ..RE...CL.-----------------------------------------
C8WKG4_EGGLE/143-342--------------------------LTT..HE...GV.-----------------------------------------
B1S8A7_9BIFI/117-306--------------------------INT..GR...AI.-----------------------------------------
A7A336_BIFAD/133-323--------------------------ITT..GR...TI.-----------------------------------------
A4E932_9ACTN/111-301--------------------------LSS..GR...GV.-----------------------------------------
A5G729_GEOUR/100-303--------------------------LSD..GP...WF.-----------------------------------------
Q3DFC2_STRAG/213-406--------------------------LNT..QT...VA.-----------------------------------------
C2LQQ9_STRSL/215-408--------------------------LDT..DR...VA.-----------------------------------------
B4U5H8_STREM/213-406--------------------------LNT..QA...SA.-----------------------------------------
C5WDV2_STRDG/213-406--------------------------LDT..QA...SA.-----------------------------------------
A4VS97_STRSY/211-404--------------------------LST..GQ...TA.-----------------------------------------
A3CJX6_STRSV/212-405--------------------------LDT..GK...EA.-----------------------------------------
A8B001_STRGC/211-404--------------------------LNT..GK...TA.-----------------------------------------
D3H625_STRM6/207-400--------------------------LTT..GK...EA.-----------------------------------------
D4FQE8_STROR/207-400--------------------------LST..GK...EA.-----------------------------------------
D2BLR7_LACLK/232-427--------------------------LDD..KS...TA.-----------------------------------------
C1I3T7_9CLOT/61-249--------------------------LNT..DD...EY.-----------------------------------------
C7VVX9_ENTFL/70-261--------------------------LET..GE...QR.-----------------------------------------
Q67RI7_SYMTH/15-208--------------------------LLT..GQ...RW.-----------------------------------------

PF00905

PBPH_BACSU/372-692---------------------AFAVMMDPNNGD---ILS-----------------------------------------
PBPF_BACSU/322-595---------------------GSAVFINNKTGG---VEA-----------------------------------------
SP5D_BACSU/246-557---------------------MIAVAMNPKNGE---ILG-----------------------------------------
PBPB_BACSU/268-577---------------------IMAAVVDPKTGK---VLA-----------------------------------------
Q45297_BACLI/374-591---------------------GGFVLFNSNRKK---YTI-----------------------------------------
PBPA_MYCTU/160-484---------------------GAVVALEPSTGK---ILA-----------------------------------------
PBPA_BACSU/352-641---------------------GGVTLLDTKNGE---VRA-----------------------------------------
Q51504_PSEAI/247-547---------------------GSLVIMDVKTGE---ILA-----------------------------------------
Q9ZHF7_BURPI/25-267---------------------ICTIVADAATGK---AVL-----------------------------------------
PBPI_BACSU/263-574---------------------GGAVLLDIENSS---VLG-----------------------------------------
P71707_MYCTU/310-601---------------------AAVVSIDPHNGA---VRA-----------------------------------------
Q51505_PSEAI/242-539---------------------GSAVLVNPKSGQ---ILA-----------------------------------------
P72405_STRCL/273-546---------------------AAIVAVDPATGN---ILA-----------------------------------------
Q59439_ENTHR/364-671---------------------GSTVATSPKTGE---LLV-----------------------------------------
P73117_SYNY3/281-593---------------------GTVLVMDAQDGA---ILA-----------------------------------------
PBP2_HAEIN/279-618---------------------GAVVVLDPKDSS---VLA-----------------------------------------
P96052_STRTR/367-698---------------------MYAVVMNADTGA---VLA-----------------------------------------
Q9AEF8_9GAMM/23-259---------------------TCFLVQENQT..---..V-----------------------------------------
O54282_STASC/363-580---------------------GSFVLYNEREQA---YSI-----------------------------------------
Q98LR0_RHILO/12-247---------------------QCTLIADAASGK---VLY-----------------------------------------
FTSI_ECOLI/260-555---------------------GSAVLVDVNTGE---VLA-----------------------------------------
PBPX_STRPN/289-609---------------------MTATLVSAKTGE---ILA-----------------------------------------
O07106_ENTFL/295-608---------------------MTAMLMEAKTGE---IVA-----------------------------------------
Q9KHJ3_SHIFL/42-276---------------------GCFLLYDASTNA---EIA-----------------------------------------
PBP2_NEIFL/81-376---------------------GAVVVLDAQTGE---ILA-----------------------------------------
Q55926_SYNY3/76-292---------------------GTIVVLDQRGGA---HQL-----------------------------------------
Q9K4N2_STAHA/361-577---------------------GSFVMYSMKKDK---YYI-----------------------------------------
Q9F0V2_ACIBA/53-270---------------------GVIIIKEGKNLS---TYG-----------------------------------------
O06214_MYCTU/338-656---------------------VSAVVLDAKTGE---VLA-----------------------------------------
PBPC_BACSU/352-666---------------------GAAVALQPKTGE---TLA-----------------------------------------
YQGF_BACSU/352-682---------------------AFVVMMDPRNGE---VLT-----------------------------------------
PBP2_STRR6/343-671---------------------VYAVALNPKTGA---VLS-----------------------------------------
PBP_STAAU/347-660---------------------GSGTAIHPQTGE---LLA-----------------------------------------
Q9AEY7_PSEAI/35-252---------------------GTIVIESLTTRQ---RLV-----------------------------------------
Q9K319_AERHY/24-259---------------------TGCFLYADGNGQ---ALS-----------------------------------------
Q53725_STAAU/268-579---------------------LFAVVMDAKTGE---ILA-----------------------------------------
O26078_HELPY/280-589---------------------ILVGIINPKSGE---ILS-----------------------------------------
Q9EY51_ACIBA/42-258---------------------GTIVVVDERTNG---NST-----------------------------------------
PBP2_ECOLI/271-609---------------------AAVVVTDPRTGG---VLA-----------------------------------------
O33622_STRCH/299-660---------------------GAVVVMEAKTGR---VVA-----------------------------------------
P94124_ACIBA/42-258---------------------GTIVVADERQTD---RVI-----------------------------------------
FTSI_HAEIN/280-572---------------------GTAVLVDVRTGE---VLA-----------------------------------------

PF00144

Y4209_BACPE/17-329--------------------------NVKKTSE---LVD.............................CSGAS.......
Q9XWZ6_CAEEL/290-607--------------------------LNSVIEH---RMR..........................SYDIPSIS.......
Q9U3M7_CAEEL/420-758--------------------------LIKRVEH---FMK..........................DLNIPGLS.......
YBBE_BACSU/52-423--------------------------VDQMIER---DIA...........................AGFPGAV.......
Q9YFA3_AERPE/8-341--------------------------LESFILE---KMS..........................RYRMPSLT.......
AMPH_ECOLI/31-372--------------------------ASDIVDR---YADHIF.....................YGS.GATGMA.......
Q9RKC5_STRCO/36-410--------------------------FARNFTS---LGE..............................RGAA.......
O88012_STRCO/23-405--------------------------LDLHFAR---QVD..........................EGRLPGFL.......
Q53403_PSEFL/18-377--------------------------FAALFDD---PQE..............................RGAG.......
P72041_MYCTU/40-404--------------------------ARHWYRA---GMH..............................PAIQ.......
Q98HG2_RHILO/72-389--------------------------APETVAE---FLI............................RSRTDA.......
Q988B4_RHILO/18-370--------------------------FAECFAQ---GLE..............................HGGG.......
Q97ML5_CLOAB/11-343--------------------------AFDLIKE---GVS..........................KGVFPGAV.......
BLAC_STRAL/53-307--------------------------LAGLERA---SGA.............................RLGVY.......
Q9A2R7_CAUCR/45-374--------------------------IRQILAQ---RVDV.........................DHQSRGMV.......
Q9A3W5_CAUCR/42-393--------------------------AQDVMAA---FPD.............................QPGLG.......
Q9A6I9_CAUCR/103-453--------------------------VDGVVQR---AMTR.........................D.HIAGVT.......
PBP4_NOCLA/8-348--------------------------WQERFDA---LRT..........................EHHVPGAA.......
BLAC_BACSU/53-299--------------------------FVQLEKK---FDA.............................RLGVY.......
Q9A862_CAUCR/42-382--------------------------ARRALAE---LAT.............................VPGLS.......
Q9I1G0_PSEAE/16-386--------------------------VDQVIEA---AFA..........................DQRLVGAV.......
Q9CE05_LACLA/7-308--------------------------FLKIIED---YIE..........................RDVFPGVN.......
AMPC_YEREN/37-388--------------------------VNNTLTP---LLE..........................KQGIPGMA.......
Q97FD2_CLOAB/68-427--------------------------LDNKVKS---TSQANYSQTKAVA......DEKASTLINKDYGSTSVQ.......
Q21569_CAEEL/51-419--------------------------FKKNFEN---GWE.............................IEGSA.......
Q9Y7D1_ASPTE/17-406--------------------------METAFRK---AVK..........................SRQIPGAV.......
BLAC_BACCE/55-300--------------------------FSQLEKK---FDA.............................RLGVY.......
BLC1_ECOLX/37-285--------------------------LAELERQ---SGG.............................RLGVA.......
P74474_SYNY3/27-387--------------------------LDNKVQT---ILD.........................................
BLAC_STAAU/27-275--------------------------LNDLEKK---YNA.............................HIGVY.......
PBPX_BACSU/82-390--------------------------RNQKISN---YLK..........................EIGFSGTA.......
AMPC_LYSLA/32-381--------------------------IQRAVAA---FMQ..........................QYQVPGVA.......
AMPC_ENTCL/32-381--------------------------VANTITP---LMK..........................AQSVPGMA.......
BLAC_CITDI/40-288--------------------------LAALEKQ---SGG.............................RLGVA.......
Q48437_KLEPN/33-381--------------------------VDGIIQP---MLK..........................EYRIPGMA.......
BLAC_STRLA/46-298--------------------------LRALEQE---HSA.............................RLGVY.......
P71778_MYCTU/39-398--------------------------FASMFPG---RRF..............................GGGA.......
Q9ABH2_CAUCR/19-369--------------------------FEQNFAD---GGE..............................LGAR.......
Q9ZDR6_RICPR/33-395--------------------------ITNCIDC---FADI.........................QQRIHEVEKEYLNNR
Q99QC1_ENTAE/36-381--------------------------VDASIQP---LLK..........................EHRIPGMA.......
AMPC_PSYIM/50-399--------------------------VDKQAKQ---LMA..........................QYQIPGMA.......
Q97PZ0_STRPN/6-304--------------------------IIKKIEE---QIE.........................................
BLAC_RHOCA/38-285--------------------------VARIEEQ---LGA.............................RVGLS.......
Q9RK50_STRCO/17-371--------------------------VQGVLDE---LVG..........................TGAERGLQ.......
BLAC_NOCLA/49-295--------------------------FTRLQTQ---YDA.............................RLGLY.......
O05900_MYCTU/63-408--------------------------VDGLVGE---LMQ..........................NTGIPGMA.......
O86739_STRCO/48-382--------------------------LRAAVAG---LPN..........................QYATAALV.......
AMPC_PSEAE/38-388--------------------------VDAAVQP---VMK..........................ANDIPGLA.......
P94288_BACCE/53-388--------------------------VKQAVRD---TLQ...........................LGFPGIL.......
Q9X5Q0_STRLA/21-361--------------------------LRRLTDV---VRA.............................RGGAA.......
O62481_CAEEL/42-406--------------------------AKELVET---TMA..........................IQGIPGLS.......
Q98JC7_RHILO/43-383--------------------------LDALAQG---AVA..........................DGGVPGLA.......
YFEW_ECOLI/43-414--------------------------MDRWISQ---QVD...........................VGYPSVN.......
ESTB_BURGA/22-391--------------------------LDAVFDQ---ALR..........................ERRLVGAV.......
P71988_MYCTU/60-399--------------------------LDAKINA---GMK..........................AYAIPGVA.......
BLAC_BACVU/48-310--------------------------ISQIVSA---CPG.............................EIGVA.......
Q9X8U8_STRCO/16-340--------------------------LTHRIAV---AQA..........................EGRTPSLV.......
BLAC_PROVU/10-258--------------------------LSTLEKY---SQG.............................RLGVA.......
BLAC_STRFR/46-298--------------------------LRALERT---HDA.............................RLGAF.......
Q9Z4V4_STRFR/44-398--------------------------LQREADA---LLR...........................LGAPGVL.......
AMPC_CITFR/32-381--------------------------VNRTITP---LMQ..........................EQAIPGMA.......
BLAC_STRCE/50-302--------------------------LRALERE---HQA.............................RIGVF.......
Q9HT32_PSEAE/60-409--------------------------PTRVIHK---GTKVRPLPAGVAIAPRYRIGGEEYGVDDFMRRNRVGG.......
AMPC_ECOLI/28-377--------------------------VHRTITP---LIE..........................QQKIPGMA.......
Q9X5R0_STRLA/136-514--------------------------TAREAAP---PPGTEDAAEAVRRARAALPGTMRELEREVGTSTPGAQ.......
FMTA_STAAU/48-386--------------------------NEKYLVD---RNKEKVAPSKLKEVYNSKDPKYKKIDKYLQSSLFNGS.......
Q18384_CAEEL/50-416--------------------------FRRNFTE---GWE.............................KAGAA.......
Q9K4I2_STRCO/49-431--------------------------RRPTLRH---GSAERAGLLPGHLRWLVTDAEAFLGPSPEHPWYAGAV.......
Q9HW54_PSEAE/59-378--------------------------FERYAFG---RRDDV.......................RRKGIRTDA.......
Q9LCC8_OCHAN/4-353--------------------------LNNAIQG---ILDDH.......................VARGVVGVS.......
BLAC_BACLI/50-296--------------------------FAKLEEQ---FDA.............................KLGIF.......
Q9K351_HAFAL/39-387--------------------------VDDLIQP---LMQ..........................KNNIPGMS.......
O53190_MYCTU/21-384--------------------------FERNFVL---RNE..............................VGAA.......
BLA1_PASHA/50-296--------------------------LANLEQQ---YQA.............................RIGVY.......
Q9RWA9_DEIRA/32-336--------------------------VRQTLRR---GGV.........................................
Q9PCY3_XYLFA/65-407--------------------------IESMAEQ---LTY..........................GQKVPGLA.......
Q9XA95_STRCO/30-359--------------------------LRERLTE---AVH..........................ACDAPDVV.......
Q9RYU2_DEIRA/7-325--------------------------TARLLRS---LTD..........................SRALSGAA.......
BLE1_PSEAI/35-292--------------------------IESIVIG---KKA.............................TVGVA.......
Q988N4_RHILO/12-356--------------------------FEDLIRQ---QVE..........................DKAIPSIS.......
P95207_MYCTU/41-390--------------------------VIRIVRD---FMT..........................QAHLKAVL.......
Q9A7L6_CAUCR/54-390--------------------------MDSRLRA---MMT..........................DRSMQGLA.......
BLA3_BACCE/59-305--------------------------FAKLEKE---YNA.............................KLGIY.......
AMPC_PROST/35-383--------------------------VDDIIKP---LMK..........................QEQIPGMS.......
Q7DFY3_SALEN/31-280--------------------------VKDAEDQ---LGA.............................RVGYI.......
Q9A3L3_CAUCR/99-483--------------------------IDSFIQA---KYID.........................TGKLPCAL.......
BLA1_STRCI/57-318--------------------------FRALEKK---FDA.............................HPGVY.......
Q9A9U2_CAUCR/29-330--------------------------WDQDDKA---DLK.................................A.......
Q21523_CAEEL/50-420--------------------------FRKNLEQ---NWE.............................RSGAA.......
Q44050_ARTGO/17-368--------------------------FGRFLSE---DRE..............................YSAQ.......
PBPE_BACSU/9-348--------------------------LQTLFET---LGE..........................KHQFNGT........
LACT2_CAEEL/79-448--------------------------FRRNFAD---GWE.............................REGAS.......
Q9I4S7_PSEAE/29-387--------------------------FARLFDN---PQE..............................RGAA.......
Q9RER5_ENTAE/32-381--------------------------VNQTITP---LMK..........................EQAIPGMA.......
Q9V2D6_PYRAB/6-348--------------------------LESFIVE---KMA..........................ERKVPGIS.......
Q9C2S3_NEUCS/19-388--------------------------IVDDVCK---ISG.............................APSAS.......
Q9A800_CAUCR/77-466--------------------------LDDHMQT---MVD..........................RGQIAGGV.......
Q9XU43_CAEEL/52-422--------------------------FRRNFGQ---GEE.............................REGAA.......
Q9I2U5_PSEAE/43-384--------------------------LQRHIRR---EME..........................RQDVPGLA.......
Q9AAM2_CAUCR/38-371--------------------------IDALVAK---IVT..........................EHQADGIS.......
Q99Y64_STRP1/9-304--------------------------VIKCIEN---HLH.........................................
Q9A7Z9_CAUCR/50-429--------------------------LDAHMQG---LVD..........................KGHLPGVT.......
Q9AI08_PHOLU/55-396--------------------------ASQLVDQ---YAQDIF.....................NGS.NAQGMA.......
Q9RKP5_STRCO/2-343--------------------------HDLTTGE---RPW.............................AAGAV.......
BLAC_STRBA/57-305--------------------------FKKLERE---FDA.............................RLGVY.......
DAP_OCHAN/9-333--------------------------LEAFVRH---IPQ..........................NYKGPGGV.......
P95290_MYCTU/53-411--------------------------FAGLYPG---RKF..............................GGGA.......
BLO1_KLEOX/37-285--------------------------LADLEKR---SGG.............................RLGVA.......
FLP_STAAM/43-372--------------------------IDKIIEH---DLQ..........................KGHIPGAS.......
Q9A2D7_CAUCR/97-472--------------------------INAALKA---MVD..........................SGRAAGVS.......
BLA2_STRCI/60-307--------------------------LKALEDE---FDV.............................RLGVY.......
AMPC_MORMO/31-379--------------------------VDSTIKP---LMA..........................QQDIPGMA.......
BLAC_PROMI/36-285--------------------------VTNAETE---LGA.............................RIGLA.......
P71981_MYCTU/64-388--------------------------IATTVGA---VMA............................ATATDG.......
BLAC_YEREN/39-287--------------------------LAELERN---ANG.............................RLGVA.......
Q9EX97_OCHAN/38-387--------------------------VDETVRP---LMA..........................EQKIPGMA.......
BLAC_STRAU/51-304--------------------------LRALEKQ---YAA.............................RLGVF.......
AMPC_SERMA/27-374--------------------------IDAVIQP---LMK..........................KYGVPGMA.......
BLAC_KLEPN/29-278--------------------------IKQSESQ---LSG.............................RVGMV.......
O87861_STRAQ/19-378--------------------------FEENFTE---RGE..............................LGAA.......
BLC3_PSEAI/29-277--------------------------VKAIEVS---LSA.............................RIGVS.......
Q9WXD6_BRELN/11-387--------------------------VARVASE---KVE..........................SGGVPGVV.......
Q44260_AERSO/33-381--------------------------VDDAIRP---VLK..........................QHRIPGMA.......
P74200_SYNY3/25-369--------------------------LNQYLID---RLNQG.......................EGKELGSAA.......
Q9F3F0_STRCO/31-381--------------------------LDAAVEN---VHR...........................AGMPGLF.......
Q9L8D3_SORCE/35-419--------------------------AREVMAA---EVA..........................AGQMPGAV.......
Q9KEY4_BACHD/34-367--------------------------LDNYVET---FLG..........................THRIPGAA.......

PF02113

Q55728_SYNY3/46-476--------------------------LQQKLES---HLQ---------------------Q.PELSRAQWGIA-------
O85665_NEIGO/13-461--------------------------LLASLAA---HAL---------------------DTGRIPQNEIAVY-------
O06380_MYCTU/72-454--------------------------VTAALAV---VAA---------------------D.PDL.GKLAGR.-------
O69539_MYCLE/72-454--------------------------LAAALAS---ALA---------------------D.PSL.GSFGGR.-------
DACB_ECOLI/19-469--------------------------QAANVDE---YIT---------------------QLPA..GANLALM-------
DACB_HAEIN/26-472--------------------------ANINVSD---LTQ---------------------KLPE..GSNVGFI-------
DACC_BACSU/36-491--------------------------LSGQIDK---ILA---------------------DHPALEGAMAGIT-------
DAC_ACTSP/54-508--------------------------LREDIDA---ILE---------------------D.PALEGAVSGVV-------
Q9Z541_STRCO/78-446--------------------------LVKNLDE---RLA---------------------D.ERLGTDVSGV.-------

PF04960

GLSL_HUMAN/177-463-----------------GKVAAYIPQLAKSNPD---LWG-----------------------------------------
GLSA_RHIEC/22-307-----------------GKVADYIPELAKIDPR---QFG-----------------------------------------
GLSA_VIBCH/22-306-----------------GIVADYIPALAKVPSD---KLG-----------------------------------------
GLSA1_BACHD/22-308-----------------GTVASYIPALAKADVS---TLG-----------------------------------------
GLSA2_BACSU/23-309-----------------GEVASYIPALAKADKH---DLS-----------------------------------------
GLSA2_BACHD/33-324-----------------GQCAQYIPALREANQT---YLG-----------------------------------------
GLSA1_BACSU/32-327-----------------GQSANYIPALGKVNDS---QLG-----------------------------------------
GLSA2_ECOLI/24-308-----------------GKVADYIPALATVDGS---RLG-----------------------------------------
GLSA_PSEAE/19-302-----------------GKVADYIPALAGVEPN---QLG-----------------------------------------
GLSA_RHILO/28-313-----------------GDVATYIPQLGKVDPR---KFG-----------------------------------------
GLSA_STRCO/25-307-----------------GRPADYIPALAARDPR---RFG-----------------------------------------
GLSA_CAUCR/24-306-----------------GKPADYIPQLATVPGG---KFG-----------------------------------------
GLS1_CAEEL/171-458-----------------GQVATYIPQLARQSPN---LWA-----------------------------------------
GLS2_CAEEL/174-460-----------------GDLATYIPQLSRVAPD---SWA-----------------------------------------
GLSK_HUMAN/244-530-----------------GKVADYIPQLAKFSPD---LWG-----------------------------------------
GLSA1_ECOLI/24-308-----------------GQNADYIPFLANVPGQ---LAA-----------------------------------------
GLSA2_YERPE/47-331-----------------GVVSNVYPALERIPAD---LFG-----------------------------------------

PF07930

DAP_OCHAN/334-421--------------------------------------------------------------------------------
DAP_BRUME/334-421--------------------------------------------------------------------------------

PF00768

D2AEU9_SHIF2/32-265------YSN---HPDL--------------------------------------------------V-RPIASISK----
DACD_ECOLI/25-263------TAG---NEHQ--------------------------------------------------Q-RNPASLTK----
DACA_ECOLI/35-273------AEQ---NADV--------------------------------------------------R-RDPASLTK----
DACX_STRSK/26-273------YTK---AADT--------------------------------------------------R-RSTGSTTK----
Q54906_STRPY/17-270------YEK---DAKE--------------------------------------------------V-VPVASVSK----
DACF_BACSU/26-261------YNK---NSNE--------------------------------------------------R-LAPASMTK----
DACA_HAEIN/27-263------TAL---NPDQ--------------------------------------------------R-QYPASLTK----
DACB_BACSU/21-251------YAK---DEHQ--------------------------------------------------K-RRIASITK----
DACC_ECOLI/28-266------AEG---NADE--------------------------------------------------K-LDPASLTK----
DACA_GEOSE/27-286------YEK---NIDT--------------------------------------------------V-LGIASMTK----
PBP5_PSEAE/19-261------YSR---NPDL--------------------------------------------------V-VPIASITK----
P72518_STRPN/17-269------YEK---DATQ--------------------------------------------------P-VEIASITK----

PF13354

D3R279_CLOB3/167-362-----.LQI...NPDY--------------------------------------------------A.RTAASTIK....
C5NV57_9BACL/95-285-----..AQ...EDTH--------------------------------------------------Y.FTAASTIK....
A3DEM2_CLOTH/156-348-----..GI...NDTE--------------------------------------------------E.FFAASTFK....
C7IRL1_THEET/200-392-----..EI...NGYD--------------------------------------------------S.FIAASTYK....
D9TSS5_THETC/196-388-----..DI...NGYD--------------------------------------------------S.FVAASTYK....
B0TAI9_HELMI/87-282-----..AI...EPDK--------------------------------------------------N.FQAASAIK....
D1C5R0_SPHTD/31-238-----..RH...NGDR--------------------------------------------------R.FRAASTVK....
C0ZJI1_BREBN/25-238-----..EH...VPDE--------------------------------------------------L.FIAESVIK....
D1CF14_THET1/24-242-----..FI...NADE--------------------------------------------------T.FNTASVIK....
C7H338_9FIRM/28-242-----..EI...GADE--------------------------------------------------E.FETASTIK....
Q1J1L5_DEIGD/60-275-----..AL...NPDR--------------------------------------------------V.FPAASTIK....
Q9RX82_DEIRA/25-240-----..AQ...AADA--------------------------------------------------V.FPAASTIK....
C1CYR0_DEIDV/25-240-----..AL...NATR--------------------------------------------------T.FPAASTIK....
D7BH62_MEISD/25-238-----..SY...QETR--------------------------------------------------P.FPAASTIK....
A4FGH3_SACEN/23-225-----..LF...GARR--------------------------------------------------V.VHPASTIK....
D1C8L0_SPHTD/32-252-----..GI...NAEC--------------------------------------------------V.LPTASVIK....
Q67QZ3_SYMTH/26-238-----..QV..GASDD--------------------------------------------------T.FPSASTIK....
C6B6H3_RHILS/32-251-----..GR...GADE--------------------------------------------------E.TPSASTRK....
Q7CSB1_AGRT5/27-246-----..GR...GENE--------------------------------------------------E.TPSGSTRK....
C7PH33_CHIPD/45-252-----..DI...NADT--------------------------------------------------I.FPTASIVK....
C6Y376_PEDHD/48-255-----..GI...YTDS--------------------------------------------------I.FPTASIVK....
C2G3X8_9SPHI/50-256-----..MI...NADS--------------------------------------------------I.FPTASIIK....
D2QMG0_SPILD/51-257-----..AI...KADT--------------------------------------------------L.FPTASTIK....
C1ACM4_GEMAT/56-266-----..ER...RGDE--------------------------------------------------T.FTTASLIK....
D3Q045_STANL/73-283-----AVDK...ASDT--------------------------------------------------K.VEAMSTNK....
D3PY77_STANL/72-283-----.TAVD.QKSDE--------------------------------------------------V.LEAWSCNK....
B5HHK2_STRPR/25-261-----..GY...GADE--------------------------------------------------P.VVVASVFK....
C3JVC0_RHOER/42-274-----..GY...GADE--------------------------------------------------G.VILASVFK....
D2ARC0_STRRD/23-261-----..GL...GADE--------------------------------------------------P.VVLASVFK....
Q6WSB4_9PSEU/29-266-----..GI...DEHA--------------------------------------------------P.VVTASVFK....
D5UMR9_TSUPD/34-269-----..SV...SGHE--------------------------------------------------P.VVPASVYK....
C7Q8V4_CATAD/62-288-----..SV...AATQ--------------------------------------------------L.AATSSLHK....
C3JVV9_RHOER/30-276-----..GS...GADA--------------------------------------------------R.SVTASTYK....
D3Q9I0_STANL/20-254-----..GV...RETT--------------------------------------------------P.VILVSVIK....
D7AWL0_NOCDD/28-268-----..GI...EPDL--------------------------------------------------E.FSTASLVK....
BLAB_STRCI/29-280-----..GI...DPDT--------------------------------------------------E.LPTASLVK....
Q769D8_9ACTO/28-268-----..GI...EPDV--------------------------------------------------Q.LPAASLVK....
C6WEM7_ACTMD/23-263-----..AI...EPDV--------------------------------------------------E.WPMASLVK....
A7VJM6_9MICO/21-237-----..AH...NEND--------------------------------------------------E.LDTASMGK....
Q6AHF8_LEIXX/31-247-----.FSV...DDHV--------------------------------------------------V.MPTASIGK....
A4AF02_9ACTN/57-273-----.LSI...DDRV--------------------------------------------------A.LPTASIGK....
A5CUW5_CLAM3/55-271-----.LAV...DDHV--------------------------------------------------A.LPAAGLGR....
A3THA9_9MICO/30-246-----.ASH...DPDR--------------------------------------------------L.LSTASVGK....
C2D5A8_LACBR/26-222-----..AV...NANK--------------------------------------------------A.FRSASLIK....
D3L9M4_OENOE/30-223-----..SF...HGNR--------------------------------------------------V.MPSASLIK....
C9ACN0_ENTCA/30-228-----..DY...QSQK--------------------------------------------------S.FSAASISK....
Q92FA7_LISIN/23-230-----..AE...NENQ--------------------------------------------------L.FTAASVIK....
C4VQE7_9LACO/23-217-----.ENS...NANM--------------------------------------------------V.FKSASLIK....
D0R6B2_LACJF/24-218-----.ENS...LANT--------------------------------------------------T.YKSASLIK....
C2F946_LACPA/27-227-----..GA...QVDQ--------------------------------------------------P.FPAASLIK....
C2JUG5_LACRH/27-227-----..GT...RTDV--------------------------------------------------L.FPAASLIK....
Q74HJ8_LACJO/23-220-----..QH...QAEK--------------------------------------------------I.FPAGSLID....
Q1IIZ9_KORVE/54-260-----..TL...NPDD--------------------------------------------------I.FPTASSIK....
B9XGI6_9BACT/30-235-----..DI...NAEM--------------------------------------------------V.FPQASAIK....
D1CAH8_SPHTD/29-234-----..EW...SPET--------------------------------------------------Q.FLAASIIK....
C6JN74_FUSVA/22-213-----..MI...NEEV--------------------------------------------------I.FPSASIIK....
D3A9C2_9CLOT/37-244-----..AY...HEEE--------------------------------------------------R.MMAASVIK....
C3WTB7_9FUSO/29-234-----..SV...NGDK--------------------------------------------------K.VLSASMIK....
C0WAD9_9FIRM/29-233-----..SI...GGKN--------------------------------------------------E.LPSASLIK....
A6TPV9_ALKMQ/24-228-----..RL...NDTH--------------------------------------------------K.MPSASIIK....
Q97MK6_CLOAB/29-233-----..YI...KENE--------------------------------------------------V.FPSASTIK....
Q2B497_9BACI/33-237-----...M...NSGR--------------------------------------------------K.YPAASLIK....
D1BLB4_VEIPT/34-242-----.AAR...GENT--------------------------------------------------V.HSSASLIK....
C9M6L1_9BACT/27-241-----..DL...RGLQ--------------------------------------------------R.LKSASLIK....
D2RJL4_ACIFV/65-269-----...Y...RGSS--------------------------------------------------T.LPSASMIK....
C4V1H1_9FIRM/88-292-----..YI...YQSE--------------------------------------------------S.MRSASMIK....
C9LUU8_9FIRM/91-296-----..LI...RDAD--------------------------------------------------E.MRAASMIK....
D3LTR8_9FIRM/96-300-----..VI...YNDH--------------------------------------------------T.MRSASMIK....
A9B776_HERA2/21-222-----.YQY...QPSL--------------------------------------------------Q.LPSASLIK....
C0WDD8_9FIRM/88-297-----...Y...NFSG--------------------------------------------------K.MPAGGLIR....
D2RLG2_ACIFV/74-285-----..FY...NYSG--------------------------------------------------K.MPAGDLVR....
Q8YNM1_NOSS1/217-419-----..DI...NAAN--------------------------------------------------A.LPAASTIK....
B2J7F0_NOSP7/218-420-----..DV...NGST--------------------------------------------------S.FPAASTIK....
D7DW46_NOSA0/212-414-----..DI...NSNA--------------------------------------------------S.FPAASTIK....
A0ZAJ6_NODSP/233-435-----..DV...NSSA--------------------------------------------------T.FSAASTIK....
A0Z083_LYNSP/220-422-----..DI...NSES--------------------------------------------------A.FAAASTIK....
B0CCE0_ACAM1/37-239-----..DI...NGAK--------------------------------------------------S.ISAASTIK....
B8HLP2_CYAP4/158-360-----..DV...NGAA--------------------------------------------------T.FPAASTIK....
B2IVV4_NOSP7/225-427-----..DV...GGDR--------------------------------------------------V.FPAASTIK....
B8HM72_CYAP4/205-407-----..DL...NGDK--------------------------------------------------I.FPAASIIK....
B7KDD6_CYAP7/166-368-----..DV...NGQA--------------------------------------------------P.FSAASTIK....
A8YG35_MICAE/134-336-----..NF...RGDT--------------------------------------------------I.FAAASTIK....
C7QSD1_CYAP0/172-374-----..SV...NGSV--------------------------------------------------P.VPAASTIK....
Q55897_SYNY3/237-440-----..NA...KGET--------------------------------------------------Q.LPAASTIK....
Q5N617_SYNP6/75-277-----..DI...NGTT--------------------------------------------------S.IPAASTIK....
B4WI30_9SYNE/252-455-----..SV...GGEE--------------------------------------------------A.IAAASTIK....
Q2JKE0_SYNJB/180-382-----..GV...RPDQ--------------------------------------------------A.FPAASVIK....
C0GGV0_9FIRM/114-323-----..SH...NGDR--------------------------------------------------V.IFPASMIK....
F1T3K7_9ACTN/155-354-----..HV...NSDK--------------------------------------------------A.FVSASMIK....
Q08XP3_STIAD/57-318-----..AY...DAER--------------------------------------------------P.TYLSSAIK....
A4VI25_PSEU5/54-317-----..RY...DAER--------------------------------------------------F.WYLGSAVK....
A4IY62_FRATW/49-258-----..AV...NASF--------------------------------------------------Y.FPICSTYK....
C6YW16_9GAMM/49-258-----..SH...NQSF--------------------------------------------------Y.FPICSTYK....
A7JMA9_FRANO/43-254-----..KY...NESY--------------------------------------------------H.FPICSVFK....
C6YWK1_9GAMM/44-255-----..SY...NENY--------------------------------------------------H.FPICSVFK....
B9EC94_MACCJ/44-253-----..SY...NEEL--------------------------------------------------L.FPYASTFK....
Q9X6W1_ECOLX/63-282-----..NV...NEKH--------------------------------------------------H.YPMQSTYK....
B6WTZ1_9DELT/61-280-----..GV...HMDT--------------------------------------------------P.FPLLSVIK....
C3X8Y4_OXAFO/46-265-----..HY...HSGD--------------------------------------------------F.FPMQSVFK....
C3X3G5_OXAFO/49-269-----..AI...AADA--------------------------------------------------L.FPMQSVYK....
C8C144_9ZZZZ/49-267-----..TA...NSDD--------------------------------------------------Q.YPLMSVFQ....
B3D802_BURM1/59-267-----..AH...HARE--------------------------------------------------R.FPLCGTYA....
A6WDM1_KINRD/35-232-----..EH...RGER--------------------------------------------------P.CPVLTLSA....
Q92Y19_RHIME/54-306-----..CV...NGEQ--------------------------------------------------R.FSLQSVMK....
B0T712_CAUSK/59-310-----..SF...NGEK--------------------------------------------------R.FPLQGVFT....
D5VFF5_CAUST/60-304-----..GF...NGDR--------------------------------------------------A.FVLGGAAR....
Q2GBE0_NOVAD/96-299-----..GF...RGAT--------------------------------------------------S.FPQGSLRR....
C4VSL3_9LACO/99-291-----..ADLTNTSQD--------------------------------------------------S.LNAGSVLK....
D0DKJ8_9LACO/105-290-----..AVV.FNTNK--------------------------------------------------A.HDAGKTMR....
Q5FIM3_LACAC/104-295-----..AVV.SNTNK--------------------------------------------------S.HDANKAMK....
C9M3W5_LACHE/79-269-----..AVV.SNTAK--------------------------------------------------A.HDAKDVMK....
D6S2M9_9LACO/93-284-----..EV..YNKKD--------------------------------------------------K.VNVSDSLK....
Q55G30_DICDI/66-270-----..SE...NSQN--------------------------------------------------S.QQTASTIK....
C3BL34_9BACI/43-240-----.ALY...NDDI--------------------------------------------------L.VPLASAAK....
C2QCU8_BACCE/29-226-----.ASY...NDEL--------------------------------------------------Y.IPLASAAK....
C2Z8Y6_BACCE/25-222-----.ATH...NNEL--------------------------------------------------Y.VPLASAAK....
C2PG18_BACCE/23-220-----.ASY...NNEL--------------------------------------------------Y.VPLASAAK....
B0AK42_BACAN/23-220-----.ASY...NSEL--------------------------------------------------N.IPLASAAK....
C2VCY9_BACCE/29-226-----.ISY...NSEL--------------------------------------------------Y.IPLASAAK....
Q112T9_TRIEI/199-405-----..DL...NGNK--------------------------------------------------PPASAASLIK....
C8WKG4_EGGLE/143-342-----..GY...NADQ--------------------------------------------------W.FFSASTVK....
B1S8A7_9BIFI/117-306-----..SY...NADA--------------------------------------------------Q.VYSASAIK....
A7A336_BIFAD/133-323-----..AY...NADV--------------------------------------------------Q.IYSASSAK....
A4E932_9ACTN/111-301-----..TY...NADV--------------------------------------------------E.VYGASSYK....
A5G729_GEOUR/100-303-----..GI...NEKV--------------------------------------------------E.YNPASMMK....
Q3DFC2_STRAG/213-406-----..GI...NIDR--------------------------------------------------S.MYSASIAK....
C2LQQ9_STRSL/215-408-----..AI...NDEK--------------------------------------------------S.MYAASVAK....
B4U5H8_STREM/213-406-----..GI...NADK--------------------------------------------------Q.MYAASISK....
C5WDV2_STRDG/213-406-----..GI...NADK--------------------------------------------------E.MYAASIAK....
A4VS97_STRSY/211-404-----..GV...NQEK--------------------------------------------------L.FYSASIAK....
A3CJX6_STRSV/212-405-----..GI...NQDQ--------------------------------------------------E.MYSASVTK....
A8B001_STRGC/211-404-----..GI...NQDT--------------------------------------------------E.MYSASVTK....
D3H625_STRM6/207-400-----..GI...NQDE--------------------------------------------------K.MYAASVLK....
D4FQE8_STROR/207-400-----..GV...NEDS--------------------------------------------------K.LYAASILK....
D2BLR7_LACLK/232-427-----..GV...NQEQ--------------------------------------------------K.MYSASLSK....
C1I3T7_9CLOT/61-249-----..IL...NPDK--------------------------------------------------Y.YIAASTTKIPLC
C7VVX9_ENTFL/70-261-----..SV...NGQH--------------------------------------------------E.FYTASTIK....
Q67RI7_SYMTH/15-208-----..LH...NADR--------------------------------------------------L.YHPASTVK....

PF00905

PBPH_BACSU/372-692-----MAGKKIDLKTN...................K-------------------IEDYAIGAFTTQ-YEMGSAVK----
PBPF_BACSU/322-595-----AIGGRDYTSKG....................-------------------.....YNRVTAV-RQPGSTFK----
SP5D_BACSU/246-557-----MSSRPDFDPADYQ..............SVDP-------------------SVYNRNLPVWST-YEPGSTFK----
PBPB_BACSU/268-577-----MGQRPSFDPNK..................RD-------------------VTNYYNDLISYA-YEPGSTMK----
Q45297_BACLI/374-591-----YNRKE..STSR....................-------------------............-FAPASTYK----
PBPA_MYCTU/160-484-----LVSSPSYDPNLLASHNPEVQAQAWQRLGDNP-------------------ASPLTNRAISET-YPPGSTFK----
PBPA_BACSU/352-641-----IGAGRNQPVGG....................-------------------....FNYATQTK-AQPGSTIK----
Q51504_PSEAI/247-547-----MTNQPTYNPNNR...............RNLQ-------------------PAAMRNRAMIDV-FEPGSTVK----
Q9ZHF7_BURPI/25-267-----HEGKC...DER....................-------------------............-VTPASTFK----
PBPI_BACSU/263-574-----IVSKPDADVSR....................-------------------.QNTLQNYMLTP-IYPGSVFK----
P71707_MYCTU/310-601-----YYGGDNANGFD....................-------------------.......FAQAG-LQTGSSFK----
Q51505_PSEAI/242-539-----MANFPSYNPNNR...............ASFA-------------------PAFMRNRTLTDT-FEPGSVIK----
P72405_STRCL/273-546-----AANVP..........................-------------------..SGMNRALEGR-YPPGSTFK----
Q59439_ENTHR/364-671-----LASSPSYDPNKMTNGISQ....EDYQAYTEN-------------------KDQPFISRFATG-YAPGSTFK----
P73117_SYNY3/281-593-----MVNEPTFNPNEY...............YKAK-------------------VEYFKNWSVSDL-YEPGSTFK----
PBP2_HAEIN/279-618-----MVSTPSYDNNLFVDGISS...EDYKRLLNDL-------------------ARPLYSRATQGA-YPPASTVK----
P96052_STRTR/367-698-----MAGQKHEQGAQ...................D-------------------FKADALGTITDV-FTPGSVVK----
Q9AEF8_9GAMM/23-259-----LKHEGKDCNKR....................-------------------............-FAPESTFK----
O54282_STASC/363-580-----YNEPE..SKQR....................-------------------............-YSPNSTYK----
Q98LR0_RHILO/12-247-----QDGTC...DQP....................-------------------............-FSPASTFK----
FTSI_ECOLI/260-555-----MANSPSYNPNNL...............SGTP-------------------KEAMRNRTITDV-FEPGSTVK----
PBPX_STRPN/289-609-----TTQRPTFDADTKE..............GITE-------------------DFVWRDILYQSN-YEPGSTMK----
O07106_ENTFL/295-608-----MSQRPTFNPETKQ..............GLDD-------------------NGTWQNLLVESP-YEPGSTIK----
Q9KHJ3_SHIFL/42-276-----QFNKAKCATQM....................-------------------............-.APDSTFK----
PBP2_NEIFL/81-376-----LVNSPAYDPNQP...............GQAN-------------------SEQRRNRAVTDM-IEPGSAMK----
Q55926_SYNY3/76-292-----WVYNQERADRA....................-------------------............-YSPASTFK----
Q9K4N2_STAHA/361-577-----YNEKE..SRKR....................-------------------............-YSPNSTYK----
Q9F0V2_ACIBA/53-270-----NALAR..ANKE....................-------------------............-YVPASTFK----
O06214_MYCTU/338-656-----MANDNTFDPSQDI..............GRQG-------------------DKQLGNPAVSSP-FEPGSVNK----
PBPC_BACSU/352-666-----LVSAPSYDPNGFIFGWSD....KEWKKLNKD-------------------KNNPFSAKFNKT-YAPGSTIK----
YQGF_BACSU/352-682-----MAGKQIKRENG.................AYK-------------------FDDYALGAMTSS-YAMGSAVK----
PBP2_STRR6/343-671-----MSGIKHDLKTG...................E-------------------LTPDSLGTVTNV-FVPGSVVK----
PBP_STAAU/347-660-----LVSTPSYDVYPFMYGMSN....EEYNKLTED-------------------KKEPLLNKFQIT-TSPGSTQK----
Q9AEY7_PSEAI/35-252-----HNDPR..AQQR....................-------------------............-YPAASTFK----
Q9K319_AERHY/24-259-----SEGDC...SSQ....................-------------------............-LPPASTFK----
Q53725_STAAU/268-579-----YSQRPTFNPETG................KDF-------------------GKKWANDLYQNT-YEPGSTFK----
O26078_HELPY/280-589-----LASSKRFNPNAI...............KTSD-------------------YESLNLSVAEKV-FEPGSTIK----
Q9EY51_ACIBA/42-258-----SVYNESRAQQR....................-------------------............-YSPASTFK----
PBP2_ECOLI/271-609-----LVSTPSYDPNLFVDGISS...KDYSALLNDP-------------------NTPLVNRATQGV-YPPASTVK----
O33622_STRCH/299-660-----MASNPDYDPNAWVGGISAK..DYKKLTGKDS-------------------NYPLLNRATQGQ-AAPGSIFK----
P94124_ACIBA/42-258-----LVFDQVRSEKR....................-------------------............-YSPASTFK----
FTSI_HAEIN/280-572-----MATAPSYNPNNR...............VGVK-------------------SELMRNRAITDT-FEPGSTVK----

PF00144

Y4209_BACPE/17-329.....VFIIHNNNIVTEEYW..............GR......HSQANNAR.....SIQE......DTQFHVASVRK----
Q9XWZ6_CAEEL/290-607.....IHILRDNKMEYSASY..............GF.......ADILQNI.....PVKT......THRYRIASVSK----
Q9U3M7_CAEEL/420-758.....IAIAKKEQLKFAAGF..............GY.......TDIRQQE.....PVTP......NHQFRVGSVSK----
YBBE_BACSU/52-423.....LVVVKDGRIIKKAAY..............GYSKKYEGSELLRRPA.....KMKT......RTMFDLASNTK----
Q9YFA3_AERPE/8-341.....LSAFKGGDVFQASY...............GY.......SSIEKGS.....PASV......DTAYGIGSITK----
AMPH_ECOLI/31-372.....LVVIDGNQRVFR.................SY.......GETRPGNN...VRPQL......DSVVRIASLTK----
Q9RKC5_STRCO/36-410.....VAVYRDGRKVVDLWG..............GSR....DVDDASGTE.....PWRR......GTAQVVRSATK----
O88012_STRCO/23-405.....VAVARGGRVAHLTVH..............GL.......RDVAAGL.....PVTA......DTLWRIYSMTK----
Q53403_PSEFL/18-377.....LCIQIGGETVVDLWA..............GT.......ADKDGTE.....AWHS......DTIVNLFSCTK----
P72041_MYCTU/40-404.....LCIRHHGRVVLNRAI..............GHG....WGNAPTDEADAEKIPVTT......DTPFCVYSAAK----
Q98HG2_RHILO/72-389.....LTVMKGGKVIGDWFA.............P.....................HMDF......GARHIIFSISK----
Q988B4_RHILO/18-370.....VSVVVHGKTVVDLWG..............GH.......ADAARTR.....PWRQ......DTLINVWSSTK----
Q97ML5_CLOAB/11-343.....AAVGTRERVIRLESFGNRCL....YPEKL.....................SMNK......DTLFDLASLTK----
BLAC_STRAL/53-307.....AYDTGSGRTV........................................AYRA......DELFPMCSVFK----
Q9A2R7_CAUCR/45-374.....VGVIDARGRRVIAHG.......................LMGAGGK.....PVDG......QTLFEIGSVTK----
Q9A3W5_CAUCR/42-393.....ITVVENGQITLAKGY..............GV.......KALGGQD.....RCDE......STVFGIASNTK----
Q9A6I9_CAUCR/103-453.....LSVVQNGQVVLKKGY..............GF.......SNLGQRK.....QVDP.....DKTLFRVASISK----
PBP4_NOCLA/8-348.....LAVFVDGDLHELAS...............GV.......LHRGTGV.....AVTT......DSVFQSGSVAK----
BLAC_BACSU/53-299.....AIDIGSNKTI........................................AYRP......NERFAYASTYK----
Q9A862_CAUCR/42-382.....LAVVQGREVVMAAGY..............GV.......ADLGTGR.....PAHA......DTAFYIASSTK----
Q9I1G0_PSEAE/16-386.....VLVAHRGQWLYRRAA..............GL.......ADREAGR.....IMGE......DSLFRLASVSK----
Q9CE05_LACLA/7-308.....FAIIEGEKVNEYLLGNSAI.....YPKTI.....................KLTQ......GKKWDLASLTK----
AMPC_YEREN/37-388.....VAVFYDGKPQFFNY...............GM.......ADIKAGR.....PVTE......NTLFELGSVSK----
Q97FD2_CLOAB/68-427.....YALIDNGKIVLSGNA..............GV.......YSKEDNK.....PVTA......DNMYGIGSVSK----
Q21569_CAEEL/51-419.....FAVFVDGKKVVDLWG..............GY.......ADKQAAR.....KWAE......DTITVTFSTTK----
Q9Y7D1_ASPTE/17-406.....IMARDCSGNLNYTRCFGARTVRRDECNQLP....................PLQV......DTPCRLASATK----
BLAC_BACCE/55-300.....AIDTGTNQTI........................................SYRP......NERFAFASTYK----
BLC1_ECOLX/37-285.....LINTADNSQI........................................LYRA......DERFAMCSTSK----
P74474_SYNY3/27-387.....EHYQNRREPEFFSAIQLSTKVGDGDIKTYVVG....TKSHAPNSP.....PIDA......KSLFQIGSITK----
BLAC_STAAU/27-275.....ALDTKSGKEV........................................KFNS......DKRFAYASTSK----
PBPX_BACSU/82-390......MIVRNGEIVTNKGF..............GY.......ADRKHYI.....QNNP......LTSFYVGSSQK----
AMPC_LYSLA/32-381.....VGITVDGAERYYNY...............GV.......SSRKTQA.....KVGA......NTLFEVGSVSK----
AMPC_ENTCL/32-381.....VAVIYQGKPHYYTF...............GK.......ADIAANK.....PVTP......QTLFELGSISK----
BLAC_CITDI/40-288.....LINTADRSQI........................................LYRG......DERFAMCSTSK----
Q48437_KLEPN/33-381.....VAVLKDGKAHYFNY...............GV.......ANRESGQ.....RVSE......QTLFEIGSVSK----
BLAC_STRLA/46-298.....ARDTATGRTV........................................LHRA......EERFPMCSVFK----
P71778_MYCTU/39-398.....LAVYLDGQPVVDVWK..............GW.......ADRAGWV.....PWSA......DSAPMVFSATK----
Q9ABH2_CAUCR/19-369.....FAFAIEGEVVVDLMG..............GF.......ADRKRQV.....PFGP......DTLTALFSTTK----
Q9ZDR6_RICPR/33-395FLNTVFMFADDYKSLLTGAKGIFA......LNGE.....................QLKA......NEMMPIASATK----
Q99QC1_ENTAE/36-381.....VAVLKDGKAHYFNY...............GV.......ANRESGA.....GVSE......QTLFEIGSVSK----
AMPC_PSYIM/50-399.....FGIIVDGKSHFYNY...............GL.......ADKQRNQ.....PVSE......DTIFELGSVSK----
Q97PZ0_STRPN/6-304.....AGIYPGASFAYFKDNQWTEFYLGQSDPEHGL...................QTEA......GLVYDLASVSK----
BLAC_RHOCA/38-285.....LMETGTGWSW........................................SHRE......DELFLMNSTVK----
Q9RK50_STRCO/17-371.....VAVYHHGALVVDAVA..............GV.......ADSRTGR.....RVAP......ETPFFGFSAGK----
BLAC_NOCLA/49-295.....AVDTGSGESV........................................AFRA......DERFAFASTFK----
O05900_MYCTU/63-408.....VAIVHGGKTLYAKGF..............GV.......RDVGKGGGP.DNKVDA......DTVFQLASVSK----
O86739_STRCO/48-382.....RVGTPGGDWHGSAGV.......................RDLASGR.....PAHP......DARFRAGSITK----
AMPC_PSEAE/38-388.....VAISLKGEPHYFSY...............GL.......ASKEDGR.....RVTP......ETLFEIGSVSK----
P94288_BACCE/53-388.....AKTSEGGKTWSYAA...............GV.......ANLSSKK.....PMKT......DFRFRIGSVTK----
Q9X5Q0_STRLA/21-361....QLCVMRRGTVVLDRSF...................................GCSS......DSLFLVYAATK----
O62481_CAEEL/42-406.....IAVSLDGKMVWKSGF..............GY.......ANLESFA.....KCTG......DSVMRIASISK----
Q98JC7_RHILO/43-383.....IAVVHDDEVIFLRGF..............GH.......REAGKPE.....AVDA......DTVFQIASLSK----
YFEW_ECOLI/43-414.....LLIIKDNQIVYRKAWGAAKKYDGSVLMEQPV...................KATT......GTLYDLASNTK----
ESTB_BURGA/22-391.....AIVARHGEILYRRAQ..............GL.......ADREAGR.....PMRE......DTLFRLASVTK----
P71988_MYCTU/60-399.....VAVWAGGQEYVKGY...............GV.......TNVDHPM.....PVDG......DTVFRIGSTTK----
BLAC_BACVU/48-310.....VIVNNRDTV.........................................KVNN......KSVYPMMSVFK----
Q9X8U8_STRCO/16-340.....AAVVRGGRAVWHGAR...................................TSVDGHGPDENVQYRIGSITK----
BLAC_PROVU/10-258.....LINTEDNSQI........................................TYRG......EERFAMASTSK----
BLAC_STRFR/46-298.....AYDTGTGRTV........................................AYRA......DERFPIASMFK----
Q9Z4V4_STRFR/44-398.....ADLRTPRGTVKVRS...............GF.......GDTDAGT.....PVPW......KARFRIGSLTK----
AMPC_CITFR/32-381.....VAIIYEGKPYYFTW...............GK.......ADIANNH.....PVTQ......QTLFELGSVSK----
BLAC_STRCE/50-302.....ALNLATGASL........................................LHRA......HELFPMCSVFK----
Q9HT32_PSEAE/60-409.....VLILKDGKVALERY...............GL...................GNDE......RTRWTSFSVVK----
AMPC_ECOLI/28-377.....VAVIYQGKPYYFTW...............GY.......ADIAKKQ.....PVTQ......QTLFELGSVSK----
Q9X5R0_STRLA/136-514.....IYVSRDGVPLADAGL.............G.....................LARPGVAMTHRSLPLWYCCAK----
FMTA_STAAU/48-386.....VAIYENGKLKMSKGY..............GY.......QDFEKGI.....KNTP......NTMFLIGSAQK----
Q18384_CAEEL/50-416.....FCVIHKGKVIVDLWG..............GY.......ADKECFK.....EWKE......DTISTIFSCTK----
Q9K4I2_STRCO/49-431.....LLAGRGGTVALHEPIGMAVRYRAYDEATDTGV....EFPPDEQI......PMTG......GTVFDLASISK----
Q9HW54_PSEAE/59-378.....VVVIRDGRLVYERYA.............G.....................PSRA......ETPHLTWSVSK----
Q9LCC8_OCHAN/4-353.....LALCLPGEETSLYQS..............GY.......ADKFNKM.....PMTG......DHLFRIASCTK----
BLAC_BACLI/50-296.....ALDTGTNRTV........................................AYRP......DERFAFASTIK----
Q9K351_HAFAL/39-387.....VAVTVNGKNYIYNY...............GL.......AAKQPQQ.....PVTE......NTLFEVGSLSK----
O53190_MYCTU/21-384.....VAVWVDGDLVVNLWG..............GS.......ADAGGTR.....PWQH......DTLATVLSGTK----
BLA1_PASHA/50-296.....VWDTETGHSL........................................SYRA......DERFAYASTFK----
Q9RWA9_DEIRA/32-336.....LGVARGDERQLLTFG...................................GVPE......NGVFELASVTK----
Q9PCY3_XYLFA/65-407.....MAIVQGGHILSMRGY..............GV.......NDVSNPQ.....PVNA......HTVFRLASLSK----
Q9XA95_STRCO/30-359.....LAVSRRGRRTLCAGG...................................TAPPPAVPREDLRYEIGSASK----
Q9RYU2_DEIRA/7-325.....LGVVNSAGERATLVL..............GH.......AQLTPET....HPLTP......EHWFDLASLTK----
BLE1_PSEAI/35-292.....VWGPDDLEPL........................................LINP......FEKFPMQSVFK----
Q988N4_RHILO/12-356.....YGLVDRDGLMGAGHI.............Q.....................RHDRGFVMGDDTCFRIGSITK----
P95207_MYCTU/41-390.....VRVTVAGKEVVTRAV.......................GDSMTGV.....PATT......AMHFRNGAVAI----
Q9A7L6_CAUCR/54-390.....VAVVEKGRLSFVQGY..............GVT....AEGGA.........PVDA......RTVFRWASLSK----
BLA3_BACCE/59-305.....ALDTSTNQTV........................................AYHA......DDRFAFASTSK----
AMPC_PROST/35-383.....VAISVNGKQAIYHY...............GV.......QSKQTQI.....PVSD......RTLYEIGSLSK----
Q7DFY3_SALEN/31-280.....ELDLNSGKILE.......................................SFRP......EERFPMMSTFK----
Q9A3L3_CAUCR/99-483.....TQVWRRGQLAHTSVL..............GS.......ADVERGK.....PLKA......DSLFRIYSMTK----
BLA1_STRCI/57-318.....AIDTRDGQEI........................................THRA......DERFAYGSTFK----
Q9A9U2_CAUCR/29-330.....VVVMRDGKVVAERYF.............N.....................GETD......KTLHDVRSAGK----
Q21523_CAEEL/50-420.....FVVYHKGQKVVDIWG..............GY.......SDRESQR.....KWTK......TTLSVAFSCSK----
Q44050_ARTGO/17-368.....LAAYHRGVKVLDISG..............GP...................HRRP......DSVTGVFSCSK----
PBPE_BACSU/9-348.....VLAAEGGDILYHHSF..............GY.......AEMTEKR.....PLKT......NSLFELASLSK----
LACT2_CAEEL/79-448.....ITVYHKDRVIVDLQG..............GY.......ADKASGR.....KWTP......DTRTVVFSTTK----
Q9I4S7_PSEAE/29-387.....LCLEVGGETVVDLWG..............GV.......ADKDGEQ.....PWQR......DTILNLFSCTK----
Q9RER5_ENTAE/32-381.....VAVIYHGKPYYFTW...............GQ.......ADVAGQR.....PVTR......QTLFELGSVSK----
Q9V2D6_PYRAB/6-348.....ISIIKDGDVVYAKGF..............GY.......RNVEARL.....PSTP......ETIYGIGSITK----
Q9C2S3_NEUCS/19-388.....VGVLHDNKIIFTKGHGTVAGN.QLNLKPR.....................QPGP......DTVYGIGSMTK----
Q9A800_CAUCR/77-466.....TVLARHGRVVQARAF..............GR.......RVLGGD......PMPM......DAIFRIRSETK----
Q9XU43_CAEEL/52-422.....FAVYYKGKEVVNLWG..............GY.......ADKESGR.....KWSE......NTKSVMFSASK----
Q9I2U5_PSEAE/43-384.....LALVDDQQLVWARGF..............GY.......ADRQHRI.....NASE......HTAFHAGDLSK----
Q9AAM2_CAUCR/38-371.....VAVVQDNRTRHYNAG.......................LMARDGS.....PVSE......RSVFEIGSISK----
Q99Y64_STRP1/9-304.....KKVYKGASLALFQSGRWQEYHIGTIDGRR.....................PVDA......NLVYDLASVSK----
Q9A7Z9_CAUCR/50-429.....TMLVRHGKVVNFQVH..............GK.......KGFDGP......PMTK......DTVFRIYSQTK----
Q9AI08_PHOLU/55-396.....MVVIDNNQVVYR.................SF.......GETHPGNG...IRPKP......DSVIRIASLTK----
Q9RKP5_STRCO/2-343.....VAVGRGPVLAAEAAAGWAVRYSSYDPHTDAGV....ELPEGSRV......PMSV......DTPFDLASLTK----
BLAC_STRBA/57-305.....AIDTGTGREV........................................THND......RARFAYHSTFK----
DAP_OCHAN/9-333.....VAVVKDGEVVLQHAW..............GF.......ADLRTRT.....PMTL......DTRMPICSVSK----
P95290_MYCTU/53-411.....LSVYIDGRQVVDVWT..............GW.......SDRQGKV.....PWTA......DTGAMVFSATK----
BLO1_KLEOX/37-285.....LINTADDSQT........................................LYRG......DERFAMCSTGK----
FLP_STAAM/43-372.....ILIVKNGKVFLNKGY..............GY.......QDVDKKV.....KASP......TTKYEIASNTK----
Q9A2D7_CAUCR/97-472.....ALVWQGGQERYFGVA..............GM.......ADREAGK.....PMDR......SALVQIFSMTK----
BLA2_STRCI/60-307.....AVDTGSGREV........................................AYRD......GERFPYNSTFK----
AMPC_MORMO/31-379.....VAVSVKGKPYYFNY...............GF.......ADVQAKQ.....PVTE......NTLFELGSVSK----
BLAC_PROMI/36-285.....AHDLETGKRW........................................EHKS......NERFPLSSTFK----
P71981_MYCTU/64-388.....WAVAHRGALVAEQYL.............D.....................GLGP......RTRHLLFSVSK----
BLAC_YEREN/39-287.....MINTGNGTKI........................................LYRA......AQRFPFCSTFK----
Q9EX97_OCHAN/38-387.....VAITIDGKSHFFGY...............GV.......ASKESGQ.....KVTE......DTIFEIGSVSK----
BLAC_STRAU/51-304.....ALDTGTGAGR........................................SYRA......GERFPMCSVFK----
AMPC_SERMA/27-374.....IAVSVDGKQQIYPY...............GV.......ASKQTGK.....PITE......QTLFEVGSLSK----
BLAC_KLEPN/29-278.....EMDLANGRTLA.......................................AWRA......DERFPMVSTFK----
O87861_STRAQ/19-378.....VTVLVDGKPVVDLWG..............GW.......ADAARTR.....PWER......DTLVNVWSTGK----
BLC3_PSEAI/29-277.....VLDTQNGEYW........................................DYNG......NQRFPLTSTFK----
Q9WXD6_BRELN/11-387.....AGVTTDKETISLTSA..............GV.......RSLNDPQ.....PMTT......DSVFMIFSTTK----
Q44260_AERSO/33-381.....VAVLKGGQAHYFNY...............GL.......ADVATGA.....KVNE......QTLFEIGSVSK----
P74200_SYNY3/25-369.....LALIHNGKVDTIHTV..............GV.......ENVDSGS.....PVDP.....ENTLYQMASVSK----
Q9F3F0_STRCO/31-381.....AEVRDGDQVWRGAA...............GV.......ADVDTGR.....PVTA......DLRHRVGSITK----
Q9L8D3_SORCE/35-419.....WLVARGDDVHVDAV...............GV.......TELGGSA.....PMRR......DTIFRIASMTK----
Q9KEY4_BACHD/34-367.....IAIVQDRETIYAKSW..............GVT....GGSEEAVTL...............ETPFLIGSVTK----

PF02113

Q55728_SYNY3/46-476-----IQPLTDSQPIYQYQA---------------------------------------------DRFFIPASNQK----
O85665_NEIGO/13-461-----VQELDSGKVIIDHRA---------------------------------------------GIPVNPASTMK----
O06380_MYCTU/72-454-----ITDALTGQELWQRLD---------------------------------------------DVPLVPASTNK----
O69539_MYCLE/72-454-----ITDAMTAKELWQQQD---------------------------------------------DMPLVPASANK----
DACB_ECOLI/19-469-----VQKVGASAPAIDYHS---------------------------------------------QQMALPASTQK----
DACB_HAEIN/26-472-----AKNINQNQIIADYNG---------------------------------------------STFMLSASTQK----
DACC_BACSU/36-491-----VRSAETGAVLYEHSG---------------------------------------------DTRMRPASSLK----
DAC_ACTSP/54-508-----VVDTATGEELYSRDG---------------------------------------------GEQLLPASNMK----
Q9Z541_STRCO/78-446-----VLDADSDTALWDHNG---------------------------------------------STALMPASNAK----

PF04960

GLSL_HUMAN/177-463-----VSLCTVDGQRHSVGHT--------------------------------------------KIPFCLQSCVK----
GLSA_RHIEC/22-307-----MAIVTVDGQVFRVGDA--------------------------------------------DIAFSIQSISK----
GLSA_VIBCH/22-306-----IAVFTNQGEVITAGDA--------------------------------------------QEGFSIQSISK----
GLSA1_BACHD/22-308-----IAIYRGGDEQVIAGDA--------------------------------------------DEKFTLQSISK----
GLSA2_BACSU/23-309-----VAIYYSNNVCLSAGDV--------------------------------------------EKTFTLQSISK----
GLSA2_BACHD/33-324-----LYVVHSNGIEIKSGDW--------------------------------------------QVPFTLQSISK----
GLSA1_BACSU/32-327-----ICVLEPDGTMIHAGDW--------------------------------------------NVSFTMQSISK----
GLSA2_ECOLI/24-308-----IAICTVDGQLFQAGDA--------------------------------------------QERFSIQSISK----
GLSA_PSEAE/19-302-----IAVYSRDGELFHAGDA--------------------------------------------LRPFSIQSISK----
GLSA_RHILO/28-313-----IAAVTNDGRVLVAGDA--------------------------------------------DQAFSIQSISK----
GLSA_STRCO/25-307-----MAVAELDGTVYGVGDW--------------------------------------------REPFSAQSLTK----
GLSA_CAUCR/24-306-----MAVRMVDGDEHVIGDA--------------------------------------------DEGFSVQSITK----
GLS1_CAEEL/171-458-----VSLCTVDGQRASFGDV--------------------------------------------KHPFCVQSVSK----
GLS2_CAEEL/174-460-----MSVCTIDGQRKMWGDA--------------------------------------------LKPFCLQSVSK----
GLSK_HUMAN/244-530-----VSVCTVDGQRHSTGDT--------------------------------------------KVPFCLQSCVK----
GLSA1_ECOLI/24-308-----VAIVTCDGNVYSAGDS--------------------------------------------DYRFALESISK----
GLSA2_YERPE/47-331-----ICMVGTNGKIHSAGDV--------------------------------------------DYEFTIMSVSK----

PF07930

DAP_OCHAN/334-421----------------------------------------------------------------------SSEVSR----
DAP_BRUME/334-421----------------------------------------------------------------------PAKPVR----

PF00768

D2AEU9_SHIF2/32-265L----M----T----AMV------V-LDAR.----.-----L----------------P---------LD----EKL---
DACD_ECOLI/25-263L----M----T----GYV------V-DRAID----S-----H----------------R---------IT----PDD---
DACA_ECOLI/35-273M----M----T----SYV------I-GQAMK----A-----G----------------K---------FK----ETD---
DACX_STRSK/26-273I----M----T----AKV------V-LAQSN----.-----L----------------N---------LD----AKV---
Q54906_STRPY/17-270L----L----T----TYL------V-YKEVS----K-----G----------------K---------LN----WDS---
DACF_BACSU/26-261I----M----T----MLL------I-MEALD----K-----G----------------K---------IK----MSD---
DACA_HAEIN/27-263M----M----T----SYV------V-GVALK----Q-----G----------------K---------IH----NTD---
DACB_BACSU/21-251I----M----T----AVL------A-IESG.----.-----.----------------.---------.K----MDQ---
DACC_ECOLI/28-266I----M----T----SYV------V-GQALK----A-----D----------------K---------IK----LTD---
DACA_GEOSE/27-286M----M----T----EYL------L-LDAIK----A-----K----------------R---------VK----WDQ---
PBP5_PSEAE/19-261L----M----T----AMV------V-LDSK.----.-----L----------------P---------LD----EVL---
P72518_STRPN/17-269L----I----T----VYL------V-YEALE----N-----G----------------S---------IT----LST---

PF13354

D3R279_CLOB3/167-362L....P....L....ALI......L-LDQIA....E.....G----------------E---------FS....LQT...
C5NV57_9BACL/95-285V....I....Y....AMK......I-YDRIR....N.....G----------------E---------IS....KDA...
A3DEM2_CLOTH/156-348I....P....L....NLY......V-YDMIR....K.....G----------------M---------LD....PMT...
C7IRL1_THEET/200-392V....P....L....NFY......L-YTLIT....D.....G----------------K---------ID....PNM...
D9TSS5_THETC/196-388V....P....L....NFY......L-YTLIT....E.....G----------------K---------ID....PNM...
B0TAI9_HELMI/87-282V....P....L....VLF......L-YALAL....D.....K----------------R---------LD....LDE...
D1C5R0_SPHTD/31-238I....P....L....MIA......V-YRAVD....A.....G----------------E---------RA....LTD...
C0ZJI1_BREBN/25-238V....P....I....M.........-.AAVFAASEQ.....G----------------H---------FR....LDD...
D1CF14_THET1/24-242V....P....I....MIE......L-FRRVY....E.....D----------------N---------VS....LDD...
C7H338_9FIRM/28-242A....F....I....LAV......L-YLQAS....R.....G----------------R---------AD....LEE...
Q1J1L5_DEIGD/60-275V....P....L....LLL......A-LSEAQ....A.....G----------------R---------LD....LSG...
Q9RX82_DEIRA/25-240V....P....L....LLF......A-LEQAG....R.....G----------------D---------LD....LIE...
C1CYR0_DEIDV/25-240V....P....L....L.........-.IQAL....QEA.QTG----------------R---------LN....LRE...
D7BH62_MEISD/25-238L....P....M....L.........-.CYAL....S.....T----------------G---------AD....LEQ...
A4FGH3_SACEN/23-225V....L....V....MLT......A-LREVQ....R.....G----------------G---------LA....LDT...
D1C8L0_SPHTD/32-252T....A....V....LVE......L-MRQAH....E.....E----------------G---------LD....LQE...
Q67QZ3_SYMTH/26-238L....A....I....F.........-.YEVMRQAGE.....G----------------R---------LD....LSE...
C6B6H3_RHILS/32-251T....S....I....MMA......A-LKAAH....E.....G----------------R---------LD....LDE...
Q7CSB1_AGRT5/27-246T....S....I....M.........-.MAVLKAASE.....G----------------R---------ID....LDQ...
C7PH33_CHIPD/45-252V....P....I....LVG......V-FDKIE....K.....G----------------E---------LS....YHQ...
C6Y376_PEDHD/48-255V....P....I....LIG......L-FDKIE....K.....G----------------E---------LS....YHQ...
C2G3X8_9SPHI/50-256V....P....I....L.........-.AGVFNKIGK.....G----------------E---------LK....YND...
D2QMG0_SPILD/51-257I....P....I....QCG......L-FDKIH....K.....G----------------E---------LT....YGQ...
C1ACM4_GEMAT/56-266V....P....V....L.........-.VALFDLAEQ.....K----------------Q---------LT....LDD...
D3Q045_STANL/73-283L....P....V....AVN......V-LTKVD....S.....G----------------K---------IS....LAN...
D3PY77_STANL/72-283V....P....V....A.........-.IAVL....DKV.DRG----------------E---------LK....IDQ...
B5HHK2_STRPR/25-261V....L....L....V.........-.LEFARQSAA.....G----------------Q---------LD....PRE...
C3JVC0_RHOER/42-274I....P....V....VLQ......Y-AREVA....A.....G----------------T---------LD....PTE...
D2ARC0_STRRD/23-261V....P....I....VLE......Y-ARQAA....A.....G----------------T---------LE....RTE...
Q6WSB4_9PSEU/29-266V....P....I....A.........-.LELARQGAD.....G----------------E---------LD....LGE...
D5UMR9_TSUPD/34-269I....V....L....LVA......A-CRAFD....S.....G----------------R---------LD....PRQ...
C7Q8V4_CATAD/62-288V....C....L....LAA......F-YREAA....A.....G----------------R---------LD....RTR...
C3JVV9_RHOER/30-276V....P....V....M.........-.LEVAAQASE.....G----------------R---------IQ....LAD...
D3Q9I0_STANL/20-254L....F....I....AWE......F-RCRVA....E.....G----------------T---------ID....PAT...
D7AWL0_NOCDD/28-268V....P....L....AVA......T-LERIR....A.....G----------------E---------ID....GAE...
BLAB_STRCI/29-280L....P....L....A.........-.LATL....ERI.RLG----------------E---------VD....GAQ...
Q769D8_9ACTO/28-268V....P....L....ALA......T-AERIR....R.....G----------------E---------LD....GAA...
C6WEM7_ACTMD/23-263V....P....L....AVA......T-LERVR....R.....G----------------E---------LD....GAT...
A7VJM6_9MICO/21-237V....F....L....LHT......A-LQMFK....D.....G----------------T---------LD....LEE...
Q6AHF8_LEIXX/31-247V....L....L....L.........-.VEVA....ARL.QSG----------------G---------LS....SLA...
A4AF02_9ACTN/57-273I....L....L....L.........-.IEVS..........A----------------R---------FE....NRE...
A5CUW5_CLAM3/55-271V....L....L....LVE......L-SARMT....S.....G----------------D---------LS....PLH...
A3THA9_9MICO/30-246V....F....A....LIE......L-AERLR....D.....G----------------R---------LA....ADQ...
C2D5A8_LACBR/26-222L....A....I....L.........-.NDVL....D.....S----------------H---------FD....LDK...
D3L9M4_OENOE/30-223L....M....I....A.........-.DYYC..........S----------------N---------FS....LAD...
C9ACN0_ENTCA/30-228L....V....L....YAY......Y-LEQIN....E.....E----------------K---------ID....PQQ...
Q92FA7_LISIN/23-230L....P....I....YLY......F-FEKIA....K.....K----------------E---------LD....LQT...
C4VQE7_9LACO/23-217L....G....I....A.........-.LYIE....E.....E----------------K---------PD...TIDN...
D0R6B2_LACJF/24-218L....A....I....A.........-.LYIQ....E....VK----------------P---------QT....INN...
C2F946_LACPA/27-227L....G....I....A.........-.AFVK....EKA.ADD----------------P---------SQ....LER...
C2JUG5_LACRH/27-227L....G....I....A.........-.AYVKAQAQA.....D----------------S---------SQ....WQR...
Q74HJ8_LACJO/23-220L....A....I....A.........-.AYIE....D.....Q----------------W---------KKTPEVVDE...
Q1IIZ9_KORVE/54-260L....P....L....L.........-.VELW....RQSQTGT----------------G---------QK....LTD...
B9XGI6_9BACT/30-235I....P....V....L.........-.MEVY....KQA.HAG----------------K---------FS....LTD...
D1CAH8_SPHTD/29-234I....P....I....LVE......G-LRQAE....E.....G----------------T---------VR....LDQ...
C6JN74_FUSVA/22-213L....F....I....L.........-.MALN...........----------------K---------DE....YNK...
D3A9C2_9CLOT/37-244L....F....V....M.........-.TEAFTRFEE.....G----------------T---------LS....PDR...
C3WTB7_9FUSO/29-234L....L....I....LAE......L-MKKIF....E.....N----------------K---------FS....LSD...
C0WAD9_9FIRM/29-233L....L....V....LVE......L-CEEVR....R.....G----------------R---------AN....LKE...
A6TPV9_ALKMQ/24-228L....L....I....MIE......A-FCQVE....E.....K----------------K---------FQ....LNQ...
Q97MK6_CLOAB/29-233V....L....I....MAE......A-LNEVL....S.....G----------------N---------HA....LEE...
Q2B497_9BACI/33-237I....P....I....M.........-.MEAFFQAEE.....G----------------V---------LD....LSE...
D1BLB4_VEIPT/34-242V....L....I....M.........-.EYVF....HLA.RTE----------------Q---------LD....IND...
C9M6L1_9BACT/27-241L....P....I....LWD......L-FARAE....E.....G----------------S---------LN....LSE...
D2RJL4_ACIFV/65-269V....F....I....LAR......A-YEDLR....N.....G----------------S---------LS....RKE...
C4V1H1_9FIRM/88-292V....F....I....LGT......A-MEQVR....D.....G----------------R---------LS....LAQ...
C9LUU8_9FIRM/91-296V....F....I....LAC......A-MEKVK....A.....G----------------E---------LH....LDD...
D3LTR8_9FIRM/96-300V....F....I....LSA......A-MEQIK....Q.....G----------------K---------MS....FDQ...
A9B776_HERA2/21-222L....F....L....A.........-.WQWY..........T----------------T---------NQ....PGF...
C0WDD8_9FIRM/88-297P....Y....V....AAA......L-LDAVK....E.....G----------------N---------LS....LDE...
D2RLG2_ACIFV/74-285L....Y....V....A.........-.AGVLRQAED.....G----------------D---------LS....LDE...
Q8YNM1_NOSS1/217-419I....P....I....LVA......F-FQDVD....A.....G----------------K---------IR....LDE...
B2J7F0_NOSP7/218-420V....P....I....LLA......F-FQDVD....A.....G----------------K---------IR....LDE...
D7DW46_NOSA0/212-414I....P....I....LIT......F-FQDVD....A.....G----------------K---------IR....LDE...
A0ZAJ6_NODSP/233-435V....P....I....LIA......F-FQDVD....A.....G----------------K---------VR....LDE...
A0Z083_LYNSP/220-422V....P....I....LVA......F-FQAVD....E.....G----------------K---------IS....LNE...
B0CCE0_ACAM1/37-239I....P....V....LLA......F-FEDVD....A.....G----------------I---------ID....LDE...
B8HLP2_CYAP4/158-360T....P....I....LVA......F-FQDVD....A.....G----------------K---------IK....LDE...
B2IVV4_NOSP7/225-427L....P....I....LIA......F-FQDLD....A.....G----------------K---------VT....LQE...
B8HM72_CYAP4/205-407L....P....I....LVA......F-FQAVD....A.....G----------------K---------VR....LDE...
B7KDD6_CYAP7/166-368I....P....V....LVA......F-FEDVD....A.....G----------------K---------IY....LDE...
A8YG35_MICAE/134-336I....P....I....LVA......F-FEDVD....A.....G----------------K---------IR....LDE...
C7QSD1_CYAP0/172-374I....P....V....LVA......F-FEALD....A.....G----------------K---------IH....LDE...
Q55897_SYNY3/237-440I....P....V....AIA......F-FEAVD....Q.....G----------------K---------IQ....LHE...
Q5N617_SYNP6/75-277I....P....V....LAA......L-MEAVQ....Q.....G----------------K---------VR....LDE...
B4WI30_9SYNE/252-455L....P....I....LLA......F-FEDVD....A.....G----------------R---------ID....LMK...
Q2JKE0_SYNJB/180-382I....P....I....LLA......F-FQAVE....T.....G----------------Q---------VR....LDE...
C0GGV0_9FIRM/114-323T....L....Y....LAV......F-LEEVK....H.....E----------------R---------QS....LDA...
F1T3K7_9ACTN/155-354L....A....V....LCE......Y-MHAVD....N.....G----------------Q---------LD....PAD...
Q08XP3_STIAD/57-318L....G....V....MLE......V-MHQVD....Q.....R----------------Q---------LS....WEE...
A4VI25_PSEU5/54-317V....P....I....A.........-.LAVL....QGV.DDD----------------E---------FR....LDQ...
A4IY62_FRATW/49-258F....L....V....V.........-.GAIL....KQS.MTD----------------N---------KL....LNQ...
C6YW16_9GAMM/49-258F....L....V....V.........-.GAIL....KQS.MTD----------------N---------NL....LNK...
A7JMA9_FRANO/43-254F....L....L....V.........-.GAIL....DYD.MHN----------------Q---------GF....LDK...
C6YWK1_9GAMM/44-255F....L....L....V.........-.GAVL....EYD.MQH----------------K---------GF....LDK...
B9EC94_MACCJ/44-253V....I...NS....A.........-.LLIE....K....LG----------------M---------NN....LDK...
Q9X6W1_ECOLX/63-282F....H....L....A.........-.LAVLDKLDK.....E----------------N---------IS....IDK...
B6WTZ1_9DELT/61-280F....P....L....A.........-.VAVLEKMQQ.....E----------------H---------TP....LTT...
C3X8Y4_OXAFO/46-265F....P....I....A.........-.LAVLDKVDK.....G----------------E---------LR....FNQ...
C3X3G5_OXAFO/49-269F....P....I....ALS......V-LDRVD....R.....G----------------E---------LS....LEK...
C8C144_9ZZZZ/49-267F....H....I....A.........-.LAVLKKMEK.....E----------------G---------IP....LTA...
B3D802_BURM1/59-267V....V....A....A.........-.AAIL..........A----------------R---------AS....LDASLL
A6WDM1_KINRD/35-232G....L....A....L.........-.GKLL....RF...RG----------------P---------AA....LTR...
Q92Y19_RHIME/54-306V....V....V....AAA......V-MQAVD....D.....R----------------R---------IA....LGD...
B0T712_CAUSK/59-310A....PLGAAV....L.........-.AEVE....A.....G----------------R---------LR....LNE...
D5VFF5_CAUST/60-304V....P....V....L.........-.AAVM....AER.AAG----------------R---------LD....LNE...
Q2GBE0_NOVAD/96-299I....WLGAVL....L.........-.EAVD....Q.....G----------------E---------LS....LDQ...
C4VSL3_9LACO/99-291L....Y....V....LLA......Y-YKAVQ....D.....K----------------S---------LN....SAN...
D0DKJ8_9LACO/105-290L....F....L....L.........-.IALY....EQE.QKG----------------K---------MG....SRT...
Q5FIM3_LACAC/104-295L....F....L....L.........-.IALY....ENE.QQG----------------K---------MG....SKT...
C9M3W5_LACHE/79-269L....F....L....L.........-.IALY....EQE.QKG----------------K---------IG....SKT...
D6S2M9_9LACO/93-284A....F....L....LVG......L-YKEIE....Q.....Q----------------K---------IK....AAA...
Q55G30_DICDI/66-270L....W....V....L.........-.LSVFKDIEA.....G----------------L---------YT....LEK...
C3BL34_9BACI/43-240V....AIGFAV....A.........-.KMVE....E.....N----------------Q---------VR....WSD...
C2QCU8_BACCE/29-226V....AIGFAL....A.........-.KMVR....E.....K----------------K---------VS....WND...
C2Z8Y6_BACCE/25-222V....AIGFAV....A.........-.KMVK....D.....K----------------L---------IS....WND...
C2PG18_BACCE/23-220V....AIGFAV....A.........-.NMVK....N.....K----------------Q---------IS....WND...
B0AK42_BACAN/23-220VTIGFV....V....A.........-.QMVK....E.....N----------------K---------CN....WDD...
C2VCY9_BACCE/29-226V....V....IGFVAA.........-.QMVK....E.....N----------------K---------RN....WND...
Q112T9_TRIEI/199-405V....P....I....AVA......L-MQKVS....K.....E----------------N---------IS....LDT...
C8WKG4_EGGLE/143-342A....P....F....VAF.....AS-QDMVD....G.....G----------------R---------AS....LDE...
B1S8A7_9BIFI/117-306A....P...FI....M.........-.ALAS....T.....G----------------T---------ID....LNA...
A7A336_BIFAD/133-323A....P....Y....L.........-.ISLF....S....TG----------------T---------VD....LNS...
A4E932_9ACTN/111-301A....L....Y....A.........-.LYIC..........E----------------T---------LV....ESG...
A5G729_GEOUR/100-303V....P....V....MIAWLELAEK-DP..............----------------.---------RV....LKQ...
Q3DFC2_STRAG/213-406L....A....T....LYA......S-QEQVK....L.....G----------------K---------LS....LDS...
C2LQQ9_STRSL/215-408L....G....V....LYY......A-QERLS....Q.....K----------------K---------LS....LSD...
B4U5H8_STREM/213-406L....A....T....L.........-.YSVQ....KKL.KSG----------------S---------LS....EGK...
C5WDV2_STRDG/213-406L....A....P....LYS......V-QKQLQ....E.....K----------------K---------VT....ENK...
A4VS97_STRSY/211-404L....P....I....LYY......V-QEQLN....A.....G----------------Y---------ID....LTT...
A3CJX6_STRSV/212-405L....P....Y....LYY......V-QEQLD....Q.....K----------------K---------LS....LDQ...
A8B001_STRGC/211-404L....P....I....LYY......A-QEELN....Q.....G----------------K---------IT....LAQ...
D3H625_STRM6/207-400L....P....Y....LYY......A-QEKIN....E.....G----------------L---------YQ....LDT...
D4FQE8_STROR/207-400L....A....Y....LYY......A-QDKIN....Q.....G----------------E---------YT....LDS...
D2BLR7_LACLK/232-427I....P....I....LYW......T-QKRLN....E.....G----------------L---------AS....LDD...
C1I3T7_9CLOT/61-249M....M....I....L.........-.DQVF....E.....G----------------A---------IS....LED...
C7VVX9_ENTFL/70-261V....PLTMLV....A.........-.DTVA....S.....G----------------Q---------KK....WTD...
Q67RI7_SYMTH/15-208V....P....V....A.........-.LYAL....EQY.RAG----------------K---------IG....WGD...

PF00905

PBPH_BACSU/372-692G----A----T-------------V.LAGYQ----D-----G----------------I---------PH----YKY---
PBPF_BACSU/322-595P----L----A-------------VYGPAMQ----E-----K----------------K---------FK----PYS---
SP5D_BACSU/246-557I----I----T-------------L.AAALE----E-----Q----------------K---------VN----LKR---
PBPB_BACSU/268-577I----F----T-------------L.AAAMQ----E-----N----------------V---------FN----ANE---
Q45297_BACLI/374-591V----F----S-------------A.LLALE----S-----G----------------I---------IT----KND---
PBPA_MYCTU/160-484V----I----T-------------T.AAALA----A-----G----------------A---------TE----TEQ---
PBPA_BACSU/352-641P----I----L-------------DYGPVIE----N-----K----------------K---------WS----TYE---
Q51504_PSEAI/247-547P----F----S-------------M.SAALA----S-----G----------------R---------WK----PSD---
Q9ZHF7_BURPI/25-267L----A----L-------------A.VMGFD----H-----G----------------F---------LK----DEH---
PBPI_BACSU/263-574T----V----I-------------A.AAAIE----N-----N----------------M---------VK----PSQ---
P71707_MYCTU/310-601V----F----A-------------L.VAALE----Q-----G----------------.---------..----IGL---
Q51505_PSEAI/242-539P----F----S-------------M.SAALA----S-----G----------------K---------FD----ENS---
P72405_STRCL/273-546V----V----T-------------T.AALLQ----Q-----G----------------.---------MN----PEE---
Q59439_ENTHR/364-671M----I----T-------------A.AIGLD----N-----Q----------------T---------LN----PDE---
P73117_SYNY3/281-593P----V----I-------------V.ALAMN----E-----G----------------V---------LK----PED---
PBP2_HAEIN/279-618P----F----I-------------AVAAQTE----N-----V----------------I---------TP----NTT---
P96052_STRTR/367-698G----A----T-------------L.TAGWR----S-----G----------------A---------IY----GDQ---
Q9AEF8_9GAMM/23-259I----A----L-------------S.LMGFD----S-----G----------------I---------LK----DTL---
O54282_STASC/363-580I----Y----L-------------A.LMAFD----Q-----N----------------L---------LS----LNH---
Q98LR0_RHILO/12-247V----P----L-------------S.LIGYD----A-----G----------------I---------LS----DEH---
FTSI_ECOLI/260-555P----M----V-------------V.MTALQ----R-----G----------------V---------VR----ENS---
PBPX_STRPN/289-609V----M----M-------------L.AAAID----N-----N----------------T---------FP----GGE---
O07106_ENTFL/295-608L----F----T-------------T.AASME----Q-----G----------------Q---------FN----PNE---
Q9KHJ3_SHIFL/42-276I----A----L-------------S.LMAFD----A-----E----------------I---------ID----QKT---
PBP2_NEIFL/81-376P----F----T-------------I.AKALD----S-----G----------------K---------VD----PTD---
Q55926_SYNY3/76-292I----P----H-------------S.LFALD----A-----G----------------V---------VR----DEF---
Q9K4N2_STAHA/361-577I----Y----L-------------A.MFGLD----R-----H----------------I---------IN----DEN---
Q9F0V2_ACIBA/53-270M----L----N-------------A.LIGLE----N-----H----------------K---------AT----TNE---
O06214_MYCTU/338-656I----V----A-------------A.SAVIE----H-----G----------------L---------SS----PDE---
PBPC_BACSU/352-666P----I----A-------------A.AIGIK----N-----G----------------T---------LK----ADE---
YQGF_BACSU/352-682G----A----T-------------V.LTGLQ----T-----G----------------A---------IN----LNT---
PBP2_STRR6/343-671A----A----T-------------I.SSGWE----N-----G----------------V---------LS----GNQ---
PBP_STAAU/347-660I----L----T-------------A.MIGLN----N-----K----------------T---------LD----DKT---
Q9AEY7_PSEAI/35-252V----L----N-------------T.LIALE----E-----G----------------A---------IS----GEN---
Q9K319_AERHY/24-259I----P----L-------------A.LMGYD----S-----G----------------F---------LV----DEE---
Q53725_STAAU/268-579S----Y----G-------------L.AAAIQ----E-----G----------------A---------FD----PDK---
O26078_HELPY/280-589P----I----V-------------Y.SLLLD----K-----N----------------L---------IN----PKE---
Q9EY51_ACIBA/42-258I----P----H-------------T.LFALD----A-----G----------------A---------VR----DEF---
PBP2_ECOLI/271-609P----Y----V-------------AVSALSA----G-----V----------------I---------TR----NTT---
O33622_STRCH/299-660V----V----S-------------S.AGAVE----A-----G----------------.---------YD----FDG---
P94124_ACIBA/42-258I----P----H-------------T.LFALD----A-----G----------------A---------AR----DEF---
FTSI_HAEIN/280-572P----F----V-------------V.LTALQ----R-----G----------------V---------VK----RDE---

PF00144

Y4209_BACPE/17-329S----Y----I----GYA------V.AYAVQ----Q-----G................L.........IS----TDD---
Q9XWZ6_CAEEL/290-607L----V----T----AMT------IGELLAD----Y-----R................H.........ID----LLT---
Q9U3M7_CAEEL/420-758P----V----T----AAA------I.MLLID----K-----G................H.........FT----LDS---
YBBE_BACSU/52-423M----Y----A----TNF------ALQRLVS----Q-----G................K.........LD----VYE---
Q9YFA3_AERPE/8-341S----F----T----ALA------V.LALEE----E-----G................K.........LS----LDD---
AMPH_ECOLI/31-372L----M----T----SEM------L.VKLLD----Q-----G................T.........VK----LND---
Q9RKC5_STRCO/36-410G----V----A----AAV------P.LLLHR----R-----G................E.........LD----LDA---
O88012_STRCO/23-405P----V----T----SVA------V.LTLVE----E-----G................R.........LA----LDD---
Q53403_PSEFL/18-377T----F----T----AVT------A.LQLVA----E-----G................K.........LQ----LDA---
P72041_MYCTU/40-404A----I----T----ATV------V.HMLVE----R-----G................H.........FA----LDD---
Q98HG2_RHILO/72-389S----V----T----AIV------A.GTLEG----E-----G................V.........FD----PEA---
Q988B4_RHILO/18-370G----V----V----ALA------I.AMLVE----R-----G................R.........LD----YAA---
Q97ML5_CLOAB/11-343V----V----A----TNT------LFMIFLE----K-----G................L.........IS----VYD---
BLAC_STRAL/53-307T----L----S----SAA------V.LRDLD----R-----N................G.........EF----LSR---
Q9A2R7_CAUCR/45-374A----L----T----SLL------L.ADMVR----R-----G................E.........VR----LED---
Q9A3W5_CAUCR/42-393A----M----T----AAL------L.AMLVE----E-----G................R.........VE----WDA---
Q9A6I9_CAUCR/103-453T----F----T----WIT------L.MNEIE----A-----G................R.........MR----LDG---
PBP4_NOCLA/8-348V----Y----T----ATL------V.MQLVD----A-----G................E.........LR----LDT---
BLAC_BACSU/53-299V----L----A----AAA------V.LKKNS----I-----E................K...........----LNE---
Q9A862_CAUCR/42-382A----F----T----ALA------I.AAIAA----R-----G................T.........FA----LDA---
Q9I1G0_PSEAE/16-386P----I----V----SVA------A.LSLVD----E-----G................R.........LA----LDE---
Q9CE05_LACLA/7-308V----V----G----TGT------AVINLVL----A-----G................K.........LE----IDA---
AMPC_YEREN/37-388T----F----T----GVA------GEYAMQT----G-----I..........................MN----LND---
Q97FD2_CLOAB/68-427M----F----V----TTA------V.MKLVD----E-----G................K.........IE----LDA---
Q21569_CAEEL/51-419A----A----A----SLA------V.ALLYE----Q-----G................K.........LR----YDD---
Q9Y7D1_ASPTE/17-406L----L----T----TIM------A.LQCME----R-----G................L.........VD----LDE---
BLAC_BACCE/55-300A----L----A----AGV------L.LQQNS----I-----D................S...........----LNE---
BLC1_ECOLX/37-285V----M----A----VAA------V.LKKSE----S-----E................P.........NL----LNQ---
P74474_SYNY3/27-387S----F----T----SVL------LLQAEAE----N-----K..........................VN----LGD---
BLAC_STAAU/27-275A----I----N----SAI------L.LEQVP----Y-----N................K...........----LNK---
PBPX_BACSU/82-390A----L----I----ATA------I.LQLEE----K-----G................K.........LQ----TSD---
AMPC_LYSLA/32-381T----F----T----ATL------ASYAQVN----Q-----Q..........................LS----LAD---
AMPC_ENTCL/32-381T----F----T----GVL------GGDAIAR----G-----E..........................IS----LDD---
BLAC_CITDI/40-288T----M----V----AAA------V.LKQSE----T-----Q................H.........DI----LQQ---
Q48437_KLEPN/33-381T----L----T----ATL------GAYAAVK----G-----G..........................FE----LDD---
BLAC_STRLA/46-298T----L----A----VAA------V.LRDLD----R-----D................G.........EF----LAT---
P71778_MYCTU/39-398G----M----T----ATV------I.HRLAD----R-----G................L.........ID----YEA---
Q9ABH2_CAUCR/19-369A----V----A----ALL------I.ARLVD----E-----G................R.........LA----YDQ---
Q9ZDR6_RICPR/33-395P----F----T----AAG------I.LKLQE----Q-----E................L.........LN----IND---
Q99QC1_ENTAE/36-381T----L----T----ATL------GAYAVVK----G-----A..........................MQ----LDD---
AMPC_PSYIM/50-399T----F----A----ATL------ASYSELN----G-----T..........................LS----LDD---
Q97PZ0_STRPN/6-304V----V----G----VGT------VCTFLWE----I-----G................Q.........LD----IDR---
BLAC_RHOCA/38-285V----P----V----CGA------I.LARWD----A-----G................R.........LS----LSD---
Q9RK50_STRCO/17-371V----M----T----SLV------A.HLLVK----S-----G................R.........IG----YDT---
BLAC_NOCLA/49-295A----L----A----AAA------V.LDSTT----P-----Q................Q...........----LDQ---
O05900_MYCTU/63-408S----V----G----ATV------V.AHAVT----D-----N................V.........VT----WDT---
O86739_STRCO/48-382V----V----T----AAT------V.LRLAA----Q-----D................E.........ID----LDA---
AMPC_PSEAE/38-388T----F----T----ATL------AGYALTQ----D-----K..........................MR----LDD---
P94288_BACCE/53-388T----F----T----ATV------V.LQLAE----E-----N................R.........LN----LDD---
Q9X5Q0_STRLA/21-361P----V----A----ALA------V.HALAE----R-----G................L.........IG----LDR---
O62481_CAEEL/42-406P----I----T----ATL------A.AQCVE----N-----G................T.........LD----LDE---
Q98JC7_RHILO/43-383P----V----S----ATV------V.AALVS----D-----G................I.........VS----WDS---
YFEW_ECOLI/43-414M----Y----A----TNF------ALQKLMS----E-----G................K.........LH----PDD---
ESTB_BURGA/22-391P----I----V----ALA------V.LRLVA----R-----G................E.........LA----LDA---
P71988_MYCTU/60-399T----F----T----GTV------M.MRLVE----R-----G................K.........VD----LDS---
BLAC_BACVU/48-310V----H----Q----ALA------LCNDFDN----K-----G..........................IS----LDT---
Q9X8U8_STRCO/16-340T----F----T----AVL------V.LRLRD----E-----G................V.........LD----LGD---
BLAC_PROVU/10-258V----M----A----VAA------I.LKESE----K-----Q................A.........GL----LDK---
BLAC_STRFR/46-298T----I----A----VAA------V.LRDLD----R-----D................G.........EV----LAR---
Q9Z4V4_STRFR/44-398T----F----V----AAT------V.LQLVG----E-----G................K.........LS----LDD---
AMPC_CITFR/32-381T----F----N----GVL------GGDRIAR----G-----E..........................IK----LSD---
BLAC_STRCE/50-302T----L----A----AAA------V.LRDLD----H-----D................G.........SQ----LAR---
Q9HT32_PSEAE/60-409S----I----S----STL------V.GAAVQ----Q-----G................L.........LA----LDQ---
AMPC_ECOLI/28-377T----F----T----GVL------GGDAIAR----G-----E..........................IK----LSD---
Q9X5R0_STRLA/136-514P----L----L----SVA------L.GRLWE----A-----G................A.........YD----PYL---
FMTA_STAAU/48-386F----S----T----GLL------L.KQLEE----E-----H................K.........IN----IND---
Q18384_CAEEL/50-416S----V----T----AIC------F.AILVD----R-----G................L.........LK----YSD---
Q9K4I2_STRCO/49-431L----F----T----SIL------A.VQQLE----R-----G................A.........LE----LAT---
Q9HW54_PSEAE/59-378S----L----L----ATL------L.GVAEG----E-----G................R.........FQ----LDD---
Q9LCC8_OCHAN/4-353S----F----I----ATG------L.HLLVQ----D-----G................T.........VD----LDE---
BLAC_BACLI/50-296A----L----T----VGV------L.LQQKS----I-----E................D...........----LNQ---
Q9K351_HAFAL/39-387T----F----A----ATL------ASYAQVS----G-----K..........................LS----LDQ---
O53190_MYCTU/21-384A----L----T----ATC------V.HQLVD----R-----G................E.........LD----LHA---
BLA1_PASHA/50-296A----L----L----AGA------V.LQSLP----E-----K................D...........----LNR---
Q9RWA9_DEIRA/32-336P----F----T----AAL------A.SALVR----D-----G................R.........LD----WNA---
Q9PCY3_XYLFA/65-407A----F----A----SAM------A.GLLVN----D-----G................I.........LS----WNS---
Q9XA95_STRCO/30-359T----F----A----ALL------L.TRLIR----R-----G................V.........VT----GAE---
Q9RYU2_DEIRA/7-325P----L----F----TAR------EVLRAAE----R-----G................Q.........LD----VDD---
BLE1_PSEAI/35-292L----H----L----AML------V.LHQVD----Q-----G................K.........LD----LNQ---
Q988N4_RHILO/12-356T----F----T----AVA------V.MQLAE----K-----G................L.........VD----LDV---
P95207_MYCTU/41-390S----Y----V----ATL------L.LKLVD----E-----K................K.........LR----LDD---
Q9A7L6_CAUCR/54-390T----V----A----GTL------T.ARLAA----D-----G................A.........LS----LQD---
BLA3_BACCE/59-305S----L----A----VGA------L.LRQNS----I-----E................A...........----LDE---
AMPC_PROST/35-383T----F----T----ATL------ATYAQIQ----G-----K..........................LD----FSQ---
Q7DFY3_SALEN/31-280V----L----L----CGA------V.LSRVD----A-----G................Q.........EQ----LGR---
Q9A3L3_CAUCR/99-483P----I----T----SVA------F.MMLVE----E-----G................L.........AS----LDD---
BLA1_STRCI/57-318A----L----Q----AGA------I.LAQVL----R-----D................GREVRRGAEADG----MDK---
Q9A9U2_CAUCR/29-330S----V----T----ALL------A.TIAVD----R-----G................L........ISS----LAD---
Q21523_CAEEL/50-420A----I----G----AIV------I.AKLID----E-----Q................R.........LT----YDD---
Q44050_ARTGO/17-368G----V----S----GLV------I.ALLVQ----D-----G................F.........LD----LDA---
PBPE_BACSU/9-348P----F----T----ALG------I.ILLEE----K-----G................I.........LG----YED---
LACT2_CAEEL/79-448A----V----G----AVC------V.AMLVD----R-----G................H.........IS----YDD---
Q9I4S7_PSEAE/29-387T----F----T----AVA------V.LQLVA----E-----G................K.........LE----LDA---
Q9RER5_ENTAE/32-381T----F----T----GVL------GGDAVAR----G-----E..........................IK----LSD---
Q9V2D6_PYRAB/6-348S----F----T----ALA------I.MKLVE----E-----G................G.........LS----LDD---
Q9C2S3_NEUCS/19-388S----F----V----IAC------L.AKVRL----E-----GKKAKFEWSTPMKDLVDG.........FN----TDD---
Q9A800_CAUCR/77-466P----V----T----GVA------M.MMLYE----Q-----G................L.........WR----LDD---
Q9XU43_CAEEL/52-422A----V----C----SIV------I.AVMVD----R-----G................L.........LN----YAD---
Q9I2U5_PSEAE/43-384L----L----I----ASA------T.LQLAE----R-----G................Q.........LS----LDA---
Q9AAM2_CAUCR/38-371T----F----T----GLL------LAHAIKE----R-----R..........................LV----ASD---
Q99Y64_STRP1/9-304V----V----G----VAT------ICNILLN----N-----G................T.........LA----LDD---
Q9A7Z9_CAUCR/50-429P----V----T----GVA------M.MILFE----E-----G................K.........WT----LDD---
Q9AI08_PHOLU/55-396L----M----T----SEI------M.IKLEE----D-----K................I.........LR----STD---
Q9RKP5_STRCO/2-343L----F----T----AVA------A.VQQIE----R-----G................T.........LG----IDA---
BLAC_STRBA/57-305A----L----Q----AAV------V.LSTYS----L-----D................G...........----LDK---
DAP_OCHAN/9-333Q----F----T----CAV------L.LDAVG----E-----P..........................EL----LDD---
P95290_MYCTU/53-411G----L----A----ATV------I.HRLVD----R-----G................L.........LS----YDA---
BLO1_KLEOX/37-285V----M----A----AAA------V.LKQSE----S-----N................P.........EV----VNK---
FLP_STAAM/43-372A----F----T----GLA------I.LKLAQ----E-----G................R.........LN----LND---
Q9A2D7_CAUCR/97-472P----V----T----GVA------L.MQLWE----Q-----G................K.........FG----LDD---
BLA2_STRCI/60-307A----L----E----CGA------V.LDKHT----D-----R................E...........----MDR---
AMPC_MORMO/31-379T----F----T----GVL------GAVSVAK----K-----E..........................MT----LND---
BLAC_PROMI/36-285T----L----A----CAN------V.LQRVD----L-----G................K.........ER----IDR---
P71981_MYCTU/64-388S----L----V----AAV------V.GALHG----A-----G................A.........IE----LDA---
BLAC_YEREN/39-287F----M----L----AAA------V.LDQSQ----S-----Q................P.........NL----LNK---
Q9EX97_OCHAN/38-387T----F----T----AML------GGYGLAT----G-----A..........................FS----LSD---
BLAC_STRAU/51-304A----L----A----AAA------V.LRDVD----A-----R................R.........EF----LTK---
AMPC_SERMA/27-374T----F----T----ATL------AVYAQQQ----S-----K..........................LS----FKD---
BLAC_KLEPN/29-278V----L----L----CGA------V.LARVD----A-----G................L.........EQ----LDR---
O87861_STRAQ/19-378G----P----T----ALC------A.HVLAD----R-----G................L.........LD----LDA---
BLC3_PSEAI/29-277T----I----A----CAK------L.LYDAE----Q-----G................K.........VN----PNS---
Q9WXD6_BRELN/11-387A----L----T----GTV------A.LQLVE----S-----G................D.........LD----LDA---
Q44260_AERSO/33-381T----Y----T----ATL------GAYAVVK----G-----G..........................FK----LDD---
P74200_SYNY3/25-369L----V----T----AWG------V.MKLVE----M-----G................Q.........IN----LDD---
Q9F3F0_STRCO/31-381T----F----T----AAA------V.LQQVE----Q-----G................R.........IV----LDA---
Q9L8D3_SORCE/35-419A----V----T----ATA------V.MMLVE----E-----G................K.........LD----LDS---
Q9KEY4_BACHD/34-367S----L----T----ALA------I.VKLLD----E-----N................K.........IM----LDD---

PF02113

Q55728_SYNY3/46-476L----I----TTAMALQELGPNFRFTTQVYQ......RDGGK----------------K---------VQVISSGDP---
O85665_NEIGO/13-461L----V----TAFAAFKTFGSNYRWATEFKSNGTVNDGTLDG----------------N---------LYWAGSGDP---
O06380_MYCTU/72-454I----L----TAAAALLTLDRQARISTRVVAGG....QNPQG----------------P---------VVLVGAGDP---
O69539_MYCLE/72-454L----L----TAAAALLTLDRQTRISTRVVAAG....PNAQG----------------P---------VVLVGAGDP---
DACB_ECOLI/19-469V----I----TALAALIQLGPDFRFTTTLETKGNVENGVLKG----------------D---------LVARFGADP---
DACB_HAEIN/26-472V----F----TAVAAKLALDDQFQFETALLSNGKIQNGNLDG----------------N---------LIVRFTGDP---
DACC_BACSU/36-491L----L----TAAAALSVLGENYSFTTEVRTDGTLKGKKLNG----------------N---------LYLKGKGDP---
DAC_ACTSP/54-508L----F----TAAAALEVLGADHSFGTEVAAESAPGRRGEVQ----------------D---------LYLVGRGDP---
Q9Z541_STRCO/78-446L----A----TATTALTLLGANHEFTTKVVYG........EG----------------T---------LTLVGGGDR---

PF04960

GLSL_HUMAN/177-463P----L----T-------------YAISIST----L-----G----------------T---------DY----VHK---
GLSA_RHIEC/22-307V----F----M-------------LTLALGK----V-----G----------------E---------G.----LWK---
GLSA_VIBCH/22-306V----L----S-------------LTLAMGL----Y-----Q----------------P---------DE----LWS---
GLSA1_BACHD/22-308V----I----A-------------LALALLD----V-----G----------------E---------EA----VFS---
GLSA2_BACSU/23-309V----L----S-------------LALVLME----Y-----G----------------K---------DK----VFS---
GLSA2_BACHD/33-324I----I----N-------------FIAACLD----R-----G----------------I---------TY----VLD---
GLSA1_BACSU/32-327V----I----S-------------FIAACMS----R-----G----------------I---------PY----VLD---
GLSA2_ECOLI/24-308V----L----S-------------LVVAMRH----Y-----S----------------E---------EE----IWQ---
GLSA_PSEAE/19-302V----F----S-------------LVQAIQH----S-----G----------------E---------D.----IWQ---
GLSA_RHILO/28-313V----F----T-------------LTLALGN----V-----G----------------D---------A.----LWQ---
GLSA_STRCO/25-307V----F----T-------------LALDLAR----E-----G----------------D---------A.----LWE---
GLSA_CAUCR/24-306V----F----A-------------LGLALNR----L-----G----------------D---------E.----IWT---
GLS1_CAEEL/171-458A----F----N-------------YAIVASD----L-----G----------------A---------DV----VHS---
GLS2_CAEEL/174-460P----F----T-------------YALVHDD----I-----G----------------P---------EE----LHA---
GLSK_HUMAN/244-530P----L----K-------------YAIAVND----L-----G----------------T---------EY----VHR---
GLSA1_ECOLI/24-308V----C----T-------------LALALED----V-----G----------------P---------QA----VQD---
GLSA2_YERPE/47-331P----F----V-------------FALVCQA----I-----G----------------A---------KT----ARE---

PF07930

DAP_OCHAN/334-421V----E----A---------------DSAWF----------G----------------S---------------WLD---
DAP_BRUME/334-421A----Q----A---------------NPGWF----------G----------------S---------------WLN---

PF00768

D2AEU9_SHIF2/32-265--KV-----------------------DIS-Q--TP-------E--MKG.----....-----.VYSRVR--.LNS-E--
DACD_ECOLI/25-263--IV-----------------------TVG-R--DA-------W--AKDN----PVFV-----GSSLMFL--KEGD-R--
DACA_ECOLI/35-273--LV-----------------------TIG-N--DA-------W--ATGN----PVFK-----GSSLMFL--KPGM-Q--
DACX_STRSK/26-273--TI-----------------------QKA-Y--SD-------Y--VVAN----....-----KPSQAHL--IVGD-K--
Q54906_STRPY/17-270--PV-----------------------TIS-N--YP-------Y--ELTT----..NY-----TISNVPL--DKR.-K--
DACF_BACSU/26-261--KV-----------------------RTS-E--HA-------A--SMG.----....-----.GSQIFL--EPGE-E--
DACA_HAEIN/27-263--MV-----------------------TIG-E--SA-------W--GRN.----..FP-----DSSKMFL--DLNT-Q--
DACB_BACSU/21-251--TV-----------------------TVS-A--NA-------V--RTEG----....-----..SAIYL--TEGQ-K--
DACC_ECOLI/28-266--MV-----------------------TVG-K--DA-------W--ATGN----PALR-----GSSVMFL--KPGD-Q--
DACA_GEOSE/27-286--MY-----------------------TPS-D--YV-------Y--RLSQ----..DR-----ALSNVPL--RKDG-K--
PBP5_PSEAE/19-261--PI-----------------------AIS-E--TS-------E--MRG.----....-----.VFSRVR--.VGS-Q--
P72518_STRPN/17-269--PV-----------------------DIS-D--YP-------Y--QLTT----..NS-----EASNIPM--EAR.-N--

PF13354

D3R279_CLOB3/167-362..VL-----------------------TYE.S..DD.......Y..E..G----..GS.....GTLQ.YS..P.IG.G..
C5NV57_9BACL/95-285..DI-----------------------VYN.E..KF.......L..E..D----..GN.....GQITNSQ..K..K.D..
A3DEM2_CLOTH/156-348..SL-----------------------EYT.E..ED.......F..E..G----..GT.....GIIW.NN..ESFG.K..
C7IRL1_THEET/200-392..KV-----------------------QYT.Q..AD.......Y..E..G----..GA.....GSIQ.AD..P.VG.S..
D9TSS5_THETC/196-388..EV-----------------------QYT.S..QD.......Y..E..S----..GS.....GSIQ.YD..P.VG.T..
B0TAI9_HELMI/87-282..TM-----------------------TLT.S..SD.......L..A..P----..SS....GGLWS.YL..P..G.R..
D1C5R0_SPHTD/31-238..RI-----------------------VLR.A..AD.......K..A..P----..GS.....GVLL.HL..H..D.G.L
C0ZJI1_BREBN/25-238..QL-----------------------VLR.Q..ED.......L..V..G----..GS.....GILY.AL..S..P.G.L
D1CF14_THET1/24-242..RL-----------------------ILE.D..RF.......R..T..G----..GS.....GILK.EF..R..S.G.L
C7H338_9FIRM/28-242..EI-----------------------TYE.A..SQ.......F..V..D----..GS.....GMLR.AL.GV..G.A..
Q1J1L5_DEIGD/60-275..RV-----------------------TLR.A..ED.......R..V..P----..GA.....GVLHELM..P..G.L..
Q9RX82_DEIRA/25-240..RV-----------------------TLR.A..ED.......R..V..P----..GA.....GVLH.EL..G.LG.L..
C1CYR0_DEIDV/25-240..RV-----------------------TLE.A..AD.......R..V..P----..GS.....GILY.EL..G..A.G.L
D7BH62_MEISD/25-238..KI-----------------------SIR.P..ET.......V..G..L----..GT.....GILK.EL..S..P.G.L
A4FGH3_SACEN/23-225..EV-----------------------RFP.D...E.......R..V..G----..GA.....GVLK.DL..P..G.L..
D1C8L0_SPHTD/32-252..RM-----------------------TMT.A..SD.......I..V..G----..GS.....GVLK.EL..G..P.G.L
Q67QZ3_SYMTH/26-238..PR-----------------------ELR.T..ED.......K..V..P----..GC.....GVLR.DL..S..P.G.I
C6B6H3_RHILS/32-251..RI-----------------------TYE.K..RF.......A..E..E----.VAS.....GMFR.YL..T..P.G.I
Q7CSB1_AGRT5/27-246..PV-----------------------TYE.K..RL.......A..E..E----.VAS.....GMFR.YM..T..P.G.I
C7PH33_CHIPD/45-252..PL-----------------------MYR.D..SI.......K..Y..G----..GS.....GLMQ.FF..K..D.S.T
C6Y376_PEDHD/48-255..PL-----------------------MYR.D..SI.......K..Y..G----..GS.....GIMQ.FF..K..D.S.S
C2G3X8_9SPHI/50-256..KF-----------------------IYR.Q..SR.......A..Y..G----..GS.....GLMQ.FF..K..D.S.V
D2QMG0_SPILD/51-257..TL-----------------------IYK.D..S........L..H..Y----..DD.....GIVG.SL..K.DG.A..
C1ACM4_GEMAT/56-266..PI-----------------------VLT.E..ID.......K..V..G----..GA.....GQLQ.FL..R.TP.L..
D3Q045_STANL/73-283..KM-----------------------RVE.D..PY.......I..V.WD----..GD.....GTIP.YD..GSYP.S..
D3PY77_STANL/72-283..LI-----------------------QVT.A..DI.......I..A..E----.DGD.....GIFR.LD..DAYP.S..
B5HHK2_STRPR/25-261..RV-----------------------RVT.S..EH.......R..L..G----..GW.....GTGG.CL..D..D.V..
C3JVC0_RHOER/42-274..HA-----------------------TVT.A..EF.......R..S..G----..GI.....GIGG.CA..D..D.V..
D2ARC0_STRRD/23-261..RL-----------------------TVT.A..AD.......K..D..G----..GI.....GTSG.CA..D..D.V..
Q6WSB4_9PSEU/29-266..PV-----------------------TVP.P..GH......PT..P..S----..PY.....GLAT.FR..H..E.I..
D5UMR9_TSUPD/34-269..RV-----------------------TVDPR..TA.......T..P..G----..PT.....GIAT.FD..D..P.V..
C7Q8V4_CATAD/62-288..QI-----------------------DIT.A..AE.......R..T..P----..GL.....SGIAVMR..D..A.V..
C3JVV9_RHOER/30-276..RI-----------------------KVP.A..DR.......R..T.IG----..PS.....GISA.MT..D..D.V..
D3Q9I0_STANL/20-254..PI-----------------------RVT.A..AD.......R..L..G----..GT.....GTAG.FR..H..D.A..
D7AWL0_NOCDD/28-268..QV-----------------------LVQ.P..GR.......I..TTPG----..PT.....GVSR.FR..H..P.A..
BLAB_STRCI/29-280..QI-----------------------EVA.P..GR.......I..T..T----PGPT.....GLSR.FR..H..P.A..
Q769D8_9ACTO/28-268..AI-----------------------DVQ.P..GR.......I..TTPG----..PT.....GLTR.FR..H..P.A..
C6WEM7_ACTMD/23-263..RV-----------------------EVRPA..PD.......A..P..P----..GS.....PGLSWFR..H..P.V..
A7VJM6_9MICO/21-237..RL-----------------------HRR.P..SE.......R..V..D----..ES.....GIWY.LM..E..Q.D..
Q6AHF8_LEIXX/31-247..LL-----------------------DRA.P..QD.......A..V..G----..DS.....GIWQ.HL..Q..V.P..
A4AF02_9ACTN/57-273..FA-----------------------PYG.I..LD.......K..V..P----..GASVGAAGLWQ.HL..Q..A.P..
A5CUW5_CLAM3/55-271..LV-----------------------DRR.L..DD.......E..G..G----..TA.....GLWR.HL..V..V.P..
A3THA9_9MICO/30-246..LL-----------------------DRR.S..VA.......P..V..A----..DS.....GLWQ.HL..S..T.D..
C2D5A8_LACBR/26-222..EI-----------------------HVR.R..DK.......L..V..G----..GA.....GVLQ.LL..S..E.R..
D3L9M4_OENOE/30-223..LQ-----------------------KQT.QKISQ.......G..V..G----..GS.....GVIQ.IL..D..Q.K..
C9ACN0_ENTCA/30-228..LI-----------------------GVN.A..VD.......L..T..G----..GA.....GVIR.LF..P..Q.K.K
Q92FA7_LISIN/23-230..DF-----------------------QIP.S..EK.......V..V..A----..GA.....GIIQ.IL..P..Q.K..
C4VQE7_9LACO/23-217..TL-----------------------NLS.S..DD.......I..V..G----..GA.....GIIN.RL..S..I.K..
D0R6B2_LACJF/24-218..EI-----------------------TLS.I..KN.......V..V..G----..GA.....GIIN.RL..S..I.K..
C2F946_LACPA/27-227..QV-----------------------TLP.E..S...........V..G----..GA.....GVLR.FM..S..P.Q..
C2JUG5_LACRH/27-227..KV-----------------------VLP.R..P...........V..G----..GA.....GVLR.FM..A..D.S..
Q74HJ8_LACJO/23-220..KM-----------------------EVT.D..LS.......R..V..R----..GA.....GIIG.DL..R..R.T..
Q1IIZ9_KORVE/54-260..LY-----------------------TFR.K..ED.......V..V..P----..DS.....AIME.NL..T.PG.V.S
B9XGI6_9BACT/30-235..TR-----------------------RIE.K..QD.......K..T..S----..GS.....GILF.EL.GD..G.T.V
D1CAH8_SPHTD/29-234..MV-----------------------PVP.D..DA.......K..V..G----..GF.....GILK.EL..T..S.V.T
C6JN74_FUSVA/22-213..KI-----------------------ELK.K..ED.......K..V..G----..GC.....GILK.VM..E..D.G.L
D3A9C2_9CLOT/37-244..II-----------------------RMR.R..ED.......C..V..P----..SC.....GALT.YL..H..D.G.I
C3WTB7_9FUSO/29-234..TV-----------------------MMA.N..FM.......K..I..G----..GD.....GVLK.EL.NT..G.H..
C0WAD9_9FIRM/29-233..AI-----------------------SIL.G..PA.......I..T..G----..GD.....GIIK.EL..K.IG.H..
A6TPV9_ALKMQ/24-228..SL-----------------------TIP.K..QD.......Q..I..P----..HS.....M.TT.DL..E..E.N..
Q97MK6_CLOAB/29-233..KI-----------------------EIK.S..SD.......K..V..N----..YS......IVT.CL..T..N.K..
Q2B497_9BACI/33-237..QV-----------------------CIG.G..IE.......K..A..G----..GA.....GIIQ.SL..S..V.T.A
D1BLB4_VEIPT/34-242..TV-----------------------PLS.R..TP.......R..V..E----..GG.....GALQ.EL..V..G.K.H
C9M6L1_9BACT/27-241..TI-----------------------VVP.S..EK.......R..V..D----..GG.....LLHK.FS..A..S.P..
D2RJL4_ACIFV/65-269..TF-----------------------TLT.P..EN.......V..V..G----..GA.....GVLQ.GR..P.YG.T..
C4V1H1_9FIRM/88-292..TL-----------------------TLR.A..AD.......K..V..G----..GA.....GVLS.GY..A.DG.S..
C9LUU8_9FIRM/91-296..VL-----------------------RLE.E..VD.......K..V..G----..GA.....GVITGYR..A..G.T..
D3LTR8_9FIRM/96-300..TI-----------------------TLQ.E..AD.......K..V..G----..GA.....GSLC.GY..P..D.G.S
A9B776_HERA2/21-222..DV-----------------------LIS.E..QL.......I..V..D----..LD.....GSLA.QA..I..G.S..
C0WDD8_9FIRM/88-297..TV-----------------------TVT.A..KA.......L..R..K----..KS.....PALS.KI..K.PG.S..
D2RLG2_ACIFV/74-285..VY-----------------------TLR.E..KD.......R..R..P----..GS.....PVLD.KL..P.AG.S..
Q8YNM1_NOSS1/217-419..LL-----------------------TMK.Q..EM.......V..A..G----..GS.....GNFQ.YK..P.AG.T..
B2J7F0_NOSP7/218-420..ML-----------------------TMQ.Q..DM.......V..A..G----..GS.....GDMG.SK..P.AG.T..
D7DW46_NOSA0/212-414..ML-----------------------TLQ.K..EM.......I..S..E----..GS.....GSLR.TQ..A.VG.S..
A0ZAJ6_NODSP/233-435..ML-----------------------RME.K..EM.......V..A..G----..GS.....GNLQ.YQ..Q.VG.T..
A0Z083_LYNSP/220-422..VL-----------------------TME.G..QH.......I..A..G----..GS.....GDMQ.YQ..P.SG.T..
B0CCE0_ACAM1/37-239..PL-----------------------VMR.P..DL.......V..A..S----..EA.....GSMQ.YE..P.VG.T..
B8HLP2_CYAP4/158-360..RL-----------------------VMR.P..DL.......I..A..S----..EA.....GIMQ.YQ..K.PG.T..
B2IVV4_NOSP7/225-427..NL-----------------------IMR.R..DL.......V..T..N----..GS.....GTMQ.YE.RV..G.K..
B8HM72_CYAP4/205-407..KL-----------------------TLR.P..EL.......F..A..S----..GS.....GEMQ.FQ..R..PWT..
B7KDD6_CYAP7/166-368..EL-----------------------VMT.K..DV.......I..G..S----..GS.....GDMQ.YQ..P.VG.K..
A8YG35_MICAE/134-336..TL-----------------------VAT.K..DV.......L..A..S----..GS.....GDMQ.YL..G.LN.K..
C7QSD1_CYAP0/172-374..IL-----------------------TMD.K..AI.......I..T..S----..GA.....GNMQ.YK..P.PG.T..
Q55897_SYNY3/237-440..EL-----------------------PLT.Q..DV.......I..V..G----..EA.....GTMQ.YD..V..G.KRS
Q5N617_SYNP6/75-277..QL-----------------------TMT.Q..DL.......V..A..S----..EA.....GAMQ.YQ..P.VG.S..
B4WI30_9SYNE/252-455..TM-----------------------SMK.P..EQ.......I..A..S----..GS.....GDMQ.VA..D..P.K.T
Q2JKE0_SYNJB/180-382..QL-----------------------TLR.E..DL.......K..G..G----..GA.....GVLQ.TR..P.LG.S..
C0GGV0_9FIRM/114-323..EY-----------------------ILQ.Q..RDKYA.GSTI..V..G----..GM.....GLLQ.YE..P.SG.T..
F1T3K7_9ACTN/155-354..RV-----------------------TLK.N..MK.......V..V..G----..GT.....GLIQ.TE..R..H.A..
Q08XP3_STIAD/57-318..TL-----------------------TFT.P..EA.......I..R..D----..GM.....HRLH.RA.QP..G.D..
A4VI25_PSEU5/54-317..RL-----------------------TLE.A..ED.......K..V..D----..GS.....GDLV.WQ..D..N.G.V
A4IY62_FRATW/49-258..KI-----------------------KIS.K..NQ.......I..V..E----..YS.....PITR.RH..I..N.Q..
C6YW16_9GAMM/49-258..EV-----------------------KIS.A..NQ.......I..I..G----..YS.....PVTK.KH..I..N.Q..
A7JMA9_FRANO/43-254..KI-----------------------PIN.Q..NDI.....GK..L..G----..YA.....PITA.KN..V..G.K..
C6YWK1_9GAMM/44-255..KI-----------------------LIT.Q..DD.......IGTL..G----..YA.....PVTG.KN..I..G.K..
B9EC94_MACCJ/44-253..EV-----------------------KVS.E..RD.......I..V..L----..YS.....PIIE.KY..K..N.K..
Q9X6W1_ECOLX/63-282..KL-----------------------FVK.K..SE.......L..L..P----NTWS.....PLRD.KY..P..D.GNV
B6WTZ1_9DELT/61-280..RI-----------------------PVR.A..GQ.......LHPD..T----..HS.....PLRD.KYGQR..D.V..
C3X8Y4_OXAFO/46-265..RI-----------------------FLK.K..SD.......L..R..P----NTWS.....PLRE.KY..K..N.GNV
C3X3G5_OXAFO/49-269..RI-----------------------AIS.R..SE.......L..R..P----GTWS.....PLRDRYR..K..G.K..
C8C144_9ZZZZ/49-267..VV-----------------------TLG.P..SD.......IDTK..T----..WS.....PMYK.KY..K..S.KKI
B3D802_BURM1/59-267PRRI-----------------------LYR.R..YG.......I..V..A----..GS.....PVTE.SH..A..D.T..
A6WDM1_KINRD/35-232..VV-----------------------PVA.R..RH.......V..V..R----..SS.....PVSS.WH..R..E.G..
Q92Y19_RHIME/54-306..RL-----------------------TIR.R..GD.......L.SV..N----..IQ.....PIAD.IV..AERG.S.F
B0T712_CAUSK/59-310..TL-----------------------RIE.D..VD.......L..S.PP----..HS.....PIAD.AW..P.SR.D..
D5VFF5_CAUST/60-304..QI-----------------------DAR.D..VD.......L..S..P----.PPS.....AVAD.AW..P..G.R.E
Q2GBE0_NOVAD/96-299..RV-----------------------PLQ.T..RA.......R..G..P----..ER.....H................
C4VSL3_9LACO/99-291..PY-----------------------KVK.S..SD.......L..N..G----..GD.....KVLK.....A..D.M..
D0DKJ8_9LACO/105-290..AI-----------------------KIS.K..KD.......K..A..K----..GD.....KMF...Q..V..G.I..
Q5FIM3_LACAC/104-295..AI-----------------------KIK.K..SD.......K..A..S----..GD.....RMF...Q..V..N.M..
C9M3W5_LACHE/79-269..AI-----------------------KIK.K..AD.......K..A..K----..GD.....GMFQ.....V..N.M..
D6S2M9_9LACO/93-284..TL-----------------------TPT.A..SE.......I..V..K----..GD.....STF...A..A..N.T..
Q55G30_DICDI/66-270..QI-----------------------ECS....................----.....................T.G..
C3BL34_9BACI/43-240..EI-----------------------ENI.E..FN.......P..K..E----..DS.....KEIYPHL..Q..R.R..
C2QCU8_BACCE/29-226..IL-----------------------HHI.K..FN.......P..G..E----..DS.....AQLYPHL..Q..G.R.T
C2Z8Y6_BACCE/25-222..TL-----------------------HHI.K..FN.......P..N..E----..DS.....AQLYPHL..Q..G.R.A
C2PG18_BACCE/23-220..ML-----------------------HQI.K..FN.......P..K..E----..DS.....AQLYPHL..Q..G.R.D
B0AK42_BACAN/23-220..IL-----------------------HHV.K..LN.......P..H..E----..DS.....AQLYPHL..Q..G.R.R
C2VCY9_BACCE/29-226..IL-----------------------HHI.K..FH.......P..H..E----..DS.....AQLYPHL..Q..G.R.S
Q112T9_TRIEI/199-405..PV-----------------------YVS.R..GN.......F..T..E----..DG.....SKIR.....A..R.K..
C8WKG4_EGGLE/143-342..EV-----------------------V...E..DV.......I..L..D----..GT.....GIMS.SD..D..I.D..
B1S8A7_9BIFI/117-306..VY-----------------------QAG.D..TQ..............----..........................
A7A336_BIFAD/133-323....-----------------------.......................----..........VAQ.SA..D..A.Q..
A4E932_9ACTN/111-301..RV-----------------------SLD.G..PL.......A..T..Y----..GG.....CSMG.WQ..........
A5G729_GEOUR/100-303..TF-----------------------VFDGK..ENL....SAL..Q..T----..IR.....PAQT.IT..P..G.R..
Q3DFC2_STRAG/213-406..KF-----------------------EYK.D..NVNQFPNSYA..P..S----..GS.....GKLE.KK..A..D.H..
C2LQQ9_STRSL/215-408..EY-----------------------QYT.S..AVNGFPGAYD..P..D----..GS.....GKIS.KM..P..D.D.K
B4U5H8_STREM/213-406..SL-----------------------KYI.D..EVNHFYGDYD..P..T----..GS.....GKIS.KT..A..D.K.K
C5WDV2_STRDG/213-406..FL-----------------------RYI.D..DVNHFYGDYD..P..S----..GS.....GKIS.KK..A..D.K.E
A4VS97_STRSY/211-404..KV-----------------------KYT.A..ESISFPGAYV..A..G----..GS.....GSLS.KT..P.DN.K..
A3CJX6_STRSV/212-405..KF-----------------------KYI.G..AVNDFAGAYE..P..E----..GS.....GSIA.KS..A..D.D.K
A8B001_STRGC/211-404..GL-----------------------KYI.Q..DVNDYSGAYD..T..E----..GS.....GSLP.KE..A.DN.K..
D3H625_STRM6/207-400..TV-----------------------KYV.S..SVNDFPGSYK..P..E----..GS.....GSLP.KK..E.DN.K..
D4FQE8_STROR/207-400..SF-----------------------KYV.P..EVNSFPGSYK..P..E----..GS.....GSLP.KK..E.DN.K..
D2BLR7_LACLK/232-427..KL-----------------------LYT.P..AINTFYGSYK..P..E----..GT.....GNLP.KT..A..D.N.K
C1I3T7_9CLOT/61-249..TI-----------------------YYE.K..LD.......S..E..G----..GS.....GVLY.YL..Q..E.I.P
C7VVX9_ENTFL/70-261..LI-----------------------PYNAE..ED.......Y..E..E----..GT.....GIIA.YN..I..Q.P..
Q67RI7_SYMTH/15-208..LI-----------------------EYT.E..AD.......V..E..P----.PLT.....GAFE.AA..E.FG.D..

PF00905

PBPH_BACSU/372-692--YI-----------------------DAP-M--L.----------..LG------TN-----LIKKSYT--N.....--
PBPF_BACSU/322-595--LL-----------------------KDE-L--Q.----------.SYG------DY-----TPKNYDS--R....Y--
SP5D_BACSU/246-557--DQ-----------------------FYD-K--GH----------AEVD------GA-----RLRCWKR--G....G--
PBPB_BACSU/268-577--KY-----------------------KSG-T--..----------FEVG------GA-----PVKDHNN--G...VG--
Q45297_BACLI/374-591--SH-----------------------MTW-D--G.----------...T------QY-----PYKEWNQ--D.....--
PBPA_MYCTU/160-484--LT-----------------------AAP-T--IP----------LPGS------TA-----QLENYGG--AP.CGD--
PBPA_BACSU/352-641--QI-----------------------DDS-A--Y.----------TYSN------GK-----PIRDWDR--K....Y--
Q51504_PSEAI/247-547--IV-----------------------DVY-P--GT----------LQIG------RY-----TIRDVSR--N.....--
Q9ZHF7_BURPI/25-267--TP-----------------------VEH-F--R.----------HGDP------DW-----GGEAWHQ--P.....--
PBPI_BACSU/263-574--TF-----------------------NCN-L--NL----------YGEP------GD-----.......--.....D--
P71707_MYCTU/310-601--GY-----------------------QVD-S--SP----------LTVD------GI-----KITNVEG--E....G--
Q51505_PSEAI/242-539--QV-----------------------SVA-P--GW----------MTID------GH-----TIHDVAR--R.....--
P72405_STRCL/273-546--RA-----------------------DCP-K--F.----------AHVN------GQ-----SFENQDQ--F...TL--
Q59439_ENTHR/364-671--VL-----------------------TIN-G--L.----------KWQK------DQ-----SWGSYQV--TR.VSD--
P73117_SYNY3/281-593--RI-----------------------NDS-G--S.----------VRVG------PW-----TISNASK--S....G--
PBP2_HAEIN/279-618--IF-----------------------DPG-Y--WV----------LPNS------TK-----RFRDWKK--T....G--
P96052_STRTR/367-698--VL-----------------------TDQ-P--I.----------NIAS------SP-----PITSWFT--D...KG--
Q9AEF8_9GAMM/23-259--NP-----------------------EWP-Y--K.----------.KEY------EL-----YLNVWKY--P.....--
O54282_STASC/363-580--TE-----------------------QQW-D--K.----------...H------QY-----PFKEWNQ--D.....--
Q98LR0_RHILO/12-247--TP-----------------------SWD-Y--K.----------...P------EF-----NAAKRDQ--K.....--
FTSI_ECOLI/260-555--VL-----------------------NTI-P--..----------YRIN------GH-----EIKDVAR--Y.....--
PBPX_STRPN/289-609--VF-----------------------NSS-E--..----------LKIA------DA-----TIRDWDV--NEGLTG--
O07106_ENTFL/295-608--LF-----------------------NRV-G--G.----------IQVG------DV-----TVNDHDY--TR.LNG--
Q9KHJ3_SHIFL/42-276--IF-----------------------KWD-K--T.----------....------PK-----GMEIWNS--N.....--
PBP2_NEIFL/81-376--TF-----------------------NTL-P--..----------YKIG------PA-----TVQDTHV--Y.....--
Q55926_SYNY3/76-292--QV-----------------------FEW-D--G.----------...V------ER-----NFAPHNQ--D.....--
Q9K4N2_STAHA/361-577--SR-----------------------MSW-N--H.----------...K------HY-----PFDAWNK--E.....--
Q9F0V2_ACIBA/53-270--.I-----------------------FKW-D--G.----------...K------KR-----TYPMWEK--D.....--
O06214_MYCTU/338-656--VL-----------------------QVP-G--S.----------IQMG------GV-----TVHDAWE--H....G--
PBPC_BACSU/352-666--KK-----------------------TIK-G--K.----------EWQK------DS-----SWGGYSV--TRVSER--
YQGF_BACSU/352-682--VF-----------------------KDE-P--LY----------IGQD------KR-----GKKSWQN--L.....--
PBP2_STRR6/343-671--TL-----------------------TDQ-S--I.----------VFQG------SA-----PINSWYT--QA..YG--
PBP_STAAU/347-660--SY-----------------------KID-G--K.----------GWQK------DK-----SWGGYNV--TRYEVV--
Q9AEY7_PSEAI/35-252--QI-----------------------FHW-N--G.----------...T------QY-----SIANWNQ--D.....--
Q9K319_AERHY/24-259--HP-----------------------ALP-F--K.----------.PGY------DD-----WLPAWRE--T.....--
Q53725_STAAU/268-579--KY-----------------------KSG-H--..----------RDIM------GS-----RISDWNR--V....G--
O26078_HELPY/280-589--RI-----------------------DLN-H--GY----------YQLG------KY-----TIKDDFI--P.....--
Q9EY51_ACIBA/42-258--HV-----------------------FRW-D--G.----------...A------KR-----SFAGHNQ--D.....--
PBP2_ECOLI/271-609--LF-----------------------DPG-W--WQ----------LPGS------EK-----RYRDWKK--W....G--
O33622_STRCH/299-660--NY-----------------------DCS-S--A.----------YNVG------GQ-----VFKNFES--A....N--
P94124_ACIBA/42-258--QV-----------------------FRW-D--G.----------...I------KR-----SFAAHNQ--D.....--
FTSI_HAEIN/280-572--II-----------------------DTT-S--..----------FKLS------GK-----EIVDVAP--R.....--

PF00144

Y4209_BACPE/17-329--PI.......T................KYL..................S----INSPILQKTTIRHLLT--HTHGL...
Q9XWZ6_CAEEL/290-607--PVFGPAGILSDVC.........SPCHPYL...................----......LHVRIIHLLE--HSSGAWPH
Q9U3M7_CAEEL/420-758--KLFGK.DSI.FGS.........EFSKKYQ...................----YPRYVTE.ITVRHLLE--HTAGGWDN
YBBE_BACSU/52-423--KV.......................SAYLPGFK...........DQPG----DLIKGKDKIRVIDVLQ--HQSGLPSS
Q9YFA3_AERPE/8-341--PV.......................GNHLG.................I----DLEVEGQPITLEHLLT--HTSGVPAT
AMPH_ECOLI/31-372--PL.......................SKYAPP..............GAR----VPTYNGTPITLVNLAT--HTSALPRE
Q9RKC5_STRCO/36-410--PV.......................GEYWP.................E----FKAHGKERVLVRHVLN--HRAGLPVL
O88012_STRCO/23-405--PV.......................DRYLPAFAEPRV..YVGGTGENV----VTRPATGPVRVRHLMT--HTAGLTFG
Q53403_PSEFL/18-377--PV.......................ANYWP.................E----FAAAGKEAITLRQLLC--HQAGLPAI
P72041_MYCTU/40-404--RV.......................CEYLP.................S----YTSHGKHRTTIRHVLT--HSAGVPFP
Q98HG2_RHILO/72-389--PV.......................TTYIP.................E----AAGSAYGDASCRHVLD--MSVSLDFE
Q988B4_RHILO/18-370--PI.......................ARYWP.................E----FAAGGKEHITLDQVMS--HQAGLNGL
Q97ML5_CLOAB/11-343--NV.......................SYYLE.................K----FKGKNKDDVTIFNLLT--HTAGFVPC
BLAC_STRAL/53-307--RILY...TQ.DDVEQADGAGPETGKPQNL...................----....ANAQLTVEELCE--VSITA...
Q9A2R7_CAUCR/45-374--PV.......................ADHLPP..............GTV----VPTRNGKAITLIDLAT--HTSGLPRL
Q9A3W5_CAUCR/42-393--PV.......................TQYLPDF.............AMK----DPIVTKL.LTVRDLLV--HRSGLSLG
Q9A6I9_CAUCR/103-453--PV.......................NLYLPEP............LQVK----DQGKKTQ.IRLRDLMT--HTSGFEDR
PBP4_NOCLA/8-348--RV.......................ADVLPG..............FAV----ADAEVARTVTIGRLLS--HTSGIAGD
BLAC_BACSU/53-299--VIHY...SK.DDLVT.....YSPITEKHL...................----....DTG.MSLKEISE--AAIRY...
Q9A862_CAUCR/42-382--PL.......................SRWIGD...............SP----FPADLAASVSLSDLLC--HRSGLENQ
Q9I1G0_PSEAE/16-386--PI.......................ADWLPAF.............RPR----LADGREARITPRQLLS--HSAGLGYR
Q9CE05_LACLA/7-308--PL.......................QKYY...................----.SKFTDRSVSLRQLLT--HTSGIDPF
AMPC_YEREN/37-388--PV.......................TEYAP.................E----LTGSQWKDVKMLHLAT--YTAGGLPL
Q97FD2_CLOAB/68-427--PV.......................TKYIKE...............FK----MADGRYKKITVRMLLN--HSSGLMGS
Q21569_CAEEL/51-419--PV.......................SKYWP.................G----FGTHGRDNVTINMALS--HMSGMAWF
Q9Y7D1_ASPTE/17-406--TV........................DRLLPDLSAMPVLEGFDDAGNA----RLRERRGKITLRHLLT--HTSGLSYV
BLAC_BACCE/55-300--VITY...TK.EDLVD.....YSPVTEKHV...................----....DTG.MKLGEIAE--AAVRS...
BLC1_ECOLX/37-285--RVEI...KK.SDLVN.....YNPIAEKHV...................----....DGT.MSLAELSA--AALQY...
P74474_SYNY3/27-387--DF.......................TTYL...................----PEYDHWNGVTITQLLN--MTSGLPNY
BLAC_STAAU/27-275--KVHI...NK.DDIVA.....YSPILEKYV...................----....GKD.ITLKALIE--ASMTY...
PBPX_BACSU/82-390--PV.......................STYLPH..............FPN----.....GQTITLKNLLT--HTSGINGH
AMPC_LYSLA/32-381--HP.......................GKYLP.................E----MKGHDFDKVTLLNLGT--HTAGGFPM
AMPC_ENTCL/32-381--AV.......................TRYWP.................Q----LTGKQWQGIRMLDLAT--YTAGGLPL
BLAC_CITDI/40-288--KMVI...KK.ADLTN.....WNPVTEKYV...................----....DKE.MTLAELSA--ATLQY...
Q48437_KLEPN/33-381--KV.......................SQHAP.................W----LKGSAFDGVTMAELAT--YSAGGLPL
BLAC_STRLA/46-298--RLFY...TE.QEVKDSG.FGPVTGLPENL...................----....AAG.MTVERLCA--AAICQ...
P71778_MYCTU/39-398--PV.......................AEYWP.................A----FGANGKATLTVRDVMR--HQAGLSGL
Q9ABH2_CAUCR/19-369--AV.......................ADVWP.................E----FAQAGKDAVTVEQALS--HQAGLSGF
Q9ZDR6_RICPR/33-395--KI.......................CKYLAPE............MWGG----KVPDWACKISIHNLLT--HSSGIAEY
Q99QC1_ENTAE/36-381--KA.......................SRHAP.................W----LKGSAFDSITMGELAT--YSAGGLPL
AMPC_PSYIM/50-399--TA.......................DKYIP.................Y----LKNSAIGNTKLISLVT--YSAGGYHY
Q97PZ0_STRPN/6-304--LV.......................IDFL...................----.PESDYPDITIRQLLT--HATDLDPF
BLAC_RHOCA/38-285--ALPV...RK.ADLVP.....YAPVTETRV...................----....GGN.MTLDELCL--AAIDM...
Q9RK50_STRCO/17-371--PV.......................AELWP................RF----GAHGKGT.TTLRHVLT--HSAGVPAM
BLAC_NOCLA/49-295--VVRY...SK.DELLE.....NSPITKDHV...................----....ATG.MTLRELCD--AAVRF...
O05900_MYCTU/63-408--PV...........................VSKLP.........WFALR----DPYVTGQ.VTIADLYS--HRSGLPDH
O86739_STRCO/48-382--PV.......................QGYLP................DL----FTPDFEQPVSVRHLLN--HTSGIKPG
AMPC_PSEAE/38-388--RA.......................SQHWP.................A----LQGSRFDGISLLDLAT--YTAGGLPL
P94288_BACCE/53-388--SI.......................EKWLPG..............VIQ----GNGYDDKQITIRQLLN--HTSGIAEY
Q9X5Q0_STRLA/21-361--PV.......................AEYWP.................Q----FARHGKGDVTVRHVLQ--HRAGVPVG
O62481_CAEEL/42-406--DI.......................RKYLPEF.............PAK----KFKNEDVKITMRQLLS--HSAGIRHY
Q98JC7_RHILO/43-383--KV...........................ADLDP.........AFRLA----DPYPTSQ.LTVRDLFS--HRSGLPGT
YFEW_ECOLI/43-414--RI.......................AKYIPGFA...........DSPN----DTIKGKNTLRISDLLH--HSGGFPAD
ESTB_BURGA/22-391--PV.......................TRWLPEF.............RPR----LADGSEPLVTIHHLLT--HTSGLGYW
P71988_MYCTU/60-399--PV.......................RRYIPD..............FAV----ADESASATVTVRQLLN--HTAGWDGR
BLAC_BACVU/48-310--LVNI...NR.DKLDPKTWSPMLKDYSGPV...................----......ISLTVRDLLR--YTLTQSDN
Q9X8U8_STRCO/16-340--PL.......................EKHL...................----.PGTGAGEATIAELLA--HSGGLAAE
BLAC_PROVU/10-258--NIII...TK.SDLVA.....YSPITEKHL...................----....ATG.MSLAQLSA--ATLQY...
BLAC_STRFR/46-298--RVHY...TA.DYVKRSG.YSPVTGLPENV...................----....ANG.MTVAELCE--ATLTR...
Q9Z4V4_STRFR/44-398--TV.......................DHWLPG..............LVS----GRGNDGSAITVGMLLR--HTSGLRDY
AMPC_CITFR/32-381--PV.......................TKYWP.................E----LTGKQWRGISLLHLAT--YTAGGLPL
BLAC_STRCE/50-302--VIRY...TE.ADVTKS...GHAPVTKDHI...................----....DTG.MTIRDLCD--ATIRY...
Q9HT32_PSEAE/60-409--PV.......................DKYLP.................S----LAGSAYQGVTVEQVLQ--MSSGVRWN
AMPC_ECOLI/28-377--PT.......................TKYWP.................E----LTAKQWNGITLLHLAT--YTAGGLPL
Q9X5R0_STRLA/136-514--PV.......................AHYLP.................E----FGNRGKESITSMELLT--HTGPLPTG
FMTA_STAAU/48-386--PV.......................SKYLPW..............FKT----.....SKPIPLKDLML--HQSGLYKY
Q18384_CAEEL/50-416--KV.......................TKYWP.................E----FGQNGKQDITIEMVLS--HTAGLPYF
Q9K4I2_STRCO/49-431--PV.......................ASYLP.................D----FGRAGKQNMTIRHLLT--HTSGFRAW
Q9HW54_PSEAE/59-378--PV.......................ARYY...................----PPFARHPEVTLRHLLN--WSSGLDWQ
Q9LCC8_OCHAN/4-353--PI.......................TRWFPD..............LPK----.....AAQMPVRILLN--HRSGLPDF
BLAC_BACLI/50-296--RITY...TR.DDLVN.....YNPITEKHV...................----....DTG.MTLKELAD--ASLRY...
Q9K351_HAFAL/39-387--SV.......................SHYVP.................E----LRGSSFDHVSVLNVGT--HTSGLQLF
O53190_MYCTU/21-384--PV.......................ARYWP.................E----FGQAGKQAITLAMVMS--HRSGAIGP
BLA1_PASHA/50-296--TISY...SQ.KDLVS.....YSPETQKYV...................----....GKG.MTIAQLCE--AAVRF...
Q9RWA9_DEIRA/32-336--PLA....AL.GG............PLRRL...................----.....PRALTPYALAT--HTAGLPPQ
Q9PCY3_XYLFA/65-407--KI.......................VDYVPG..............FHL----SNPTATNKLTVADVLS--HRVGLSRN
Q9XA95_STRCO/30-359--PA.......................AGCLD.................P----GRTPGPHPVTLAHLIT--HTSGLPAL
Q9RYU2_DEIRA/7-325--PL.......................AAHLP.................E----TAELPLGERTLRQLLS--HSAGVPAG
BLE1_PSEAI/35-292--TVIV...NR.AKVLQN...TWAPIMKAYQ...................----..GDEFS.VPVQQLLQ--YSVSH...
Q988N4_RHILO/12-356--DV.......................SEYLPGFKPQ.......NPFAGR----EGGPHGAQISLRKLMS--HTAGLVRE
P95207_MYCTU/41-390--KL.......................SRWL...................----PDFPHADRVTLGQLAQ--MTSGYPDY
Q9A7L6_CAUCR/54-390--PL........................SAFDT..............SLK----LPGDAQVGLTLEQLLS--QRTGLGRN
BLA3_BACCE/59-305--RITY...TR.KDLSN.....YNPITEKHV...................----....DTG.MTLKELAD--ASVRY...
AMPC_PROST/35-383--SV.......................SHYLP.................E----LKGSAFDNVSVMNLAT--HTSGLSLF
Q7DFY3_SALEN/31-280--RIHY...SQ.NDLVE.....YSPVTEKHL...................----....TDG.MTVRELCS--AAITM...
Q9A3L3_CAUCR/99-483--PV.......................HRFIPAWRDIGV..FQAGVAGAF----QTTRTKEPMRTIDLLR--HTSGLTYG
BLA1_STRCI/57-318--VVHY...GQ.DAILP.....NSPVTEKHV...................----....ADG.MSLRELCD--AVVAY...
Q9A9U2_CAUCR/29-330--PV.......................KTYWP.................Q----AATSAIGDVRLDDVLT--MRSGLAAF
Q21523_CAEEL/50-420--LV.......................IKHWP.................E----FGANGKQNVTIRWLLT--HKAGLAYT
Q44050_ARTGO/17-368--EV.......................VKYWP.................E----FGAEGKATITVAQLLS--HQAGLLGV
PBPE_BACSU/9-348--KV.......................DRWLPG..............FPY----......QGVTIRHLLN--HTSGLPDY
LACT2_CAEEL/79-448--KM.......................SKIWP.................E----FAQNGKENITIDWLMS--HRAGLAAL
Q9I4S7_PSEAE/29-387--PV.......................AHYWP.................E----FAAAGKAAISVRQLLC--HRAGLPAL
Q9RER5_ENTAE/32-381--PA.......................QKYWP.................Q----LTGQQWQGISLLHLAT--YTAGGLPL
Q9V2D6_PYRAB/6-348--PV.......................EKFVN.................I----KLRPFGEPVTVHHLLT--HSSGIPSL
Q9C2S3_NEUCS/19-388--RL........................QHL...................----........VTLSDFIS--HRTGLDGD
Q9A800_CAUCR/77-466--PV.......................SLHIPEFANLRVA.KGVDETGQP----ILTPVSRSPTMRELMT--HTAGFAYG
Q9XU43_CAEEL/52-422--RV.......................VDYWP.................E----YGRYGKNATTIEDVLS--HKAGLPYL
Q9I2U5_PSEAE/43-384--PL...........................QDTLREF....YVRSRFHA----DQSEADRAITFRRLLS--HQSGLPGE
Q9AAM2_CAUCR/38-371--DV.......................RQHLPA..............GYD----NLVRDGRPVRLIDLVN--TTSALPDN
Q99Y64_STRP1/9-304--PL.......................KVYY...................----.PSIADATVTIRQLLT--HTSGLDPY
Q9A7Z9_CAUCR/50-429--PV.......................SKFIPEFANLRVL.KGVNADGSF----DTVPAERPPTMRELMS--HSAGFAYG
Q9AI08_PHOLU/55-396--PL.......................QDYSYYG............VKVP----EYSPLQP.IRLFHLAS--HTSGLPRE
Q9RKP5_STRCO/2-343--EV.......................GAYLP.................D----FRAAAEHRVTVRQLLT--HTSGLRPE
BLAC_STRBA/57-305--RVTY...TR.EDLVA.....HSPVTEKHV...................----....DTG.MTLKELCD--ASVRY...
DAP_OCHAN/9-333--AL.......................EAYL...................----.DKFEDERPAVRDLCN--NQSGLRDY
P95290_MYCTU/53-411--PV.......................AEYWP.................E----FGANGKSEVTVSDVLR--HRSGLAHL
BLO1_KLEOX/37-285--RLEI...KK.SDLVV.....WSPITEKHL...................----....QSG.MTLAELSA--AALQY...
FLP_STAAM/43-372--DV.......................SKHVPH..............FKM----NYNGQNETITIKQLLA--QTSGIPSD
Q9A2D7_CAUCR/97-472--PL.......................ARYLPEFADM......KVSDGQG----GVRPAARPILVRDILR--HTAGFSYG
BLA2_STRCI/60-307--VVKY...SE.DDLVD.....NSPVTEKHV...................----....EDG.MTLTALCD--AAVRY...
AMPC_MORMO/31-379--PA.......................EKYQP.................E----LALPQWKGITLLDLAT--YTAGGLPL
BLAC_PROMI/36-285--VVRF...SE.SNLVT.....YSPVTEKHV...................----....GKKGMSLAELCQ--ATLST...
P71981_MYCTU/64-388--PV.......................TAYVP.................A----LADCGYAGATVRHLLD--MRSGVAFS
BLAC_YEREN/39-287--HINY...HE.SDLLS.....YAPITRKNL...................----....AHG.MTVSELCA--ATIQY...
Q9EX97_OCHAN/38-387--PA.......................TKWAP.................E----LAGSSFDKITMRDLGT--YTPGGLPL
BLAC_STRAU/51-304--RIHY...TE.KFVKDAG.YIPVTGKPENI...................----....AGG.MTGAELCA--AAVSE...
AMPC_SERMA/27-374--PA.......................SHYLP.................D----VRGSAFDGVSLLNLAT--HTSGLPLF
BLAC_KLEPN/29-278--RIHY...RQ.QDLVD.....YSPVSEKHL...................----....VDG.MTIGELCA--AAITL...
O87861_STRAQ/19-378--PV.......................AAHWP.................E----FAANGKESVLVRHLLS--HRSGVAGP
BLC3_PSEAI/29-277--TVEI...KK.ADLVT.....YSPVIEKQV...................----....GQA.ITLDDACF--ATMTT...
Q9WXD6_BRELN/11-387--PA.......................REYAPGLADVQVI.EGFDVDGSP----ILRAPASEPTTKQLLL--HTAGFGYD
Q44260_AERSO/33-381--QV.......................SGHAP.................W----LKGSAFDGITMAELAT--YSAGGLPL
P74200_SYNY3/25-369--PV.......................LSHLRRW.............QFP----ADSPYRGEVTIAQLLS--HTGGQNDH
Q9F3F0_STRCO/31-381--PI.......................GRYLPG..............LLP----..DGRGEAVTVRMLMN--HTSGLAEY
Q9L8D3_SORCE/35-419--PV.......................DRWLPELANRKV..LARIDGPID----ETVPAERPITVRDLMT--FTMGFGIS
Q9KEY4_BACHD/34-367--PV.......................QAHLPW..............FTL----QDRAAATQITIRHLLA--HTSGLSTY

PF02113

Q55728_SYNY3/46-476--SF-----------------------DVDD............LTAIAKG....LKDRGVTAIEELELV..DTIAPQDYQ
O85665_NEIGO/13-461--VF-----------------------NQEN............LLAVQRQ....LRDKGIRNI.TGRLMLDHSLW.GEVG
O06380_MYCTU/72-454--TL-----------------------SAAPPGQDTWYHGAARIGDLVEQ....IRRSGVTPT...AVQVDASAFSGPTM
O69539_MYCLE/72-454--TL-----------------------SAASPDQSTWYRGAPRISDLVEQ....VRRSGVTPT...AVQVDTSLFTGPTM
DACB_ECOLI/19-469--TL-----------------------KRQD............IRNMVAT....LKKSGVNQI.DGNVLIDTSIFASHDK
DACB_HAEIN/26-472--DL-----------------------TRGQ............LYSLLAE....LKKQGIKKI.NGDLVLDTSVFSSHDR
DACC_BACSU/36-491--TL-----------------------LPSD............FDKMAEI....LKHSGVKVI.KGNLIGDDTWHDDMRL
DAC_ACTSP/54-508--TL-----------------------SAED............LDAMAAE....VAASGVRTV.RGDLYADDTWFDSERL
Q9Z541_STRCO/78-446--TL-----------------------TGED............VAELARTAADGLRAAGRTDV...QVRVDDSLFADPSL

PF04960

GLSL_HUMAN/177-463--FV-----------------------GKEPS------------------------GLRYNKLSLNEEGI--...PHNPM
GLSA_RHIEC/22-307--RV-----------------------GREPS------------------------GSAFNSIVQLEHES--.GIPRNPF
GLSA_VIBCH/22-306--RV-----------------------GKEPS------------------------GQAFNSLIQLEMEQ--.GIPRNPF
GLSA1_BACHD/22-308--KV-----------------------GMEPT------------------------GDPFNSISKLETSV--PSKPLNPM
GLSA2_BACSU/23-309--YV-----------------------GQEPT------------------------GDPFNSIIKLETVN--PSKPLNPM
GLSA2_BACHD/33-324--RV-----------------------DVEPT------------------------GDPFNSMVRLEMRK--TGKPFNPM
GLSA1_BACSU/32-327--RV-----------------------DVEPT------------------------GDAFNSIIRLEINK--PGKPFNPM
GLSA2_ECOLI/24-308--RV-----------------------GKDPS------------------------GSPFNSLVQLEMEQ--.GIPRNPF
GLSA_PSEAE/19-302--RL-----------------------GHEPS------------------------GQPFNSLVQLEFER--.GKPRNPF
GLSA_RHILO/28-313--RV-----------------------GREPS------------------------GNPFNSIVQLEHEN--.GIPRNPF
GLSA_STRCO/25-307--HV-----------------------GREPS------------------------GNPFNSLVQLEYEN--.GIPRNPF
GLSA_CAUCR/24-306--RV-----------------------GKEPS------------------------GTPFNHLSLLEAEQ--.GVPRNPF
GLS1_CAEEL/171-458--YV-----------------------GQEPS------------------------GRLFNEICLDSTNK--...PHNPM
GLS2_CAEEL/174-460--HV-----------------------GQEPS------------------------GRLFNDISLDHNKK--...PHNPL
GLSK_HUMAN/244-530--YV-----------------------GKEPS------------------------GLRFNKLFLNEDDK--...PHNPM
GLSA1_ECOLI/24-308--KI-----------------------GADPT------------------------GLPFNSVIALELHG--.GKPLSPL
GLSA2_YERPE/47-331--KL-----------------------GVNST------------------------GMAFNSVTAIERAS--.DGRTNPM

PF07930

DAP_OCHAN/334-421------------------------------------------------------------------------DETGLV--
DAP_BRUME/334-421------------------------------------------------------------------------PETGLV--

PF00768

D2AEU9_SHIF2/32-265---ISRKDMLLLALM--------------------------------------------------SSENRAAASLAHHY-
DACD_ECOLI/25-263---VSVRDLSRGLIV--------------------------------------------------DSGNDACVALADYI-
DACA_ECOLI/35-273---VPVSQLIRGINL--------------------------------------------------QSGNDACVAMADFA-
DACX_STRSK/26-273---VTVRQLLYGLML--------------------------------------------------PSGCDAAYALADKY-
Q54906_STRPY/17-270---YTVKELLSALVV--------------------------------------------------NNANSPAIALAEKI-
DACF_BACSU/26-261---MTVKEMLKGIAI--------------------------------------------------ASGNDASVAMAEFI-
DACA_HAEIN/27-263---VSVADLNRGVIV--------------------------------------------------VSGNDATVALAEHI-
DACB_BACSU/21-251---VKLKDLVYGLML--------------------------------------------------RSGNDAAVAIAEHV-
DACC_ECOLI/28-266---VSVADLNKGVII--------------------------------------------------QSGNDACIALADYV-
DACA_GEOSE/27-286---YTVRELYEAMAI--------------------------------------------------YSANGATVAIAEII-
PBP5_PSEAE/19-261---ISRRDMLLLALM--------------------------------------------------SSENRAAASLAQNY-
P72518_STRPN/17-269---YTVEELLEATLV--------------------------------------------------SSANSAAIALAEKI-

PF13354

D3R279_CLOB3/167-362H..YSLKQLLDFLIV--------------------------------------------------ESDNVAARMLMRWLH
C5NV57_9BACL/95-285S..YKLEYVLQNMIQ--------------------------------------------------YSDNTATNMLMGNS.
A3DEM2_CLOTH/156-348T..FTIKELLRLSIV--------------------------------------------------YSDNVAVNMLLRCV.
C7IRL1_THEET/200-392Y..YTIRELSRRSIE--------------------------------------------------ESDNIASNMIMRIV.
D9TSS5_THETC/196-388Y..YTIRELSRRSIE--------------------------------------------------ESDNIASNMIMRVV.
B0TAI9_HELMI/87-282Q..YTLRQLAKHVIE--------------------------------------------------DSDNTAANMLMRRV.
D1C5R0_SPHTD/31-238E..LTLEDLVYLTIS--------------------------------------------------ISDNTATNLLIDLV.
C0ZJI1_BREBN/25-238R..LTIRDLVTLMII--------------------------------------------------QSDNTATNMLIDLV.
D1CF14_THET1/24-242Q..LTLWDLCVAMIA--------------------------------------------------LSDNVATNMLIDYL.
C7H338_9FIRM/28-242K..LKVKDTATMMII--------------------------------------------------CSDNIATNMIIDYL.
Q1J1L5_DEIGD/60-275A..PTWQDLLTLMIV--------------------------------------------------VSDNTATNLVIERL.
Q9RX82_DEIRA/25-240A..LTWQDVLTLMIV--------------------------------------------------VSDNTATNLLIERL.
C1CYR0_DEIDV/25-240Q..PSWLDLLTLMVI--------------------------------------------------VSDNTATNLVIARL.
D7BH62_MEISD/25-238A..LPLRDILTLMIV--------------------------------------------------VSDNTATNVVLDFF.
A4FGH3_SACEN/23-225R.CLELADAITLMIS--------------------------------------------------ISDNTATNAVIEAV.
D1C8L0_SPHTD/32-252Q..PTVADVAMLMII--------------------------------------------------VSDNTATNMLIDRV.
Q67QZ3_SYMTH/26-238R..LPLRDLATLMMI--------------------------------------------------ISDNTASNMCIDAV.
C6B6H3_RHILS/32-251V..ISLRDAITGMMV--------------------------------------------------LSDNVCTKMVFERL.
Q7CSB1_AGRT5/27-246V..ISLRDAIAGMMV--------------------------------------------------LSDNVCTKMVLERL.
C7PH33_CHIPD/45-252E..TDLSVLVALMMA--------------------------------------------------YSDNTTSLWNQALA.
C6Y376_PEDHD/48-255A..TELSVLANLMMT--------------------------------------------------YSDNTTSLWNQRLA.
C2G3X8_9SPHI/50-256E..TDLSTMAALMIG--------------------------------------------------YSDNVTSIWCQELA.
D2QMG0_SPILD/51-257K..IPLSEVVMLMET--------------------------------------------------VSDNTASLWCQALA.
C1ACM4_GEMAT/56-266T..LRLWDVAWLMTT--------------------------------------------------LSDNTATNLVLDRI.
D3Q045_STANL/73-283E..ISLGHTLALLLS--------------------------------------------------ISEDTSSRLCSQVT.
D3PY77_STANL/72-283Q..VTIGHVLANLLT--------------------------------------------------ISDDTAVRLCGTVV.
B5HHK2_STRPR/25-261E..LSLRDLAHFAMA--------------------------------------------------VSDNTAADLLMERV.
C3JVC0_RHOER/42-274T..ASWRDLALLMMS--------------------------------------------------FSDNAATDFLYERL.
D2ARC0_STRRD/23-261S..LTLRDLAHFMMT--------------------------------------------------MSDNAATDVLLRRV.
Q6WSB4_9PSEU/29-266T..MSWYDLAILMIG--------------------------------------------------ISDNVATDLILARV.
D5UMR9_TSUPD/34-269Q..LSVRDLARSMIA--------------------------------------------------VSDNAAAGTLLSLV.
C7Q8V4_CATAD/62-288R..LSLRDLATLVVA--------------------------------------------------VSDNAAADILWREV.
C3JVV9_RHOER/30-276E..VSIRDLALLMMQ--------------------------------------------------VSDNTATDILQEMV.
D3Q9I0_STANL/20-254H..IAVGDLAGLMME--------------------------------------------------VSDNTAADVVVRHM.
D7AWL0_NOCDD/28-268R..VSVEDLLYLSMC--------------------------------------------------LSDNAATDALFEIT.
BLAB_STRCI/29-280R..VAVDDLLYLSTS--------------------------------------------------VSDGTASDALFEIT.
Q769D8_9ACTO/28-268R..IALDDLLYLSTS--------------------------------------------------VSDGAAADALFDLT.
C6WEM7_ACTMD/23-263E..VAVDDLLYLGVA--------------------------------------------------ISDSRAAGALFALT.
A7VJM6_9MICO/21-237D..LSIFDVALLIGA--------------------------------------------------FSDNFATNVLIRRV.
Q6AHF8_LEIXX/31-247A..LPVADLAALVGA--------------------------------------------------TSDNLATNVLLRRV.
A4AF02_9ACTN/57-273S..LPVADLAALVGA--------------------------------------------------TSDNLATNILLRLI.
A5CUW5_CLAM3/55-271S..LPVTDLASLVGA--------------------------------------------------TGDAAATNALLGLV.
A3THA9_9MICO/30-246V..LPLTDVARLVGA--------------------------------------------------VSDNLATNVLIDLL.
C2D5A8_LACBR/26-222T..FQLKDLLALMIS--------------------------------------------------VSDNSATNLVIAHI.
D3L9M4_OENOE/30-223V..LSLSDLISMMLS--------------------------------------------------LSDNTAANTLIDIV.
C9ACN0_ENTCA/30-228G..WTISELLTAMIA--------------------------------------------------VSDNTATNVLLDLV.
Q92FA7_LISIN/23-230R.IWTLEELLHLMIA--------------------------------------------------VSDNTATNQLIELA.
C4VQE7_9LACO/23-217S..WQISDLLDLMLS--------------------------------------------------VSDNTATNALLNYY.
D0R6B2_LACJF/24-218T..WKIRDLIDLMLS--------------------------------------------------LSDNSATNALLSYY.
C2F946_LACPA/27-227A..WRVRDLLTLMLT--------------------------------------------------VSDNLATNALLTTY.
C2JUG5_LACRH/27-227S..WCVRDLVTLMLM--------------------------------------------------VSDNLAANALLKTY.
Q74HJ8_LACJO/23-220N..WSVRDLVYLTSA--------------------------------------------------LSDNVATNLLIEKF.
Q1IIZ9_KORVE/54-260K..VTNRDLAGMVVA--------------------------------------------------VSDNSATNVLIDRV.
B9XGI6_9BACT/30-235Q..MTIHDLCILMIL--------------------------------------------------ISDNTATNLLIDLV.
D1CAH8_SPHTD/29-234S..ISLLDLLTLMII--------------------------------------------------VSDNTATNLCIDVL.
C6JN74_FUSVA/22-213P..LTIKDVAYLMIC--------------------------------------------------LSDNTATNILIDYI.
D3A9C2_9CLOT/37-244E..VTVLDLVTLMII--------------------------------------------------FSDNTATNVLIDLL.
C3WTB7_9FUSO/29-234H..FTLKELATLMII--------------------------------------------------VSDNQATNILIDFL.
C0WAD9_9FIRM/29-233T..FTLEELATLMII--------------------------------------------------VSDNEAANQLIDRL.
A6TPV9_ALKMQ/24-228T..FQFVDLVQLMIT--------------------------------------------------VSDNTATNVLIDLL.
Q97MK6_CLOAB/29-233I..YPLIDLLTLMII--------------------------------------------------SSDNTASNILIDLL.
Q2B497_9BACI/33-237S..LSILDCITLMII--------------------------------------------------VSDNTAANLLIKLL.
D1BLB4_VEIPT/34-242S..FTYLELCRLMMV--------------------------------------------------LSDNIATNLLITVL.
C9M6L1_9BACT/27-241T..LRLEDLAVLAGT--------------------------------------------------VSDNTAANLLMDRL.
D2RJL4_ACIFV/65-269K..VPLQEALDLMIT--------------------------------------------------ESDNTAANLLIDRL.
C4V1H1_9FIRM/88-292E..LSLDTVLRLMIT--------------------------------------------------ESDNTATNMMIDLL.
C9LUU8_9FIRM/91-296V..FSVEELLRQMIA--------------------------------------------------ESDNTATNMMIDRL.
D3LTR8_9FIRM/96-300V..VDVRTLLKLMIT--------------------------------------------------QSDNTATNLMIDLV.
A9B776_HERA2/21-222K..FSSDHMIYLMLN--------------------------------------------------QSENNATNVLLAQL.
C0WDD8_9FIRM/88-297K..VPVRILLEDMML--------------------------------------------------DQDETALYELVRFI.
D2RLG2_ACIFV/74-285R..LTVRNLLEDMVL--------------------------------------------------QNDTTALYKLIWIA.
Q8YNM1_NOSS1/217-419Q..YPALEVATKMIT--------------------------------------------------ISDNTATNMLITRL.
B2J7F0_NOSP7/218-420K..YNALEVVTKMIT--------------------------------------------------ISDNTATNMLIARL.
D7DW46_NOSA0/212-414Q..YTALDIATKMIT--------------------------------------------------ISDNTATNMLVTRL.
A0ZAJ6_NODSP/233-435Q..YSALELATQMSA--------------------------------------------------SSDNTATNMLIARL.
A0Z083_LYNSP/220-422E..YTALETATKMIV--------------------------------------------------ISDNTATNMLIERL.
B0CCE0_ACAM1/37-239T..FSALDTAEYMIA--------------------------------------------------ISDNTATNMLIDRL.
B8HLP2_CYAP4/158-360K..FSALETADLMIT--------------------------------------------------ISDNTATNMLIDRL.
B2IVV4_NOSP7/225-427K..YTALETITKMIT--------------------------------------------------ISDNTATNMIIDRL.
B8HM72_CYAP4/205-407Q..FSAQYTAAQMII--------------------------------------------------ISDNTATNLILKRL.
B7KDD6_CYAP7/166-368K..YSALETAAKMNI--------------------------------------------------ISDNTATNMLIKRL.
A8YG35_MICAE/134-336T..YTALETATKMNV--------------------------------------------------ISDNTATNMLIKRM.
C7QSD1_CYAP0/172-374K..FTALETATQMIV--------------------------------------------------ISDNTATDMLIRRL.
Q55897_SYNY3/237-440S..YPALEVVTKMIV--------------------------------------------------ISDNTATNMLIKRL.
Q5N617_SYNP6/75-277K..FTVLETAIEMIR--------------------------------------------------ISDNTATNLLIARL.
B4WI30_9SYNE/252-455Q..YTALEVASQMIV--------------------------------------------------TSDNTATNMMIDLL.
Q2JKE0_SYNJB/180-382Q..VSALEAATLMIT--------------------------------------------------LSDNFATNLIIDRL.
C0GGV0_9FIRM/114-323K..VTHAELLSLMVA--------------------------------------------------ESDNVATNIITNIL.
F1T3K7_9ACTN/155-354S..YSYDELCRYMIM--------------------------------------------------YSDNTATNVLINKL.
Q08XP3_STIAD/57-318T..LSVSTLLEAMMV--------------------------------------------------DSDNAAADLLIQRV.
A4VI25_PSEU5/54-317D..YSLRDLLKEMLI--------------------------------------------------ESDNTAANMLIRLV.
A4IY62_FRATW/49-258I..MTVKQLCQASM.--------------------------------------------------QGDNTATNILIEKL.
C6YW16_9GAMM/49-258T..MTVSELSKAAI.--------------------------------------------------QSDNTATNLLIEKL.
A7JMA9_FRANO/43-254T..LTISQLNYAAI.--------------------------------------------------LSDNPAANILVREL.
C6YWK1_9GAMM/44-255T..LTISQLNYAAI.--------------------------------------------------LSDNPAANILVREI.
B9EC94_MACCJ/44-253N..VSLKMLIEAALL--------------------------------------------------YSDNTANNLIIEEL.
Q9X6W1_ECOLX/63-282D..LSISEILKATVS--------------------------------------------------RSDNNGCDILFRFV.
B6WTZ1_9DELT/61-280R..LSLQELLHATVT--------------------------------------------------FSDNNGCDILMDYV.
C3X8Y4_OXAFO/46-265Y..VSLKEILRTTMK--------------------------------------------------DSDNNGCDILLKLA.
C3X3G5_OXAFO/49-269TVFIPLAEIVRTTMT--------------------------------------------------DSDNNGCDILLRLA.
C8C144_9ZZZZ/49-267T..LSYGDLINYMVS--------------------------------------------------QSDNNACNWLINFV.
B3D802_BURM1/59-267G..MTVAQLCAAMLE--------------------------------------------------SGDKGAGNLLMDVL.
A6WDM1_KINRD/35-232E..LPVTVLADAALR--------------------------------------------------RGDATATNLLVRQA.
Q92Y19_RHIME/54-306E..TSIGDLVSRAVV--------------------------------------------------ESDSAATDVLISHL.
B0T712_CAUSK/59-310T..YTVQELLERAVG--------------------------------------------------DSDNTAADVLMKRI.
D5VFF5_CAUST/60-304S..YTVAEL.EALAR--------------------------------------------------TGDNTALDLLTKRI.
Q2GBE0_NOVAD/96-299...EQVSALLRKAVA--------------------------------------------------QDDRSAQDEILAGL.
C4VSL3_9LACO/99-291A..YSYTYLLDLMMR--------------------------------------------------QQNNNAANIILNKI.
D0DKJ8_9LACO/105-290T..YGVSYLRSAM.L--------------------------------------------------KGNKTAASALTRKI.
Q5FIM3_LACAC/104-295A..YGVAYLREAML.--------------------------------------------------KGNKTASNALIRKI.
C9M3W5_LACHE/79-269A..YGVAYLREAMLK--------------------------------------------------N.NKTASNALIRKI.
D6S2M9_9LACO/93-284V..YSLTYVRQNLMS--------------------------------------------------KNSNTAANLLLNKL.
Q55G30_DICDI/66-270L..ITVEQCIALMIG--------------------------------------------------VSDNCATYSLTALT.
C3BL34_9BACI/43-240T.VLTLKDAVEVMIA--------------------------------------------------CHDNCIAQSVVNFC.
C2QCU8_BACCE/29-226T..LTLSKAVEVMIA--------------------------------------------------CHDSYVAQSIVMHC.
C2Z8Y6_BACCE/25-222T..LTLSKAVEVMIA--------------------------------------------------CHDSYIAQSIVMHC.
C2PG18_BACCE/23-220T..ISLSKAVEVMIA--------------------------------------------------CHDSYIAKAIVLHC.
B0AK42_BACAN/23-220T..LTLSKAVEVMIA--------------------------------------------------CHDSYVAQSVVMYC.
C2VCY9_BACCE/29-226T..LTLSKAVEVMIA--------------------------------------------------CHDSYIAHSVVKHC.
Q112T9_TRIEI/199-405R..YPLKTLVGEMID--------------------------------------------------HSSNIATNQLIDYL.
C8WKG4_EGGLE/143-342R..YDLQTVMANTIV--------------------------------------------------HSDNTGYGLLRERF.
B1S8A7_9BIFI/117-306N..ATTKQNIDQVLT--------------------------------------------------VSDNTAYSWLVDTY.
A7A336_BIFAD/133-323S..ATVHQKVDAVLR--------------------------------------------------NSDNASYDWLYKTY.
A4E932_9ACTN/111-301....TVRDLIENAVA--------------------------------------------------NSDNDSFIALRAAF.
A5G729_GEOUR/100-303A..YTVEELLRYMIS--------------------------------------------------YSDNNATSLLYEGL.
Q3DFC2_STRAG/213-406K.LYTVKELLEATAK--------------------------------------------------ESDNVATNMLGYYV.
C2LQQ9_STRSL/215-408N..YSLENLLKAVAQ--------------------------------------------------NSDNVATNILGYYV.
B4U5H8_STREM/213-406D..YNVMELLKAVAQ--------------------------------------------------QSDNVATNILGYYL.
C5WDV2_STRDG/213-406D..YKVSTLLKAVAQ--------------------------------------------------NSDNVATNILGYYLC
A4VS97_STRSY/211-404D..YSVEELINKTAK--------------------------------------------------ESDNVASNLLSYYV.
A3CJX6_STRSV/212-405E..YSVQDLINRVAK--------------------------------------------------ESDNVAHNILGYYAT
A8B001_STRGC/211-404E..YSVQDLINHIAK--------------------------------------------------ESDNAATNILGYYV.
D3H625_STRM6/207-400E..YSLKDLITKVSK--------------------------------------------------ESDNVAHNILGYYI.
D4FQE8_STROR/207-400E..YSLQQLITKVTK--------------------------------------------------ESDNVAHNILGYYV.
D2BLR7_LACLK/232-427Y..YSLQDVINRTAK--------------------------------------------------LSDNVGSNMLAYY..
C1I3T7_9CLOT/61-249N..ITVEEAIYLSIV--------------------------------------------------ESDNITKNMLH.RI.
C7VVX9_ENTFL/70-261E..YPLKTLQEYAIT--------------------------------------------------YSDNIAKNMLYDTL.
Q67RI7_SYMTH/15-208L..YPVQDLVHWALA--------------------------------------------------YSDNVAVNMLGRRL.

PF00905

PBPH_BACSU/372-692---MGTINELTALQK--------------------------------------------------SSNVYMFNV.AMHI-
PBPF_BACSU/322-595---EGEVTMSDAITY--------------------------------------------------SKNAPAVWT.LNEI-
SP5D_BACSU/246-557---HGLQTYLEVVQN--------------------------------------------------SCNPGFVEL.GERL-
PBPB_BACSU/268-577---WGPTTYHDGVLR--------------------------------------------------SSNVAFAKLAKEKL-
Q45297_BACLI/374-591---...QDLFSAMSS--------------------------------------------------STTWYFQKL.DRQI-
PBPA_MYCTU/160-484---EPTVSLREAFVK--------------------------------------------------SCNTAFVQL.GIRT-
PBPA_BACSU/352-641---LGPISMRYALAQ--------------------------------------------------SRNIPALKA.FQAV-
Q51504_PSEAI/247-547---SRQLDLTGILIK--------------------------------------------------SSNVGISKI.AFDI-
Q9ZHF7_BURPI/25-267---...IDPALWLKY--------------------------------------------------SVVWYSQRI.THAM-
PBPI_BACSU/263-574---KGTLSFDESFAQ--------------------------------------------------SCNYTFTSLAEQLM-
P71707_MYCTU/310-601---CGTCNIAEALKM--------------------------------------------------SLNTSYYRL.MLKL-
Q51505_PSEAI/242-539---.DVLTMTGVLIN--------------------------------------------------SSNIGMSKV.ALQI-
P72405_STRCL/273-546---PAGSTFRDSFAH--------------------------------------------------SCNTFFVNS.RSKL-
Q59439_ENTHR/364-671---VPQVNLRNAMIY--------------------------------------------------SDNIYMAQE.TLKM-
P73117_SYNY3/281-593---AGMINITQVLRY--------------------------------------------------SSNVAMVAI.ARRL-
PBP2_HAEIN/279-618---HGDTDLNKAITE--------------------------------------------------SSDTYFYQV.AYNM-
P96052_STRTR/367-698---SRAITATQALEY--------------------------------------------------SSNTYMVQI.AIKR-
Q9AEF8_9GAMM/23-259---...HNPRTWIRD--------------------------------------------------SCVWYSQVL.TQQL-
O54282_STASC/363-580---...QNLNSSMKY--------------------------------------------------SVNWYYENL.NKHL-
Q98LR0_RHILO/12-247---..IVDPVIWEKD--------------------------------------------------SVLWYSREI.TRKL-
FTSI_ECOLI/260-555---.SELTLTGVLQK--------------------------------------------------SSNVGVSKL.ALAM-
PBPX_STRPN/289-609---GRTMTFSQGFAH--------------------------------------------------SSNVGMTLL.EQKM-
O07106_ENTFL/295-608---KEYLNYRQAISW--------------------------------------------------SSNIGMVKL.EQKM-
Q9KHJ3_SHIFL/42-276---...HTPKTWMQF--------------------------------------------------SVVWVSQEI.TQKI-
PBP2_NEIFL/81-376---.PTLDVRGIMQK--------------------------------------------------SSNVGTSKLSAMFT-
Q55926_SYNY3/76-292---...QTLRSAMRN--------------------------------------------------SAVWVYEIF.AAEI-
Q9K4N2_STAHA/361-577---...QDLNTAMQN--------------------------------------------------SVNWYFERI.SDQI-
Q9F0V2_ACIBA/53-270---...MTLGEAMAL--------------------------------------------------SAVPVYQEL.ARRT-
O06214_MYCTU/338-656---VMPYTTTGVFGK--------------------------------------------------SSNVGTLML.SQRV-
PBPC_BACSU/352-666---LQQVDLENALIT--------------------------------------------------SDNIYFAQN.ALDM-
YQGF_BACSU/352-682---.GPVGIQTALEK--------------------------------------------------SSNVFMFKT.AIAV-
PBP2_STRR6/343-671---SFPITAVQALEY--------------------------------------------------SSNTYMVQT.ALGL-
PBP_STAAU/347-660---NGNIDLKQAIES--------------------------------------------------SDNIFFARV.ALEL-
Q9AEY7_PSEAI/35-252---...QTLDSAFKV--------------------------------------------------SCVWCYQQI.ALRV-
Q9K319_AERHY/24-259---...TTPRRWETY--------------------------------------------------SVVWFSQQI.TEWL-
Q53725_STAAU/268-579---WGEIPMSLGFTY--------------------------------------------------SSNTLMMHL.QDLV-
O26078_HELPY/280-589---SKKAVVEDILIQ--------------------------------------------------SSNVGMIKI.SKNL-
Q9EY51_ACIBA/42-258---...QNLRSAMRN--------------------------------------------------STVWVYQLF.AKEI-
PBP2_ECOLI/271-609---HGRLNVTRSLEE--------------------------------------------------SADTFFYQV.AYDM-
O33622_STRCH/299-660---EGMITIGRALEL--------------------------------------------------SCDTVFYRLSHQEW-
P94124_ACIBA/42-258---...QDLRSAMRN--------------------------------------------------STVWIYELF.AKEI-
FTSI_HAEIN/280-572---.AQQTLDEILMN--------------------------------------------------SSNRGVSRL.ALRM-

PF00144

Y4209_BACPE/17-329....KMVNGK...............................LQQEFT...........SGESWA.YRGIGIE.LLTQIV-
Q9XWZ6_CAEEL/290-607TSKFEFDRLEQNQ..................TEFLMRVVQHEFPILF...........PGGRHM.YSNIGYI.LLGRII-
Q9U3M7_CAEEL/420-758LQSDAAWVQPEMTT.................KELIEYVLTNVPLEYK...........PGTMWI.YSNFGYQ.LLGYLI-
YBBE_BACSU/52-423FYFYTPEKAGKYYSQ...............ERDKTIEYLTKIPLDYQ...........TGTKHV.YSDIGYM.LLGCIV-
Q9YFA3_AERPE/8-341AYAEALLRGFLGVGGYWKPY.....SRPWDAVLYLKRAIDKGWAVSK...........PGRRFF.YLNEGYV.ALGIVV-
AMPH_ECOLI/31-372.QPGGAAHRPVFVWP...............TREQRWKYLSTAKLKAA...........PGSQAA.YSNLAFD.LLADAL-
Q9RKC5_STRCO/36-410.DRPLTPEEALDP...................RRGPAAVAAQAPVWE...........PGTDHG.YHALTYGWLLDELV-
O88012_STRCO/23-405FYRTHPVDALYRAAGVESS......VRPGADLAETVDLYASLPLQFD...........PGTEWN.YSVASN..VLGRLV-
Q53403_PSEFL/18-377.REMLPTEALYDW...................RLMVDTLAAEAPWWT...........PGQGHG.YEAITYGWLVGELL-
P72041_MYCTU/40-404TGPRPDVRRADDH...................EYAVERLGELRPLYR...........PGLVHI.YHALTWGPLMREIV-
Q98HG2_RHILO/72-389EAYLDPESAFARYRRATLW.......NPGGGTESLREFILSLQRLAE..........PHGQTFR.YRSPNSD.LLGLLL-
Q988B4_RHILO/18-370.AVPMDEAGLFAW...................TPFVDALAAMPPLWE...........PGSRCI.YHALTYGHLAGEVL-
Q97ML5_CLOAB/11-343KPLYKLCKGYE......................DSIDYICRCGLSYK...........PGTKCV.YSDFSYI.LLAYIL-
BLAC_STRAL/53-307.................................................................SDNCAANLMLRE.L-
Q9A2R7_CAUCR/45-374PTNMAMKDPLNPYAD..............YTEAQLDAFLRDYVLTRD...........IGGIYE.YSNLGVG.LLGRAL-
Q9A3W5_CAUCR/42-393.AGDLMIWPAPTHT.................RAEIVAGLKHLPIGGQ...........FRGGYA.YDNVLYV.VAGAVI-
Q9A6I9_CAUCR/103-453.ALGQLFERDPNR..................VRPLYDYLRQERPRRVR.........EPGLMPT.YSNYGAA.LAGAAV-
PBP4_NOCLA/8-348FTLDTGRGDDCLA....................RFVDACADVGQDCP...........PDTVIS.YCSTGYA.ILGRIV-
BLAC_BACSU/53-299.................................................................SDNTAGNILLQQ.L-
Q9A862_CAUCR/42-382PIAHRAAFTGEHT...................PAAMSALLRSTIRSKD.........TPHGVFR.YTNTGYN.LATTLI-
Q9I1G0_PSEAE/16-386FLEADADGPYARAGISDGM......DLPGFDLAENLRRLASVPLLYE...........PGRAWG.YSLATD..VLGALV-
Q9CE05_LACLA/7-308IKNRDKLNAK.......................ELTEAINQIKIT.............DNKTFK.YTDINFI.LLGFLL-
AMPC_YEREN/37-388QLPDSVTDQK.......................SLWQYYQQWQPQWA...........PGVMRN.YSNASIG.LFGALA-
Q97FD2_CLOAB/68-427SFSNAILFGDNDTY................SHDTFLKQLSKQRLKAD...........PGAYSV.YCNDGFS.LAEILV-
Q21569_CAEEL/51-419.DTPITEEIAADH...................EKMRQIIEEEEPKWA...........PGTKTG.YHAYTFGWLVDQIV-
Q9Y7D1_ASPTE/17-406FLHPLLREYMAQGHLQ............SAEKFGIQSRLAPPAVND............PGAEWI.YGANLD..WAGKLV-
BLAC_BACCE/55-300.................................................................SDNTAGNILFNK.I-
BLC1_ECOLX/37-285.................................................................SDNVAMNKLISH.V-
P74474_SYNY3/27-387SDSPTLNYGFVQSPER............IWQDKELVDVVYPQPNLPAP.........PLNTGYA.YTNTAYT.LGGLVL-
BLAC_STAAU/27-275.................................................................SDNTANNKIIKE.I-
PBPX_BACSU/82-390IEGNGAITPD.......................DLIKDIELQGIKRQ...........PGVWD..YKDSNYS.VLAYII-
AMPC_LYSLA/32-381QVPTQVKTDQ.......................QLTAYFQSWHPQYP...........AGTKRT.YANPGIG.MLGVIA-
AMPC_ENTCL/32-381QVPDEVTDNA.......................SLLRFYQNWQPQWK...........PGTTRL.YANASIG.LFGALA-
BLAC_CITDI/40-288.................................................................SDNTAMNKLLEH.L-
Q48437_KLEPN/33-381QFPDEVDSND.......................KMRTYYRHWSPVYP...........AGTHRQ.YSNPSIG.LFGHLA-
BLAC_STRLA/46-298.................................................................SDNAAANLLLRE.L-
P71778_MYCTU/39-398..RGATQQDLLDH...................VVMEERLAAAVPGRL...........LGKSA..YHALTFGWLMSGLA-
Q9ABH2_CAUCR/19-369.PDETDPAIWFDW...................DATCAKLAAMAPLFP...........IGSASG.YHPVTYGYLAGEIF-
Q9ZDR6_RICPR/33-395FSFVKLDLNMSKQE................VHKKILQFVSSKPLEIS...........IGKKFK.YSNTNFV.ILGMII-
Q99QC1_ENTAE/36-381QFPEEVDSSE.......................KMRAYYRQWAPVYS...........PGSHRQ.YSNPSIG.LFGHLA-
AMPC_PSYIM/50-399RCLKTLENNK.......................ELLQYYKSWHPDFP...........VNSKRL.YSNASIG.LFGYIS-
Q97PZ0_STRPN/6-304IPNRDLLTAP.......................ELKEAMFHLNRR.............SQPAFL.YSDVHFL.LLGFIL-
BLAC_RHOCA/38-285.................................................................SDNVAANILIGH.L-
Q9RK50_STRCO/17-371.PRDIGPGDLSDW...................SRVCTALADAAPRWR...........PGTRTG.YHSYTYGFLVGEIA-
BLAC_NOCLA/49-295.................................................................SDNTAGNLLLKH.V-
O05900_MYCTU/63-408.AGDLLEDLGYDR...................RQVLQRLKYLPLAP............FRISYA.YTNFGVT.AAAEAV-
O86739_STRCO/48-382DGLGDDFAELYSHRYET...........LTPQQVAASAIAKGPEDFV...........PGTRQQ.YLNINYT.ILGLLI-
AMPC_PSEAE/38-388QFPDSVQKDQA......................QIRDYYRQWQPTYA...........PGSQRL.YSNPSIG.LFGYLA-
P94288_BACCE/53-388TRSKSFDLMDTKKSY...............RAEELVKMGISMPPDFA...........PGKSWS.YSNTGYV.LLGILI-
Q9X5Q0_STRLA/21-361RGIVRTMRTAGDW...................ERSVRDLEQSRPKWP...........GGEVAA.YHFMSFGFILGELV-
O62481_CAEEL/42-406ATEKKKSETHEDPSNNNTETPEFLSNKPYNSSLDALAIFKNDDLVEK...........PGSKFS.YTTYGLT.LAGAVL-
Q98JC7_RHILO/43-383.AGDDLEDIGYDR...................AEILHRLRFVPPSSS...........FRAGYS.YSNFG...LTEGAV-
YFEW_ECOLI/43-414PQYPNKAVAGALYSQ...............DKGQTLEMIKRTPLEYQ...........PGSKHI.YSDVDYM.LLGFIV-
ESTB_BURGA/22-391.LLEGAGSVYDRLGISDGI......DLRDFDLDENLRRLASAPLSFA...........PGSGWQ.YSLALD..VLGAVV-
P71988_MYCTU/60-399NGQDFGRGDDAVA....................LYVKAMTRLPQLTP...........PGTAFA.YNNSGLV.VAGRII-
BLAC_BACVU/48-310NASNLMFKDMVNV...................AQTDSFIATLIPRSSFQIAYTEEEMSADHNKA.YSNYTSPLGAAMLM-
Q9X8U8_STRCO/16-340SPAPWWERTPGSL..................RPELADVLGKQPLLHP...........VGRRHH.YSNPGYT.LLGALV-
BLAC_PROVU/10-258.................................................................SDNTAMNKILDY.L-
BLAC_STRFR/46-298.................................................................SDNTAANLLLRD.L-
Q9Z4V4_STRFR/44-398VPELPYIFLEKEYGPNRF.........RTVRPEQAVRLALRHPPVFA...........PGTRWG.YSNTNYI.LAGMIV-
AMPC_CITFR/32-381QIPGDVTDKA.......................ELLRFYQNWQPQWT...........PGAKRL.YANSSIG.LFGALA-
BLAC_STRCE/50-302.................................................................SDNCAANLLLRE.L-
Q9HT32_PSEAE/60-409ETYRDPKSDRRQMFDAQ..........LAERPGGILRLLASLPRQYP...........SGTHFT.YSTGESH.LQSELL-
AMPC_ECOLI/28-377QVPDEVKSSS.......................DLLRFYQNWQPAWA...........PGTQRL.YANSSIG.LFGALA-
Q9X5R0_STRLA/136-514DDPLHGIVAGPDEE................RVRRAFEVPVAPRPGGT...........PGIN...YSQWWAWFVLARIL-
FMTA_STAAU/48-386KSSKDYKNLD.......................QAVKAIQKRGIDPK...........KYKKHM.YNDGNYL.VLAKVI-
Q18384_CAEEL/50-416PGVKFTEEDLTDN...................NKLSHMIENLKPVFA...........PGTRTA.YHALTFGWLTDQIF-
Q9K4I2_STRCO/49-431IPLYSAPTYE.......................EKVQLVYDEAPVSA...........PGTAYL.YSDLNMI.SLQLVL-
Q9HW54_PSEAE/59-378.EDYEFAPLKSSVVAML..........YTRGRDDMAGFVAETPQARP...........PGRRFR.YSSGDSN.VLAAAL-
Q9LCC8_OCHAN/4-353ETSMPMISDKSWT..................AQEIVDFSFRHGVQKE...........PWHGME.YSNTGYV.LAGMII-
BLAC_BACLI/50-296.................................................................SDNAAQNLILKQ.I-
Q9K351_HAFAL/39-387.MPEDIKNTT.......................QLMAYLKAWKPADA...........AGTHRV.YSNIGTG.LLGMIA-
O53190_MYCTU/21-384.RGRLGWEQVADW...................DFVCEQLAAAEPWWQ...........PGAAQG.YHMTTFGFILGEVF-
BLA1_PASHA/50-296.................................................................SDNSATNLLLKE.L-
Q9RWA9_DEIRA/32-336PARAALTTFTRFADPYG...........GMSPADVLASARRWANPG............QAGRFG.YSNLGAG.VLALGL-
Q9PCY3_XYLFA/65-407AYDGEIESNADYY....................SLNRKLAYAPLICS...........PGECYS.YQNVAFS.LIGDVV-
Q9XA95_STRCO/30-359PAGFLRRGLPAWHTNPY..........ARYPAERLTDAFLRHEPKHR...........PGTRWH.YSNYGVS.VLGHAL-
Q9RYU2_DEIRA/7-325GFLPLHEWG........................DPAAIRARLPLESWEL.......REPGEAE..YSDLGYL.LLGLVL-
BLE1_PSEAI/35-292.................................................................SDNVACDLLFEL.V-
Q988N4_RHILO/12-356PKSGHYLDAARPP..................LADTVAELATSTLKQD...........PSLGQMHYSNAGIA.VAGRVI-
P95207_MYCTU/41-390VLGNEAFDAELYANPFR...........QWTTQELLDQISSRPLLYD...........PGTNWN.YAHTNYL.LLGLAL-
Q9A7L6_CAUCR/54-390AYDGRLEDGEDPN....................VIRGSFAALKPVCP...........PGTCHT.YQNIAYD.TITEVI-
BLA3_BACCE/59-305.................................................................SDSTAHNLILKK.L-
AMPC_PROST/35-383.VPSDIKTND.......................QLMAYYQKWLPDNE...........VGQYRS.YSNLGVG.LLGIVT-
Q7DFY3_SALEN/31-280.................................................................SDNTAANLLLTT.I-
Q9A3L3_CAUCR/99-483FQQRTNVDAAYRKLKLDGV.......DSEGGLKTFVETLGTVPLEFS...........PGEAWN.YSVATD..VLGYLV-
BLA1_STRCI/57-318.................................................................SDNTAANLLFDQ.L-
Q9A9U2_CAUCR/29-330DADTPSPGDEDRLD................EAADPVAFTLGVPRAHT...........PGVHYR.YNSLTAY.VAGLVI-
Q21523_CAEEL/50-420.DHPITLEIAKNP...................NEIDRVLEQQVPNWP...........PGTKVG.YHAVTHGWLVDAIV-
Q44050_ARTGO/17-368.EGGLTLAEYNNS...................ELAAAKLAQMRPLWK...........PGTAFG.YHALTIGVFMEELC-
PBPE_BACSU/9-348MGWFFANWDSHKIA................VNQDIVDMLMNEGLSGYF.........EPNEGWM.YSNTGYV.LLAVII-
LACT2_CAEEL/79-448.DMPITIEDANDF...................EKMSEVIASQKPNWE...........PGTKSG.YHAITYGWIVDQIV-
Q9I4S7_PSEAE/29-387.REQMPPEALYDW...................QAMTTALAAEEPWWT...........PGEAHG.YAPITYGWLLGEVI-
Q9RER5_ENTAE/32-381QVPDEVTDEA.......................ALLRYYQNWQPQWA...........PGSKRL.YANASIG.LFGALA-
Q9V2D6_PYRAB/6-348GYAEAFIDGMVGGDNWLPV.......STPEETIAFARDMEKWAVAK............PGERFF.YLNTGYV.LLGKII-
Q9C2S3_NEUCS/19-388.MSIAYQGDQEFLL................PKHEVLRAVATLSKAGH...........FRNDWI.YNNWGYS.LAGKVL-
Q9A800_CAUCR/77-466LANDPSSPADQAYYRAEV........LQSASLTDLVQKVSGLPMFAE...........PGQLWR.YSVAAD..IQGYIV-
Q9XU43_CAEEL/52-422.SEDISIEDVKNG...................LKIMEKVENSVPAWT...........PGTASG.YHAVTFGFILDGLV-
Q9I2U5_PSEAE/43-384HLPPLFGERPNSL...................GQLPAKVSGVWLSNP...........PGTQVA.HSNLGYE.LVGAAI-
Q9AAM2_CAUCR/38-371IPDWRTAAANAKPSEAALVAA...QMLANYSTDQLMIDLRNASLVDV...........PGRTPR.HSNVASE.LLRVVL-
Q99Y64_STRP1/9-304IPNRDVLNAQ.......................QLRKALNHLTQK.............ENKNFY.YTDVNFL.LLGFML-
Q9A7Z9_CAUCR/50-429LTPDNPLDKAYADKVLG...........ARSRADFVKAIAEIPLVDQ...........PGKRWK.YSIAVD..IQGLIV-
Q9AI08_PHOLU/55-396.QPVGQWARPVFVWP...............TQANRWTWLKTAQLDVS...........PGTTVS.YSNLAYD.LLADAL-
Q9RKP5_STRCO/2-343LPLYDSGAFADKE....................ARLRRLRAEPPVGV...........PGTYC..YSDLNML.LLQQVL-
BLAC_STRBA/57-305.................................................................SDNTAANLLFDPRA-
DAP_OCHAN/9-333WALSVLCGADPEGVFL............PAQAQSLLRRLKTTHFE.............PGSHYS.YCNGNFR.ILADLI-
P95290_MYCTU/53-411..KGVDKDEVMDH...................LLMEQKLAAAPLDRQ...........HGKLA..YHAVTYGWLLSGLA-
BLO1_KLEOX/37-285.................................................................SDNTAMNKMISY.L-
FLP_STAAM/43-372ITSEDAVTNKNNR..................LNDVTRAIMGDELHHK...........PGEEFE.YSNMNYD.LLGLII-
Q9A2D7_CAUCR/97-472WGEGPADAAFRAADPLN..........LNNDLAEFGRRLATAPLLYD...........PGERWS.YSAAVD..VQALLV-
BLA2_STRCI/60-307.................................................................SDNTAANLLFET.V-
AMPC_MORMO/31-379QVPDAVKSRA.......................DLLHFYQQWQPSRK...........PGDMRL.YANSSIG.LFGALT-
BLAC_PROMI/36-285.................................................................SDNSAANFILQA.I-
P71981_MYCTU/64-388ENYDDPAAEIHVREQVIGWA....PKRGPDLPATLRDYLLTLRRKSA...........HGGPFE.YRSCETD.VLGWIC-
BLAC_YEREN/39-287.................................................................SDNTAANLLIKE.L-
Q9EX97_OCHAN/38-387QFPDAVTDDS.......................SMLAYFKKWKPDYP...........AGTQRR.YSNPSIG.LFGYLA-
BLAC_STRAU/51-304.................................................................SDNGAGNLLLRE.L-
AMPC_SERMA/27-374.VPDDVTNNA.......................QLMAYYRAWQPKHP...........AGSYRV.YSNLGIG.MLGMIA-
BLAC_KLEPN/29-278.................................................................SDNSAGNLLLAT.V-
O87861_STRAQ/19-378.DTPLTLEELYDW...................ETACARLAATTPWWE...........PGTRSG.YHAISYGFLVGEVV-
BLC3_PSEAI/29-277.................................................................SDNTAANIILSA.V-
Q9WXD6_BRELN/11-387FFNEKYERLAREQGQ..............PSIVSSTKQALQTPLLFD...........PGTQWE.YGSNMD..WVGQVI-
Q44260_AERSO/33-381QFPDEVDSSD.......................TMRAYYRHWTPPYQ...........AGTQRQ.YSNPSIG.LFGHLA-
P74200_SYNY3/25-369LGYGGFLPGQPLQTLEQS.........LTLTKDVAFGEPRGVEAVYP...........PGEEFS.YSGGGYT.VLQLLV-
Q9F3F0_STRCO/31-381LPHAYSSLKAFPALADTGPQSLDDHRFTRFDPAELIALGVAAPAVGP...........PGGAPGLYSNTNYL.LLGKLL-
Q9L8D3_SORCE/35-419FDASSPIQRAIDELGLVNAQP...VPMTPHGPDEWIRRLGTLPLMHQ...........PGAQWM.YNTGSL..VQGVLV-
Q9KEY4_BACHD/34-367TGLAIADQGSADEN................AIVSHVRNLATEELTAD...........PGEQHQ.YSNANYL.ILGALV-

PF02113

Q55728_SYNY3/46-476RPSWEWDDLHYGYAPPVNGAIL......TGNQVILTLTP.QNLGEPLTPTWSDPIAGAQWQIINQT.ETAVDPHQPPQVQ
O85665_NEIGO/13-461SPDHFEADSGSPFMTPPNPTML......SAGMVMVRAER.NAAGSTDILTDPPLPHIFAQNNLKITASQAACPSVKKLMR
O06380_MYCTU/72-454APGWDPADIDNGDIAPIEAAMI......DAGRIQPTTVN.........................................
O69539_MYCLE/72-454AQGWDPADVDNGYTAPIESAMI......DAGRIQPTTVK.........................................
DACB_ECOLI/19-469APGWPWNDMTQCFSAPPAAAIV......DRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDV
DACB_HAEIN/26-472GLGWIWNDLTMCFNSPPAAANI......DNNCFYAELDANKNPGEIVKINVPAQFPIQVFGQVYV..ADSNEAPYCQLDV
DACC_BACSU/36-491SPDMPWSDEYTYYGAPISALTASPNEDYDAGTVIVEVTPNQKEGEEPAVSVSPKTDYITIKNDAK..TTAAGSEKDLTIE
DAC_ACTSP/54-508VDDWWPEDEPYAYSAQISALTVAHGERFDTGVTEVSVTP.AAEGEPADVDLGAAEGYAELDNRAV..TGAAGSANTLVID
Q9Z541_STRCO/78-446AEGW........................NEGYYPTEVAP.........................................

PF04960

GLSL_HUMAN/177-463VNAGAIVVSSLIKMD--------------------------------------------------CNKAEKFDFVLQYLN
GLSA_RHIEC/22-307INAGAIAVTDVVMAG--------------------------------------------------HAPREAIGELLRFVR
GLSA_VIBCH/22-306INAGAIVVCDMLQSR--------------------------------------------------LS..APRQRLLEFVR
GLSA1_BACHD/22-308INAGALAVTNMIIGE--------------------------------------------------TT.EQSLGRLLSFIH
GLSA2_BACSU/23-309INAGALVVTSLIRGR--------------------------------------------------TV.KERLDYLLSFIR
GLSA2_BACHD/33-324INAGAITVASLLSGK--------------------------------------------------SP.TEKLESVYSLVE
GLSA1_BACSU/32-327INAGALTIASILPGE--------------------------------------------------SA.YEKLEFLYSVME
GLSA2_ECOLI/24-308INAGALVVCDMLQGR--------------------------------------------------LS..APRQRMLEVVR
GLSA_PSEAE/19-302INAGALVICDINQSR--------------------------------------------------FA..APAQSMRDFVR
GLSA_RHILO/28-313INAGAIVISDILLAG--------------------------------------------------HQPREAIGEILRFIQ
GLSA_STRCO/25-307INAGALVVTDRLHTR--------------------------------------------------TG..DAAGELLAFLR
GLSA_CAUCR/24-306INAGALAVTDVLMDV--------------------------------------------------TR..DPAALVRDFGG
GLS1_CAEEL/171-458VNSGAIVITSLIKSK--------------------------------------------------TNMADRFDFVLNQYR
GLS2_CAEEL/174-460INAGAIVVASLLKNK--------------------------------------------------LPLADRFDFMIHACR
GLSK_HUMAN/244-530VNAGAIVVTSLIKQG--------------------------------------------------VNNAEKFDYVMQFLN
GLSA1_ECOLI/24-308VNAGAIATTSLINAE--------------------------------------------------NV.EQRWQRILHIQQ
GLSA2_YERPE/47-331VNSGAIATTSLVPGA--------------------------------------------------TS.DEQWKFIYDGLC

PF07930

DAP_OCHAN/334-421---LSLEDAGHGRM---------------------------------------------------KARFGTSPEMMDVV-
DAP_BRUME/334-421---LSLEDAGGGRM---------------------------------------------------KARFGTGPEKMDIS-

PF00768

D2AEU9_SHIF2/32-265---PGG------------------Y......KAFIKA---MNAKAKS-L--------------------GMNN-TRFVEP
DACD_ECOLI/25-263---AGG------------------Q......RQFVEM---MNNYAEK-L--------------------HLKD-THFETV
DACA_ECOLI/35-273---AGS------------------Q......DAFVGL---MNSYVNA-L--------------------GLKN-THFQTV
DACX_STRSK/26-273---GSG------------------SQAAARVKSFIGK---MNTAATN-L--------------------GLHN-THFDSF
Q54906_STRPY/17-270---GGT------------------E......PKFVDK---MKKQLRQ-W--------------------GISD-AKVVNS
DACF_BACSU/26-261---SGS------------------E......EEFVKK---MNKKAKE-L--------------------GLKN-TSFKNP
DACA_HAEIN/27-263---SGN------------------V......PNFVET---MNKYVQQ-F--------------------GLKN-TNFTTP
DACB_BACSU/21-251---GGS------------------L......DGFVYM---MNQKAEQ-L--------------------GMKN-TRFQNP
DACC_ECOLI/28-266---AGS------------------Q......ESFIGL---MNGYAKK-L--------------------GLTN-TTFQTV
DACA_GEOSE/27-286---AGS------------------E......KNFVKM---MNDKAKE-L--------------------GLKD-YKFVNA
PBP5_PSEAE/19-261---PGG------------------K......NAFVKA---MNAKAHA-L--------------------GMKN-TRYVEP
P72518_STRPN/17-269---AGS------------------E......KDFVDM---MRAKLLE-W--------------------GIQD-ATVVNT

PF13354

D3R279_CLOB3/167-362TYTG.H------------------Q-----------A...MPLIQHT.Y--------------------..........G
C5NV57_9BACL/95-285..ATAA------------------D-----------V...VVKYLAE.L--------------------GVK........
A3DEM2_CLOTH/156-348...G.K------------------A-----------N...VKEYMRR.L--------------------GGVV.VD....
C7IRL1_THEET/200-392...G.R------------------D-----------N...YIKFMEK.L--------------------GAYV.IPYS..
D9TSS5_THETC/196-388...G.Y------------------D-----------N...YLNFMKS.M--------------------GANV.IPYT..
B0TAI9_HELMI/87-282...G.R------------------S-----------N...FYLFLRL.A--------------------GART.V.....
D1C5R0_SPHTD/31-238...G.L------------------D-----------A...VNDVIAS.L--------------------GMRD.SNLSRK
C0ZJI1_BREBN/25-238...G.K------------------D-----------Q...IDQTMID.L--------------------GMHQ.SCYSRK
D1CF14_THET1/24-242...G.I------------------D-----------A...INRCMDS.L--------------------GAHN.TRLHRM
C7H338_9FIRM/28-242...G.L------------------D-----------T...INACIRE.L--------------------GFGH.TVLHNP
Q1J1L5_DEIGD/60-275...G.L------------------D-----------R...VNDWLGE.R--------------------GLSG.TQLVGL
Q9RX82_DEIRA/25-240...G.Q------------------D-----------H...FNLWLTA.R--------------------GLNS.TRLIGP
C1CYR0_DEIDV/25-240...G.P------------------D-----------E...INSWLAR.G--------------------GWSS.TRLIGR
D7BH62_MEISD/25-238...GHK------------------E-----------P...FNAYYQA.Q--------------------GWRE.THTAGM
A4FGH3_SACEN/23-225...G.F------------------E-----------A...VGELAAE.L--------------------GCEG.TQVQRL
D1C8L0_SPHTD/32-252...GGV------------------E-----------A...VNRTMQERY--------------------GLRS.IVLHNR
Q67QZ3_SYMTH/26-238...G.I------------------E-----------S...VNRSMDE.L--------------------GLTG.LRLRWK
C6B6H3_RHILS/32-251...T.L------------------D-----------E...VDSYCKS.I--------------------GMTG.TNHRFL
Q7CSB1_AGRT5/27-246...T.L------------------E-----------E...VDGYCKS.L--------------------GMAN.THHRFL
C7PH33_CHIPD/45-252...GGG------------------Q-----------R...INELMAQ.Y--------------------GLNN.TRVNSR
C6Y376_PEDHD/48-255...GGG------------------A-----------R...INEVLEQ.Y--------------------GFKD.TRVNSR
C2G3X8_9SPHI/50-256...E.G------------------T-----------K...INELMDE.L--------------------GLPN.TRVNSR
D2QMG0_SPILD/51-257...GGG------------------T-----------A...INTWLES.N--------------------GFRK.TRVNSR
C1ACM4_GEMAT/56-266...K.I------------------R-----------R...VWQKMEA.L--------------------GLPH.TKVHSG
D3Q045_STANL/73-283...T.A------------------K-----------D...INEYLTS.L--------------------GYKE.TQVE.P
D3PY77_STANL/72-283...P.G------------------P-----------E...INEILKK.K--------------------GFPK.TQVEPK
B5HHK2_STRPR/25-261...G.T------------------D-----------T...VAMLAKE.L--------------------GLEN.TRIVGG
C3JVC0_RHOER/42-274...G.L------------------D-----------N...IVATLRG.L--------------------GLEK.TNLVRD
D2ARC0_STRRD/23-261...G.L------------------G-----------N...LHATLRG.L--------------------GLER.TRLIGG
Q6WSB4_9PSEU/29-266...G.K------------------E-----------P...TEKSLRR.L--------------------GFEH.TTVPQD
D5UMR9_TSUPD/34-269...G.L------------------D-----------E...VQRTARE.L--------------------GLRR.TVIAGG
C7Q8V4_CATAD/62-288...G.F------------------A-----------T...VNRTMAE.L--------------------GLSD.TVAVHS
C3JVV9_RHOER/30-276...G.T------------------E-----------N...IMSRLRA.L--------------------GLNS.TSITTD
D3Q9I0_STANL/20-254...G.A------------------G-----------G...LRSLPAR.L--------------------GLTG.TRLIGS
D7AWL0_NOCDD/28-268...P.P------------------E-----------R...VAASLRA.A--------------------GLRG.ITVRHT
BLAB_STRCI/29-280...P.P------------------A-----------Q...VEQMVRE.W--------------------GFRD.LTVRHS
Q769D8_9ACTO/28-268...P.A------------------A-----------Q...VADILHE.L--------------------GLDG.ITIRHG
C6WEM7_ACTMD/23-263...P.P------------------P-----------R...VNALLRE.L--------------------GVRG.LAVRHD
A7VJM6_9MICO/21-237...G.L------------------E-----------N...VGNQVEK.L--------------------GYRN.SGLHDF
Q6AHF8_LEIXX/31-247...G.L------------------E-----------A...VSARTEA.L--------------------GLTR.TALLDL
A4AF02_9ACTN/57-273...G.L------------------D-----------A...VRARTES.L--------------------GLTK.TALLDL
A5CUW5_CLAM3/55-271...G.L------------------D-----------A...VRTRAES.L--------------------GLRR.TALLDV
A3THA9_9MICO/30-246...G.Q------------------D-----------S...IRERAAQ.W--------------------APRG.SDLVDV
C2D5A8_LACBR/26-222...G.M------------------E-----------H...VNQYLSK.M--------------------GFYK.TRLNRY
D3L9M4_OENOE/30-223...G.L------------------N-----------S...LSVWIKG..--------------------HYSA.TSLSRK
C9ACN0_ENTCA/30-228...G.L------------------P-----------T...LQAWIQE..--------------------..PE.IQFERY
Q92FA7_LISIN/23-230...T.I------------------T-----------K...LQSWLRE.N--------------------NWEDGIQLERQ
C4VQE7_9LACO/23-217...N.I------------------N-----------T...INDYLQQ..--------------------NFQN.ISLGRF
D0R6B2_LACJF/24-218...H.L------------------D-----------T...INSFLQQ..--------------------NFQN.ISLNRF
C2F946_LACPA/27-227...G.L------------------P-----------T...IAAWLTR..--------------------HYSG.VQLRRP
C2JUG5_LACRH/27-227...G.L------------------T-----------T...VERWLDQ..--------------------QFPG.AKLNRS
Q74HJ8_LACJO/23-220...D.I------------------Y-----------E...IDEWLKQ..--------------------NYPG.IRLGRE
Q1IIZ9_KORVE/54-260...G.F------------------D-----------N...VNKMLDA.Q--------------------GLHK.TRLRRH
B9XGI6_9BACT/30-235...G.I------------------T-----------N...VNQTLNS.L--------------------GFEQ.TRLQRR
D1CAH8_SPHTD/29-234...G.V------------------E-----------S...INRTIAS.L--------------------GLTG.TQLQRK
C6JN74_FUSVA/22-213...G.M------------------D-----------K...INESIKA.N--------------------GFRG.TVLGRK
D3A9C2_9CLOT/37-244...G.I------------------E-----------E...INRTIRR.L--------------------GYRD.TVLRRK
C3WTB7_9FUSO/29-234...G.M------------------E-----------N...INQLGKE.L--------------------DLKE.TFLGRK
C0WAD9_9FIRM/29-233...G.M------------------K-----------A...INERAKK.L--------------------GLAQ.THLGRL
A6TPV9_ALKMQ/24-228...G.F------------------E-----------N...INQRAEK.L--------------------GLKE.TVLSRK
Q97MK6_CLOAB/29-233...T.M------------------D-----------S...INNYGKK.I--------------------GLKT.TLLRRK
Q2B497_9BACI/33-237...G.K------------------K-----------N...INDRMHG.L--------------------GLQT.TVLGRK
D1BLB4_VEIPT/34-242...G.M------------------E-----------N...INARAEK.L--------------------GVDE.MELNRM
C9M6L1_9BACT/27-241...G.L------------------D-----------G...INDRIRS.L--------------------GMKS.TSLERR
D2RJL4_ACIFV/65-269...G.M------------------D-----------R...INSYLQS.H--------------------GYSH.SVLRRK
C4V1H1_9FIRM/88-292...G.M------------------E-----------E...INAYITR.N--------------------GYTD.TILQRK
C9LUU8_9FIRM/91-296...G.M------------------T-----------E...INGYMRA.H--------------------GYDA.SRLQRK
D3LTR8_9FIRM/96-300...G.M------------------D-----------A...INHYMQQ.H--------------------GYTE.TRLEWK
A9B776_HERA2/21-222...GGI------------------Q-----------A...ANSWLQQ.A--------------------GYQA.TRWGRV
C0WDD8_9FIRM/88-297...G.W------------------D-----------E...INAYLLR.K--------------------GYAD.TILGSP
D2RLG2_ACIFV/74-285...G.R------------------E-----------D...LNEWLAK.Q--------------------GYAD.TVVGTA
Q8YNM1_NOSS1/217-419...GGM------------------E-----------A...LNERFRS.W--------------------GLTN.TVIRNI
B2J7F0_NOSP7/218-420...GGM------------------E-----------A...LNQRFRT.W--------------------GLTT.TTIRNS
D7DW46_NOSA0/212-414...GGQ------------------E-----------V...LNERFRS.W--------------------GLAT.TMIRNP
A0ZAJ6_NODSP/233-435...GGM------------------E-----------A...LNQRFLR.W--------------------GLSA.TAIRNP
A0Z083_LYNSP/220-422...GGA------------------E-----------F...INQKFLD.W--------------------GLHN.TVIRDV
B0CCE0_ACAM1/37-239...GGA------------------E-----------K...LNQRFKS.W--------------------GLKH.TTIRNP
B8HLP2_CYAP4/158-360...GGA------------------A-----------A...LNQRFLS.W--------------------GLQQ.TVIRNW
B2IVV4_NOSP7/225-427...GGV------------------T-----------K...LNQRFRN.W--------------------GLKD.TVIRHL
B8HM72_CYAP4/205-407...GGP------------------G-----------V...LNQQFRS.W--------------------GLKQ.TVIRNW
B7KDD6_CYAP7/166-368...GGK------------------E-----------A...LNERFKA.W--------------------GLTQ.TVINNP
A8YG35_MICAE/134-336...GGK------------------K-----------A...LNQRFQA.W--------------------GLTS.TVINNP
C7QSD1_CYAP0/172-374...GGK------------------E-----------A...LNARFRD.W--------------------GMTN.TVINNR
Q55897_SYNY3/237-440...GGK------------------E-----------F...LNQRFQA.W--------------------QMPQ.TKINNY
Q5N617_SYNP6/75-277...GGI------------------E-----------A...VNQRFAA.W--------------------GLQT.TRIRNL
B4WI30_9SYNE/252-455...GGP------------------E-----------A...LNNRFIN.Y--------------------GLET.TQLNAP
Q2JKE0_SYNJB/180-382...GGQ------------------E-----------T...LNQKFRQ.W--------------------GLQH.TQISWW
C0GGV0_9FIRM/114-323...G.F------------------Q-----------H...INDRIKE.Y--------------------GLKN.TRAHRK
F1T3K7_9ACTN/155-354...G.Q------------------D-----------A...INERVQA.L--------------------GCKN.TSLNRQ
Q08XP3_STIAD/57-318...G.V------------------D-----------N...VQAQLAA.R--------------------GVRT.GPVSSL
A4VI25_PSEU5/54-317...G.E------------------D-----------A...LNQRTRK.S--------------------MGGD.FEAITS
A4IY62_FRATW/49-258...GGL------------------K-----------N...LNKFILS.L--------------------ADHA.TKVANL
C6YW16_9GAMM/49-258...GGL------------------N-----------N...LNNFILS.L--------------------HDHA.TKVAGL
A7JMA9_FRANO/43-254...GGL------------------Q-----------N...LNKFIKK.L--------------------GDND.TIITAD
C6YWK1_9GAMM/44-255...GGL------------------E-----------K...LNKLVAK.L--------------------GDKD.TIIKND
B9EC94_MACCJ/44-253...GGL------------------K-----------E...VEKRLSA.L--------------------GIKG.VNVNRK
Q9X6W1_ECOLX/63-282...GGT------------------N-----------K...VHNFISK.L--------------------GVKN.ISIKAT
B6WTZ1_9DELT/61-280...GGP------------------S-----------V...VEACARR.L--------------------GADS.VFIGHN
C3X8Y4_OXAFO/46-265...GGP------------------G-----------A...VTAYLRE.K--------------------GIKD.MTVATT
C3X3G5_OXAFO/49-269...GAP------------------E-----------K...VTAFLRR.H--------------------GVAG.MTVATT
C8C144_9ZZZZ/49-267...GGI------------------Q-----------N...VNDFIKN.L--------------------GIDR.IQLIET
B3D802_BURM1/59-267...GGP------------------Q-----------A...VTAFARE.S--------------------GDTT.FRLDRW
A6WDM1_KINRD/35-232...GGR------------------A-----------A...LTAFCRG.L--------------------GDER.TRLDRA
Q92Y19_RHIME/54-306...GGT------------------K-----------A...VQAFLDE.A--------------------GLQG.IRIDRT
B0T712_CAUSK/59-310...GGP------------------G-----------A...VTAWLQG.R--------------------KVAP.LDIDRY
D5VFF5_CAUST/60-304...GGP------------------G-----------A...VNGWLDV.R--------------------QLRG.VSVDRY
Q2GBE0_NOVAD/96-299..MG.P------------------S-----------G...MAAWLER.R--------------------GFGE.VAFGPS
C4VSL3_9LACO/99-291...G.K------------------D-----------K...VNETAKA.F--------------------GASK.TEITEN
D0DKJ8_9LACO/105-290...G.V------------------N-----------N...IDQVAKK.M--------------------GATQ.TKVNSN
Q5FIM3_LACAC/104-295...G.V------------------N-----------N...VDSVAKR.M--------------------GATQ.TTIAKN
C9M3W5_LACHE/79-269...G.I------------------K-----------S...IESVAKI.M--------------------GADQ.TTIAKR
D6S2M9_9LACO/93-284...G.K------------------E-----------Q...VNNIIKE.M--------------------GTRE.TVISNK
Q55G30_DICDI/66-270...K.I------------------E-----------S...VNSLFSE.L--------------------GMND.SQFIEW
C3BL34_9BACI/43-240...GGW------------------E-----------E...VNRRIQC..--------------------SFSK.IYIT..
C2QCU8_BACCE/29-226...GGW------------------N-----------T...VREYVLT.Y--------------------.FSK.IYIQ..
C2Z8Y6_BACCE/25-222...GGW------------------D-----------T...VREYVST..--------------------NFSK.IHIQEN
C2PG18_BACCE/23-220...GGW------------------D-----------S...VRKYVST.Y--------------------.FPN.IHVQEN
B0AK42_BACAN/23-220...GGW------------------D-----------V...VKTYAQT.Y--------------------.FSK.IHIQED
C2VCY9_BACCE/29-226...GGW------------------D-----------A...VKINAQT.Y--------------------.......FSKI
Q112T9_TRIEI/199-405...G.Q------------------P-----------Y...INKVLKD.D--------------------GYKI.IRVNYK
C8WKG4_EGGLE/143-342...D.Q------------------N-----------D...FQAWCAA.A--------------------DVDA.AAWQ.G
B1S8A7_9BIFI/117-306...G.T------------------G-----------A...FDSWAAQ.A--------------------GT....AVQMA
A7A336_BIFAD/133-323...G.L------------------D-----------C...FNTWAEQ.A--------------------GAAS.R.....
A4E932_9ACTN/111-301...D.H------------------D-----------G...YEDWIAN.L--------------------GVDD.ETALNP
A5G729_GEOUR/100-303...S.A------------------A-----------E...LEDVLLS.M--------------------DI.........
Q3DFC2_STRAG/213-406...N..------------------.-----------.....NQYDSM.F--------------------QTQV.DTISGM
C2LQQ9_STRSL/215-408...T..------------------N-----------Q...YDKAFQK.S--------------------.VDK.AAATSW
B4U5H8_STREM/213-406...C..------------------N-----------Q...YNQAFQS..--------------------EIRA.LAGVD.
C5WDV2_STRDG/213-406..HQYD------------------Q-----------A...FQTEIKA.L--------------------S........GS
A4VS97_STRSY/211-404...A..------------------.-----------......NKFDS.N--------------------FYQV.ITAKTG
A3CJX6_STRSV/212-405..NQSD------------------K-----------N...FQQTINK..--------------------.......IAGK
A8B001_STRGC/211-404...T..------------------D-----------K...SSSTYRS..--------------------TIEN.IAGR..
D3H625_STRM6/207-400...S..------------------N-----------Q...SDSTFKS..--------------------KMSA.IMGDDW
D4FQE8_STROR/207-400...T.N------------------Q-----------SDGAFKEKMYA.I--------------------MGED.WDVN..
D2BLR7_LACLK/232-427...E.T------------------Q-----------E...FNPNYQK..--------------------EINR.IA..GQ
C1I3T7_9CLOT/61-249...S.K------------------I-----------S...LTDYLRD.I--------------------TEDD......S
C7VVX9_ENTFL/70-261...G.G------------------D-----------A......KAKQ.E--------------------MYQ......RY
Q67RI7_SYMTH/15-208...G.W------------------G-----------N...IERWTET.I--------------------GGRL.THEDR.

PF00905

PBPH_BACSU/372-692---AGVTYKPHGSL..PADQNDLLK----------..---MRNYYSQ-F--------------------GLGVKTGIDLP
PBPF_BACSU/322-595---GVE..................T----------..---GKSYLKA-N--------------------GIDIPDE....
SP5D_BACSU/246-557---GKE..................K----------..---LFKYIKD-F--------------------GFGQKTGIDLQ
PBPB_BACSU/268-577---GYD..................R----------..---LNQYLHK-F--------------------NFYQKTGIDLP
Q45297_BACLI/374-591---GED..................H----------..---LRHYLKS-I--------------------HYGNEDF....
PBPA_MYCTU/160-484---GAD..................A----------..---LRSMARA-F--------------------GLDSPPRPTPL
PBPA_BACSU/352-641---GKD..................T----------..---AVDFANG-L--------------------GLGLTKDNVT.
Q51504_PSEAI/247-547---GAE..................S----------..---IYSVMQQ-V--------------------GLGQDTGLGFP
Q9ZHF7_BURPI/25-267---GAQ..................T----------..---FQAYVRK-L--------------------GYGNMDVSGDP
PBPI_BACSU/263-574---KKD..................S----------SV---IEDMSEK-L--------------------ALTDRAGWEGK
P71707_MYCTU/310-601---NGG..................P----------QA---VADAAHQ-A--------------------GIASSFPGVAH
Q51505_PSEAI/242-539---GPK..................P----------..---ILEQLGR-V--------------------GFGAPLSLGFP
P72405_STRCL/273-546---SES..................S----------..---LKQAAEA-F--------------------GIGGTWDVGAS
Q59439_ENTHR/364-671---GEK..................K----------..---FREGLNK-F--------------------IFGEDLDLPIS
P73117_SYNY3/281-593---KPE..................R----------..---YYELLQG-V--------------------GLDSRTGIDLP
PBP2_HAEIN/279-618---GID..................R----------..---LSNWMKD-F--------------------GFGMPTGIEIQ
P96052_STRTR/367-698---LGQQYVPGMSLSTDNMEKAMTT----------..---LRDTYAE-F--------------------GMGVSTGLDLP
Q9AEF8_9GAMM/23-259---GMT..................R----------..---FKNYVDA-F--------------------HYGNQDISGDK
O54282_STASC/363-580---RQD..................E----------..---VKSYLDL-I--------------------EYGNEEI....
Q98LR0_RHILO/12-247---GPE..................S----------..---FAGYVSK-L--------------------GYGNKDVSGNP
FTSI_ECOLI/260-555---PSS..................A----------..---LVDTYSR-F--------------------GLGKATNLGLV
PBPX_STRPN/289-609---GDA..................T----------..---WLDYLNR-F--------------------KFGVPTRFGLT
O07106_ENTFL/295-608---GDE..................K----------..---WMEYLKK-F--------------------GFGTSTHSGLI
Q9KHJ3_SHIFL/42-276---GLN..................K----------..---IKNYLKD-F--------------------DYGNQDFSGDK
PBP2_NEIFL/81-376---PKE...................----------..---MYDFYHD-L--------------------GVGVRMHSGFP
Q55926_SYNY3/76-292---GEA..................K----------..---AREYLTQ-I--------------------DYGNVDS....
Q9K4N2_STAHA/361-577---PKN..................Y----------..---TATQLKQ-L--------------------NYGNKNL....
Q9F0V2_ACIBA/53-270---GLE..................L----------..---MQKEVKR-V--------------------NFGNTNI....
O06214_MYCTU/338-656---GPE..................R----------..---YYDMLRK-F--------------------GLGQRTGVGLP
PBPC_BACSU/352-666---GAD..................T----------..---FTKGLKT-F--------------------GFSEDVPYEFP
YQGF_BACSU/352-682---GKGEYKPHQAL..PLDTSAFDT----------..---FRNYFSQ-F--------------------GLGVKTGIDLP
PBP2_STRR6/343-671---MGQTYQPNMFVGTSNLESAMEK----------..---LRSTFGE-Y--------------------GLGTATGIDLP
PBP_STAAU/347-660---GSK..................K----------..---FEKGMKK-L--------------------GVGEDIPSDYP
Q9AEY7_PSEAI/35-252---GAL..................K----------..---YPAYIQQ-T--------------------NYGHLLE....
Q9K319_AERHY/24-259---GME..................R----------..---FQQYVDR-F--------------------DYGNRDLSGNP
Q53725_STAAU/268-579---GAD..................K----------..---MKSWYER-F--------------------GFGKSTKGMFD
O26078_HELPY/280-589---NPK..................D----------..---FYNGLLG-Y--------------------GFSQKTGIDLS
Q9EY51_ACIBA/42-258---GEN..................K----------..---ARSYLEK-L--------------------NYGNADP....
PBP2_ECOLI/271-609---GID..................R----------..---LSEWMGK-F--------------------GYGHYTGIDLA
O33622_STRCH/299-660---KKDGGMN..........PKNPH----------DY---FYKAAHQ-F--------------------GLGAKTGIDLP
P94124_ACIBA/42-258---GED..................K----------..---ARRYLKQ-I--------------------DYGNADP....
FTSI_HAEIN/280-572---PPS..................A----------..---LMETYQN-A--------------------GLSKPTDLGLI

PF00144

Y4209_BACPE/17-329---KIT------------------T..G.QS.....VAEIV.DQVFK-S.................L..EFKE-TGWYGE
Q9XWZ6_CAEEL/290-607---EKV------------------S..G.RS.....YEEYAMEKVLN-P.................I..GVNA-TIGKEG
Q9U3M7_CAEEL/420-758---ETT------------------T..G.MS.....YEAFVKKNIFA-P.................S..GVYD-IQVARP
YBBE_BACSU/52-423---EKL------------------T..G.KP.....LDVYTEQELYK-P.................L..RLKH-TLYNPL
Q9YFA3_AERPE/8-341---ERS------------------S..G.YS.....YEEYIRRLVFE-K.................L..GMTS-SGFIG.
AMPH_ECOLI/31-372---ANA------------------S..G.KP.....YTQLFEEQITR-P.................L..GMKD-TTYTPS
Q9RKC5_STRCO/36-410---RRV------------------S..GGRG.....AGQWIADEIAG-P....................LGLD-LWVGLP
O88012_STRCO/23-405---EVV------------------S..G.QP.....LDVFCAERIFG-P.................L..GMTD-TGFHVA
Q53403_PSEFL/18-377---RRA------------------D..G.RG.....PGESIVARVAR-P....................LGLD-FHVGLA
P72041_MYCTU/40-404---YAA------------------T..G.KE.....IREILATEILD-P.................L..GFRW-TNFGVA
Q98HG2_RHILO/72-389---ERA------------------S..G.QR.....FSDLMREKLWL-P.................L.GAVSD-ASIGVD
Q988B4_RHILO/18-370---RRV------------------D..G.RS.....IGRFIGEEIAG-P....................LGAD-FHVGLP
Q97ML5_CLOAB/11-343---EKI------------------G..G.DT.....LDILCDRYIFK-P.................L..YMEN-TTFKPK
BLAC_STRAL/53-307---GGP------------------A..AVTR.....FVRSLGDRVTR-L....................DRWE-PELNSA
Q9A2R7_CAUCR/45-374---AYR------------------A..G.GD.....YETVLRQRVLT-P.................L..GMSD-TAIVLS
Q9A3W5_CAUCR/42-393---EAV------------------T..G.QT.....WEQVIKARIFD-P.................L..GMSN-TVSSPR
Q9A6I9_CAUCR/103-453---SNV------------------T..G.KP.....FEQLVSEEIII-PAGLTRTTFREARPWRDDLPAPMAE-TLAADL
PBP4_NOCLA/8-348---EVL------------------T..G.QS.....WDDALRDRLFT-P.................L..GLHQ-SMTLPE
BLAC_BACSU/53-299---GGP------------------K..GFEK.....SLKQIGDHVTK-A....................KRFE-TDLNSA
Q9A862_CAUCR/42-382---EDR------------------FGLD........WRDMVDREVLR-P.................A..GMTR-TTARID
Q9I1G0_PSEAE/16-386---ERV------------------D..G.RP.....LAEALRQRVGI-P.................A..GMRD-SGFLCA
Q9CE05_LACLA/7-308---EEY------------------Y..G.ES.....LDKIFYKQVFE-D.................W..KMTD-TSFGPV
AMPC_YEREN/37-388---VKR------------------S..Q.LT.....FENYMKEYVFQ-P.................L..KLDH-TFITIP
Q97FD2_CLOAB/68-427---ERV------------------A..G.VS.....YTTYITNNITD-I.................L..KMNN-TKTPAS
Q21569_CAEEL/51-419---RHT------------------DDQK.RG.....IGQFFREEIAT-K....................LDVD-YHIGLP
Q9Y7D1_ASPTE/17-406---ERA------------------TGLD........LEQYLQENICA-P.................L..GITD-MTFKLQ
BLAC_BACCE/55-300---GGP------------------K..GYEK.....ALRHMGDRITM-S....................NRFE-TELNEA
BLC1_ECOLX/37-285---GGP------------------A..SVTA.....FARQLGDETFR-L....................DRTE-PTLNTA
P74474_SYNY3/27-387---EKV------------------Y..G.QS.....YAELIDKKLLQ-P.................L..ELNN-TFYPIP
BLAC_STAAU/27-275---GGI------------------K..KVKQ.....RLKELGDKVTN-P....................VRYE-IELNYY
PBPX_BACSU/82-390---AEV------------------S..G.EP.....YEQYIKNHIFK-P.................A..GMTH-AGFYKT
AMPC_LYSLA/32-381---AKS------------------M..R.MP.....FQKAMTGVLLP-K.................L..GLTN-TYLTVP
AMPC_ENTCL/32-381---VKP------------------S..G.MP.....YEQAMTTRVLK-P.................L..KLDH-TWINVP
BLAC_CITDI/40-288---GGT------------------S..NVTA.....FARSIGDTTFR-L....................DRKE-PELNTA
Q48437_KLEPN/33-381---ANS------------------L..G.QP.....FEQLMSQTLLP-K.................L..GLHH-TYIQVP
BLAC_STRLA/46-298---GGP------------------E..AVTR.....FCRSVGDRTTR-L....................DRWE-PELNSA
P71778_MYCTU/39-398---RAV------------------T..G.KD.....MRLLFREELAE-P.................L..DTDG-LHLGRP
Q9ABH2_CAUCR/19-369---RRV------------------D..G.RT.....MGTALREDICE-P....................LGLD-LWIGLP
Q9ZDR6_RICPR/33-395---EKV------------------AKKD........LANFFYDEFFK-P.................L..NMKS-TSFASY
Q99QC1_ENTAE/36-381---ASS------------------L..K.QP.....FAPLMEQTLLP-G.................L..GMHH-TYVNVP
AMPC_PSYIM/50-399---ALS------------------MHSD........YTKLIENTVLP-S.................L..KMTN-TFVDVP
Q97PZ0_STRPN/6-304---ERI------------------F..N.QD.....LDVILKDQVWK-P.................W..GMTE-TKFGPV
BLAC_RHOCA/38-285---GGP------------------E..AVTQ.....FFRSVGDPTSR-L....................DRIE-PKLNDF
Q9RK50_STRCO/17-371---RRA------------------T..D.RP.....MRQLLREWVTE-P.................L..GLEG-NLYFSV
BLAC_NOCLA/49-295---GGP------------------Q..GLDA.....ALTAVGDEVTS-A....................DRWE-PELNSA
O05900_MYCTU/63-408---AAA------------------A..G.QS.....WEDLSDEVLYR-P.................L..GMGS-TSSRFT
O86739_STRCO/48-382---EKV------------------T..G.RS.....YASEATRLVLR-P.................A..GMHH-TYFPGT
AMPC_PSEAE/38-388---ARS------------------L..G.QP.....FERLMEQQVFP-A.................L..GLEQ-THLDVP
P94288_BACCE/53-388---ETV------------------T..G.NS.....YAEEIENRIIE-P.................L..ELSN-TFLPGN
Q9X5Q0_STRLA/21-361---QRV------------------T..G.RS.....FRDFVTSELFA-P.................L..GLND-LHMGLP
O62481_CAEEL/42-406---EKC------------------S..G.KT.....YRQLANQLFSD-L....................GMRN-TQLDTK
Q98JC7_RHILO/43-383---AAA------------------MPTG.KS.....WEEVAQEKLYR-P.................L..GMAS-TSSRHS
YFEW_ECOLI/43-414---ESV------------------T..G.QP.....LDRYVEESIYR-P.................L..GLTH-TVFNPL
ESTB_BURGA/22-391---ERA------------------T..G.QP.....LAAAVDALVAQ-P.................L..GMRD-CGFVSA
P71988_MYCTU/60-399---ELV------------------A..G.TT.....YESTVQRLLLD-P.................L..QLAH-TRYFSD
BLAC_BACVU/48-310---NRL------------------FTEG........LIDDEKQSFIK-N....................TLKE-CKTGVD
Q9X8U8_STRCO/16-340---EKL------------------R..G.AP.....WEEVLQREVLD-P.................L..ELRR-TGTRPS
BLAC_PROVU/10-258---GGP------------------S..KVTQ.....FARSINDVTYR-L....................DRKE-PELNTA
BLAC_STRFR/46-298---GGP------------------T..AVTR.....FCRSVGDHVTR-L....................DRWE-PELNSA
Q9Z4V4_STRFR/44-398---EKA------------------T..G.HS.....WQHEVRTRVIE-P.................L..GLRH-TYAPDT
AMPC_CITFR/32-381---VKS------------------S..G.MS.....YEEAMTRRVLQ-P.................L..KLAH-TWITVP
BLAC_STRCE/50-302---GGP------------------T..AVTR.....FCRSLGDPVTR-L....................DRWE-PELNSG
Q9HT32_PSEAE/60-409---HAA------------------TRIP........VSDYLSERIWA-R.................M..GMES-DGFWQL
AMPC_ECOLI/28-377---VKP------------------S..G.LS.....FEQAMQTRVFQ-P.................L..KLNH-TWINVP
Q9X5R0_STRLA/136-514---PVV------------------DGRE........YRAYVQEEILG-PCGMSGTRVHLDREEFAALGGELPL-IHVSNP
FMTA_STAAU/48-386---EEV------------------T..G.KS.....YAENYYTKIGD-P.................L..KLQH-TAFYDE
Q18384_CAEEL/50-416---RRV------------------DSQK.RT.....VGQFFKDEIAT-K....................HYID-IHIGEC
Q9K4I2_STRCO/49-431---EEV------------------T..G.RT.....LDVLLREEITK-P.................L..GLTR-TRYNPP
Q9HW54_PSEAE/59-378---HGM------------------L..G.AD.....YAEYPWRALFE-P.................L..GIRS-AVWERD
Q9LCC8_OCHAN/4-353---AHE------------------T..G.KP.....YSDHLRSRIFA-P.................L..GMKD-TWVGTH
BLAC_BACLI/50-296---GGP------------------E..SLKK.....ELRKIGDEVTN-P....................ERFE-PELNEV
Q9K351_HAFAL/39-387---AKS------------------L..G.VS.....YEDAIEKTLLP-Q.................L..GMHH-SYLKVP
O53190_MYCTU/21-384---RRV------------------T..G.RT.....VGQYLRTEIAE-P....................LGAD-VHIGLH
BLA1_PASHA/50-296---GGV------------------E..QYQR.....ILRQLGDNVTH-T....................NRLE-PDLNQA
Q9RWA9_DEIRA/32-336---AHA------------------A..G.EETSAAGYKRALRRLVTF-P.................L..GLPG-VGLTPA
Q9PCY3_XYLFA/65-407---FAA------------------S..G.DF.....YEQAVERRIFK-P.................L..GMND-ASLGLA
Q9XA95_STRCO/30-359---AAT------------------TGTA........WEDLITGQVLR-A.................L..GLSG-TALRAE
Q9RYU2_DEIRA/7-325---ERV------------------S..G.RP.....LGEFALDAELT-F.....................VPD-PAHAVA
BLE1_PSEAI/35-292---GGP------------------A..ALHD.....YIQSMGIKETA-V....................VANE-AQMHAD
Q988N4_RHILO/12-356---ETL------------------TRKS........YAEYVSENILK-P.................LGMDQTS-SGLAPG
P95207_MYCTU/41-390---EKA------------------AGQD........MPTLLQRKVLS-P.................L..GLTA-TANSDT
Q9A7L6_CAUCR/54-390---HAR------------------TGLD........YAEAVKRRLFE-P.................L..GMKS-TTFGEA
BLA3_BACCE/59-305---GGP------------------S..AFEK.....ILREMGDTVTN-S....................ERFE-PELNEV
AMPC_PROST/35-383---AKQ------------------L..N.MP.....FSQAMEKLMLP-S.................L..GLKH-TYIHVP
Q7DFY3_SALEN/31-280---GGP------------------K..ELTA.....FLHNMGDHVTR-L....................DRWE-PELNEA
Q9A3L3_CAUCR/99-483---EVI------------------S..G.MP.....FDVFLKTRIFD-P.................L..KMVD-TGFFVP
BLA1_STRCI/57-318---GGR------------------R..GSTR.....VLKQLGDHTTS-M....................DRYE-QELGSA
Q9A9U2_CAUCR/29-330---EKA------------------A..G.RP.....MSRFADETLFK-P.................L..GIDV-WRWDAD
Q21523_CAEEL/50-420---RRV------------------DKKK.RT.....VGQYFKEEIAD-K....................HNID-FYIGLP
Q44050_ARTGO/17-368---RRI------------------T..G.ST.....LQEIYEQRIRS-V....................TGAH-FFLGLP
PBPE_BACSU/9-348---EKA------------------S..G.MS.....YADFIKTSIFL-P.................A..GMNE-TRVYNR
LACT2_CAEEL/79-448---RRS------------------DPKG.RS.....VGRFFKEEVAD-V....................HGID-FHIGLP
Q9I4S7_PSEAE/29-387---RRV------------------D..G.RE.....PGEAIVARTAA-P....................LGLD-FHVGLD
Q9RER5_ENTAE/32-381---VKP------------------S..G.MS.....FEQAMSQRVLQ-P.................L..KLSH-TWINVP
Q9V2D6_PYRAB/6-348---EKV------------------S..G.VS.....YEEYIKKKILE-P.................L..GMNR-SYFFKE
Q9C2S3_NEUCS/19-388---EKY------------------SGKS........FKDCLRDYVLV-P.................L..SLHN-TTTTPD
Q9A800_CAUCR/77-466---EKL------------------S..G.QS.....LPVFMQERIFT-P.................L..GMKD-TAFYVP
Q9XU43_CAEEL/52-422---RKA------------------DPRG.RN.....IKRFFEEEIAR-P....................NDLD-IQIGAQ
Q9I2U5_PSEAE/43-384---ERN------------------TGKH........FEQHMREHLLD-P.................L..QMTR-SSFARN
Q9AAM2_CAUCR/38-371---ERV------------------Y..G.QS.....YQTLLARYIER-P.................F..GMGA-GVVEPP
Q99Y64_STRP1/9-304---EEL------------------F..S.ES.....LDQIFDKTIFT-P.................F..GMYH-TSFGPR
Q9A7Z9_CAUCR/50-429---EKL------------------T..G.LS.....LGDFMKSRIFD-P.................L..KMKD-TGFWLP
Q9AI08_PHOLU/55-396---SKA------------------A..G.XP.....YTRLLHDKITG-P.................Y..YMKD-TTLTPS
Q9RKP5_STRCO/2-343---ERI------------------T..G.RG.....LDVLVRDGITR-P.................L..GMTA-TGFGP.
BLAC_STRBA/57-305---AGP------------------K..GLDA.....SLEKLGDDITR-M....................DREE-PELSRW
DAP_OCHAN/9-333---EAH------------------TGRT........LVDILSERIFA-P.................A..GMKR-AELISD
P95290_MYCTU/53-411---RAV------------------T..G.KG.....MRELFREELAR-P.................L..NTDG-IHLGRP
BLO1_KLEOX/37-285---GGP------------------E..KVTA.....FAQSIGDVTFR-L....................DRTE-PALNSA
FLP_STAAM/43-372---QNV------------------TKQS........YTKYITNSWLK-P.................L..HMTH-TSFKQT
Q9A2D7_CAUCR/97-472---ERL------------------S..G.QP.....FETYVKANVLE-P.................L..GMRT-TAWTQP
BLA2_STRCI/60-307---GGP------------------K..GLDK.....TLEGLGDHVTR-M....................ERVE-PFLSRW
AMPC_MORMO/31-379---ANA------------------A..G.MP.....YEQLLTARILA-P.................L..GLSH-TFITVP
BLAC_PROMI/36-285---GGP------------------K..ALTK.....FLRSIGDDTTR-L....................DRWE-PELNEA
P71981_MYCTU/64-388---EAA------------------A..G.QP.....MPELMSELLWS-R.................I..GAQC-DATIAL
BLAC_YEREN/39-287---GGL------------------A..AVNQ.....FARSIGDQMFR-L....................DRWE-PDLNTA
Q9EX97_OCHAN/38-387---ARS------------------M..D.KP.....FDVLMEQKLLP-A.................F..GLKN-TFINVP
BLAC_STRAU/51-304---DGP------------------T..GITR.....FCRSLGDTTTR-L....................DRWE-PALNSA
AMPC_SERMA/27-374---AKS------------------L..D.QP.....FIQAMEQGMLP-A.................L..GMSH-TYVQVP
BLAC_KLEPN/29-278---GGP------------------A..GLTA.....FLRQIGDNVTR-L....................DRWE-TALNEA
O87861_STRAQ/19-378---RRI------------------T..G.LL.....PGAFLRQEITG-P....................LGID-FTFGLP
BLC3_PSEAI/29-277---GGP------------------K..GVTD.....FLRQIGDKETR-L....................DRIE-PDLNEG
Q9WXD6_BRELN/11-387---EGI------------------T..G.TT.....LGQAMQTRVLD-P.................L..GMKD-SSFRTS
Q44260_AERSO/33-381---ASS------------------L..Q.QP.....FSTLMEQTLLP-A.................L..GLEH-TYLQVP
P74200_SYNY3/25-369---EEV------------------T..G.QS.....FAEFMQEQILH-P.................L..GMTG-ANFDWP
Q9F3F0_STRCO/31-381---EEV------------------T..G.TS.....AERCITRNVIE-R.................A..GLRD-TELPTG
Q9L8D3_SORCE/35-419---GRA------------------ADQ