Sequence alignment for CL0015

PF03209

P73827_SYNY3/40-466-------------------------------------------------------------------VL-------NR--
PUCC_RHOS4/51-454-------------------------------------------------------------------TL-------NR--
BCH2_RHOCB/28-417-------------------------------------------------------------------TL-------NR--
D5AMI6_RHOCB/54-460-------------------------------------------------------------------TL-------NR--
D5ANS1_RHOCB/51-456-------------------------------------------------------------------TL-------NR--
G3XCS5_PROMA/1-413-------------------------------------------------------------------ML-------NR--
I0HT76_RUBGI/55-465-------------------------------------------------------------------TL-------NR--
Q3J171_RHOS4/51-459-------------------------------------------------------------------TL-------NR--
Q3J183_RHOS4/28-414-------------------------------------------------------------------TL-------NR--

PF13347

Q2G9N1_NOVAD/15-450-------------------------------FNGLG-----SVAYGIKDNG-------------FATFL-------LL..
C4Z9B4_EUBR3/10-441-------------------------------AFGFG-----AFGKDIVYML-------------ISSYL-------LY..
Q0AL93_MARMM/20-465-------------------------------LYGVG-----SMAYGVKDVA-------------FRAYL-------LW..
Q28K27_JANSC/9-401-------------------------------P.GYA-----VFAAMLASAG-------------LPIYI-------HAP.
E6WJ95_PANSA/12-430-------------------------------SYGLG-----DMASHIAIDN-------------VIIFL-------TF..
D2VB35_NAEGR/26-486-------------------------------SQILI-----AILPTFLTSI-------------LDVYI-------DMHL
D4LG93_9FIRM/24-452-------------------------------FFGVG-----DAGFVLMSNI-------------ETFYF-------MT..
Q8I3H5_PLAF7/74-507-------------------------------SFSCP-----MIGVGGMNLI-------------STIYT-------SY..
Q026U3_SOLUE/24-465-------------------------------MYGVG-----EIANAVKTVT-------------FALYG-------LF..
A6TPY1_ALKMQ/12-433-------------------------------AYGFG-----ELGFIIMMTL-------------ATTYY-------SY..
B1ZS00_OPITP/16-436-------------------------------GFGAG-----DAAVNVVWSA-------------LAIII-------TF..
B2GBT3_LACF3/25-466-------------------------------SFCFG-----NLGHSAFYGA-------------LSTYF-------IV..
R7CNT8_9FIRM/17-438-------------------------------AYGFG-----DVGCNFSWMF-------------VSNFL-------MI..
D4L2L1_9FIRM/12-431-------------------------------SYGLY-----FMGQNVFYGL-------------VG.YM-------TT..
C5BVC3_BEUC1/25-453-------------------------------LIAMP-----LPAAMMSSVL-------------IHNVY-------VK..
A1SNV8_NOCSJ/14-434-------------------------------GYGSG-----SVATGAFGTV-------------PGLML-------LP..
A6TPY6_ALKMQ/13-436-------------------------------GYGVP-----DLTCNLMMMG-------------AVTYY-------AY..
NLS1_XENTR/40-494-------------------------------CFAIG-----GAPYQITGCA-------------LGFFL-------QI..
A7HQL5_PARL1/12-433-------------------------------MHGSI-----GLPIAMFGYP-------------VAVWL-------PP..
C3Z8Z9_BRAFL/18-394-------------------------------CYGIG-----GAGIEITWTV-------------LGAYT-------ST..
Q03PA7_LACBA/7-451-------------------------------SYAAG-----ALGHDAFYAT-------------LSTYF-------AM..
Q2N8H6_ERYLH/15-453-------------------------------INGSG-----AVAFGVKDLG-------------FSFFL-------LP..
D1BWG8_XYLCX/33-459-------------------------------GFGSG-----DLAQNLIYNT-------------VSTYL-------LF..
Q5YU93_NOCFA/41-478-------------------------------GYLLG-----PSGALLLNAV-------------LATYL-------NV..

PF03092

Q25272_LEIDO/59-606--------------------------------------------KGLANGL-------------MRLSM-------QP--
B3GVG0_TRYBB/138-667--------------------------------------------KGIAHDM-------------IRTTL-------FP--
Q9UAB8_LEIDO/94-683--------------------------------------------KGIADQL-------------ISYSR-------QP--
Q9UAB7_LEIDO/75-654--------------------------------------------RGVADRI-------------LTGQT-------YA--
Q9UAC0_LEIDO/76-655--------------------------------------------KGVADQI-------------LYGQT-------YA--
Q9UAC1_LEIDO/75-651--------------------------------------------RGVADRI-------------LTGQT-------YA--
FBT8_ARATH/98-515--------------------------------------------QGS.RCF-------------PWLAL-------NF--
FBT7_ARATH/30-441--------------------------------------------QGF.RGF-------------PWLGA-------NF--
FBT3_ARATH/61-473--------------------------------------------QGLGKGL-------------SKVST-------QY--
FBT1_ARATH/137-553--------------------------------------------QGV.LGL-------------ARLAV-------SF--
FBT_SYNY3/46-457--------------------------------------------QGV.LGL-------------SRLAV-------SF--
O68867_SYNE7/38-441--------------------------------------------QGI.LGL-------------SRLAV-------SF--

PF06963

S40A2_ARATH/31-479--------------------------RSMVISLYLG-----YFLARWGART-------------WEFSV-------AL--
S40A1_ORYSJ/21-450--------------------------AALLRRLYVG-----HFLARWGARM-------------WEFSV-------GL--
S40A1_ARATH/35-483--------------------------RRFVIYLYVG-----YFLARWSART-------------WEFSV-------AL--
A2R421_ASPNC/42-466--------------------------TRILFRLYIS-----HFLSTWNSRM-------------FEFGA-------VL--
Q5AXY5_EMENI/19-441--------------------------NRVLLRLYTS-----HFLSTWNSRM-------------FEFGA-------VV--
Q8IA95_CAEEL/5-448--------------------------SGKELQLNSA-----FLLTTLGDRM-------------WAFVI-------GL--
S40A3_ARATH/146-569--------------------------PEGLYVLYAS-----CLVGNLVEQL-------------WNFAW-------PS--
Q0CWF0_ASPTN/44-463--------------------------KHVLFRLYVS-----HTLSTWNSRM-------------FEFGS-------VL--
A0A0D1CCA6_USTMA/82-563--------------------------ARGTLLLAVQ-----HATLSWGYRS-------------AEFAY-------PL--
S40A1_HUMAN/22-531--------------------------TSAKFLLYLG-----HSLSTWGDRM-------------WHFAV-------SV--
S40A1_DANRE/19-522--------------------------KSAKFLIYVG-----HALSTWGDRM-------------WNFAV-------AV--
A8X2J9_CAEBR/13-461--------------------------SKASIFLYCA-----YISTCLEDRA-------------WSFCV-------SL--
A5BT51_VITVI/32-472--------------------------SSLIIYLYVG-----HFLARWGARM-------------WEFSV-------GL--
A1CBM9_ASPCL/39-469--------------------------KHVLARLYVS-----HFLSTWNSRM-------------FEFGA-------IL--
S40A3_ORYSJ/147-569--------------------------..AMNALYAA-----CLAGNATEQL-------------WNFTW-------PA--
H3DM67_TETNG/10-523--------------------------..PKFLIYVS-----GALSMWGDRM-------------WHFAI-------SV--

PF13000

C4R336_PICPG/74-584-------------------------------QFALL-----VMLYLIQGVP-------------IGLAF-------GT--
G0WCJ0_NAUDC/17-577-------------------------------QFYLL-----VALYFVQGIP-------------VGLAF-------GT--
G8BYR1_TETPH/85-660-------------------------------QFYLL-----VALYFIQGIP-------------IGLSF-------GT--
Q75EB1_ASHGO/51-585-------------------------------QFYLL-----VALYFLQGIP-------------VGLAF-------GT--
E7K9I5_YEASA/17-559-------------------------------QFYLL-----IMLYLAQGIP-------------VGLAF-------GT--
Q6CKM4_KLULA/10-515-------------------------------QFYLL-----VVLYLLQGIP-------------VGLTF-------GT--
G0VIX6_NAUCC/41-595-------------------------------QFFLL-----IALYFVQGVP-------------VGLAF-------GT--
H2AY09_KAZAF/18-574-------------------------------QFYLL-----VILYFLQGIP-------------VGLAF-------GT--
I2H5Y9_TETBL/23-594-------------------------------.FFLL-----VLLYFLQGIP-------------VGLTF-------GT--
G8JR10_ERECY/17-554-------------------------------QFYLL-----VVLYFLQGIP-------------VGLAF-------GT--
S6E3L5_ZYGB2/13-555-------------------------------QFYLL-----VVLYLLQGIP-------------VGLAF-------GT--
Q6FMM5_CANGA/15-566-------------------------------QFYLL-----ICLYFLQGIP-------------VGLAF-------GT--
C5E2P0_LACTC/16-543-------------------------------.FFLL-----VVLYFLQGIP-------------VGLAF-------GT--
B6ABL4_CRYMR/9-525-------------------------------VIY.L-----ITLYTLQGLP-------------IGLS.-------SS--
G8ZXV2_TORDC/17-551-------------------------------QFYLL-----VALYLLQGIP-------------VGLAF-------GT--
J7RSN7_KAZNA/20-561-------------------------------QFYLL-----VALYFVQGIP-------------VGLAF-------GA--

PF03825

YEGT_ECOLI/1-405-------------------------MKTTAKLSFMM-----FVEWFI-WGA-------------WFVPL-------WL--
Q9A7U2_CAUCR/1-395-------------------------MGTSFRLFVMM-----VLQLAI-WGA-------------WAPKI-------FP--
XAPB_ECOLI/1-407-------------------------MSIAMRLKVMS-----FLQYFI-WGS-------------WLVTL-------GS--
NUPG_ECOLI/1-406-------------------------MNLKLQLKILS-----FLQFCL-WGS-------------WLTTL-------GS--

PF12832

C3YMP2_BRAFL/15-420----------------------------LLVVKAIF-----FLFYSG-TSC-------------IYPYL-------TV--
B4G7T5_DROPE/37-721----------------------------LIMLKITL-----FVMYGA-TSS-------------LLPYL-------TI--
Q17GA0_AEDAE/15-612----------------------------LISLKIVL-----FLFYAA-LGC-------------LHPYL-------QK--
A7UVG6_ANOGA/15-612----------------------------LISLKIVL-----FLFYGA-LGC-------------LHPYI-------QK--
A7RI07_NEMVE/55-515----------------------------LLSYKAFY-----FLFFGG-FGS-------------SFPYM-------SL--
A7SQQ8_NEMVE/56-507----------------------------LLIYKVFY-----FFYFAA-IGS-------------LQPYF-------GL--
Q54G39_DICDI/13-544----------------------------HTNIKLLY-----FFLFSS-LST-------------FYPFI-------TI--
Q55CH3_DICDI/12-488----------------------------HTNLKILY-----FFQSAS-IAC-------------FQPFI-------SI--
B7PL10_IXOSC/11-489----------------------------...MKGHY-----FFYYSA-LSG-------------FLPFI-------GV--
Q6FB61_ACIAD/7-363----------------------------TTKLGGFY-----FFYYAI-VGT-------------FMPYW-------SL--
Q21IX9_SACD2/6-359----------------------------YWRLAFFY-----FVYFAV-IGG-------------LSPYW-------GL--
C5BL70_TERTT/3-356----------------------------YWRLSSVY-----FFYFAV-VGA-------------ISPFW-------GL--
B3PHF3_CELJU/16-370----------------------------YWRLSGFY-----FFYFAV-VGA-------------LVPYW-------GI--
Q3J7E6_NITOC/10-363----------------------------YWRLSGFY-----LFYFAT-LGA-------------LLPYW-------GL--
D3SB25_THISK/4-359----------------------------SARLSTVY-----FFYFAS-LGA-------------FMPFW-------GP--
B8GQD4_THISH/6-360----------------------------YWKLSGFY-----FFYFAS-IGA-------------FVPYW-------GL--
A1WY15_HALHL/15-368----------------------------YWRLSGFY-----LFFFAA-LGA-------------LMPYW-------GP--
Q2SJE3_HAHCH/6-360----------------------------IWKLAGFY-----FFYFAL-VGG-------------ISPYF-------PV--
Q07ZQ8_SHEFN/11-364----------------------------LRWLSACY-----FFFFSI-LGI-------------MVPYL-------GV--
A3QFN3_SHELP/25-378----------------------------LHWISACY-----FFFFAI-LGV-------------LVPYL-------GV--

PF01306

LACY_CITFR/1-412--------------------MYYLKNTNFWMFGFFF-----FFYFFI.MGA-------------YFPFF-------PI--
RAFB_ECOLX/4-415--------------------ASTHKNTDFWIFGLFF-----FLYFFI.MAT-------------CFPFL-------PV--
A0A017JVR8_ECOLX/4-411--------------------NIPFRN.AYYRFASSY-----SFLFFISWSL-------------WWSLY-------AI--
LACY_KLEOX/6-416--------------------LAPRERHNFIYFMLFF-----FFYYFI.MSA-------------YFPFF-------PV--

PF07690

O17785_CAEEL/33-439-------------------------------VICTL-----CLSIAQ-SDT.............LTLNF.......TI--
Y2994_MYCTU/18-356-------------------------------SLGVT-----ASSFLF-ING.............VAFLI.......P.--
ANTR2_ARATH/137-500-------------------------------LCFSS-----FLLCNM-DRV.............NMSIA.......IL--
Q19296_CAEEL/16-403-------------------------------LIPAL-----ICNMLA-FTS.............ILPLF.......PT--
A9CFQ9_AGRFC/27-373-------------------------------AVGTQ-----TAGSFV-SQG.............IYILV.......P.--
O25793_HELPY/8-347-------------------------------LALVS-----SLRFLG-LFI.............VLPVI.......S.--
Q97XW7_SULSO/20-385-------------------------------LMFAS-----LAIGYF-MWG.............VIASI.........--
D7GFS1_PROFC/22-419-------------------------------LVVGG-----ITAIMD-TTI.............VAIGM.......H.--
O66589_AQUAE/21-406-------------------------------ASFIY-----FDHSFS-IWL.............LLGAL.......GP--
Q9I0P8_PSEAE/19-362-------------------------------VAIML-----GPTGIL-LNT.............FSLFI.......AP--
MFSD9_HUMAN/49-427-------------------------------LYLVG-----FLDLFG-VSM.............VVPLL.......SL--
Q97CG2_THEVO/16-347-------------------------------VAVIE-----VLRMFG-IFL.............VVPVF.......T.--
Q9CF47_LACLA/24-427-------------------------------LLVAI-----FAFQLN-ASM.............LSPAL.......V.--
Q92RK8_RHIME/23-360-------------------------------VSFCH-----MLNDIM-QSL.............LTALY.......P.--
Q8YC70_BRUME/8-339-------------------------------AAIAT-----ISAVGA-AIG.............LGIPL.......LS--
A0A098UI88_SALET/17-369-------------------------------LLILG-----FASGLP-LAL.............TSGTL.......QA--
Q8NU65_CORGL/19-414-------------------------------SVLTF-----WLFAQS-TLN.............IGPDM.........--
Q9YG70_AERPE/18-417-------------------------------LALTA-----FLVMYV-EAV.............LYTSV.......P.--
Q9HLN0_THEAC/12-329-------------------------------VMSMN-----SLYQYS-WNV.............LEPMI.......SI--
Q8XR21_RALSO/30-433-------------------------------ALAIH-----LCIGMA-YGF.............SVFWL.......PL--
Q7X233_STAAU/33-313-------------------------------IFIGY-----AGYYLL-RKN.............FSLAM.......PA--
O87836_STRCO/61-422-------------------------------PWIGM-----MGISSA-EYA.............FASAE.......DT--
Q8NNT7_CORGL/10-351-------------------------------VLVAV-----AAAFGS-WSL.............LLPVV.......PL--
Q92WR7_RHIME/13-355-------------------------------AGGLL-----GCIAIG-AMF.............SLPVF.......LV--
Q8TZJ0_PYRFU/13-389-------------------------------LGFGF-----FGISII-WSL.............YNAYI.......PI--
O58400_PYRHO/34-380-------------------------------FAIGM-----FFANLA-WGI.............GYPYL.......T.--
Q9KRL8_VIBCH/16-353-------------------------------LAFGS-----FLVFCN-LYL.............FQPML.......P.--
Q9KWU2_SPHSX/13-348-------------------------------MSLMA-----HVTMSG-GRV.............SASLF.......AL--
A0A090LWD5_STAAU/18-353-------------------------------MLIIL-----FLMEFA-RGM.............YILSY.......IN--
Q8Y7M4_LISMO/13-349-------------------------------ITLIN-----FVVYLV-YYL.............LMVII.......AV--
NART_STACT/13-344-------------------------------QTLSL-----VAGFMV-WSI.............IAPLM.......P.--
Q9K646_BACHD/13-358-------------------------------LWIAQ-----SVSALG-GTF.............TTFTV.......SW--
YLZ2_SCHPO/48-434-------------------------------ISSMT-----FLNQYG-DSV.............FAPSI.......S.--
YWOG_BACSU/15-348-------------------------------VLLVN-----LFVFVF-FYT.............FLTVL.......PI--
Q1K517_NEUCR/132-490-------------------------------MCLIS-----LSNGMS-DSA.............PGALI.......P.--
O54179_STRCO/33-428-------------------------------LLVAQ-----FMLAVD-FSI.............LNVAL.......P.--
Q98B83_RHILO/60-407-------------------------------GLLLF-----FCAGFA-DGA.............LMPFF.......PL--
A0A027U3K7_ECOLX/39-413-------------------------------FLFVL-----FIFSFL-DRI.............NIGFA.......GL--
Q9EYN6_SYNPW/18-450-------------------------------TWFAF-----FLTFVV-WFN.............LAPLA.......T.--
Q9KBG2_BACHD/16-398-------------------------------VMCTL-----ALSAMS-VLI.............FNFVL.......A.--
Q986N1_RHILO/24-356-------------------------------LLTGC-----IAVIGS-NSL............VLGPIA.......P.--
Q93LX8_9ACTN/30-425-------------------------------LAANM-----LIDALE-VSV.............ALVAL.......P.--
Q8KDQ3_CHLTE/9-374-------------------------------LFLTV-----LLDLIG-FGI.............VLPLL.......P.--
Q9PCL3_XYLFA/32-422-------------------------------VLLGF-----FVITLD-AVV.............VNVAL.......P.--
Q9URI1_CANAX/123-512-------------------------------ISFLT-----TSVYMG-SAV.............YTPGI.......E.--
Q9KRK6_VIBCH/22-366-------------------------------LGALG-----ALTPLA-IDM.............YLPAM.......P.--
Q92Y26_RHIME/19-357-------------------------------VVGAG-----VVSAFQ-VGK.............APAAL.......A.--
Q9RSF5_DEIRA/46-397-------------------------------LFLTI-----FIAMLG-LSV.............LFPII.......GP--
LIZ1_SCHPO/36-407-------------------------------CCVSY-----FINYLD-RSS.............INNAY.......LS--
Q97IY3_CLOAB/13-357-------------------------------YLIGI-----FISGIG-TKL.............TTIAL.......AN--
Q9I008_PSEAE/29-430-------------------------------GLLGV-----LLASLT-AGLN...........GHVTEI.......AM--
Q9HTX1_PSEAE/12-346-------------------------------LFLCG-----CAAFLN-LYT.............TQGIF.......D.--
Q9KYI2_STRCO/15-371-------------------------------IFSSV-----FIDTFG-WGL.............FAPLA.......FL--
Q973W8_SULTO/12-335-------------------------------ISFSA-----FFADLG-YQA.............AVASF.......PI--
Q18472_CAEEL/18-397-------------------------------GFLCL-----ASVCSN-YII.............INFTF.......I.--
Q8ZXX0_PYRAE/10-352-------------------------------ILIAR-----IGSGAS-AFL...........................--
Q9AA55_CAUCR/30-391-------------------------------LFGVS-----VATALG-NTG.............MLSVL.......PA--
YN42_SCHPO/141-527-------------------------------LAYVA-----LCSSFA-SSV...............FAV.......PA--
Q2FVB9_STAA8/16-376-------------------------------FFFIG-----VIAYMD-RAN.............ISYIA.......KQ--
Q961H2_DROME/54-453-------------------------------LEPAV-----FLIFFA-RNL.............IGAVY.......QN--
C3SM02_ECOLX/36-398-------------------------------IWLGY-----ALFYFT-RKS.............FNAAV.......PE--
Q8KCE7_CHLTE/27-390-------------------------------FLFAS-----FFSIGM-VTF.............VSIGQ.......AY--
P95852_SULSF/9-333-------------------------------FTILV-----FFTGLY-LGT.............LRIII.......P.--
O45678_CAEEL/27-403-------------------------------TMFSG-----TCVLYA-SRA.............SLPIS.......AA--
Q9I5C8_PSEAE/21-369-------------------------------ATFAQ-----ACACFF-VQG.............IGAIA.......V.--
O30222_ARCFU/15-357-------------------------------GAMLA-----FTVRWL-HYL.............YSFTA.......P.--
O54630_HALSA/24-368-------------------------------LVFAT-----GLTIGS-ERT.............VVPVL.......GE--
Q8TR38_METAC/18-398-------------------------------LYTIT-----FIGTLG-FGI.............ILTFL.......V.--
Q986D7_RHILO/41-396-------------------------------VAANA-----SFSATF-SGI.............PATAV.........--
O69759_PSEFL/31-392-------------------------------VTFCY-----LFYYTG-RQT.............LGFAI.......P.--
Q9HLR9_THEAC/6-377-------------------------------WFASY-----LMSSMA-SGI.............TNPMI.......PL--
A0A098UKM0_SALET/13-352-------------------------------AHVCI-----NFVLGG-VYA.............FSYFK.......TP--
O28944_ARCFU/4-328-------------------------------LILSG-----FFAYAS-LSC.............VIPII.......P.--
Q9KKX8_VIBCH/40-383-------------------------------VLIGT-----LFARTS-FFM.............AWPFL.......VV--
Q96XQ4_SULTO/9-336-------------------------------VFISS-----LSFFLS-YFSR...........IAWSIV.........--
Q8Y6H4_LISMO/13-376-------------------------------RLFGE-----ALLDIS-FWM.............VFPFL.......TI--
O62376_CAEEL/16-394-------------------------------TFVSY-----GLYHAS-RKAL..........SGVKSSI.......KA--
YCUD_SCHPO/89-473-------------------------------LFVAT-----VYTFLE-VYV.............IWSST.......AC--
Y1634_MYCTU/25-423-------------------------------LAGGV-----ALYATN-EFL.............TISLL.......PS--
Q9KG75_BACHD/5-341-------------------------------IYIIL-----VVAFID-TFI.............QLPII.......TP--
Q7JZE2_DROME/46-458-------------------------------AFLAT-----CLHAAM-RNM.............LGMIILKMVMPRPE--
Q9KLN6_VIBCH/36-395-------------------------------LIFGY-----AMFYVV-RMA.............LGVVK.......KP--
Q8P881_XANCP/26-418-------------------------------LACAI-----FMEQMD-ATV.............LATAL.......P.--
H1XFL1_9XANT/19-356-------------------------------MAAAT-----GLAVAS-NYY.............AQPLL.......E.--
YQ92_SCHPO/20-407-------------------------------IAIAL-----FTDLFL-YGI.............ITPIL.......PF--
O16697_CAEEL/36-432-------------------------------CIFLQ-----FIVGVQ-ISV.............YYMSM.......WP--
A0A0E1EPM8_STRPY/10-353-------------------------------AWLGN-----FFTGAS-FSL.............VMPFM.......A.--
Q1K880_NEUCR/87-498-------------------------------LMSNV-----FLYGFD-GTI.............TAAVY.......S.--
Q8XKW0_CLOPE/26-404-------------------------------LMIFA-----LVIDNS-FKI.............ISPDL.........--
O58488_PYRHO/9-354-------------------------------LDTIL-----MTAGFG-TLT.............FMGVA.......KP--
Q9K9F3_BACHD/14-368-------------------------------VTFLT-----FLAVQG-VRL.............SFGAF.......VQ--
O29880_ARCFU/11-360-------------------------------GFLLN-----LMLGIV-YAW.............SVFVN.......PL--
Q97C48_THEVO/19-351-------------------------------VSTAA-----AVRSIG-YGA.............TWPFM.......AV--
Q9Y7D4_ASPTE/35-449-------------------------------VTLVA-----FLMLLD-MSI.............IVTAI.......P.--
Q97DX4_CLOAB/23-413-------------------------------LLLAG-----FLSLFN-ETV.............LNVAF.......P.--
Q8MPU6_CAEEL/90-445-------------------------------LSLAN-----LCSTIA-FSC.............IAPFY.......PA--
Q96Y06_SULTO/9-344-------------------------------TSISH-----FINDGN-TWV.............LPTVY.......G.--
A9CIR5_AGRFC/18-359-------------------------------LVVIA-----GVAALC-MNL.............FLPSL.......SA--
Q8ZWZ3_PYRAE/12-326-------------------------------VLFSR-----GVYSLM-WFF.............LAPVL.......P.--
A0A027YK03_ECOLX/20-357-------------------------------FLIVA-----FLTGIA-GAL.............QTPTL.......SI--
G4UU99_NEUT9/52-417-------------------------------VTLLY-----MLCFLD-RVN.............IGNAR.......IQ--
Y2456_MYCTU/16-365-------------------------------LDLLN-----FSLADV-RDG.............LGPYL.......SI--
Q19845_CAEEL/45-446-------------------------------AGSCA-----FIQATQ-FAI.............FFTSM.......YP--
YHJO_BACSU/19-353-------------------------------RFFGE-----LLTSLT-GAM.............MGPFM.......VL--
Q8ZVF8_PYRAE/4-322-------------------------------VNLAT-----LLFFTA-NGI.............AIIAI.......PP--
O58825_PYRHO/10-360-------------------------------FSVGR-----WISTAG-WTI.............QDVAV.......PL--
A0A029L256_ECOLX/8-341-------------------------------LALGT-----FGLGMA-EFG.............IMGVL.......T.--
Q9L8Q4_PSEST/17-351-------------------------------LLLIA-----MGMPMM-IFY.............AIGIL.......GP--
Q9XXC1_CAEEL/44-436-------------------------------FLLSS-----IICYNA-CYV.............SMVNP.......QS--
Y4007_STRCO/39-376-------------------------------IALCT-----AVTAAN-IYL.............AAPLL.......P.--
Q8YQ15_NOSS1/8-358-------------------------------LATLY-----ISQFIP-TTF.............FIQAL.......PV--
O93992_CANAX/65-459-------------------------------ISIGS-----VCVTCI-SSS.............VALAT.......P.--
Q8YWH2_NOSS1/17-343-------------------------------LYIVA-----FLSGIS-LGL.............FNPFI.......ST--
Q9RSM6_DEIRA/32-418-------------------------------LLIVI-----LVVAFE-SAA.............VGTMM.......P.--
Q9VDS0_DROME/61-500-------------------------------IFLCK-----IPAAWF-MAC.............IIFTG.......PE--
Q9I0Y2_PSEAE/28-357-------------------------------IFCLG-----INLRPI-LTG.............IGPLL.......EE--
Q92TU0_RHIME/19-421-------------------------------LVAGI-----VLATLT-EAI.............ASTVL.......SL--
I3XGH7_RHIFR/18-362-------------------------------LFGLQ-----FISMGA-MEM.............NGPFW.......P.--
Q8XGP2_RALSO/41-431-------------------------------LMTAA-----ILAALD-TTI.............ANTAL.......P.--
YFIS_BACSU/15-364-------------------------------LLASQ-----TISSLG-DWL.............HILAV.......LT--
Q92BU8_LISIN/14-347-------------------------------TAAAS-----LLAFMG-IGV.............VDPLL.......P.--
Q55937_SYNY3/19-365-------------------------------LYLAQ-----AISLLG-DAL.............TWVGL.......A.--
Q9A856_CAUCR/31-388-------------------------------LFLAM-----VINYVD-RQT.............IGFLK.......H.--
D6EJD0_STRLI/29-361-------------------------------VMLGI-----FSIITT-EIL.............PIGLL.......T.--
Q97BG6_THEVO/17-357-------------------------------LALSR-----LIRASG-RVS.............SFIFL.......PL--
Q9X4X9_9PSED/27-377-------------------------------AGVAI-----SINAAL-LYG.............FGTLV.......V.--
Q973J7_SULTO/8-320-------------------------------LILSS-----SLNGII-WGA.............NIIII.......AL--
O32859_MYCFO/12-364-------------------------------ILFAA-----LTAGAG-NGI.............TIVAF.......PW--
Q9S243_STRCO/13-352-------------------------------LVIAF-----GFAQAA-VSM.............ARPAV.......S.--
Q8DNZ1_STRR6/13-344-------------------------------LSLVL-----ITSFSI-SSA.............LPAMF.......D.--
Q97CC5_THEVO/27-411-------------------------------LFIAI-----LFNYAD-RE..............IWIVS.......EP--
AMPG1_RICPR/10-405-------------------------------IWLFG-----FISGFN-VMI.............TGNTL.......NY--
Q9RD97_STRCO/46-435-------------------------------TSAAT-----AVALMA-FTA.............PMVTL.......P.--
Q8R8R3_CALS4/20-398-------------------------------FLMLF-----SVRFLR-KEINMTTL...KKVAYSFGNF.......PI--
O30210_ARCFU/17-354-------------------------------LFGTL-----FLFWYD-MGT.............LAPVL.........--
Q8X120_EXODE/120-524-------------------------------TVISA-----AQLLTQ-AAL.............AMSIA.......PL--
Q9EW91_9ACTN/13-358-------------------------------YLIGQ-----LTSNIG-TWM.............QRAAQ.......DL--
Q8MMD6_DROME/21-407-------------------------------LFLSI-----VVNYMA-KFN.............AGVAV.......VA--
Q8XVV0_RALSO/19-414-------------------------------GTLGA-----MMATLD-ISI.............VNSAL.......P.--
Q978I2_THEVO/17-358-------------------------------LVSSV-----WFSHTA-FSA.............YNLIV.......IW--
S22AI_MOUSE/13-363-------------------------------TYVLA-----ALELTC-LFM.............QFSIL.......P.--
Q92XG9_RHIME/14-352-------------------------------ISFGT-----VLGIAG-TDL.............VLPAI.......P.--
Q8P8I8_XANCP/24-370-------------------------------ILLYR-----VSAMLS-YQI.............VAVTV.......GW--
Q9I1Q7_PSEAE/34-397-------------------------------VFALT-----VINLVD-RVS.............LSIAM.......P.--
Q9I4J1_PSEAE/26-388-------------------------------TWLAY-----AAFYFT-RKA.............FSVAK.......LG--
Q9KG22_BACHD/29-373-------------------------------LWVAS-----IFSGLS-FSI.............YFLTK.......SW--
Q9KYE9_STRCO/8-359-------------------------------IHVGN-----ALSAFG-LGF.............TVPYL.......YV--
A0A0E1EPV8_STRPY/27-401-------------------------------AFFGY-----VCAYLV-RNN.............FKLMS.......NT--
O31131_BRELN/13-405-------------------------------ILLGG-----VLLPLA-MSG.............ASVAV.......P.--
M4U5Z3_9XANT/29-361-------------------------------MSLCV-----ALLIAS-EFM.............PVSLL.......TP--
Q9ZC50_YERPE/23-431-------------------------------IALAQ-----ILMSFN-VAS.............LPVAL.......G.--
Q8U366_PYRFU/20-359-------------------------------LGLVS-----FLNDMS-SEM.............IAPIV.......PT--
Q9C9R9_ARATH/11-379-------------------------------VNLAG-----IMERAD-ESL.............LPGVY.......KE--
Q20265_CAEEL/46-427-------------------------------TLVQA-----NVHVYN-FTV.............LCMQE.......EQ--
Q9PCQ0_XYLFA/73-403-------------------------------LAMTG-----FIAIVT-ETL.............PAGLL.......P.--
Q9I247_PSEAE/4-339-------------------------------IFSGY-----FAAEGL-IYP.............FWPTW.........--
Q9VPX2_DROME/42-442-------------------------------VAMVA-----MVNHTA-IKAHGDGGGHGGHGSVILSNA.......SQ--
Q8Y3L9_LISMO/17-359-------------------------------LFIGY-----TSVYVD-KYT.............IGISL.......V.--
Q8VUK1_HALHD/23-380-------------------------------LSPLV-----FALVFA-SWT.............IFAVL.......GL--
B8FVY2_DESHD/13-347-------------------------------AISSV-----SLLVMT-YSS.............ISVIM.......AD--
A9CGF2_AGRFC/30-354-------------------------------MAPIG-----IVAMLS-QTH...........................--
O66181_ARTSP/15-353-------------------------------TIATI-----TAVGFG-RMA.............YGILM.......P.--
Q8KYU7_9PROT/15-359-------------------------------GALLT-----LISSFG-QTY.............FISIF.......AG--
YJ7D_SCHPO/81-445-------------------------------MCITY-----MIQYLD-KTA.............LSYAA.......LY--
Q8XEG8_ECO57/47-408-------------------------------LFFAA-----VINYLD-RSS.............LSVAN.......L.--
Q9VY22_DROME/66-470-------------------------------VANNV-----TVEPIL-AAY.............IMPSV.......LS--
Q8U4E5_PYRFU/8-345-------------------------------LNFST-----LFFFLG-VSI.............LNPLV.......SP--
YFKL_BACSU/12-351-------------------------------MYINY-----FFLGMV-NII.............LASNM.......S.--
O30679_RHORH/8-341-------------------------------LGLAV-----FAQGTS-EFM.............LSGLI.......P.--
Q97TH3_CLOAB/16-408-------------------------------IFLGS-----FLVSLG-TST.............INLAL.......P.--
E7KRF3_YEASL/86-451-------------------------------LCCTY-----LLMFLD-KAL.............LNYAA.......SM--
Q9A961_CAUCR/19-356-------------------------------TYLMF-----MMFAMT-TDS.............VGVII.......P.--
Q97TH7_CLOAB/19-357-------------------------------LGLAG-----FVSAAD-NWF.............VSPAL.......Q.--
A0A0D6HIB6_STAAU/12-398-------------------------------LILIM-----FMSAIE-SSI.............ISLAL.......P.--
Q9VPD9_DROME/28-441-------------------------------AVIVT-----FMHYFS-WGL.............LTVPF.......IE--
Q8PVU8_METMA/11-346-------------------------------LCITA-----CFAMAG-GSL.............LTPVL.......P.--
F6MF49_STAAU/18-410-------------------------------MLISA-----FVAILN-QTL.............LNTAL.......P.--
Q97FI4_CLOAB/17-361-------------------------------LFLVQ-----VINRLG-DFV..............FPFL.......SL--
Q8KR58_ESCFE/20-359-------------------------------LALCA-----GLLGIG-QNG.............LLVML.......PQ--
Q8NLD6_CORGL/19-353-------------------------------MSFAA-----FVYVTF-EMF.............AVGLI.......K.--
Q9LAA0_AERHY/27-362-------------------------------AAFIQ-----LVSALD-FMM.............IMPLG.......P.--
O06742_BACIU/18-364-------------------------------IGSIP-----LILTLG-NSM.............LIPIL.......P.--
Q9FCG1_STRCO/24-364-------------------------------LWTST-----LVNRLG-AFV............ATFMAL.........--
O94019_CANAX/86-529-------------------------------FFIVI-----FITAFT-AAT............SNDAGS.......IQ--
MOT14_MOUSE/42-459-------------------------------SFFVH-----ILIMGS-QMA.............LGVLN.......VE--
Q92V77_RHIME/8-347-------------------------------LAVGS-----FTMSTV-GFV.............FSSLL.......PS--
Q9Y7E0_ASPTE/42-435-------------------------------VSWMT-----LVVTFS-STC.............LLPAA.......P.--
Q9I431_PSEAE/11-401-------------------------------YLLGF-----ALDLVN-IFI.............ASVAY.......P.--
O76837_CAEEL/25-400-------------------------------LIIGL-----CCICCT-NAN.............YNAIN.......FS--
Q96ZI2_SULTO/36-365-------------------------------IIPLT-----IAIRAS-NNM.............LMTTI.......PL--
Q7BQD2_PSEST/7-367-------------------------------VGLQL-----LFGWMN-LVLAV.........PSIYLML.......GM--
Q94886_DROME/14-423-------------------------------TFIGF-----IVNYMI-RIN.............LNITI.......VD--

PF00083

GTR4_MOUSE/27-483-------------------------------AVFSAVLGS.LQFGYN-IGV-------------INAPQ-------KV--
GTR1_MOUSE/14-467-------------------------------LAVGGAVLGSLQFGYN-TGV-------------INAPQ-------KV--
QUTD_EMENI/24-490-------------------------------LAAVASFTS.CMIGYD-SAF-------------IGTTL-------SL--
ITR2_YEAST/112-569-------------------------------LTFVASISG.FMFGYD-TGY-------------ISSAL-------IS--
SNF3_YEAST/100-556-------------------------------VGVFVAVGG.FLFGYD-TGL-------------INSIT-------SM--
GALP_ECOLI/18-451-------------------------------VCFLAALAG.LLFGLD-IGV-------------IAGAL-------PF--
HXT5_YEAST/89-549-------------------------------CCLMVAFGG.FVFGWD-TGT-------------ISGFV-------RQ--
GTR3_MOUSE/13-465-------------------------------AVTVATIGS.FQFGYN-TGV-------------INAPE-------TI--
HXT9_YEAST/64-526-------------------------------LCLMIAFGG.FIFGWD-TGT-------------ISGFV-------NL--
HXT8_YEAST/69-530-------------------------------MCLCMAFGG.FMSGWD-TGT-------------ISGFV-------NQ--
HXT6_YEAST/68-528-------------------------------MCIMIAFGG.FVFGWD-TGT-------------ISGFI-------NQ--
GTR3_CHICK/14-464-------------------------------AVSVAAIGS.LQFGYN-TGV-------------INAPE-------KI--
GTR5_HUMAN/20-475-------------------------------ATLIAAFGSSFQYGYN-VAA-------------VNSPA-------LL--
HXT13_YEAST/60-521-------------------------------LCYPISFGG.FLPGWD-SGI-------------TAGFI-------NM--
YB91_YEAST/27-485-------------------------------GTIVACLGS.IQYGYH-IAE-------------LNAPQ-------EF--
PROP_ECOLI/25-453-------------------------------KAITAASLGNAMEWFD-FGV-------------YGFVA-------YA--
JEN1_YEAST/125-563-------------------------------VNPIPELRKMTWQNWN-YFF-------------MGYFA-------WL--
GIT1_YEAST/43-466-------------------------------KNIVTIIASGFALISD-GYV-------------NGSMS-------ML--
GTR2_MOUSE/13-498-------------------------------TVFTAVLSS.FQFGYD-IGV-------------INAPQ-------EV--
HXT2_YEAST/59-519-------------------------------LCLMIAFGG.FVFGWD-TGT-------------ISGFV-------NQ--
XYLE_ECOLI/13-478-------------------------------ITLVATLGG.LLFGYD-TAV-------------ISGTV-------ES--
LACP_KLULA/75-529-------------------------------LCFITYLCA.TMQGYD-GAL-------------MGSIY-------TE--
STP1_ARATH/26-489-------------------------------TCVVAAMGG.LIFGYD-IGI-------------SGGVT-------SM--
MAL31_YEAST/102-561-------------------------------WSLLVSTTL.IQEGYD-TAI-------------LGAFY-------AL--
QAY_NEUCR/24-494-------------------------------CAAIASFAS.CMIGYD-SAF-------------IGTTL-------AL--
GLF_ZYMMO/13-469-------------------------------LALIAAIGG.LLFGYD-SAV-------------IAAIG-------TP--
STL1_YEAST/30-488-------------------------------FITIASMTGFSLFGYD-QGL-------------MASLI-------TG--
ARAE_ECOLI/25-461-------------------------------VSVAAAVAG.LLFGLD-IGV-------------IAGAL-------PF--
GAL2_YEAST/74-534-------------------------------LCLCVAFGG.FMFGWD-TGT-------------ISGFV-------VQ--
A4I0Q6_LEIIN/5-442-------------------------------VMLCAALGG.FLFGYD-TGV-------------INAAL-------FQ--
A4I8N6_LEIIN/77-573-------------------------------VATPIILTP.LLYGYN-LGF-------------VGPYS-------TM--
Q38AB8_TRYB2/39-501-------------------------------VAQVQVVGG.TLNGFS-IGF-------------VAVYI-------LL--
Q38AB9_TRYB2/39-500-------------------------------VAQVQVVGG.TLNGYV-IGY-------------VAVYL-------LL--

PF11700

AT221_ASPNC/30-582---------------------------TSKKELAGW-----YSYGWA-AEV-------------FTVCAMGSFLPITL--
AT221_ASPOR/20-571---------------------------TSRKELAGW-----YSYSWA-AEV-------------FTVCAMGSFLPITL--
AT222_ASPTN/24-571---------------------------TSKKELVGW-----YSYGWA-AEV-------------FTVCAMGSFLPITL--
AT221_EMENI/24-564---------------------------TNKKELLGW-----YSYGWA-AEV-------------FTVCAMGSFLPITL--
AT221_ASPFU/24-580---------------------------TSKKELAGW-----YSYGWA-AEV-------------FTVCAMGSFLPITL--
AT222_ASPCL/24-579---------------------------TSKKELAGW-----YSYGWA-AEV-------------FTVCAMGSFLPITL--
AT221_PENCW/20-562---------------------------TSKRELAGW-----YCYGWA-AEV-------------FVVCAMGSFLPITL--
ATG22_COCIM/35-567---------------------------TSKKELAGW-----YSYGWA-AEV-------------FAVCAMGSFLPITL--
AT222_PHANO/72-634---------------------------TSNKELSGF-----YMYGWA-AEV-------------FVVCGIGSFIPVTL--
AT222_SCLS1/72-619---------------------------TSRKELSGW-----YAYGFA-AEV-------------FVICGIGSFIPITL--
ATG22_NEUCR/155-689---------------------------TSQKELAGW-----YAYAFA-AEV-------------YVICGIGSFIPILL--
AT222_PENCW/33-580---------------------------TSRREILGW-----YSYGIA-AEV-------------FAVCGVGSFLPLTL--
AT222_ASPOR/30-578---------------------------TSKREIWGW-----YAYGIA-AEV-------------FAVCGVGSFLPLTL--
AT222_EMENI/31-576---------------------------TGRREIWGW-----YAYGVA-AEV-------------FAVCGVGSFLPLTL--
ATG22_YARLI/6-582---------------------------TTQKELYGW-----YAYAWA-AEP-------------FMVVAVATYIPQLL--
ATG22_CANGA/31-527---------------------------AARDNIKGW-----YLYSFS-SEP-------------FVVSAVATYVPLLL--
ATG22_VANPO/27-511---------------------------RTKQNIVGW-----YFYSFS-SEP-------------FVVSAIATYIPLLL--
ATG22_KLULA/17-487---------------------------QAKRNIKGW-----YFYCFS-SEP-------------FIVSAVSTYVPLLL--
A9WGR7_CHLAA/9-439---------------------------DNRREQVGW-----YFYDWA-NSA-------------FSTTVVTVFLGPYL--
A4X7E0_SALTO/18-457---------------------------SSRRERTGW-----YVYDWA-NSA-------------FQTTVITVFLGPFL--
A6H0A9_FLAPJ/7-445---------------------------GDKKLLNAW-----AFYDWA-NSV-------------YSLVIASAIFPIFY--
ATG22_CRYNJ/1-531---------------------------MPPPHVRAW-----YSYAFA-AEV-------------FSSY..........--
ATG22_SCHPO/13-525---------------------------TTVWHVLSW-----ILYAVG-AGP-------------TAIISMGVYVPLIV--
A7EQB6_SCLS1/56-534---------------------------ATRKELWSY-----YAYYAG-NNG-------------IGSF...QYSSLLF--
A5DD56_PICGU/47-524---------------------------TTKWEVLMY-----ALYYFG-NNA-------------TGPY...TFTPTQY--
A0A0D1E381_USTMA/59-561---------------------------TGRYELWSF-----YIYYIG-NCG-------------LGPF...NFAPSQF--
Q0TYS2_PHANO/43-505---------------------------TTRKEIWSY-----YSYYVG-DNG-------------LTLF...NFGPTAF--
Q0CF56_ASPTN/43-493---------------------------ATKWEIWAY-----YSF...-...-------------FYLLTDIDFAPTAF--
Q0CXZ2_ASPTN/50-478---------------------------TTKWEIWAY-----..YAWV-NNH-------------FG........PTAF--
Q0U0L9_PHANO/44-456---------------------------ATKRALIAW-----LVLCFS-TGP-------------TAGMAF.RYVPAVL--
A1CD46_ASPCL/43-518---------------------------NSKRALWGY-----LVLCFS-TGP-------------TSSM.VNNYVTAAI--
ATG22_CANAL/39-496---------------------------NKKSIFHTW-----LLLCYS-TGP-------------VASM.SRTYIPASI--
A3LP71_PICST/32-502---------------------------AKKSIYRAW-----LLLCYS-TGP-------------VASM.SRTYVPAVI--
Q75EJ9_ASHGO/58-558---------------------------RGRWVFPAW-----LLVCFS-TGP-------------TYVM.MRSFVPASL--
Q6CKN0_KLULA/64-544---------------------------DTRKTYLVW-----LLICFS-TGP-------------TAAM.MRSYVPATI--

PF06779

Q986E3_RHILO/34-394-------------------------------MAVAM-----GIGRFV-----------------YTPIL-------PG--
Q89HQ1_BRADU/48-412-------------------------------SLVGL-----GLARFS-----------------YTPLI-------PA--
A9CI18_AGRFC/23-387-------------------------------MASAM-----GFGRFS-----------------FTPIL-------PG--
Q88ED9_PSEPK/14-373-------------------------------LMMAM-----GIGRFA-----------------LTPQL-------PQ--
Q8Y185_RALSO/36-399-------------------------------LSVAM-----GIGRFA-----------------FTPIL-------PM--
Q9I3T2_PSEAE/20-380-------------------------------LVVAM-----GVGRFS-----------------LTPQL-------PH--
Q89X18_BRADU/63-426-------------------------------ATVGL-----GIGRFA-----------------YALVL-------PD--
Q92UK2_RHIME/1-365-------------------------------MAVAM-----GFGRFS-----------------YTPIL-------PA--
YJIJ_ECOLI/23-381-------------------------------LTLGM-----GLGRFL-----------------YTPML-------PV--
Q8ZJZ6_SALTY/23-379-------------------------------LTLGM-----GVGRFL-----------------YTPML-------PV--
Q9PGN0_XYLFA/26-385-------------------------------LSLGI-----GIGRFL-----------------HTPIL-------PV--

PF05977

Q92LE2_RHIME/11-531--------------------STALAPLRNGVFRSIW-----TASQISSLGW-------------LVQTV-------AI--
Q98HB4_RHILO/11-532--------------------VSALAPFRHGIFRAVW-----SASLVSNFGG-------------LIQGV-------GA--
Q92Y88_RHIME/8-530--------------------TSGFAPLRQKVFAVLW-----IATIVGNTGS-------------FIRDV-------AS--
A9CFW7_AGRFC/8-530--------------------ASSFAPLAQPVFAVLW-----AATVLGNTGS-------------FMRDV-------AS--
Q9HYE1_PSEAE/25-549--------------------TGTWAPFSIQAFRIIW-----ICNLFANLGT-------------WAQSV-------AA--
Q989L4_RHILO/31-551--------------------SATFPPLENSTFRPIW-----IATQVSSLGW-------------LIQMV-------AI--
Q92SW7_RHIME/14-535--------------------ISPLAPFRHDIFRTIW-----IASLASNFGG-------------LIQAV-------GA--
Q989T8_RHILO/11-532--------------------PAAFAPLRNSTFRSIW-----LAIQVANLGW-------------LMQAV-------AI--
Q9I0E1_PSEAE/6-529--------------------ASPWSPLRQTTFRWLW-----LASIASNIGT-------------WMHEV-------GA--

PF03137

Q924H6_RAT/144-701-------------------------------FFLIS-----FCILTLAQ.G-------------IVFGL-------TD--
A0NEW4_ANOGA/55-618-------------------------------LYVLL-----FGLMGCIL.N-------------STTSY-------FY--
A7S331_NEMVE/27-582-------------------------------WFLFF-----ICSYFFTQSI-------------VVNGV-------YS--
A7S539_NEMVE/32-576-------------------------------WFLFF-----LVMYFFTQSI-------------VVNGV-------YS--
A7S542_NEMVE/18-557-------------------------------WFLFF-----LVMYFFTQSI-------------VVNGV-------YS--
A7SHZ4_NEMVE/19-550-------------------------------WFLVF-----QCWLVLAQGL-------------IVSGM-------TG--
A7SQZ6_NEMVE/18-584-------------------------------WFTVF-----LCMFILTQGI-------------LINGV-------TS--
A7SWE4_NEMVE/55-622-------------------------------GFMVF-----LCIFGLVQGM-------------AINTF-------VN--
A7SX54_NEMVE/31-599-------------------------------WFLVF-----LTIYSFMQGM-------------TANGF-------TA--
A8P8W3_BRUMA/81-731-------------------------------WMLLW-----LCWFCTVQGL-------------LVNGL-------VP--
A8PR64_BRUMA/26-571-------------------------------CFLVT-----MLFVIAVQ.G-------------TYLAY-------VV--
B0WEE2_CULQU/64-642-------------------------------LYVFL-----FGFVGCLF.G-------------STSAY-------FY--
B0WEE5_CULQU/105-708-------------------------------AYVFL-----YGVVGCVF.S-------------ATYAY-------FN--
B0WGA7_CULQU/25-763-------------------------------SFIMV-----YGFLGTTQ.A-------------MAYIY-------FV--
B3DJD4_DANRE/48-631-------------------------------MFLVA-----LSFAYFSK.A-------------LSGSY-------MK--
B3MGJ1_DROAN/65-620-------------------------------MYVVL-----YGFAGCVL.V-------------MTFSY-------FN--
B3MGJ2_DROAN/51-611-------------------------------TFVIV-----YGIASCFM.A-------------MAFTY-------FT--
B3MNT7_DROAN/36-684-------------------------------MFMGV-----YGLLGTIQ.A-------------MSYMY-------FI--
B3RLK5_TRIAD/8-577-------------------------------WLLAF-----TSLYVIISGM-------------MISGF-------TA--
B3RLK6_TRIAD/21-588-------------------------------WLLVF-----TSSYIIIASM-------------LISGF-------TA--
B3RLK7_TRIAD/29-614-------------------------------WLLFF-----ICSFIVIAGM-------------QATGF-------TG--
B3RLK8_TRIAD/27-595-------------------------------WLLLI-----LCFYSVTMSM-------------QIIGF-------RG--
B3RLL2_TRIAD/176-721-------------------------------YFLFF-----LCTTILLAHM-------------QAHGI-------KA--
B3S2R8_TRIAD/18-575-------------------------------WLMAF-----IGIYIFISGI-------------QTTGL-------GG--
B3SCA6_TRIAD/44-614-------------------------------CLILI-----VCLQVFVSGM-------------MISAF-------VG--
B4J9Q1_DROGR/61-622-------------------------------MYVTI-----YGVSGCFM.A-------------MCFAY-------FS--
B4J9Q2_DROGR/50-610-------------------------------AYVLI-----YGLGGCLM.S-------------MSIAY-------FT--
B4J9Q3_DROGR/52-605-------------------------------VYVVV-----YGIAGCFI.A-------------MAFSY-------FN--
B4JCP9_DROGR/31-685-------------------------------YFMGV-----YGLLGTIQ.A-------------MSYMY-------FI--
B4KJ36_DROMO/34-688-------------------------------AFMGV-----YGLLGTIQ.A-------------ISYMY-------FI--
B4KS84_DROMO/70-629-------------------------------MYVTI-----YGIAGCFM.A-------------MCFAY-------FN--
B4KS85_DROMO/55-614-------------------------------SFVLI-----YGIGGCLL.S-------------MSLAY-------FN--
B4KS86_DROMO/50-605-------------------------------MFMVL-----FGIAGCFI.G-------------MAFSY-------FN--
B4KS87_DROMO/111-737-------------------------------AYVLL-----YGIVGCIF.S-------------MTYAY-------FN--
B4MDK1_DROVI/34-691-------------------------------WFMGV-----YGLLGTIQ.A-------------MSYMY-------FI--
B4MFR1_DROVI/68-626-------------------------------MYVTI-----YGIAGCFM.A-------------MCFAY-------FN--
B4MFR2_DROVI/57-615-------------------------------LFVVI-----YGIGGCFL.S-------------MSLAY-------FN--
B4MJH9_DROWI/51-614-------------------------------MFMVL-----YGIAGCFL.A-------------MAFSY-------SN--
B4MJI0_DROWI/54-620-------------------------------MYVTL-----YGIAGCTI.A-------------MTFAY-------FN--
B4MWM1_DROWI/38-693-------------------------------TFMGV-----YGLLGTIQ.A-------------MSYMY-------FI--
B4N051_DROWI/200-840-------------------------------IFVLL-----LSLLVMMQQA-------------LSSGY-------IN--
B5DE94_XENTR/28-595-------------------------------VFVVC-----HALLQLSQ.L-------------LYSAY-------FK--
B5DI87_DROPS/36-609-------------------------------MFMGV-----YGLLGTIQ.A-------------MSYMY-------FI--
B5E0I0_DROPS/65-626-------------------------------MYVIL-----YGLAGCVM.T-------------MTFAY-------FN--
B7PPH4_IXOSC/20-614-------------------------------WFLLV-----FCVLGVLQ.G-------------AYRTY-------FI--
B7QN84_IXOSC/6-567-------------------------------AFLAV-----FCLTSVLQ.G-------------MYYTY-------FV--
C3Y4T6_BRAFL/2-565-------------------------------SFILF-----LCLLILSQGI-------------LVSGY-------IN--
C3Y4T7_BRAFL/83-626-------------------------------AILFF-----LSWLAFTQGM-------------VVNGF-------VN--
C3YMS7_BRAFL/5-587-------------------------------CVVIA-----ISLLTLVQSM-------------LVSGY-------LS--
C3ZQA6_BRAFL/26-589-------------------------------GMMVL-----LVICTVAENM-------------THGGM-------IG--
C3ZX58_BRAFL/40-591-------------------------------CLVAM-----ICVFNFLTSS-------------IHFGY-------LN--
D6W853_TRICA/116-732-------------------------------CFVFL-----LSFLVTLQQA-------------LSSGY-------IN--
D6W895_TRICA/53-625-------------------------------AYVFL-----YGLLGCVF.S-------------AAYAY-------FN--
E0VXM5_PEDHC/126-706-------------------------------VYVLL-----YGLLGCFN.S-------------ATYAY-------FN--
E0W488_PEDHC/204-804-------------------------------VFVML-----LSFLVNLQQA-------------LSSGY-------IN--
E1C5S3_CHICK/28-603-------------------------------FFVFC-----HGLLQLSQ.L-------------LVSSY-------LK--
E1FKB9_LOALO/26-596-------------------------------CFLVT-----MLFVIAIQ.G-------------TYLAY-------VV--
E1FVI2_LOALO/58-633-------------------------------WLLVM-----LGICAFVQSF-------------VVNSI-------FP--
E2A200_CAMFO/99-698-------------------------------AFLVT-----FCLTWVLQ.G-------------MYYTY-------FV--
E2ABP4_CAMFO/74-684-------------------------------AYVFL-----YGVLGCIF.S-------------ASYAY-------FN--
E2BXT3_HARSA/74-652-------------------------------AYVFL-----YGVLGCIF.S-------------ASYAY-------FN--
E2RSD4_CANFA/44-638-------------------------------VFLGA-----LSFVYFAK.A-------------LAEGY-------LK--
E4X1Y1_OIKDI/36-601-------------------------------GFLVC-----FSCYIFFQSM-------------VSSGY-------TA--
E5S461_TRISP/81-717-------------------------------WMLFW-----ICWYCTVQGM-------------VVSGL-------VP--
E5SC63_TRISP/58-613-------------------------------FLLII-----LCISATSQSM-------------AINGF-------VP--
E7F5H8_DANRE/27-603-------------------------------IFLIS-----ECALMLAQGT-------------VG.AY-------LV--
E9G6H1_DAPPU/44-620-------------------------------SFLFW-----ICWAGGFQSF-------------LINGL-------LN--
E9GGR7_DAPPU/1-573-------------------------------MFLAV-----FCLACVLQ.G-------------MFYTY-------FV--
E9GTG7_DAPPU/37-616-------------------------------SYLLT-----YSFLGLFQ.A-------------MFFSY-------SI--
E9INY6_SOLIN/50-616-------------------------------LYVGL-----ICWIGVVQ.A-------------ASYTY-------FH--
F1NQ62_CHICK/86-676-------------------------------VFLAA-----LSFSYFSK.A-------------LSGVI-------MK--
F1Q3Z3_CANFA/92-650-------------------------------CFMIF-----YCLLVTSQ.G-------------IVFGL-------ID--
F1Q9B1_DANRE/21-583-------------------------------IFVLC-----HGLLQLTQ.L-------------LYSSY-------FK--
F1QBF7_DANRE/27-591-------------------------------FFVLC-----HGMLQLSQ.L-------------LVSGY-------LK--
F1RU07_PIG/132-741-------------------------------CFLVC-----MCFLTFIQAL-------------MVSGY-------LS--
F1SQZ6_PIG/21-597-------------------------------MFLLA-----ITCAYVAK.T-------------QSGSY-------MN--
F2U1E1_SALR5/138-886-------------------------------WYLVF-----LSMFAFGQSM-------------IISGV-------FP--
F4WH08_ACREC/51-617-------------------------------LFVGL-----ICWIGVVQ.A-------------ASYAY-------FH--
F4X6X3_ACREC/89-670-------------------------------WALFW-----LCWAGAMQGM-------------VVNGF-------VN--
F6RPB8_HORSE/50-647-------------------------------VFVLC-----HSLLQLAQ.L-------------MISGY-------LK--
F6SHC6_MONDO/129-692-------------------------------GYLFY-----YCLLALTQGI-------------VVNGL-------VN--
F6SHD5_MONDO/83-645-------------------------------GFLFH-----YCLLALIQGI-------------VVNGL-------VN--
F6SNL4_XENTR/97-651-------------------------------GVLVF-----LCAASFLQGM-------------TVNGF-------LN--
F6TIF0_CIOIN/25-583-------------------------------GFLVG-----YSFFVIVQGM-------------LVNGF-------VN--
F6UFC7_MONDO/37-638-------------------------------FFVFC-----HSLLQLAQ.L-------------MISGY-------LK--
F6UHW9_MACMU/29-621-------------------------------MFLAA-----LALSFIAK.A-------------LGAVV-------MK--
F6Z8W3_MONDO/36-628-------------------------------IFVVA-----LTFSFVCK.T-------------LAGIV-------MK--
F6ZVK8_CIOIN/40-603-------------------------------AFVAF-----VGIALCGQ.S-------------ALATY-------NK--
F6ZXK1_MONDO/21-593-------------------------------IFLLA-----LLCAFVSK.T-------------LSGSF-------IN--
F7ACE2_CIOIN/22-602-------------------------------WYLVV-----HCLLAIASTV-------------VSAGI-------TN--
F7B262_CIOIN/35-639-------------------------------TFVAF-----LSLLQLVQ.V-------------MGSGY-------NK--
F7B8B6_XENTR/14-595-------------------------------MFLVA-----LCFSYFAK.A-------------FSGSY-------MK--
F7BQX3_MONDO/39-601-------------------------------VFVLC-----HGLLQLCQ.L-------------LYSAY-------FK--
F7CCC4_MACMU/114-672-------------------------------CFMVF-----YCILVLCQ.G-------------VVFGL-------TD--
F7D880_XENTR/45-603-------------------------------GYLVM-----YSLLAVMQGT-------------AVNGL-------VN--
F7DID9_ORNAN/85-636-------------------------------GILFF-----LCLASFLQGM-------------TVNGL-------IN--
F7E5T7_MACMU/28-625-------------------------------LFVLC-----HSLLQLAQ.L-------------MISGY-------LK--
F7G693_MONDO/107-666-------------------------------GILFF-----LCMASFLQGM-------------TVNGF-------IN--
F7IM14_CALJA/33-639-------------------------------VFVLC-----QGLLQLCQ.L-------------LYSAY-------FK--
G1KDM6_ANOCA/110-669-------------------------------GVLFF-----LCVASFLQGM-------------TVNGF-------IN--
G1KJC8_ANOCA/62-624-------------------------------LFVLC-----HGLLQLAQ.L-------------LYSAY-------FK--
G1KTZ7_ANOCA/42-626-------------------------------IFLVA-----LAFAYLTK.T-------------MSGAY-------VN--
G1KTZ8_ANOCA/2-594-------------------------------MFLIA-----LAFSYFAK.G-------------FSGSY-------MK--
G1KU16_ANOCA/44-637-------------------------------IFLCA-----LSFVYFAK.A-------------LSGSY-------LK--
G1LS58_AILME/38-599-------------------------------CFLFF-----YSLLITSQ.G-------------IVFGL-------VD--
G1MG68_AILME/111-671-------------------------------GFLVF-----LCAAAFLQGM-------------TVNGF-------IN--
G1NLJ6_MELGA/21-604-------------------------------LFLLA-----LSLAFIGK.T-------------MTGAY-------LN--
G1P1F0_MYOLU/56-614-------------------------------CFLIF-----FYTLVVSQ.G-------------MVIGL-------ID--
G1PCN2_MYOLU/58-650-------------------------------FFVLC-----HSLLQLAQ.L-------------MISGY-------LK--
G1PGX5_MYOLU/20-594-------------------------------MFLLA-----ITCAFISK.T-------------LSGSY-------MN--
G1QXW4_NOMLE/21-597-------------------------------MFLLA-----ITCAFVSK.T-------------LSGSY-------MN--
G1RKH9_NOMLE/129-734-------------------------------CFLVC-----MCLLTFIQAL-------------MVSGY-------LS--
G1SJM2_RABIT/94-653-------------------------------CFMVI-----YFILASSQ.G-------------IVFGL-------VD--
G1T6Y7_RABIT/47-646-------------------------------FFVLC-----HSLLQLTQ.L-------------MVSGY-------LK--
G1T960_RABIT/29-621-------------------------------MFLVA-----LALSYICK.A-------------LGGII-------MK--
G3NAV0_GASAC/31-610-------------------------------FFVFC-----HSLLQLAQ.L-------------LVSGY-------MK--
G3NHS2_GASAC/34-602-------------------------------LFVLC-----HGLLQLSQ.L-------------LYSAY-------FK--
G3P9F5_GASAC/17-593-------------------------------IFLIS-----ECALMLAQGT-------------VG.AY-------LV--
G3Q5Q6_GASAC/29-624-------------------------------LFLVS-----LAFVYFSK.A-------------FGGSY-------MK--
G3RFJ2_GORGO/108-666-------------------------------CFMIF-----YCILLICQ.G-------------VVFGL-------ID--
G3RW09_GORGO/3-600-------------------------------IFLTL-----LSFSYVAK.A-------------LAGIF-------MK--
G3THK1_LOXAF/27-590-------------------------------FFMIF-----YCILLISQ.G-------------MIFGL-------VD--
G3VZ81_SARHA/19-591-------------------------------GFLFH-----YCLLALIQGI-------------VVNGL-------VN--
G3WV28_SARHA/37-630-------------------------------MFMIA-----LSFSYICK.S-------------LAGTV-------MK--
G3WVX8_SARHA/40-630-------------------------------LFMIA-----LICCLFCK.A-------------LMATF-------LK--
G3WWQ7_SARHA/43-640-------------------------------VFLCA-----LSFVYFAK.A-------------LSEGY-------LK--
G4VAF3_SCHMA/62-701-------------------------------AFLAA-----ACFISCLQ.A-------------SFSGY-------TS--
G5BJ45_HETGA/1-591-------------------------------MFLAA-----LSFSYICK.I-------------IGGIT-------MK--
G6D5X6_DANPL/120-675-------------------------------VFVFF-----LSFLVTLQQA-------------LSSGY-------IN--
G6DHQ3_DANPL/73-638-------------------------------MFMLV-----FLSGWVLQ.G-------------MFLTY-------FV--
H0VSG6_CAVPO/50-647-------------------------------FFVLC-----HSLLQLAQ.L-------------MISGY-------LK--
H0VU31_CAVPO/105-653-------------------------------GFLLF-----LCTASFLQGM-------------TVNGF-------IN--
H0W6D9_CAVPO/29-617-------------------------------MFLAA-----LSFSVFCR.L-------------ISGIS-------MK--
H0WRN3_OTOGA/1-607-------------------------------VFVLC-----QGILQLCQ.L-------------LYSAC-------FK--
H0X513_OTOGA/48-645-------------------------------LFVLC-----HSLLQLAQ.L-------------MISGY-------LK--
H0XUZ7_OTOGA/29-621-------------------------------MFFSA-----LSYSFIAK.A-------------LAGTV-------MK--
H0ZQ14_TAEGU/44-636-------------------------------IFLGA-----LSFVYFAK.A-------------LSGSY-------LK--
H2L5X8_ORYLA/7-609-------------------------------LFVLC-----HGLLQLSQ.L-------------LYTTY-------FK--
H2LW99_ORYLA/3-593-------------------------------IFLVA-----LSFAYFAK.A-------------LSGSY-------MK--
H2LWK4_ORYLA/34-623-------------------------------IFLIA-----ECALMLAQGT-------------VG.AY-------LV--
H2LXV9_ORYLA/4-606-------------------------------LFIVA-----LSFSYFSK.A-------------LTGTY-------MK--
H2ME20_ORYLA/33-598-------------------------------VFVLC-----HSLLQLAQ.L-------------LVSGY-------MK--
H2NP86_PONAB/41-622-------------------------------IFLVS-----ECALMLAQGT-------------VG.AY-------LV--
H2SCH0_TAKRU/44-642-------------------------------LFLVS-----LAFAFFAK.A-------------FSGAY-------LK--
H2SCH1_TAKRU/29-627-------------------------------LFLVS-----LAFAFFAK.A-------------FSGAY-------LK--
H2SCH5_TAKRU/21-605-------------------------------IFILV-----LSFACFSR.S-------------LTATH-------MK--
H2SN38_TAKRU/26-590-------------------------------FFVLC-----HSLLQLSQ.L-------------LVSGY-------MK--
H2T5W9_TAKRU/22-602-------------------------------IFLIS-----ECALMLAQGT-------------VG.AY-------LV--
H2TWS2_TAKRU/7-592-------------------------------CFLFC-----MCYLTFIQSL-------------MVSGY-------LS--
H2UWX7_TAKRU/9-600-------------------------------MFLVA-----LSFAYFAK.A-------------LSGSY-------MK--
H2UZN6_TAKRU/20-610-------------------------------LFVLC-----HGLLQLSQ.L-------------LCSAY-------FK--
H2V2U5_TAKRU/20-610-------------------------------IFIAA-----LSYAYFAK.A-------------LSGSY-------MK--
H2YEL4_CIOSA/27-585-------------------------------GFLVA-----YSFFVVVQGM-------------FVNGF-------IN--
H2YTS0_CIOSA/2-575-------------------------------MFLFF-----LTCFQLIN.L-------------LTLTY-------TD--
H2YZB0_CIOSA/24-616-------------------------------QYLLV-----HCVFAVAATL-------------VSAGI-------VN--
H2Z037_CIOSA/5-589-------------------------------CFLVV-----YSLFSMVAGT-------------MIGGL-------TN--
H2Z5W5_CIOSA/21-582-------------------------------AFLVL-----LTLANIMQGV-------------IINGL-------LK--
H2ZCE8_CIOSA/9-615-------------------------------TFVVF-----LSLLQLVQ.V-------------MGSGY-------NK--
H3ABP2_LATCH/6-582-------------------------------FFVVC-----HGVLQLSQ.L-------------LVSGY-------LK--
H3AUF3_LATCH/60-624-------------------------------GYLFF-----YSVLAIVQGT-------------VVNGL-------IN--
H3AXL7_LATCH/47-642-------------------------------VFLAA-----LSFAYFAK.A-------------LSGSY-------MK--
H3B0P1_LATCH/42-638-------------------------------VFLVA-----ISFAYFAR.G-------------ASGSY-------MK--
H3BW91_TETNG/35-616-------------------------------FFVLC-----HSLLQLAQ.L-------------LVSGY-------MK--
H3DMV0_TETNG/12-567-------------------------------LFVLC-----HGLLQLSQ.L-------------LYSAY-------FK--
H3DSJ9_PRIPA/41-714-------------------------------GFLTL-----FVIVYLME.A-------------MGGMY-------IV--
H3FQI4_PRIPA/22-588-------------------------------VFIGL-----MLLVVAIQ.G-------------CYLGY-------VV--
H9GXA5_DANRE/22-598-------------------------------IFIAA-----LAFCYFSK.S-------------MTASY-------TK--
H9GYB5_DANRE/9-610-------------------------------MFLAA-----MCFVFFAK.A-------------FQGSY-------MK--
H9J2D0_BOMMO/122-735-------------------------------VFVFF-----LSFLVTLQQA-------------LSSGY-------IN--
A0A088AHC0_APIME/72-668-------------------------------AYVFL-----YGVLGCIF.S-------------ASYAY-------FN--
A0A088AHB9_APIME/23-630-------------------------------NFIAV-----YGLLGTVQ.A-------------MAFIY-------IV--
I1FF21_AMPQE/83-628-------------------------------MFTFL-----LCCYAFLQGA-------------IVSGF-------TS--
I1FF22_AMPQE/53-616-------------------------------AFTVF-----LCLFAVIEGA-------------IVIGL-------TS--
I3J8K7_ORENI/27-592-------------------------------FFVFC-----HSLLQLAQ.L-------------LVSGY-------MK--
I3JPB0_ORENI/4-598-------------------------------MFLAA-----LSFAYFAK.A-------------LSGSY-------MK--
I3JU44_ORENI/3-598-------------------------------LFLAS-----LAFVYFAK.A-------------FAGAY-------MK--
I3JU45_ORENI/36-628-------------------------------LFIVA-----LSFAYFSK.A-------------LTGTY-------MK--
I3KD69_ORENI/19-600-------------------------------IFLIS-----ECALMLAQGT-------------VG.AY-------LV--
I3KT50_ORENI/9-572-------------------------------LFVLC-----HGLLQLSQ.L-------------LYSAY-------FK--
I3MXD4_SPETR/104-661-------------------------------GLLFF-----LCAASFLQGM-------------TVNGF-------IN--
I3MZY5_SPETR/101-669-------------------------------GFLIH-----YCLLALTQGV-------------VVNGL-------VN--
J9JWU7_ACYPI/65-667-------------------------------VFLAT-----FCFSWVLQ.G-------------MFSTY-------FV--
J9K6L3_ACYPI/47-601-------------------------------VYVLV-----YGLLGLNQ.F-------------MLSSY-------FN--
K1PJB3_CRAGI/119-693-------------------------------AFVVC-----MSVLLAVSGT-------------LSTGY-------LN--
K1Q6Z9_CRAGI/63-616-------------------------------LFVVW-----VFILCFLEGF-------------AVNGI-------SN--
K1QB38_CRAGI/29-589-------------------------------ALLFF-----LSCFCMLQGF-------------VVNGI-------NN--
K1QD74_CRAGI/43-615-------------------------------WFVLW-----LCIFGFVEGA-------------AVNGV-------VN--
K7IWN1_NASVI/25-629-------------------------------SFIAV-----YGLLGTVQ.S-------------MAFIY-------IV--
K7IWN2_NASVI/77-675-------------------------------AYVFL-----YGVLGCIF.S-------------ASYAY-------FN--
K7J562_NASVI/209-820-------------------------------VFVFL-----LSFLVTLQQA-------------LSSGY-------IN--
K7J8P8_NASVI/104-674-------------------------------MFLFT-----FCITWVLQ.G-------------MYYTY-------FV--
L5JNP4_PTEAL/43-638-------------------------------FFLLC-----HSLLQLVQ.L-------------MISGY-------LK--
L7N264_MOUSE/21-597-------------------------------VFLLA-----LTGACVSK.S-------------LTGSH-------MK--
L9L9W1_TUPCH/47-739-------------------------------SFVLC-----HSLLQLAQ.L-------------MISGY-------LK--
M3WPK8_FELCA/38-596-------------------------------CFLVF-----FCILVASQ.G-------------IVFGL-------VD--
M3XXF4_MUSPF/103-666-------------------------------GFLLY-----YCLLALTQGI-------------IVNGL-------VN--
M3XXG5_MUSPF/93-653-------------------------------CFVVF-----FCLLITSQ.G-------------IVFGL-------KE--
M3YCV1_MUSPF/50-648-------------------------------FFVLC-----HSLLQLAQ.L-------------MISGY-------LK--
M3ZWM7_XIPMA/18-618-------------------------------LFLVS-----LAFMYFAK.A-------------FAGAY-------MK--
M3ZXE4_XIPMA/24-582-------------------------------VFVLC-----HSLLQLAQ.L-------------LVSGY-------MK--
M4ABK2_XIPMA/34-613-------------------------------IFLVA-----ECALMLAQGT-------------VG.AY-------LV--
SO1A3_RAT/21-597-------------------------------VFLMA-----LTCAYVSK.S-------------LSGTF-------MS--
SO2A1_RAT/33-602-------------------------------VFVLC-----HGLLQLCQ.L-------------LYSAY-------FK--
Q16RK9_AEDAE/100-701-------------------------------AYVFL-----YGVVGCIF.S-------------ATYAY-------FN--
Q16RL0_AEDAE/55-631-------------------------------LYVFL-----FGIVGCLF.G-------------STTAY-------FY--
Q171D5_AEDAE/25-762-------------------------------SFIMV-----YGFLGTTQ.A-------------MAYIY-------FV--
Q28XS7_DROPS/47-608-------------------------------LYMVI-----YGIAGCFL.A-------------IAFSY-------FN--
A0A0A6YYJ9_HUMAN/29-621-------------------------------MFLAA-----LSFSYIAK.A-------------LGGII-------MK--
SO4C1_RAT/102-664-------------------------------GFLLH-----YCLLALTQGI-------------VVNGL-------VN--
Q7Q103_ANOGA/25-768-------------------------------SFIMV-----YGFLGTVQ.A-------------MAYIY-------FV--
Q7Q551_ANOGA/114-716-------------------------------VYVFM-----YGVVGCIF.S-------------ATYAY-------FN--
SO2B1_MOUSE/42-636-------------------------------FFVLC-----HSLLQLTQ.L-------------MISGY-------LK--
Q8C0X7_MOUSE/95-654-------------------------------GFMTL-----YVAAVLIH.G-------------ALFAV-------VD--
SO1A5_MOUSE/21-597-------------------------------MFLLA-----LTCAYVSK.S-------------LSGIY-------MN--
Q93550_CAEEL/18-586-------------------------------IFVLL-----MVLVIAVQ.G-------------TYLGY-------VV--
SO4A1_HUMAN/104-663-------------------------------GILFF-----LCAAAFLQGM-------------TVNGF-------IN--
SO1A6_MOUSE/21-597-------------------------------VFLLA-----LIWAYISK.I-------------LSGVY-------MS--
SO4A1_RAT/103-665-------------------------------GFLFF-----LCAASFLQGM-------------TVNGF-------IN--
SO1C1_RAT/44-642-------------------------------VFLGA-----LSFVYFAK.A-------------LTEGY-------LK--
SO1B2_MOUSE/27-617-------------------------------IFLAA-----LSFSYICK.A-------------LGGVI-------MK--
SO1B2_RAT/29-615-------------------------------LFLAA-----LSFSYICK.A-------------LGGVV-------MK--
Q9VK84_DROME/36-684-------------------------------MFMGV-----YGLLGTIQ.A-------------MSYMY-------FI--
Q9VVH9_DROME/175-754-------------------------------VFMVV-----FLLAYILQ.G-------------MYMTY-------FV--
Q9W269_DROME/112-731-------------------------------AYVLL-----YGIVGCIF.S-------------MTYAY-------FN--
Q9W270_DROME/95-661-------------------------------MFVIV-----YGIASCFL.A-------------MAFTY-------FT--
Q9W271_DROME/67-626-------------------------------MYVIL-----YGLAGCVM.T-------------MTFAY-------FN--
Q9XWC5_CAEEL/49-620-------------------------------CLLVV-----LGICAFIQSF-------------VVNAI-------FP--
R4GBU6_ANOCA/260-819-------------------------------GYLVF-----YSLLSVFQGI-------------VVNGL-------IN--
T1ER69_HELRO/33-610-------------------------------TFIVL-----YFIFSFSH.G-------------VQGTY-------TS--
T1G9I5_HELRO/71-663-------------------------------TFLCV-----ACCFVALQGM-------------VVSGF-------VS--
T1HLF3_RHOPR/50-617-------------------------------AYVFL-----YGLLGCIF.S-------------AAYSY-------FN--
T1HLL5_RHOPR/20-673-------------------------------TFMVV-----YGLLGTIQ.A-------------MSYVY-------II--
T1HYS5_RHOPR/25-590-------------------------------AFLVT-----FCITWVLQ.G-------------MYYTY-------FV--
T1I8L4_RHOPR/19-568-------------------------------IYVLI-----YGLLGVYE.T-------------VLESY-------FI--
T1IDL3_RHOPR/22-585-------------------------------SYVII-----YGLLGLNV.A-------------ALSAY-------FI--
T1IV13_STRMM/34-600-------------------------------VFTLC-----YGFLSVVQ.G-------------MSFMF-------IV--
T1J381_STRMM/107-721-------------------------------VFLGV-----FCLASVLQ.G-------------MYYTY-------FV--
T1J4Q6_STRMM/53-601-------------------------------VYMIS-----YCILNMCQ.G-------------MFYTY-------MI--
T1J9S9_STRMM/138-752-------------------------------VFVFL-----SCILVALQQT-------------LSSGY-------LN--
T1K555_TETUR/46-593-------------------------------IFVAI-----FSLIATMR.S-------------AYFVY-------MI--
U1NEN2_ASCSU/27-606-------------------------------IFLVV-----MLAVIGVQ.G-------------TYLGY-------TV--
U1NQ20_ASCSU/50-610-------------------------------VLLAS-----LCICAICQGS-------------IVNGF-------IS--
U3I6L4_ANAPL/103-660-------------------------------GVLFF-----LCVASFLQGM-------------TVNGF-------IN--
U3I6Y8_ANAPL/7-588-------------------------------FFVFC-----HGLLQLSQ.L-------------LVSGY-------LK--
U3K039_FICAL/40-624-------------------------------VFLLA-----LSLAFIGK.T-------------MSGAY-------MN--
U3K045_FICAL/38-630-------------------------------IFLGA-----LAFSFFAK.G-------------FSGSY-------MK--
U3KFS6_FICAL/31-593-------------------------------VFVLC-----HGLLQLSQ.L-------------LYSAN-------FK--
V8NPM0_OPHHA/58-605-------------------------------GYLVF-----YSLLSVFQGI-------------IVNGL-------IN--
W4WD24_ATTCE/23-636-------------------------------TFIVV-----YGLLGTVQ.A-------------MAFIY-------II--
W4XLX7_STRPU/60-699-------------------------------VYVTM-----TCIANVVYIS-------------SIGGY-------VS--
W4XQW5_STRPU/59-640-------------------------------FFCVL-----LCMVVASD.A-------------FNSGT-------FG--
W4XVZ6_STRPU/91-689-------------------------------GYLLA-----LSLTGLFHYL-------------VPFGL-------FF--
W4Z5F6_STRPU/135-671-------------------------------AYLVI-----YSLIGIVQVM-------------TSYGM-------VS--
W4Z5F7_STRPU/78-634-------------------------------GFLVW-----LCLFALTQSY-------------VTSGI-------VF--
W5J7I4_ANODA/56-623-------------------------------LYVLL-----FGLIGCIL.N-------------STTSY-------FY--
W5JBI4_ANODA/130-794-------------------------------VFVLL-----LSILVTLQQA-------------LSSGY-------IN--
W5JW33_ANODA/25-791-------------------------------SFIMV-----YGFLGTVQ.A-------------MAYIY-------FV--
W5KDH2_ASTMX/31-629-------------------------------LFLFA-----MSFIYFAK.A-------------FQGSY-------MK--
W5KJ52_ASTMX/32-619-------------------------------IFLVA-----ECALMLAQGT-------------VG.AY-------LV--
W5LQU9_ASTMX/27-591-------------------------------FFVLC-----HGMLQLAL.L-------------LVSGY-------LK--
W5MDQ5_LEPOC/17-593-------------------------------FFVLC-----HGSMQLTQ.L-------------LYSAY-------VK--
W5MFK3_LEPOC/106-669-------------------------------WVLFF-----LCVASFLQGM-------------IVNGF-------IN--
W5MRR1_LEPOC/26-603-------------------------------AFVAT-----LC.LILSANS-------------IGNAY-------LI--
W5MRT2_LEPOC/53-615-------------------------------GFLVF-----YCLLAVVQGF-------------LVNGL-------VN--
W5MY22_LEPOC/30-602-------------------------------VFVFC-----HGLLQLAQ.L-------------LVSGY-------LK--
W5NE89_LEPOC/38-625-------------------------------MFLAA-----LALSYFCK.S-------------LSASY-------TK--
W5NE95_LEPOC/1-594-------------------------------MFLVS-----LSFVYFAK.A-------------FQGSY-------MK--
W5NE99_LEPOC/24-615-------------------------------MFLVS-----LSFVYFAK.A-------------FQGSY-------MK--
W5NEA9_LEPOC/1-598-------------------------------MFLFA-----LSFAYFAK.A-------------LSGSY-------MK--
W5PSU6_SHEEP/93-647-------------------------------GFLLF-----LCVASFLQGM-------------TVNGF-------IN--
W5QAF5_SHEEP/107-670-------------------------------CFLIF-----FCILVMAQ.C-------------IVFGL-------VD--
W5QGQ1_SHEEP/21-597-------------------------------MFLLA-----ITCAFVSK.T-------------LSGSY-------MN--
X5LX59_CAEEL/46-677-------------------------------PMIVL-----LCVYCSIQGL-------------IVNGL-------VP--
X5M903_CAEEL/27-574-------------------------------PFMSI-----LSANAMLQGA-------------IVNGL-------VS--

PF06609

Q8NII4_FUSAU/1-598MTATVHEKGVDLESQPDDRLRAQALATTADELPEGYYTSPRVIASFA-GFS-------------LNVCATYFVLQASA--
Q9C1B3_FUSSP/1-598MTVVVPEEGLDLESQPDDRMRAKALATSAAELPDGYYRSPRIVASFA-AFS-------------MNVVATYFVLQASA--

PF05631

Q9N3A9_CAEEL/1-336-------------------------------MFVGV-----FYGLAAVCGL-------------LYFYTRSATESNDD--
Q9FWD6_ORYSJ/4-357-------------------------------FYYLV-----FGGLAAVVAG-------------LELGKSGKDRVATT--

PF01770

S19A1_HUMAN/23-434----------------------------RSWRHLVC-----YLCFYGFMAQ-------------IRPGE-------SF--
Q9EQN9_MOUSE/28-459----------------------------ECWFLPTA-----LLCAYGFFAN-------------LRPSE-------PF--
Q9VK64_DROME/2-395----------------------------KSWLKISL-----LLCTFGFFRE-------------FRPSE-------PY--
Q29L76_DROPS/2-397----------------------------EYWLKISL-----LLCTFGFLRE-------------LRPSE-------PY--
Q294A5_DROPS/2-414----------------------------ESWLKISW-----VLCIFGFLRE-------------IRPSE-------PY--
Q9VGV5_DROME/2-408----------------------------KEWLKISC-----LLCVFGCIRE-------------IRPSE-------PY--
Q16JT2_AEDAE/2-405----------------------------EQWGKIAI-----VLTLFGFLKD-------------FRPSD-------PF--
S19A3_HUMAN/10-441----------------------------SSWIYPTV-----ILCLFGFFSM-------------MRPSE-------PF--
Q1LV16_DANRE/4-414----------------------------SDWVFPTV-----LLSLYGFFAN-------------CRPAE-------PF--
Q9VGV6_DROME/2-411----------------------------ESWLKISC-----LLCIFGFLRE-------------LRPSE-------PY--
FOLT2_CAEEL/2-394----------------------------EQW.KVMV-----LICMYGAVKE-------------FRPTE-------PY--
Q28C92_XENTR/10-422----------------------------SGWKYPTI-----LLCLFGFFAD-------------MRAVD-------PF--
Q7Q5N2_ANOGA/2-422----------------------------QPWLRVSL-----LLCVFGFFRE-------------LRVSE-------PF--
A8BIM9_GIAIC/39-447----------------------------GSFNALLF-----LQVLLGILCA-------------FKPAE-------PF--
A7SN54_NEMVE/6-420----------------------------EFWQKATL-----LLCLYGFFKE-------------MKPSE-------PF--
S19A3_MOUSE/11-435----------------------------NSWVYPTV-----ILCLFGFFSM-------------FRPSE-------AF--
F1N2M7_BOVIN/23-430----------------------------QSWWCLVF-----FLCFYGFMAQ-------------MRPGE-------SF--
F1NVD6_CHICK/32-445----------------------------QRWKLQVF-----YLCFYGFMTQ-------------IRPGE-------SF--
F7EDM0_XENTR/76-481----------------------------.QWKFLLF-----YLCIYGFMTQ-------------LRPGE-------SF--
H3CDB6_TETNG/12-433----------------------------ENWKYPTF-----ILCIYGFFST-------------VRPIE-------PF--
S19A1_MOUSE/23-426----------------------------KSWRCLVF-----YLCFFGFMAQ-------------LRPGE-------SF--

PF00854

PTR7_ARATH/99-532-------------------------------YLTIA----------------------------IFAAI-----------
F7BBU0_ORNAN/81-472-------------------------------FKTII----------------------------YLSIV-----------
PEPT3_CAEEL/82-453-------------------------------FKVIL----------------------------YGSSI-----------
PEPT1_CAEEL/113-509-------------------------------FWTIF----------------------------SVSIL-----------
PTR12_ARATH/99-524-------------------------------FVIFL----------------------------ISASI-----------
S15A1_RABIT/81-472-------------------------------FKTIV----------------------------WLSIV-----------
PTR30_ARATH/96-518-------------------------------FWTFT----------------------------ASSLI-----------
PTR2_ARATH/113-544-------------------------------YWTIA----------------------------CFSGI-----------
DTPA_ECOLI/88-460-------------------------------KRVIM----------------------------LGAIV-----------
DTPD_ECOLI/76-458-------------------------------RMAVM----------------------------LGALL-----------
DTPC_ECOLI/75-447-------------------------------RTAVI----------------------------AGALL-----------
PTR2_SCHPO/158-542-------------------------------YNTIV----------------------------CSAVI-----------
S15A2_HUMAN/111-487-------------------------------FKTII----------------------------YLSLV-----------
PTR2_YEAST/155-533-------------------------------YNTIC----------------------------CGTAI-----------
S15A1_RAT/81-474-------------------------------FKTIV----------------------------SLSIV-----------
PTR17_ARATH/124-550-------------------------------YWTIA----------------------------SFSAI-----------
S15A4_RAT/94-517-------------------------------ARAIL----------------------------LSLAL-----------
DTPT_LACLA/91-474-------------------------------.RTIF----------------------------LGGIL-----------
PEPT2_CAEEL/99-494-------------------------------FWTIF----------------------------FISIF-----------
DTPB_ECOLI/81-457-------------------------------KRTIV----------------------------LGALV-----------
YCLF_BACSU/95-469-------------------------------ANTVF----------------------------YGGIF-----------

PF05978

Q19933_CAEEL/13-169--------------------------------------------------------------------------------
Q9XV34_CAEEL/12-166--------------------------------------------------------------------------------
MFS11_MOUSE/14-166--------------------------------------------------------------------------------
Q8MYL9_CAEEL/14-170--------------------------------------------------------------------------------
Q965T3_CAEEL/14-170--------------------------------------------------------------------------------
P91007_CAEEL/16-172--------------------------------------------------------------------------------
Q9XWR7_CAEEL/37-194--------------------------------------------------------------------------------
Q19932_CAEEL/14-169--------------------------------------------------------------------------------
Q21545_CAEEL/14-168--------------------------------------------------------------------------------
O61865_CAEEL/27-183--------------------------------------------------------------------------------
Q18251_CAEEL/11-167--------------------------------------------------------------------------------

PF06813

Q7XGH1_ORYSJ/34-288-------------------------------RWFMM-----LACMVI-MSA-------------SGGTN-----------
Q9LUF8_ARATH/16-265-------------------------------RWLVF-----VCAMWV-QSV-------------AGVGY-----------
Q8H613_ORYSJ/14-261-------------------------------PWVGL-----GAAVWV-QVA-------------GGASS-----------
Q94D97_ORYSJ/8-252-------------------------------HWLSL-----VGSIWL-QTI-------------NGPNS-----------
Q9M8M1_ARATH/13-260-------------------------------PWVGL-----AAAAWV-QVS-------------AGSGS-----------
Q9ZUV4_ARATH/17-262-------------------------------RWFMV-----FASFLI-MAC-------------AGATY-----------
O80960_ARATH/21-266-------------------------------RWFMF-----FGSLLI-MST-------------AGATY-----------
Q8H132_ARATH/7-253-------------------------------KWMIL-----VATIWI-QAF-------------TGTNF-----------
Q9SLF1_ARATH/14-260-------------------------------KWLGF-----VTAVWV-QSI-------------SGNNY-----------
NFD4_ARATH/43-286-------------------------------KWTVL-----VAAIWI-QAS-------------TGTNF-----------
F4J4R8_ARATH/23-272-------------------------------RWTVL-----VAAIWI-QAF-------------TGTNF-----------
Q9S7R2_ARATH/16-263-------------------------------RWLVF-----VAAMWI-QSC-------------AGIGY-----------

PF07672

Q8EUQ6_MYCPE/191-477-------------------------------KD.RP-----KFMTIN-QFG-----------------------------
Y077_MYCPN/209-467-------------------------------NRKKS-----ILSNAN-FWG-----------------------------
Q8EVP4_MYCPE/172-441-------------------------------NK.KS-----KYIASN-TFG-----------------------------
Y076_MYCPN/210-484-------------------------------QRRKS-----VLSNAN-LWG-----------------------------
Q98PH4_MYCPU/154-430-------------------------------AKTKG-----KISIFT-TWG-----------------------------
Q7NAK7_MYCGA/200-455-------------------------------MKTKT-----TLSVIN-SFG-----------------------------

PF03219

TLC2_ARATH/88-571-----------------FDEGDTAAMAVSPKIFGVE-----VTTLKKIVPL-------------GLMFF-------CI--
TLC1_CHLTR/2-492-----------------TQTAEKPFGKLRSFLWPIH-----MHELKKVLPM-------------FLMFF-------CI--
Q6MEN4_PARUW/1-484-----------------MSQQESEFGKLRAFFWPIH-----GHEVKKVLPM-------------MLMLF-------LI--
Q6MBI2_PARUW/1-474-----------------MKNQQNSVSS........T-----LLILKKRSLI-------------LFQFF-------LI--
Q6MEN5_PARUW/4-499-----------------TPTGSREFSPWRSNLWPVH-----RYELKKLIPM-------------LLIFF-------FI--
Q6MEM5_PARUW/2-491-----------------SQDAKQDFGKWRAFFWPVH-----GYELKKLLPM-------------FFMFF-------FI--
A5CCG3_ORITB/1-504-----------------MQKTNI.LKKFTKALWPIE-----LHEMKLFMPM-------------ALIIF-------CL--
Q1MSG2_LAWIP/9-504-----------------GSMPEEDFTGWRAILWPVY-----NFELKKFLPM-------------GLMML-------CI--
C4YY86_9RICK/5-489-----------------..KSDNYLSELRKVIWPIE-----RYENKKFLPM-------------AFMMF-------CI--
C4YYY2_9RICK/12-501-----------------...NKARNSKFRHIVWPIR-----SYELTKFIPM-------------ALLMF-------FI--
C4YZB1_9RICK/5-496-----------------....KIFFEKVKEIIWPIE-----RKELKLFIPM-------------ALMMS-------CI--
F8KVN2_PARAV/3-490-----------------.NESKPEFGPLRSFFWPVH-----NYELRKLLPM-------------FLMFF-------CI--
TLCE_RICPR/7-496-----------------...SRSFKNKFRAAFWPVH-----NYELGKFIPI-------------SALMF-------CI--
TLC2_CHLTR/2-500-----------------.SSEVKSFSKFRGYFFPIY-----RSEFSKFIPL-------------FFLAF-------FV--
TLCD_RICPR/14-503-----------------..KINSHFSKLTDYIWPIK-----RHEISKFLFI-------------TLLMF-------CI--

PF01733

ENT1_ARATH/167-450-------------------------------SAAVA-----LSGL.GDALM-------------QGGLI-------GV--
S29A1_RAT/144-455-------------------------------MIKIV-----LINS.FGAIL-------------QASLF-------GL--
S29A2_HUMAN/131-454-------------------------------MASVC-----FINS.FSAVL-------------QGSLF-------GQ--
S29A1_HUMAN/144-454-------------------------------MIKIV-----LINS.FGAIL-------------QGSLF-------GL--
FUN26_YEAST/180-510-------------------------------IMMLV-----VISSMGTAMT-------------QNGIM-------AI--
Q19495_CAEEL/137-426-------------------------------LGMAT-----SINF.SNGLY-------------ENSVY-------GV--
Q21145_CAEEL/434-723-------------------------------LGTIV-----VLNA.ANGLF-------------QNSMF-------GL--

PF03239

FTH1_YEAST/8-404-------------------------------SFQIF-----FIFLRESLEI-------------VVIVS-------IL--
EFEU_BACSU/9-395-------------------------------LFSLL-----MVFGSAAHAE-------------DDPIA-------AL--
Q9Y8Z4_AERPE/4-268-------------------------------ALATG-----LVAFREAFEA-------------ILLST-------II--
Y964_SYNY3/6-291-------------------------------GLPIF-----IVTLREALEA-------------SLVVG-------IV--
FIP1_SCHPO/7-320-------------------------------SVAIF-----FIVLRETLEA-------------SIIVS-------VL--
EFEU_ECOLI/1-276-------------------------------MFVPF-----LIMLREGLEA-------------ALIVS-------LI--
O83937_TREPA/14-362-------------------------------VYGMG-----CTMVAPGMPA-------------AFARS-------VV--
Q9ZC51_YERPE/156-557-------------------------------LLAQA-----ISEYQDGKYA-------------EASKS-------VQ--
Q9RKQ1_STRCO/1-274-------------------------------MFSNY-----LIGLREGLEA-------------SLVVC-------IL--
Q9ZDD8_RICPR/1-278-------------------------------MFKIA-----LVVFRECLEI-------------SLLLS-------VI--
FTR1_YEAST/7-321-------------------------------NVAVF-----FVVFRECLEA-------------VIVIS-------VL--
Y154_ARCFU/4-266-------------------------------MMGQM-----VITLREGFEA-------------ALLVA-------VL--
Q9WYP8_THEMA/2-266-------------------------------HLGAL-----LITFREALEA-------------SVIIA-------VI--

PF03209

P73827_SYNY3/40-466----------VLI--------------DE----------------------------------------------L----
PUCC_RHOS4/51-454----------VMI--------------VE----------------------------------------------L----
BCH2_RHOCB/28-417----------LMV--------------VE----------------------------------------------L----
D5AMI6_RHOCB/54-460----------VMI--------------VE----------------------------------------------L----
D5ANS1_RHOCB/51-456----------VMI--------------LE----------------------------------------------L----
G3XCS5_PROMA/1-413----------IMI--------------TE----------------------------------------------L----
I0HT76_RUBGI/55-465----------VMI--------------VE----------------------------------------------L----
Q3J171_RHOS4/51-459----------VMI--------------VE----------------------------------------------L----
Q3J183_RHOS4/28-414----------LMV--------------VE----------------------------------------------L----

PF13347

Q2G9N1_NOVAD/15-450..........FYN--------------QV----------------------------------------------L....
C4Z9B4_EUBR3/10-441..........YYN--------------VV----------------------------------------------L....
Q0AL93_MARMM/20-465..........YYN--------------YV----------------------------------------------I....
Q28K27_JANSC/9-401.........KFYV--------------DT----------------------------------------------Y....
E6WJ95_PANSA/12-430..........YYT--------------DV----------------------------------------------V....
D2VB35_NAEGR/26-486TKYYMEDICKYYS--------------DK----------------------------------------------S....
D4LG93_9FIRM/24-452..........FLT--------------DL----------------------------------------------A....
Q8I3H5_PLAF7/74-507..........FYT--------------NI----------------------------------------------V....
Q026U3_SOLUE/24-465..........FAT--------------VV----------------------------------------------K....
A6TPY1_ALKMQ/12-433..........FLT--------------DV----------------------------------------------A....
B1ZS00_OPITP/16-436..........FYT--------------DV----------------------------------------------Y....
B2GBT3_LACF3/25-466..........YVT--------------SG----------------------------------------------MFSGI
R7CNT8_9FIRM/17-438..........FYT--------------DV----------------------------------------------F....
D4L2L1_9FIRM/12-431..........YFT--------------DI----------------------------------------------.....
C5BVC3_BEUC1/25-453..........FYT--------------DV----------------------------------------------I....
A1SNV8_NOCSJ/14-434..........YLT--------------DS----------------------------------------------L....
A6TPY6_ALKMQ/13-436..........FLT--------------DI----------------------------------------------I....
NLS1_XENTR/40-494..........FLL--------------DI----------------------------------------------A....
A7HQL5_PARL1/12-433..........FYA--------------GE----------------------------------------------L....
C3Z8Z9_BRAFL/18-394..........FLV--------------QV----------------------------------------------A....
Q03PA7_LACBA/7-451..........FVT--------------SV----------------------------------------------LFVGK
Q2N8H6_ERYLH/15-453..........YYN--------------LV----------------------------------------------L....
D1BWG8_XYLCX/33-459..........FYT--------------EV----------------------------------------------F....
Q5YU93_NOCFA/41-478..........YYT--------------DV----------------------------------------------L....

PF03092

Q25272_LEIDO/59-606----------MLT--------------GR----------------------------------------------Y----
B3GVG0_TRYBB/138-667----------MFT--------------YT----------------------------------------------F----
Q9UAB8_LEIDO/94-683----------MFM--------------SR----------------------------------------------Y----
Q9UAB7_LEIDO/75-654----------MMI--------------DR----------------------------------------------Y----
Q9UAC0_LEIDO/76-655----------MMI--------------DR----------------------------------------------Y----
Q9UAC1_LEIDO/75-651----------MMI--------------DR----------------------------------------------Y----
FBT8_ARATH/98-515----------HMV--------------HS----------------------------------------------L----
FBT7_ARATH/30-441----------FLT--------------EQ----------------------------------------------L----
FBT3_ARATH/61-473----------YFK--------------DE----------------------------------------------Q----
FBT1_ARATH/137-553----------YLK--------------DD----------------------------------------------L----
FBT_SYNY3/46-457----------FLK--------------DE----------------------------------------------L----
O68867_SYNE7/38-441----------FLK--------------DD----------------------------------------------L----

PF06963

S40A2_ARATH/31-479----------YMI--------------YL----------------------------------------------W----
S40A1_ORYSJ/21-450----------YMI--------------RI----------------------------------------------W----
S40A1_ARATH/35-483----------YMI--------------HL----------------------------------------------W----
A2R421_ASPNC/42-466----------FLA--------------TI----------------------------------------------F----
Q5AXY5_EMENI/19-441----------FLA--------------SI----------------------------------------------F----
Q8IA95_CAEEL/5-448----------FMH--------------QL----------------------------------------------.----
S40A3_ARATH/146-569----------AIA--------------ML----------------------------------------------Y----
Q0CWF0_ASPTN/44-463----------FLA--------------SI----------------------------------------------F----
A0A0D1CCA6_USTMA/82-563----------MMV--------------QL----------------------------------------------F----
S40A1_HUMAN/22-531----------FLV--------------EL----------------------------------------------Y----
S40A1_DANRE/19-522----------FLV--------------EL----------------------------------------------Y----
A8X2J9_CAEBR/13-461----------CMD--------------LL----------------------------------------------.----
A5BT51_VITVI/32-472----------YMI--------------NI----------------------------------------------W----
A1CBM9_ASPCL/39-469----------FLA--------------SI----------------------------------------------F----
S40A3_ORYSJ/147-569----------AVA--------------VL----------------------------------------------H----
H3DM67_TETNG/10-523----------FLI--------------EL----------------------------------------------Y----

PF13000

C4R336_PICPG/74-584--------IPFLL--------------KG----------------------------------------------.----
G0WCJ0_NAUDC/17-577--------IPFLL--------------KS----------------------------------------------M----
G8BYR1_TETPH/85-660--------VPFLL--------------KS----------------------------------------------I----
Q75EB1_ASHGO/51-585--------VPFLL--------------KS----------------------------------------------I----
E7K9I5_YEASA/17-559--------VPFLL--------------KS----------------------------------------------L----
Q6CKM4_KLULA/10-515--------IPFIL--------------KS----------------------------------------------S----
G0VIX6_NAUCC/41-595--------IPFLL--------------KS----------------------------------------------M----
H2AY09_KAZAF/18-574--------VPFLL--------------KS----------------------------------------------L----
I2H5Y9_TETBL/23-594--------IPFLL--------------KS----------------------------------------------I----
G8JR10_ERECY/17-554--------VPFLL--------------KS----------------------------------------------V----
S6E3L5_ZYGB2/13-555--------VPFLL--------------KS----------------------------------------------M----
Q6FMM5_CANGA/15-566--------VPFLL--------------KS----------------------------------------------M----
C5E2P0_LACTC/16-543--------VPFLL--------------KS----------------------------------------------G----
B6ABL4_CRYMR/9-525--------IPFIL--------------QG----------------------------------------------.----
G8ZXV2_TORDC/17-551--------IPFLL--------------KS----------------------------------------------M----
J7RSN7_KAZNA/20-561--------IPFLL--------------KS----------------------------------------------M----

PF03825

YEGT_ECOLI/1-405-----------WL--------------S----K------------------------------------------S----
Q9A7U2_CAUCR/1-395-----------YM--------------G----M------------------------------------------L----
XAPB_ECOLI/1-407-----------YM--------------I----N------------------------------------------T----
NUPG_ECOLI/1-406-----------YM--------------F----V------------------------------------------T----

PF12832

C3YMP2_BRAFL/15-420-----------YM--------------Q.---Q------------------------------------------Q----
B4G7T5_DROPE/37-721-----------HM--------------Q.---S------------------------------------------I----
Q17GA0_AEDAE/15-612-----------HM--------------T.---L------------------------------------------T----
A7UVG6_ANOGA/15-612-----------HM--------------T.---L------------------------------------------T----
A7RI07_NEMVE/55-515-----------YF--------------R.---Q------------------------------------------I----
A7SQQ8_NEMVE/56-507-----------YL--------------KH---S------------------------------------------V----
Q54G39_DICDI/13-544-----------YL--------------N.---S------------------------------------------K----
Q55CH3_DICDI/12-488-----------YL--------------R.---D------------------------------------------K----
B7PL10_IXOSC/11-489-----------LL--------------K.---D------------------------------------------R----
Q6FB61_ACIAD/7-363-----------YL--------------E.---N------------------------------------------Q----
Q21IX9_SACD2/6-359-----------YL--------------E.---H------------------------------------------I----
C5BL70_TERTT/3-356-----------YL--------------E.---S------------------------------------------L----
B3PHF3_CELJU/16-370-----------YL--------------K.---S------------------------------------------L----
Q3J7E6_NITOC/10-363-----------YL--------------Q.---S------------------------------------------L----
D3SB25_THISK/4-359-----------YL--------------S.---E------------------------------------------A----
B8GQD4_THISH/6-360-----------YL--------------R.---D------------------------------------------Q----
A1WY15_HALHL/15-368-----------YL--------------R.---A------------------------------------------E----
Q2SJE3_HAHCH/6-360-----------YL--------------E.---Y------------------------------------------V----
Q07ZQ8_SHEFN/11-364-----------FF--------------D.---S------------------------------------------R----
A3QFN3_SHELP/25-378-----------FF--------------E.---N------------------------------------------R----

PF01306

LACY_CITFR/1-412-----------WL--------------HE---V------------------------------------------N----
RAFB_ECOLX/4-415-----------WL--------------SD---V------------------------------------------V----
A0A017JVR8_ECOLX/4-411-----------WL--------------KG---H------------------------------------------L----
LACY_KLEOX/6-416-----------WL--------------AE---V------------------------------------------N----

PF07690

O17785_CAEEL/33-439----------ICM..............SG---DGAPVSNRSALTNLENMEMTLVNASGSLTDNVENMEHKIADGRY----
Y2994_MYCTU/18-356----------.RL..............EN---A..........................................R----
ANTR2_ARATH/137-500----------.PM..............SQ---E..........................................Y----
Q19296_CAEEL/16-403----------.IL..............NY---YSKEG.................................HRDWLY----
A9CFQ9_AGRFC/27-373----------.FW..............RE---A..........................................F----
O25793_HELPY/8-347----------.LY..............AD---S..........................................F----
Q97XW7_SULSO/20-385----------.................AP---L...........................................----
D7GFS1_PROFC/22-419----------.TL..............TE---A..........................................L----
O66589_AQUAE/21-406----------.FI..............AE---S..........................................F----
Q9I0P8_PSEAE/19-362----------..M..............SA---E..........................................Y----
MFSD9_HUMAN/49-427----------.HV...............K---S..........................................L----
Q97CG2_THEVO/16-347----------.LY..............GK---L..........................................F----
Q9CF47_LACLA/24-427----------.TM..............QT---Q..........................................L----
Q92RK8_RHIME/23-360----------.LL..............KE---N..........................................Y----
Q8YC70_BRUME/8-339----------.VL..............LE---S..........................................R----
A0A098UI88_SALET/17-369----------.WM..............TV---E..........................................N----
Q8NU65_CORGL/19-414----------.................AT---D..........................................L----
Q9YG70_AERPE/18-417----------.AI..............QA---E..........................................L----
Q9HLN0_THEAC/12-329----------DLH..............TS---T..........................................V----
Q8XR21_RALSO/30-433----------.................SR---A..........................................L----
Q7X233_STAAU/33-313----------.................LQ---E..........................................Q----
O87836_STRCO/61-422----------LHE..............AQ---H...........................................----
Q8NNT7_CORGL/10-351----------AVL..............NN---G...........................................----
Q92WR7_RHIME/13-355----------.PI..............SR---D..........................................T----
Q8TZJ0_PYRFU/13-389----------.FL..............QE---T..........................................F----
O58400_PYRHO/34-380----------.VY..............MK---I..........................................I----
Q9KRL8_VIBCH/16-353----------.YL..............AN---H..........................................F----
Q9KWU2_SPHSX/13-348----------QHN..............DS---N..........................................F----
A0A090LWD5_STAAU/18-353----------.FL..............PT---V..........................................T----
Q8Y7M4_LISMO/13-349----------.IA..............QE---E..........................................L----
NART_STACT/13-344----------.MI..............SQ---D..........................................I----
Q9K646_BACHD/13-358----------.LM................---...........................................Y----
YLZ2_SCHPO/48-434----------.NI..............AE---Q..........................................F----
YWOG_BACSU/15-348----------.YT..............LQ---E..........................................L----
Q1K517_NEUCR/132-490----------.SI..............EK---Y..........................................Y----
O54179_STRCO/33-428----------.AI..............GD---G..........................................L----
Q98B83_RHILO/60-407----------.WA..............SS---E..........................................A----
A0A027U3K7_ECOLX/39-413----------.TM..............GR---D..........................................L----
Q9EYN6_SYNPW/18-450----------.TV..............KA---D..........................................L----
Q9KBG2_BACHD/16-398----------.DI..............QD---T..........................................F----
Q986N1_RHILO/24-356----------.AV..............AS---S..........................................F----
Q93LX8_9ACTN/30-425----------.AI..............GD---D..........................................L----
Q8KDQ3_CHLTE/9-374----------.TY..............AK---E..........................................L----
Q9PCL3_XYLFA/32-422----------.TL..............AH---D..........................................L----
Q9URI1_CANAX/123-512----------.EL..............MH---D..........................................F----
Q9KRK6_VIBCH/22-366----------.TI..............AR---D..........................................F----
Q92Y26_RHIME/19-357----------.AV..............QG---D..........................................L----
Q9RSF5_DEIRA/46-397----------..L..............GR---Q..........................................L----
LIZ1_SCHPO/36-407----------.GM..............QE---D..........................................L----
Q97IY3_CLOAB/13-357----------KVIG...........FSGG---D..........................................F----
Q9I008_PSEAE/29-430----------TDV..............RG---A..........................................L----
Q9HTX1_PSEAE/12-346----------.EL..............AA---S..........................................F----
Q9KYI2_STRCO/15-371----------.YF..............SY---N..........................................T----
Q973W8_SULTO/12-335----------IFV..............FY---...........................................F----
Q18472_CAEEL/18-397----------.CM..............KE---D..........................................N----
Q8ZXX0_PYRAE/10-352----------.VV..............KL---A..........................................S----
Q9AA55_CAUCR/30-391----------...................---...........................................I----
YN42_SCHPO/141-527----------EAI..............TT---V..........................................F----
Q2FVB9_STAA8/16-376----------.MM...............D---D..........................................L----
Q961H2_DROME/54-453----------QILYQT........CITIE---KFNAT.................................QCEPLL----
C3SM02_ECOLX/36-398----------.IL..............AN---G..........................................V----
Q8KCE7_CHLTE/27-390----------.IL..............NE---H..........................................L----
P95852_SULSF/9-333----------.VF..............EK---Q..........................................I----
O45678_CAEEL/27-403----------.AV..............AK---E..........................................F----
Q9I5C8_PSEAE/21-369----------.FV..............QN---D..........................................L----
O30222_ARCFU/15-357----------.QI..............MD---E..........................................F----
O54630_HALSA/24-368----------DVL..............GV---E...........................................----
Q8TR38_METAC/18-398----------.FL..............VT---K..........................................Y----
Q986D7_RHILO/41-396----------.VL..............RQ---G..........................................Y----
O69759_PSEFL/31-392----------.GI..............QH---D..........................................Y----
Q9HLR9_THEAC/6-377----------.FV..............VV---Y..........................................L----
A0A098UKM0_SALET/13-352----------.LM................---...........................................A----
O28944_ARCFU/4-328----------.SY..............AS---S..........................................L----
Q9KKX8_VIBCH/40-383----------.FL..............YQ---D..........................................Y----
Q96XQ4_SULTO/9-336----------.SV..............YS---S..........................................L----
Q8Y6H4_LISMO/13-376----------.YF..............SE---S..........................................I----
O62376_CAEEL/16-394----------DWL..............SN---S..........................................S----
YCUD_SCHPO/89-473----------INF..............FD---I..........................................Y----
Y1634_MYCTU/25-423----------.TI...............A---D..........................................I----
Q9KG75_BACHD/5-341----------YAL................---S..........................................L----
Q7JZE2_DROME/46-458----------DALVVPAGLSRLTEGNVTS---TGRCG.................................SPRVVF----
Q9KLN6_VIBCH/36-395----------MLD..............AG---I...........................................----
Q8P881_XANCP/26-418----------.TL..............AR---D..........................................F----
H1XFL1_9XANT/19-356----------.TL..............AQ---A..........................................F----
YQ92_SCHPO/20-407----------.SL..............VD---R..........................................V----
O16697_CAEEL/36-432----------YLS..............GL---D..........................................K----
A0A0E1EPM8_STRPY/10-353----------.LY..............VE---N..........................................L----
Q1K880_NEUCR/87-498----------.II..............SA---E..........................................F----
Q8XKW0_CLOPE/26-404----------.................AK---A..........................................F----
O58488_PYRHO/9-354----------.DI..............IH---H..........................................F----
Q9K9F3_BACHD/14-368----------.PW..............ET---E..........................................F----
O29880_ARCFU/11-360----------.................MN---T..........................................F----
Q97C48_THEVO/19-351----------.YF..............NE---Y..........................................L----
Q9Y7D4_ASPTE/35-449----------.HI..............TA---Q..........................................F----
Q97DX4_CLOAB/23-413----------.TL..............MK---E..........................................M----
Q8MPU6_CAEEL/90-445----------EAK..............LK---N...........................................----
Q96Y06_SULTO/9-344----------.FM..............VK---Y..........................................L----
A9CIR5_AGRFC/18-359----------MAL..............YF---E..........................................I----
Q8ZWZ3_PYRAE/12-326----------.AI..............LR---E..........................................F----
A0A027YK03_ECOLX/20-357----------.FL..............TD---E..........................................V----
G4UU99_NEUT9/52-417----------.GL..............AT---D..........................................L----
Y2456_MYCTU/16-365----------.YL..............LL---I..........................................H----
Q19845_CAEEL/45-446----------YIL..............TL---E..........................................H----
YHJO_BACSU/19-353----------.YL..............HE---Q..........................................L----
Q8ZVF8_PYRAE/4-322----------.YL...............R---D..........................................L----
O58825_PYRHO/10-360----------.YV..............LD---K..........................................T----
A0A029L256_ECOLX/8-341----------.EL..............AH---N..........................................V----
Q9L8Q4_PSEST/17-351----------.HL..............VA---D..........................................L----
Q9XXC1_CAEEL/44-436----------SPY..............WE---D..........................................F----
Y4007_STRCO/39-376----------.LI..............AH---D..........................................M----
Q8YQ15_NOSS1/8-358----------.FM..............RQ---Q..........................................K----
O93992_CANAX/65-459----------.QI..............ME---H..........................................L----
Q8YWH2_NOSS1/17-343----------LMK..............QN---N...........................................----
Q9RSM6_DEIRA/32-418----------.RV..............AT---E..........................................L----
Q9VDS0_DROME/61-500----------LYP..............GS---E..........................................F----
Q9I0Y2_PSEAE/28-357----------ITA..............GT---G..........................................L----
Q92TU0_RHIME/19-421----------.GR..............GD---I..........................................I----
I3XGH7_RHIFR/18-362----------.IQ..............IK---A..........................................L----
Q8XGP2_RALSO/41-431----------.EI..............AV---D..........................................L----
YFIS_BACSU/15-364----------.LA..............AF---Q..........................................L----
Q92BU8_LISIN/14-347----------.SI..............AE---S..........................................I----
Q55937_SYNY3/19-365----------.LL..............AF---E...........................................----
Q9A856_CAUCR/31-388----------.DL..............SV---E..........................................F----
D6EJD0_STRLI/29-361----------.SI..............GS---S..........................................F----
Q97BG6_THEVO/17-357----------.IF..............IE---I..........................................Y----
Q9X4X9_9PSED/27-377----------.PL..............NQ---A..........................................F----
Q973J7_SULTO/8-320----------.YF...............K---S..........................................L----
O32859_MYCFO/12-364----------.LV..............LQ---H..........................................N----
Q9S243_STRCO/13-352----------.YR..............AL---A..........................................L----
Q8DNZ1_STRR6/13-344----------.YY................---...........................................Q----
Q97CC5_THEVO/27-411----------.AF..............AY---S..........................................F----
AMPG1_RICPR/10-405----------WFA..............KK---D...........................................----
Q9RD97_STRCO/46-435----------.ET..............AA---D..........................................L----
Q8R8R3_CALS4/20-398----------GIM..............LE---A..........................................F----
O30210_ARCFU/17-354----------.................ME---T..........................................Y----
Q8X120_EXODE/120-524----------HII..............GN---T..........................................F----
Q9EW91_9ACTN/13-358----------.LV..............LH---L..........................................T----
Q8MMD6_DROME/21-407----------MTN..............AE---N..........................................T----
Q8XVV0_RALSO/19-414----------.TI..............QG---E..........................................I----
Q978I2_THEVO/17-358----------VVL..............FI---T...........................................----
S22AI_MOUSE/13-363----------.YL..............SR---T..........................................L----
Q92XG9_RHIME/14-352----------.AM..............PT---A..........................................L----
Q8P8I8_XANCP/24-370----------.HI..............YE---I..........................................T----
Q9I1Q7_PSEAE/34-397----------.TI..............AG---E..........................................F----
Q9I4J1_PSEAE/26-388----------IAE..............DP---S..........................................F----
Q9KG22_BACHD/29-373----------.YV..............VD---E..........................................L----
Q9KYE9_STRCO/8-359----------.YV..............AQ---V..........................................R----
A0A0E1EPV8_STRPY/27-401----------.IM................---...........................................V----
O31131_BRELN/13-405----------.AI..............GD---D..........................................L----
M4U5Z3_9XANT/29-361----------..I..............AS---D..........................................L----
Q9ZC50_YERPE/23-431----------.GM..............VK---S..........................................F----
Q8U366_PYRFU/20-359----------.YL..............TD---V..........................................L----
Q9C9R9_ARATH/11-379----------VGL..............AL---H...........................................----
Q20265_CAEEL/46-427----------EKANNESLSRNETILPSSL---N..........................................F----
Q9PCQ0_XYLFA/73-403----------.QI..............AQ---D..........................................L----
Q9I247_PSEAE/4-339----------.................LA---S..........................................L----
Q9VPX2_DROME/42-442----------VSL..............VE---ECNPP.................................GGASNV----
Q8Y3L9_LISMO/17-359----------.TV..............SQ---D..........................................L----
Q8VUK1_HALHD/23-380----------.EL..............RE---P..........................................L----
B8FVY2_DESHD/13-347----------.LI..............KA---F..........................................P----
A9CGF2_AGRFC/30-354----------.................GE---Y..........................................W----
O66181_ARTSP/15-353----------.FM..............KE---S..........................................L----
Q8KYU7_9PROT/15-359----------.EI..............RA---A..........................................F----
YJ7D_SCHPO/81-445----------.GM..............KT---D..........................................T----
Q8XEG8_ECO57/47-408----------.TI..............RE---E..........................................L----
Q9VY22_DROME/66-470----------NLA..............TQ---N..........................................L----
Q8U4E5_PYRFU/8-345----------YAI................---T..........................................L----
YFKL_BACSU/12-351----------.SL..............TK---Q..........................................W----
O30679_RHORH/8-341----------.DM..............AR---D..........................................L----
Q97TH3_CLOAB/16-408----------.FL..............MK---S..........................................F----
E7KRF3_YEASL/86-451----------.GI..............KD---H..........................................L----
Q9A961_CAUCR/19-356----------.HV..............IK---T..........................................F----
Q97TH7_CLOAB/19-357----------.PI..............AS---E..........................................L----
A0A0D6HIB6_STAAU/12-398----------.TI..............KQ---D..........................................L----
Q9VPD9_DROME/28-441----------.KL..............SG---S..........................................F----
Q8PVU8_METMA/11-346----------.DM..............VE---P..........................................L----
F6MF49_STAAU/18-410----------.SI..............MR---E..........................................L----
Q97FI4_CLOAB/17-361----------.LL..............TQ---K..........................................L----
Q8KR58_ESCFE/20-359----------LVT..............LT---G..........................................L----
Q8NLD6_CORGL/19-353----------.PM..............AS---D..........................................L----
Q9LAA0_AERHY/27-362----------.DL..............SR---A..........................................L----
O06742_BACIU/18-364----------.KM..............KS---E..........................................L----
Q9FCG1_STRCO/24-364----------.YL..............TI---D..........................................R----
O94019_CANAX/86-529----------DSL..............NE---K..........................................Y----
MOT14_MOUSE/42-459----------.WL...............E---E..........................................F----
Q92V77_RHIME/8-347----------.IA..............AD---T..........................................H----
Q9Y7E0_ASPTE/42-435----------.EI..............AN---E..........................................F----
Q9I431_PSEAE/11-401----------.DI..............GR---S..........................................L----
O76837_CAEEL/25-400----------VIC..............MQ---D...........................................----
Q96ZI2_SULTO/36-365----------.VT..............KY---I..........................................F----
Q7BQD2_PSEST/7-367----------PLV..............MR---Q..........................................H----
Q94886_DROME/14-423----------.MIAGKGAITSNETHENST---D..........................................L----

PF00083

GTR4_MOUSE/27-483----------IEQ--------------SY---N------------------------------------------A----
GTR1_MOUSE/14-467----------IEE--------------FY---N------------------------------------------Q----
QUTD_EMENI/24-490----------QSF--------------QN---E------------------------------------------F----
ITR2_YEAST/112-569----------INR--------------DL---D------------------------------------------N----
SNF3_YEAST/100-556----------NY.--------------VK---S------------------------------------------H----
GALP_ECOLI/18-451----------IA.--------------..---D------------------------------------------E----
HXT5_YEAST/89-549----------TDF--------------IR---R------------------------------------------F----
GTR3_MOUSE/13-465----------LKD--------------FL---N------------------------------------------Y----
HXT9_YEAST/64-526----------SDF--------------IR---R------------------------------------------F----
HXT8_YEAST/69-530----------TDF--------------LR---R------------------------------------------F----
HXT6_YEAST/68-528----------TDF--------------IR---R------------------------------------------F----
GTR3_CHICK/14-464----------IQA--------------FY---N------------------------------------------R----
GTR5_HUMAN/20-475----------MQQ--------------FY---N------------------------------------------E----
HXT13_YEAST/60-521----------DNF--------------KM---N------------------------------------------F----
YB91_YEAST/27-485----------LSC--------------SR---F------------------------------------------E----
PROP_ECOLI/25-453----------LGK--------------VF---F------------------------------------------P----
JEN1_YEAST/125-563----------SAA--------------WA---F------------------------------------------F----
GIT1_YEAST/43-466----------NKV--------------FV---M------------------------------------------E----
GTR2_MOUSE/13-498----------IIS--------------HY---R------------------------------------------H----
HXT2_YEAST/59-519----------TDF--------------KR---R------------------------------------------F----
XYLE_ECOLI/13-478----------LNT--------------VF---V------------------------------------------A----
LACP_KLULA/75-529----------DAY--------------LK---Y------------------------------------------Y----
STP1_ARATH/26-489----------PSF--------------LK---R------------------------------------------F----
MAL31_YEAST/102-561----------PVF--------------QK---K------------------------------------------Y----
QAY_NEUCR/24-494----------PSF--------------TK---E------------------------------------------F----
GLF_ZYMMO/13-469----------VD.--------------.I---H------------------------------------------F----
STL1_YEAST/30-488----------KQF--------------NY---E------------------------------------------F----
ARAE_ECOLI/25-461----------IT.--------------..---D------------------------------------------H----
GAL2_YEAST/74-534----------TDF--------------LR---R------------------------------------------F----
A4I0Q6_LEIIN/5-442----------MK.--------------.D---H------------------------------------------F----
A4I8N6_LEIIN/77-573----------YGY--------------AS---N------------------------------------------C----
Q38AB8_TRYB2/39-501----------YEV--------------AT---N------------------------------------------C----
Q38AB9_TRYB2/39-500----------YLT--------------AT---E------------------------------------------C----

PF11700

AT221_ASPNC/30-582----------EQM--------------AR...E------------------------------------------R----
AT221_ASPOR/20-571----------EQM--------------AR...D------------------------------------------R----
AT222_ASPTN/24-571----------EQM--------------AR...D------------------------------------------S----
AT221_EMENI/24-564----------EQM--------------AR...E------------------------------------------R----
AT221_ASPFU/24-580----------EQM--------------AR...D------------------------------------------R----
AT222_ASPCL/24-579----------EQM--------------AR...D------------------------------------------R----
AT221_PENCW/20-562----------EQM--------------AR...D------------------------------------------R----
ATG22_COCIM/35-567----------EQM--------------TR...D------------------------------------------Q----
AT222_PHANO/72-634----------EQL--------------AR...E------------------------------------------N----
AT222_SCLS1/72-619----------EQL--------------AR...E------------------------------------------N----
ATG22_NEUCR/155-689----------ESL--------------AR...E------------------------------------------N----
AT222_PENCW/33-580----------EQL--------------AR...E------------------------------------------R----
AT222_ASPOR/30-578----------EQL--------------AR...E------------------------------------------Q----
AT222_EMENI/31-576----------EQL--------------AR...E------------------------------------------Q----
ATG22_YARLI/6-582----------QSY--------------AR...Q------------------------------------------N----
ATG22_CANGA/31-527----------EQF--------------AR...I------------------------------------------N----
ATG22_VANPO/27-511----------EQF--------------AR...H------------------------------------------N----
ATG22_KLULA/17-487----------EQF--------------GR...I------------------------------------------N----
A9WGR7_CHLAA/9-439----------TSI--------------TR....------------------------------------------.----
A4X7E0_SALTO/18-457----------TTV--------------AE....------------------------------------------.----
A6H0A9_FLAPJ/7-445----------EMI--------------FK...K------------------------------------------R----
ATG22_CRYNJ/1-531----------...--------------.....P------------------------------------------S----
ATG22_SCHPO/13-525----------MKN--------------AH...D------------------------------------------H----
A7EQB6_SCLS1/56-534----------QNL--------------IYQAGF------------------------------------------N----
A5DD56_PICGU/47-524----------QNL--------------LS...Q------------------------------------------S----
A0A0D1E381_USTMA/59-561----------QNL--------------LS...Q------------------------------------------Q----
Q0TYS2_PHANO/43-505----------QNL--------------MYQ..A------------------------------------------A----
Q0CF56_ASPTN/43-493----------QNL--------------LYQ..A------------------------------------------A----
Q0CXZ2_ASPTN/50-478----------QNL--------------LSQAAG------------------------------------------S----
Q0U0L9_PHANO/44-456----------QSA--------------AN...V------------------------------------------L----
A1CD46_ASPCL/43-518----------LSA--------------AN...L------------------------------------------L----
ATG22_CANAL/39-496----------QSI--------------AK...N------------------------------------------V----
A3LP71_PICST/32-502----------QSI--------------AT...E------------------------------------------V----
Q75EJ9_ASHGO/58-558----------QTI--------------AH...E------------------------------------------L----
Q6CKN0_KLULA/64-544----------QTT--------------AH...A------------------------------------------L----

PF06779

Q986E3_RHILO/34-394----------MME-------------------E------------------------------------------L----
Q89HQ1_BRADU/48-412----------LIA-------------------A------------------------------------------K----
A9CI18_AGRFC/23-387----------MMA-------------------D------------------------------------------V----
Q88ED9_PSEPK/14-373----------LIA-------------------E------------------------------------------G----
Q8Y185_RALSO/36-399----------MLH-------------------D------------------------------------------G----
Q9I3T2_PSEAE/20-380----------LIR-------------------E------------------------------------------G----
Q89X18_BRADU/63-426----------MRE-------------------T------------------------------------------L----
Q92UK2_RHIME/1-365----------MMT-------------------D------------------------------------------T----
YJIJ_ECOLI/23-381----------MMA-------------------E------------------------------------------G----
Q8ZJZ6_SALTY/23-379----------MLA-------------------E------------------------------------------K----
Q9PGN0_XYLFA/26-385----------MLR-------------------E------------------------------------------G----

PF05977

Q92LE2_RHIME/11-531----------SWL--------------MA---S------------------------------------------I----
Q98HB4_RHILO/11-532----------AWM--------------MT---T------------------------------------------I----
Q92Y88_RHIME/8-530----------SWL--------------VT---D------------------------------------------L----
A9CFW7_AGRFC/8-530----------SWL--------------MT---D------------------------------------------L----
Q9HYE1_PSEAE/25-549----------AWV--------------VT---D------------------------------------------A----
Q989L4_RHILO/31-551----------SWL--------------MA---T------------------------------------------I----
Q92SW7_RHIME/14-535----------AWL--------------MT---S------------------------------------------I----
Q989T8_RHILO/11-532----------SWL--------------MA---T------------------------------------------I----
Q9I0E1_PSEAE/6-529----------GWL--------------MT---S------------------------------------------L----

PF03137

Q924H6_RAT/144-701----------LSI--------------GNFERD------------------------------------------F----
A0NEW4_ANOGA/55-618----------GTL--------------TTVEKS------------------------------------------I----
A7S331_NEMVE/27-582----------VSI--------------TTIETR------------------------------------------F----
A7S539_NEMVE/32-576----------VSI--------------STIEKR------------------------------------------Y----
A7S542_NEMVE/18-557----------VSI--------------STIEKR------------------------------------------Y----
A7SHZ4_NEMVE/19-550----------VVI--------------SSLEKR------------------------------------------F----
A7SQZ6_NEMVE/18-584----------LVI--------------TTIEKR------------------------------------------F----
A7SWE4_NEMVE/55-622----------QAL--------------PTLERR------------------------------------------F----
A7SX54_NEMVE/31-599----------AGL--------------TALEKR------------------------------------------F----
A8P8W3_BRUMA/81-731----------SAI--------------TSIERR------------------------------------------F----
A8PR64_BRUMA/26-571----------GIL--------------TNLERR------------------------------------------F----
B0WEE2_CULQU/64-642----------GTL--------------STVEKS------------------------------------------I----
B0WEE5_CULQU/105-708----------GTI--------------TTLEKR------------------------------------------Y----
B0WGA7_CULQU/25-763----------ITL--------------TTLEKR------------------------------------------F----
B3DJD4_DANRE/48-631----------STI--------------TQLERR------------------------------------------F----
B3MGJ1_DROAN/65-620----------GTI--------------TTMEKR------------------------------------------Y----
B3MGJ2_DROAN/51-611----------GTI--------------TTLEKR------------------------------------------F----
B3MNT7_DROAN/36-684----------VTL--------------TTLEKR------------------------------------------F----
B3RLK5_TRIAD/8-577----------VAI--------------TSLETR------------------------------------------F----
B3RLK6_TRIAD/21-588----------VAI--------------TSLETR------------------------------------------F----
B3RLK7_TRIAD/29-614----------VII--------------TSLEKR------------------------------------------Y----
B3RLK8_TRIAD/27-595----------VVI--------------PQVEKR------------------------------------------F----
B3RLL2_TRIAD/176-721----------TIV--------------PSLEKR------------------------------------------Y----
B3S2R8_TRIAD/18-575----------VVI--------------TSLETR------------------------------------------Y----
B3SCA6_TRIAD/44-614----------VTV--------------SSIEKR------------------------------------------F----
B4J9Q1_DROGR/61-622----------GTI--------------TTLEKR------------------------------------------Y----
B4J9Q2_DROGR/50-610----------GTL--------------TTLEKR------------------------------------------Y----
B4J9Q3_DROGR/52-605----------GTI--------------TTLEKR------------------------------------------Y----
B4JCP9_DROGR/31-685----------VTL--------------TTLEKR------------------------------------------F----
B4KJ36_DROMO/34-688----------VTL--------------TTLEKR------------------------------------------F----
B4KS84_DROMO/70-629----------GTI--------------TTLEKR------------------------------------------Y----
B4KS85_DROMO/55-614----------AIV--------------TTLEKR------------------------------------------Y----
B4KS86_DROMO/50-605----------GTI--------------TTLEKR------------------------------------------Y----
B4KS87_DROMO/111-737----------GTI--------------TTIEKR------------------------------------------F----
B4MDK1_DROVI/34-691----------VTL--------------TTLEKR------------------------------------------F----
B4MFR1_DROVI/68-626----------GTI--------------TTLEKR------------------------------------------Y----
B4MFR2_DROVI/57-615----------GTI--------------TTLEKR------------------------------------------Y----
B4MJH9_DROWI/51-614----------GTI--------------TTLEKR------------------------------------------F----
B4MJI0_DROWI/54-620----------GTI--------------TTLEKR------------------------------------------Y----
B4MWM1_DROWI/38-693----------VTL--------------TTLEKR------------------------------------------F----
B4N051_DROWI/200-840----------SVI--------------TTIEKR------------------------------------------F----
B5DE94_XENTR/28-595----------SCL--------------TTIEKR------------------------------------------F----
B5DI87_DROPS/36-609----------VTL--------------TTLEKR------------------------------------------F----
B5E0I0_DROPS/65-626----------GTI--------------TTLEKR------------------------------------------Y----
B7PPH4_IXOSC/20-614----------GIQ--------------STLERR------------------------------------------F----
B7QN84_IXOSC/6-567----------SVL--------------TTIEKL------------------------------------------Y----
C3Y4T6_BRAFL/2-565----------SVV--------------TTIEKR------------------------------------------F----
C3Y4T7_BRAFL/83-626----------VVI--------------TTIEKR------------------------------------------F----
C3YMS7_BRAFL/5-587----------SVI--------------TTIEKR------------------------------------------F----
C3ZQA6_BRAFL/26-589----------ATI--------------STIEKR------------------------------------------Y----
C3ZX58_BRAFL/40-591----------GVL--------------TTIERQ------------------------------------------F----
D6W853_TRICA/116-732----------SVI--------------TTIEKR------------------------------------------F----
D6W895_TRICA/53-625----------GTI--------------TTLEKR------------------------------------------F----
E0VXM5_PEDHC/126-706----------GTI--------------TSLEKR------------------------------------------F----
E0W488_PEDHC/204-804----------SVI--------------TTIEKR------------------------------------------F----
E1C5S3_CHICK/28-603----------SSI--------------STIEKR------------------------------------------Y----
E1FKB9_LOALO/26-596----------GIL--------------TNLERR------------------------------------------F----
E1FVI2_LOALO/58-633----------VGL--------------STLEKR------------------------------------------F----
E2A200_CAMFO/99-698----------SVI--------------TTIEKL------------------------------------------F----
E2ABP4_CAMFO/74-684----------GTI--------------TTIEKR------------------------------------------F----
E2BXT3_HARSA/74-652----------GTI--------------TTIEKR------------------------------------------F----
E2RSD4_CANFA/44-638----------STI--------------TQIERR------------------------------------------F----
E4X1Y1_OIKDI/36-601----------GVS--------------SSIEQR------------------------------------------Y----
E5S461_TRISP/81-717----------SVL--------------STLERR------------------------------------------F----
E5SC63_TRISP/58-613----------NSI--------------TTLESR------------------------------------------F----
E7F5H8_DANRE/27-603----------SVL--------------TTLERR------------------------------------------F----
E9G6H1_DAPPU/44-620----------VCV--------------STIERR------------------------------------------Y----
E9GGR7_DAPPU/1-573----------SVL--------------TTIEKL------------------------------------------F----
E9GTG7_DAPPU/37-616----------ATL--------------TTLEKQ------------------------------------------F----
E9INY6_SOLIN/50-616----------VTG--------------STIARR------------------------------------------F----
F1NQ62_CHICK/86-676----------SSI--------------TQIERR------------------------------------------F----
F1Q3Z3_CANFA/92-650----------LSI--------------DTFQKA------------------------------------------Y----
F1Q9B1_DANRE/21-583----------STI--------------TTIERR------------------------------------------Y----
F1QBF7_DANRE/27-591----------ASI--------------TTIEKR------------------------------------------Y----
F1RU07_PIG/132-741----------SVI--------------TTIERR------------------------------------------Y----
F1SQZ6_PIG/21-597----------SML--------------TQIERQ------------------------------------------F----
F2U1E1_SALR5/138-886----------ISI--------------TSITRQ------------------------------------------L----
F4WH08_ACREC/51-617----------VTG--------------STIARR------------------------------------------F----
F4X6X3_ACREC/89-670----------VVI--------------TTIERR------------------------------------------F----
F6RPB8_HORSE/50-647----------GSI--------------STVEKR------------------------------------------F----
F6SHC6_MONDO/129-692----------ISI--------------STIEKR------------------------------------------Y----
F6SHD5_MONDO/83-645----------ISI--------------STIEKR------------------------------------------Y----
F6SNL4_XENTR/97-651----------TVI--------------TTIERR------------------------------------------F----
F6TIF0_CIOIN/25-583----------VSI--------------TTLEKR------------------------------------------F----
F6UFC7_MONDO/37-638----------SSI--------------STIEKR------------------------------------------F----
F6UHW9_MACMU/29-621----------SSI--------------IHIERR------------------------------------------F----
F6Z8W3_MONDO/36-628----------SSI--------------TQIERR------------------------------------------F----
F6ZVK8_CIOIN/40-603----------SVL--------------TSIEKR------------------------------------------F----
F6ZXK1_MONDO/21-593----------SIL--------------TQLERQ------------------------------------------F----
F7ACE2_CIOIN/22-602----------INV--------------STLETR------------------------------------------F----
F7B262_CIOIN/35-639----------SAL--------------TSIERR------------------------------------------Y----
F7B8B6_XENTR/14-595----------SSI--------------TQIERR------------------------------------------F----
F7BQX3_MONDO/39-601----------SSL--------------TTIEKR------------------------------------------F----
F7CCC4_MACMU/114-672----------VSI--------------GNVQRE------------------------------------------Y----
F7D880_XENTR/45-603----------VVI--------------STIEKR------------------------------------------F----
F7DID9_ORNAN/85-636----------TVI--------------TSLERR------------------------------------------F----
F7E5T7_MACMU/28-625----------SSI--------------STVEKR------------------------------------------F----
F7G693_MONDO/107-666----------TVI--------------TSIERR------------------------------------------Y----
F7IM14_CALJA/33-639----------SSL--------------TTIEKH------------------------------------------F----
G1KDM6_ANOCA/110-669----------TVI--------------TSIERR------------------------------------------F----
G1KJC8_ANOCA/62-624----------SSL--------------STIEKR------------------------------------------F----
G1KTZ7_ANOCA/42-626----------SML--------------TQIERR------------------------------------------F----
G1KTZ8_ANOCA/2-594----------SMM--------------TQIERR------------------------------------------F----
G1KU16_ANOCA/44-637----------STI--------------TQIEKR------------------------------------------F----
G1LS58_AILME/38-599----------LSI--------------DTFEKE------------------------------------------S----
G1MG68_AILME/111-671----------TVI--------------TSIERR------------------------------------------Y----
G1NLJ6_MELGA/21-604----------SMY--------------TQIEKQ------------------------------------------F----
G1P1F0_MYOLU/56-614----------VSL--------------NTFQRR------------------------------------------S----
G1PCN2_MYOLU/58-650----------SSI--------------STVEKR------------------------------------------F----
G1PGX5_MYOLU/20-594----------SML--------------TQIERQ------------------------------------------F----
G1QXW4_NOMLE/21-597----------SML--------------TQIERQ------------------------------------------F----
G1RKH9_NOMLE/129-734----------SVI--------------TTIERR------------------------------------------Y----
G1SJM2_RABIT/94-653----------LSI--------------SNFQKN------------------------------------------Y----
G1T6Y7_RABIT/47-646----------SSI--------------STVEKR------------------------------------------F----
G1T960_RABIT/29-621----------SSI--------------TQIERR------------------------------------------F----
G3NAV0_GASAC/31-610----------SSI--------------STIERR------------------------------------------Y----
G3NHS2_GASAC/34-602----------STI--------------STIEKR------------------------------------------Y----
G3P9F5_GASAC/17-593----------SVL--------------TTLERR------------------------------------------F----
G3Q5Q6_GASAC/29-624----------SSI--------------TQIERR------------------------------------------F----
G3RFJ2_GORGO/108-666----------VSI--------------GDFQKE------------------------------------------Y----
G3RW09_GORGO/3-600----------ISS--------------TQIERR------------------------------------------F----
G3THK1_LOXAF/27-590----------LSI--------------DHFQKV------------------------------------------Y----
G3VZ81_SARHA/19-591----------ISI--------------STIEKR------------------------------------------Y----
G3WV28_SARHA/37-630----------SSI--------------THIERR------------------------------------------F----
G3WVX8_SARHA/40-630----------SSI--------------THIERR------------------------------------------F----
G3WWQ7_SARHA/43-640----------STI--------------TQIERR------------------------------------------F----
G4VAF3_SCHMA/62-701----------SQV--------------TTLEKR------------------------------------------F----
G5BJ45_HETGA/1-591----------TAI--------------TQIERR------------------------------------------F----
G6D5X6_DANPL/120-675----------SVI--------------TTIEKR------------------------------------------F----
G6DHQ3_DANPL/73-638----------SVT--------------TTVEKL------------------------------------------F----
H0VSG6_CAVPO/50-647----------SSI--------------STVEKR------------------------------------------F----
H0VU31_CAVPO/105-653----------TVI--------------TSIERR------------------------------------------Y----
H0W6D9_CAVPO/29-617----------TAI--------------THIERR------------------------------------------F----
H0WRN3_OTOGA/1-607----------SSL--------------TTIEKR------------------------------------------F----
H0X513_OTOGA/48-645----------SSI--------------STVEKR------------------------------------------F----
H0XUZ7_OTOGA/29-621----------SSI--------------TQIERR------------------------------------------F----
H0ZQ14_TAEGU/44-636----------STI--------------TQIERR------------------------------------------F----
H2L5X8_ORYLA/7-609----------SII--------------STIERR------------------------------------------Y----
H2LW99_ORYLA/3-593----------STI--------------TQLERR------------------------------------------F----
H2LWK4_ORYLA/34-623----------SVL--------------TTLERR------------------------------------------F----
H2LXV9_ORYLA/4-606----------SSI--------------TQIERR------------------------------------------F----
H2ME20_ORYLA/33-598----------SSI--------------TTIERR------------------------------------------Y----
H2NP86_PONAB/41-622----------SVL--------------TTLERR------------------------------------------F----
H2SCH0_TAKRU/44-642----------SSI--------------TQIERR------------------------------------------F----
H2SCH1_TAKRU/29-627----------SSI--------------TQIERR------------------------------------------F----
H2SCH5_TAKRU/21-605----------SSI--------------TQIERH------------------------------------------F----
H2SN38_TAKRU/26-590----------SSI--------------STIERR------------------------------------------Y----
H2T5W9_TAKRU/22-602----------SVL--------------TTLERR------------------------------------------F----
H2TWS2_TAKRU/7-592----------SVI--------------TTIEKR------------------------------------------Y----
H2UWX7_TAKRU/9-600----------STI--------------TQLERR------------------------------------------F----
H2UZN6_TAKRU/20-610----------SII--------------TTIERR------------------------------------------Y----
H2V2U5_TAKRU/20-610----------STI--------------TQLERR------------------------------------------F----
H2YEL4_CIOSA/27-585----------VSI--------------TTLEKR------------------------------------------F----
H2YTS0_CIOSA/2-575----------SVL--------------NYITKR------------------------------------------F----
H2YZB0_CIOSA/24-616----------INV--------------STLERR------------------------------------------F----
H2Z037_CIOSA/5-589----------TNI--------------STLERR------------------------------------------F----
H2Z5W5_CIOSA/21-582----------ISI--------------TSIERR------------------------------------------F----
H2ZCE8_CIOSA/9-615----------SAL--------------TSIERR------------------------------------------Y----
H3ABP2_LATCH/6-582----------SSV--------------STIEKR------------------------------------------F----
H3AUF3_LATCH/60-624----------ISI--------------STIEKR------------------------------------------Y----
H3AXL7_LATCH/47-642----------SSI--------------TQIERR------------------------------------------F----
H3B0P1_LATCH/42-638----------SSI--------------TQIERR------------------------------------------F----
H3BW91_TETNG/35-616----------SSI--------------STIERR------------------------------------------Y----
H3DMV0_TETNG/12-567----------SII--------------TTIERR------------------------------------------Y----
H3DSJ9_PRIPA/41-714----------SAI--------------QNIEKQ------------------------------------------F----
H3FQI4_PRIPA/22-588----------GML--------------TTLEKR------------------------------------------F----
H9GXA5_DANRE/22-598----------STI--------------TQIERR------------------------------------------F----
H9GYB5_DANRE/9-610----------SSV--------------TQIERR------------------------------------------F----
H9J2D0_BOMMO/122-735----------SVI--------------TTIEKR------------------------------------------F----
A0A088AHC0_APIME/72-668----------GTI--------------TTIEKR------------------------------------------F----
A0A088AHB9_APIME/23-630----------VTL--------------TTLEKR------------------------------------------F----
I1FF21_AMPQE/83-628----------VVL--------------STIQNR------------------------------------------Y----
I1FF22_AMPQE/53-616----------VNL--------------SSISKR------------------------------------------Y----
I3J8K7_ORENI/27-592----------SSI--------------STIERR------------------------------------------Y----
I3JPB0_ORENI/4-598----------STI--------------TQLERR------------------------------------------F----
I3JU44_ORENI/3-598----------SSI--------------TQIERR------------------------------------------F----
I3JU45_ORENI/36-628----------SSI--------------TQIERR------------------------------------------F----
I3KD69_ORENI/19-600----------SVL--------------TTLERR------------------------------------------F----
I3KT50_ORENI/9-572----------STI--------------STIERR------------------------------------------Y----
I3MXD4_SPETR/104-661----------TVI--------------TSIERR------------------------------------------F----
I3MZY5_SPETR/101-669----------ISI--------------STIEKR------------------------------------------Y----
J9JWU7_ACYPI/65-667----------SVI--------------TTLEKL------------------------------------------F----
J9K6L3_ACYPI/47-601----------GTL--------------TTMEKR------------------------------------------F----
K1PJB3_CRAGI/119-693----------SVL--------------TTIEKR------------------------------------------F----
K1Q6Z9_CRAGI/63-616----------AGL--------------PAIEKH------------------------------------------F----
K1QB38_CRAGI/29-589----------VNT--------------TSVERR------------------------------------------F----
K1QD74_CRAGI/43-615----------IAL--------------TTLERQ------------------------------------------Y----
K7IWN1_NASVI/25-629----------VSL--------------TTLEKR------------------------------------------F----
K7IWN2_NASVI/77-675----------GTI--------------TTIEKR------------------------------------------F----
K7J562_NASVI/209-820----------SVI--------------TTIEKR------------------------------------------F----
K7J8P8_NASVI/104-674----------SVI--------------TTIEKL------------------------------------------F----
L5JNP4_PTEAL/43-638----------SSI--------------STVEKR------------------------------------------F----
L7N264_MOUSE/21-597----------SML--------------LQIERQ------------------------------------------F----
L9L9W1_TUPCH/47-739----------SSI--------------STVEKR------------------------------------------F----
M3WPK8_FELCA/38-596----------LSI--------------DTFQKE------------------------------------------N----
M3XXF4_MUSPF/103-666----------ISI--------------STIEKR------------------------------------------Y----
M3XXG5_MUSPF/93-653----------LSM--------------ETFVKD------------------------------------------S----
M3YCV1_MUSPF/50-648----------SSI--------------STVEKR------------------------------------------F----
M3ZWM7_XIPMA/18-618----------SSI--------------TQIERR------------------------------------------F----
M3ZXE4_XIPMA/24-582----------SSI--------------STIERR------------------------------------------Y----
M4ABK2_XIPMA/34-613----------SVL--------------TTLERR------------------------------------------F----
SO1A3_RAT/21-597----------SML--------------TQIERQ------------------------------------------F----
SO2A1_RAT/33-602----------SSL--------------TTIEKR------------------------------------------F----
Q16RK9_AEDAE/100-701----------GTI--------------TTLEKR------------------------------------------Y----
Q16RL0_AEDAE/55-631----------GTL--------------TTVEKS------------------------------------------I----
Q171D5_AEDAE/25-762----------ITL--------------TTLEKR------------------------------------------F----
Q28XS7_DROPS/47-608----------GTL--------------TTLEKR------------------------------------------Y----
A0A0A6YYJ9_HUMAN/29-621----------ISI--------------TQIERR------------------------------------------F----
SO4C1_RAT/102-664----------ISI--------------STIEKR------------------------------------------Y----
Q7Q103_ANOGA/25-768----------ITL--------------TTLEKR------------------------------------------F----
Q7Q551_ANOGA/114-716----------GTI--------------TTLEKR------------------------------------------Y----
SO2B1_MOUSE/42-636----------SSI--------------STVEKR------------------------------------------F----
Q8C0X7_MOUSE/95-654----------MTL--------------NIYQVQ------------------------------------------F----
SO1A5_MOUSE/21-597----------SML--------------TQIERQ------------------------------------------F----
Q93550_CAEEL/18-586----------GML--------------TTLEKR------------------------------------------F----
SO4A1_HUMAN/104-663----------TVI--------------TSLERR------------------------------------------Y----
SO1A6_MOUSE/21-597----------TML--------------TQLERQ------------------------------------------F----
SO4A1_RAT/103-665----------TVI--------------TSIERR------------------------------------------F----
SO1C1_RAT/44-642----------STI--------------TQIERR------------------------------------------F----
SO1B2_MOUSE/27-617----------SSI--------------TQIERR------------------------------------------F----
SO1B2_RAT/29-615----------SSI--------------TQIERR------------------------------------------F----
Q9VK84_DROME/36-684----------VTL--------------TTLEKR------------------------------------------F----
Q9VVH9_DROME/175-754----------SVI--------------TTIEKL------------------------------------------F----
Q9W269_DROME/112-731----------GTI--------------TTIEKR------------------------------------------F----
Q9W270_DROME/95-661----------GTI--------------TTMEKR------------------------------------------F----
Q9W271_DROME/67-626----------GTI--------------TTLEKR------------------------------------------Y----
Q9XWC5_CAEEL/49-620----------VGL--------------STLERR------------------------------------------F----
R4GBU6_ANOCA/260-819----------VSI--------------STIEKR------------------------------------------Y----
T1ER69_HELRO/33-610----------TIL--------------ATLENN------------------------------------------F----
T1G9I5_HELRO/71-663----------VCL--------------STLERR------------------------------------------F----
T1HLF3_RHOPR/50-617----------GII--------------TTLEKR------------------------------------------Y----
T1HLL5_RHOPR/20-673----------STL--------------TTIERR------------------------------------------F----
T1HYS5_RHOPR/25-590----------SVI--------------TTIEKL------------------------------------------F----
T1I8L4_RHOPR/19-568----------GTI--------------STLEKR------------------------------------------F----
T1IDL3_RHOPR/22-585----------GTI--------------STIEKR------------------------------------------F----
T1IV13_STRMM/34-600----------ATL--------------TTIESH------------------------------------------F----
T1J381_STRMM/107-721----------SVL--------------TTIEKL------------------------------------------F----
T1J4Q6_STRMM/53-601----------SIL--------------STVERR------------------------------------------F----
T1J9S9_STRMM/138-752----------SVI--------------TTIEKR------------------------------------------F----
T1K555_TETUR/46-593----------GVM--------------STLEKR------------------------------------------Y----
U1NEN2_ASCSU/27-606----------GIL--------------TNLERR------------------------------------------F----
U1NQ20_ASCSU/50-610----------TSI--------------SSLEKR------------------------------------------F----
U3I6L4_ANAPL/103-660----------TVI--------------TSIERR------------------------------------------F----
U3I6Y8_ANAPL/7-588----------SSI--------------STIERR------------------------------------------Y----
U3K039_FICAL/40-624----------SMY--------------TQIEKQ------------------------------------------F----
U3K045_FICAL/38-630----------SMS--------------SQIERR------------------------------------------F----
U3KFS6_FICAL/31-593----------SSL--------------TTIEKR------------------------------------------F----
V8NPM0_OPHHA/58-605----------VSI--------------STIEKR------------------------------------------Y----
W4WD24_ATTCE/23-636----------VTL--------------TTLEKR------------------------------------------F----
W4XLX7_STRPU/60-699----------ASL--------------STIEQR------------------------------------------F----
W4XQW5_STRPU/59-640----------SAV--------------TSLETR------------------------------------------Y----
W4XVZ6_STRPU/91-689----------AVL--------------TTLEKR------------------------------------------F----
W4Z5F6_STRPU/135-671----------IAV--------------TTIEKR------------------------------------------F----
W4Z5F7_STRPU/78-634----------TVT--------------TTLEQR------------------------------------------F----
W5J7I4_ANODA/56-623----------GTL--------------TTVEKS------------------------------------------L----
W5JBI4_ANODA/130-794----------SVI--------------TTIEKR------------------------------------------F----
W5JW33_ANODA/25-791----------ITL--------------TTLEKR------------------------------------------F----
W5KDH2_ASTMX/31-629----------SSV--------------VQIERR------------------------------------------F----
W5KJ52_ASTMX/32-619----------SVL--------------TTLERR------------------------------------------F----
W5LQU9_ASTMX/27-591----------GSI--------------STIEKR------------------------------------------Y----
W5MDQ5_LEPOC/17-593----------STV--------------TTIEKR------------------------------------------F----
W5MFK3_LEPOC/106-669----------TVI--------------TSIERR------------------------------------------F----
W5MRR1_LEPOC/26-603----------SML--------------STLEKR------------------------------------------F----
W5MRT2_LEPOC/53-615----------ISI--------------STIEKR------------------------------------------Y----
W5MY22_LEPOC/30-602----------SSI--------------STIEKR------------------------------------------Y----
W5NE89_LEPOC/38-625----------STI--------------TQIERR------------------------------------------F----
W5NE95_LEPOC/1-594----------SSI--------------TQIERR------------------------------------------F----
W5NE99_LEPOC/24-615----------SSI--------------TQIERR------------------------------------------F----
W5NEA9_LEPOC/1-598----------STI--------------TQLERR------------------------------------------F----
W5PSU6_SHEEP/93-647----------TVI--------------TSIERR------------------------------------------Y----
W5QAF5_SHEEP/107-670----------LST--------------NSFKKE------------------------------------------N----
W5QGQ1_SHEEP/21-597----------SML--------------TQIERQ------------------------------------------F----
X5LX59_CAEEL/46-677----------SAI--------------SSIERR------------------------------------------F----
X5M903_CAEEL/27-574----------VSI--------------SSIEKR------------------------------------------F----

PF06609

Q8NII4_FUSAU/1-598----------SAL--------------PNILQD------------------------------------------I----
Q9C1B3_FUSSP/1-598----------SAL--------------PNILQD------------------------------------------V----

PF05631

Q9N3A9_CAEEL/1-336----------PKF--------------KSFQRT------------------------------------------Y----
Q9FWD6_ORYSJ/4-357----------PAF--------------NAFKNN------------------------------------------Y----

PF01770

S19A1_HUMAN/23-434----------ITP--------------YLLGPD------------------------------------------K----
Q9EQN9_MOUSE/28-459----------LTP--------------YLLGPD------------------------------------------K----
Q9VK64_DROME/2-395----------VTE--------------YLASDY------------------------------------------G----
Q29L76_DROPS/2-397----------VTE--------------YLAGDY------------------------------------------G----
Q294A5_DROPS/2-414----------HAE--------------ILMSDW------------------------------------------Y----
Q9VGV5_DROME/2-408----------VTE--------------YLLGPW------------------------------------------R----
Q16JT2_AEDAE/2-405----------VVQ--------------FLNGSW------------------------------------------H----
S19A3_HUMAN/10-441----------LIP--------------YLSGPD------------------------------------------K----
Q1LV16_DANRE/4-414----------LTP--------------YLVGP.------------------------------------------K----
Q9VGV6_DROME/2-411----------HAE--------------ILMGEW------------------------------------------Y----
FOLT2_CAEEL/2-394----------MYE--------------YQHTV.------------------------------------------L----
Q28C92_XENTR/10-422----------TAQ--------------YFTGSY------------------------------------------H----
Q7Q5N2_ANOGA/2-422----------VTE--------------FLSGEW------------------------------------------R----
A8BIM9_GIAIC/39-447----------VVP--------------YYID..------------------------------------------N----
A7SN54_NEMVE/6-420----------LTP--------------YLRAPP------------------------------------------K----
S19A3_MOUSE/11-435----------LIP--------------FLSEPS------------------------------------------K----
F1N2M7_BOVIN/23-430----------ITP--------------YLLGPD------------------------------------------K----
F1NVD6_CHICK/32-445----------ITP--------------YLLGHD------------------------------------------K----
F7EDM0_XENTR/76-481----------ITP--------------YLLSPE------------------------------------------R----
H3CDB6_TETNG/12-433----------LFA--------------YLTGPD------------------------------------------K----
S19A1_MOUSE/23-426----------ITP--------------FLLE..------------------------------------------R----

PF00854

PTR7_ARATH/99-532---------------------------------------------------------------------------Q----
F7BBU0_ORNAN/81-472---------------------------------------------------------------------------Y----
PEPT3_CAEEL/82-453---------------------------------------------------------------------------Y----
PEPT1_CAEEL/113-509---------------------------------------------------------------------------Y----
PTR12_ARATH/99-524---------------------------------------------------------------------------E----
S15A1_RABIT/81-472---------------------------------------------------------------------------Y----
PTR30_ARATH/96-518---------------------------------------------------------------------------Y----
PTR2_ARATH/113-544---------------------------------------------------------------------------Y----
DTPA_ECOLI/88-460---------------------------------------------------------------------------L----
DTPD_ECOLI/76-458---------------------------------------------------------------------------M----
DTPC_ECOLI/75-447---------------------------------------------------------------------------M----
PTR2_SCHPO/158-542---------------------------------------------------------------------------Y----
S15A2_HUMAN/111-487---------------------------------------------------------------------------Y----
PTR2_YEAST/155-533---------------------------------------------------------------------------Y----
S15A1_RAT/81-474---------------------------------------------------------------------------Y----
PTR17_ARATH/124-550---------------------------------------------------------------------------Y----
S15A4_RAT/94-517---------------------------------------------------------------------------Y----
DTPT_LACLA/91-474---------------------------------------------------------------------------I----
PEPT2_CAEEL/99-494---------------------------------------------------------------------------Y----
DTPB_ECOLI/81-457---------------------------------------------------------------------------L----
YCLF_BACSU/95-469---------------------------------------------------------------------------I----

PF05978

Q19933_CAEEL/13-169---------------------------------------------------------------------------L----
Q9XV34_CAEEL/12-166---------------------------------------------------------------------------L----
MFS11_MOUSE/14-166---------------------------------------------------------------------------L----
Q8MYL9_CAEEL/14-170---------------------------------------------------------------------------L----
Q965T3_CAEEL/14-170---------------------------------------------------------------------------V----
P91007_CAEEL/16-172---------------------------------------------------------------------------L----
Q9XWR7_CAEEL/37-194---------------------------------------------------------------------------L----
Q19932_CAEEL/14-169---------------------------------------------------------------------------L----
Q21545_CAEEL/14-168---------------------------------------------------------------------------L----
O61865_CAEEL/27-183---------------------------------------------------------------------------L----
Q18251_CAEEL/11-167---------------------------------------------------------------------------L----

PF06813

Q7XGH1_ORYSJ/34-288--------------------------------I------------------------------------------F----
Q9LUF8_ARATH/16-265--------------------------------L------------------------------------------F----
Q8H613_ORYSJ/14-261--------------------------------T------------------------------------------F----
Q94D97_ORYSJ/8-252--------------------------------D------------------------------------------F----
Q9M8M1_ARATH/13-260--------------------------------T------------------------------------------F----
Q9ZUV4_ARATH/17-262--------------------------------L------------------------------------------F----
O80960_ARATH/21-266--------------------------------M------------------------------------------F----
Q8H132_ARATH/7-253--------------------------------D------------------------------------------F----
Q9SLF1_ARATH/14-260--------------------------------T------------------------------------------F----
NFD4_ARATH/43-286--------------------------------D------------------------------------------F----
F4J4R8_ARATH/23-272--------------------------------D------------------------------------------F----
Q9S7R2_ARATH/16-263--------------------------------L------------------------------------------F----

PF07672

Q8EUQ6_MYCPE/191-477---------------------------------------------------------------------------F----
Y077_MYCPN/209-467---------------------------------------------------------------------------F----
Q8EVP4_MYCPE/172-441---------------------------------------------------------------------------L----
Y076_MYCPN/210-484---------------------------------------------------------------------------F----
Q98PH4_MYCPU/154-430---------------------------------------------------------------------------Y----
Q7NAK7_MYCGA/200-455---------------------------------------------------------------------------F----

PF03219

TLC2_ARATH/88-571----------LFN--------------YTILRD-----------------------------------------------
TLC1_CHLTR/2-492----------SFN--------------YTILRD-----------------------------------------------
Q6MEN4_PARUW/1-484----------CFN--------------YSILRN-----------------------------------------------
Q6MBI2_PARUW/1-474----------IIV--------------YHTLKD-----------------------------------------------
Q6MEN5_PARUW/4-499----------SFD--------------YNILRT-----------------------------------------------
Q6MEM5_PARUW/2-491----------SFN--------------YTILRD-----------------------------------------------
A5CCG3_ORITB/1-504----------LFN--------------FSALRA-----------------------------------------------
Q1MSG2_LAWIP/9-504----------LFI--------------YRLVRD-----------------------------------------------
C4YY86_9RICK/5-489----------LLN--------------YSTLRS-----------------------------------------------
C4YYY2_9RICK/12-501----------LLN--------------QNLVRS-----------------------------------------------
C4YZB1_9RICK/5-496----------LFN--------------FGALRS-----------------------------------------------
F8KVN2_PARAV/3-490----------SFN--------------YTILRD-----------------------------------------------
TLCE_RICPR/7-496----------LFN--------------QNILRI-----------------------------------------------
TLC2_CHLTR/2-500----------GVN--------------YALLKT-----------------------------------------------
TLCD_RICPR/14-503----------LFI--------------QNLIRA-----------------------------------------------

PF01733

ENT1_ARATH/167-450----------AGE--------------------------------------------------------------M----
S29A1_RAT/144-455----------AGV--------------------------------------------------------------L----
S29A2_HUMAN/131-454----------LGT--------------------------------------------------------------M----
S29A1_HUMAN/144-454----------AGL--------------------------------------------------------------L----
FUN26_YEAST/180-510----------ANV--------------------------------------------------------------F----
Q19495_CAEEL/137-426----------FAD--------------------------------------------------------------F----
Q21145_CAEEL/434-723----------ASP--------------------------------------------------------------F----

PF03239

FTH1_YEAST/8-404----------LTI--------------------------------------------------------------V----
EFEU_BACSU/9-395----------IQL--------------------------------------------------------------N----
Q9Y8Z4_AERPE/4-268----------IML--------------------------------------------------------------L----
Y964_SYNY3/6-291----------LAC--------------------------------------------------------------L----
FIP1_SCHPO/7-320----------MSF--------------------------------------------------------------I----
EFEU_ECOLI/1-276----------ASY--------------------------------------------------------------L----
O83937_TREPA/14-362----------RAS--------------------------------------------------------------A----
Q9ZC51_YERPE/156-557----------QAH--------------------------------------------------------------Y----
Q9RKQ1_STRCO/1-274----------IAY--------------------------------------------------------------L----
Q9ZDD8_RICPR/1-278----------LAV--------------------------------------------------------------T----
FTR1_YEAST/7-321----------LSF--------------------------------------------------------------L----
Y154_ARCFU/4-266----------VAY--------------------------------------------------------------L----
Q9WYP8_THEMA/2-266----------LAY--------------------------------------------------------------L----

PF03209

P73827_SYNY3/40-466--A-------------------------------------------------------------------------VLPW
PUCC_RHOS4/51-454--K-------------------------------------------------------------------------VPAS
BCH2_RHOCB/28-417--A-------------------------------------------------------------------------LPAV
D5AMI6_RHOCB/54-460--A-------------------------------------------------------------------------VPAS
D5ANS1_RHOCB/51-456--G-------------------------------------------------------------------------VPAL
G3XCS5_PROMA/1-413--A-------------------------------------------------------------------------FPAI
I0HT76_RUBGI/55-465--G-------------------------------------------------------------------------VPAS
Q3J171_RHOS4/51-459--A-------------------------------------------------------------------------VPAT
Q3J183_RHOS4/28-414--A-------------------------------------------------------------------------LPAV

PF13347

Q2G9N1_NOVAD/15-450..G-------------------------------------------------------------------------MDAR
C4Z9B4_EUBR3/10-441..G-------------------------------------------------------------------------MSSV
Q0AL93_MARMM/20-465..G-------------------------------------------------------------------------ADAA
Q28K27_JANSC/9-401..G-------------------------------------------------------------------------VSLT
E6WJ95_PANSA/12-430..G-------------------------------------------------------------------------LPAI
D2VB35_NAEGR/26-486..C-------------------------------------------------------------------------IEAS
D4LG93_9FIRM/24-452..G-------------------------------------------------------------------------FAAG
Q8I3H5_PLAF7/74-507..G-------------------------------------------------------------------------LRNI
Q026U3_SOLUE/24-465..G-------------------------------------------------------------------------LPGT
A6TPY1_ALKMQ/12-433..Y-------------------------------------------------------------------------IGAA
B1ZS00_OPITP/16-436..R-------------------------------------------------------------------------LNVA
B2GBT3_LACF3/25-466PNK-------------------------------------------------------------------------TANK
R7CNT8_9FIRM/17-438..G-------------------------------------------------------------------------ISMA
D4L2L1_9FIRM/12-431..G-------------------------------------------------------------------------ITAA
C5BVC3_BEUC1/25-453..G-------------------------------------------------------------------------LEPQ
A1SNV8_NOCSJ/14-434..G-------------------------------------------------------------------------ISAI
A6TPY6_ALKMQ/13-436..R-------------------------------------------------------------------------INAA
NLS1_XENTR/40-494..Q-------------------------------------------------------------------------VPPF
A7HQL5_PARL1/12-433..G-------------------------------------------------------------------------VSLA
C3Z8Z9_BRAFL/18-394..Q-------------------------------------------------------------------------MPPL
Q03PA7_LACBA/7-451GAG-------------------------------------------------------------------------TDAK
Q2N8H6_ERYLH/15-453..G-------------------------------------------------------------------------VEAW
D1BWG8_XYLCX/33-459..G-------------------------------------------------------------------------LSAG
Q5YU93_NOCFA/41-478..G-------------------------------------------------------------------------LTAV

PF03092

Q25272_LEIDO/59-606--G-------------------------------------------------------------------------LTGA
B3GVG0_TRYBB/138-667--G-------------------------------------------------------------------------ADAK
Q9UAB8_LEIDO/94-683--G-------------------------------------------------------------------------IDGQ
Q9UAB7_LEIDO/75-654--G-------------------------------------------------------------------------IDVA
Q9UAC0_LEIDO/76-655--G-------------------------------------------------------------------------IDVA
Q9UAC1_LEIDO/75-651--G-------------------------------------------------------------------------IDVA
FBT8_ARATH/98-515--A-------------------------------------------------------------------------LQPS
FBT7_ARATH/30-441--R-------------------------------------------------------------------------VNPS
FBT3_ARATH/61-473--K-------------------------------------------------------------------------IQPS
FBT1_ARATH/137-553--H-------------------------------------------------------------------------LDPA
FBT_SYNY3/46-457--G-------------------------------------------------------------------------LSPA
O68867_SYNE7/38-441--G-------------------------------------------------------------------------LSPA

PF06963

S40A2_ARATH/31-479--P-------------------------------------------------------------------------NSLF
S40A1_ORYSJ/21-450--P-------------------------------------------------------------------------GSLL
S40A1_ARATH/35-483--P-------------------------------------------------------------------------NSLL
A2R421_ASPNC/42-466--P-------------------------------------------------------------------------GTLR
Q5AXY5_EMENI/19-441--P-------------------------------------------------------------------------GTLL
Q8IA95_CAEEL/5-448--.-------------------------------------------------------------------------GGMT
S40A3_ARATH/146-569--P-------------------------------------------------------------------------.SLL
Q0CWF0_ASPTN/44-463--P-------------------------------------------------------------------------GTLL
A0A0D1CCA6_USTMA/82-563--T-------------------------------------------------------------------------NTLL
S40A1_HUMAN/22-531--G-------------------------------------------------------------------------NSLL
S40A1_DANRE/19-522--G-------------------------------------------------------------------------NSLL
A8X2J9_CAEBR/13-461--.-------------------------------------------------------------------------GGMR
A5BT51_VITVI/32-472--P-------------------------------------------------------------------------NSLL
A1CBM9_ASPCL/39-469--Q-------------------------------------------------------------------------DTLL
S40A3_ORYSJ/147-569--P-------------------------------------------------------------------------ASIL
H3DM67_TETNG/10-523--G-------------------------------------------------------------------------RNLL

PF13000

C4R336_PICPG/74-584--.-------------------------------------------------------------------------SNLS
G0WCJ0_NAUDC/17-577--V-------------------------------------------------------------------------KETS
G8BYR1_TETPH/85-660--I-------------------------------------------------------------------------KETT
Q75EB1_ASHGO/51-585--A-------------------------------------------------------------------------KDTS
E7K9I5_YEASA/17-559--A-------------------------------------------------------------------------KETS
Q6CKM4_KLULA/10-515--Q-------------------------------------------------------------------------RQTS
G0VIX6_NAUCC/41-595--A-------------------------------------------------------------------------KETS
H2AY09_KAZAF/18-574--V-------------------------------------------------------------------------KETS
I2H5Y9_TETBL/23-594--A-------------------------------------------------------------------------KETS
G8JR10_ERECY/17-554--A-------------------------------------------------------------------------KDTS
S6E3L5_ZYGB2/13-555--A-------------------------------------------------------------------------KETS
Q6FMM5_CANGA/15-566--A-------------------------------------------------------------------------KETT
C5E2P0_LACTC/16-543--A-------------------------------------------------------------------------RETT
B6ABL4_CRYMR/9-525--.-------------------------------------------------------------------------.RIS
G8ZXV2_TORDC/17-551--A-------------------------------------------------------------------------KDTS
J7RSN7_KAZNA/20-561--A-------------------------------------------------------------------------KQTS

PF03825

YEGT_ECOLI/1-405--G------------------------------------------------------------------------.FSAG
Q9A7U2_CAUCR/1-395--G------------------------------------------------------------------------.FAPW
XAPB_ECOLI/1-407--L------------------------------------------------------------------------HFTGA
NUPG_ECOLI/1-406--L------------------------------------------------------------------------KFDGA

PF12832

C3YMP2_BRAFL/15-420--G-------------------------------------------------------------------------LLAS
B4G7T5_DROPE/37-721--G-------------------------------------------------------------------------LTVE
Q17GA0_AEDAE/15-612--G-------------------------------------------------------------------------LDYK
A7UVG6_ANOGA/15-612--G-------------------------------------------------------------------------LNYY
A7RI07_NEMVE/55-515--G-------------------------------------------------------------------------LNAS
A7SQQ8_NEMVE/56-507--Q-------------------------------------------------------------------------LPAY
Q54G39_DICDI/13-544--E-------------------------------------------------------------------------LKPS
Q55CH3_DICDI/12-488--E-------------------------------------------------------------------------LKPS
B7PL10_IXOSC/11-489--G-------------------------------------------------------------------------VSPA
Q6FB61_ACIAD/7-363--G-------------------------------------------------------------------------FNYK
Q21IX9_SACD2/6-359--G-------------------------------------------------------------------------LTPK
C5BL70_TERTT/3-356--E-------------------------------------------------------------------------FSPA
B3PHF3_CELJU/16-370--D-------------------------------------------------------------------------YSSR
Q3J7E6_NITOC/10-363--G-------------------------------------------------------------------------FAPQ
D3SB25_THISK/4-359--G-------------------------------------------------------------------------FSGS
B8GQD4_THISH/6-360--G-------------------------------------------------------------------------FNPA
A1WY15_HALHL/15-368--G-------------------------------------------------------------------------FSSA
Q2SJE3_HAHCH/6-360--G-------------------------------------------------------------------------FDAL
Q07ZQ8_SHEFN/11-364--G-------------------------------------------------------------------------FNAQ
A3QFN3_SHELP/25-378--G-------------------------------------------------------------------------FDAQ

PF01306

LACY_CITFR/1-412--H-------------------------------------------------------------------------ISKG
RAFB_ECOLX/4-415--G-------------------------------------------------------------------------LSKT
A0A017JVR8_ECOLX/4-411--G-------------------------------------------------------------------------LTGT
LACY_KLEOX/6-416--H-------------------------------------------------------------------------LTKT

PF07690

O17785_CAEEL/33-439--N---------------------------------........................................YSPS
Y2994_MYCTU/18-356--G---------------------------------........................................TPLS
ANTR2_ARATH/137-500--N---------------------------------........................................WSSA
Q19296_CAEEL/16-403--D---------------------------------ISVKGLQS........................FQEAIGVPHSER
A9CFQ9_AGRFC/27-373--G---------------------------------........................................VSLA
O25793_HELPY/8-347--H---------------------------------.......................................SSSPL
Q97XW7_SULSO/20-385--.---------------------------------........................................IYPN
D7GFS1_PROFC/22-419--H---------------------------------........................................APVS
O66589_AQUAE/21-406--G---------------------------------........................................LSGA
Q9I0P8_PSEAE/19-362--A---------------------------------........................................WDRA
MFSD9_HUMAN/49-427--G---------------------------------........................................ASPT
Q97CG2_THEVO/16-347--S---------------------------------........................................NSPI
Q9CF47_LACLA/24-427--H---------------------------------........................................TTAS
Q92RK8_RHIME/23-360--A---------------------------------........................................LDFV
Q8YC70_BRUME/8-339--G---------------------------------........................................YSAS
A0A098UI88_SALET/17-369--I---------------------------------.........................................DLK
Q8NU65_CORGL/19-414--G---------------------------------........................................MSDG
Q9YG70_AERPE/18-417--G---------------------------------........................................ISPV
Q9HLN0_THEAC/12-329--Y---------------------------------............................................
Q8XR21_RALSO/30-433--G---------------------------------ITQSHTCGADV.................SLIAELFTTSCDWRIS
Q7X233_STAAU/33-313--G---------------------------------........................................FTKA
O87836_STRCO/61-422--.---------------------------------........................................WSSG
Q8NNT7_CORGL/10-351--.---------------------------------........................................GSSA
Q92WR7_RHIME/13-355--G---------------------------------........................................WSVT
Q8TZJ0_PYRFU/13-389--K---------------------------------........................................MNRT
O58400_PYRHO/34-380--G---------------------------------........................................GTMF
Q9KRL8_VIBCH/16-353--A---------------------------------........................................VSET
Q9KWU2_SPHSX/13-348--M---------------------------------............................................
A0A090LWD5_STAAU/18-353--S---------------------------------........................................IAVA
Q8Y7M4_LISMO/13-349--N---------------------------------........................................ASLG
NART_STACT/13-344--K---------------------------------........................................ITSS
Q9K646_BACHD/13-358--Q---------------------------------........................................LTDS
YLZ2_SCHPO/48-434--H---------------------------------........................................ASRT
YWOG_BACSU/15-348--G---------------------------------........................................GTES
Q1K517_NEUCR/132-490--N---------------------------------........................................IGYA
O54179_STRCO/33-428--G---------------------------------........................................FALS
Q98B83_RHILO/60-407--G---------------------------------........................................IPVG
A0A027U3K7_ECOLX/39-413--G---------------------------------........................................LSAT
Q9EYN6_SYNPW/18-450--G---------------------------------........................................LTVG
Q9KBG2_BACHD/16-398--Q---------------------------------........................................ISTA
Q986N1_RHILO/24-356--A---------------------------------........................................TSVP
Q93LX8_9ACTN/30-425--G---------------------------------........................................LAPH
Q8KDQ3_CHLTE/9-374--G---------------------------------........................................ASPF
Q9PCL3_XYLFA/32-422--G---------------------------------........................................ASVD
Q9URI1_CANAX/123-512--G---------------------------------........................................IGRV
Q9KRK6_VIBCH/22-366--G---------------------------------........................................VNAG
Q92Y26_RHIME/19-357--A---------------------------------........................................LSLA
Q9RSF5_DEIRA/46-397--G---------------------------------........................................LTPA
LIZ1_SCHPO/36-407--K---------------------------------........................................MHGN
Q97IY3_CLOAB/13-357--N---------------------------------............................................
Q9I008_PSEAE/29-430--A---------------------------------........................................IGHD
Q9HTX1_PSEAE/12-346--H---------------------------------........................................ISAH
Q9KYI2_STRCO/15-371--G---------------------------------........................................LSFS
Q973W8_SULTO/12-335--H---------------------------------........................................APIF
Q18472_CAEEL/18-397--S---------------------------------EMHLVN............................GTMRSIYDYT
Q8ZXX0_PYRAE/10-352--G---------------------------------.........................................GKL
Q9AA55_CAUCR/30-391--G---------------------------------...........................................R
YN42_SCHPO/141-527--H---------------------------------........................................ISLT
Q2FVB9_STAA8/16-376--G---------------------------------........................................MTKP
Q961H2_DROME/54-453--G---------------------------------IDRGS..............................DADKEVEVI
C3SM02_ECOLX/36-398--L---------------------------------.........................................SRS
Q8KCE7_CHLTE/27-390--G---------------------------------........................................IPVS
P95852_SULSF/9-333--N---------------------------------........................................ISIM
O45678_CAEEL/27-403--A---------------------------------........................................WNKT
Q9I5C8_PSEAE/21-369--Q---------------------------------........................................LSSL
O30222_ARCFU/15-357--G---------------------------------........................................VPAA
O54630_HALSA/24-368--.---------------------------------.........................................SFL
Q8TR38_METAC/18-398--G---------------------------------........................................GNAL
Q986D7_RHILO/41-396--H---------------------------------........................................LSNA
O69759_PSEFL/31-392--C---------------------------------........................................LSKY
Q9HLR9_THEAC/6-377--H---------------------------------........................................SNVF
A0A098UKM0_SALET/13-352--Q---------------------------------............................................
O28944_ARCFU/4-328--G---------------------------------........................................ASVF
Q9KKX8_VIBCH/40-383--H---------------------------------........................................ATAT
Q96XQ4_SULTO/9-336--K---------------------------------........................................PTVI
Q8Y6H4_LISMO/13-376--G---------------------------------..........................................RE
O62376_CAEEL/16-394--G---------------------------------HAPL...............................FTNEADAKH
YCUD_SCHPO/89-473--Q---------------------------------............................................
Y1634_MYCTU/25-423--G---------------------------------.........................................GSR
Q9KG75_BACHD/5-341--G---------------------------------........................................ASET
Q7JZE2_DROME/46-458--N---------------------------------........................................PQIQ
Q9KLN6_VIBCH/36-395--.---------------------------------........................................VTLE
Q8P881_XANCP/26-418--G---------------------------------........................................VAAP
H1XFL1_9XANT/19-356--G---------------------------------........................................IQVR
YQ92_SCHPO/20-407--G---------------------------------........................................ISPD
O16697_CAEEL/36-432--T---------------------------------........................................ADVD
A0A0E1EPM8_STRPY/10-353--G---------------------------------.........................................TPT
Q1K880_NEUCR/87-498--G---------------------------------.........................................AAN
Q8XKW0_CLOPE/26-404--N---------------------------------........................................ISAT
O58488_PYRHO/9-354--G---------------------------------........................................ISSN
Q9K9F3_BACHD/14-368--S---------------------------------........................................MDRG
O29880_ARCFU/11-360--G---------------------------------........................................WSKT
Q97C48_THEVO/19-351--H---------------------------------........................................LSLI
Q9Y7D4_ASPTE/35-449--H---------------------------------.........................................SLG
Q97DX4_CLOAB/23-413--N---------------------------------........................................VTAL
Q8MPU6_CAEEL/90-445--.---------------------------------........................................LSET
Q96Y06_SULTO/9-344--G---------------------------------........................................FSNL
A9CIR5_AGRFC/18-359--D---------------------------------..........................................YA
Q8ZWZ3_PYRAE/12-326--R---------------------------------........................................VDPA
A0A027YK03_ECOLX/20-357--H---------------------------------........................................ARPA
G4UU99_NEUT9/52-417--H---------------------------------........................................LEGT
Y2456_MYCTU/16-365--D---------------------------------........................................WDQA
Q19845_CAEEL/45-446--N---------------------------------........................................VTQT
YHJO_BACSU/19-353--N---------------------------------........................................GSIM
Q8ZVF8_PYRAE/4-322--G---------------------------------.......................................VQSET
O58825_PYRHO/10-360--G---------------------------------............................................
A0A029L256_ECOLX/8-341--G---------------------------------........................................ISIP
Q9L8Q4_PSEST/17-351--G---------------------------------........................................ISRQ
Q9XXC1_CAEEL/44-436--V---------------------------------NSNKSLDEINWN................DPDLPLSQRRFAFDTT
Y4007_STRCO/39-376--G---------------------------------........................................STPS
Q8YQ15_NOSS1/8-358--M---------------------------------.........................................SLD
O93992_CANAX/65-459--D---------------------------------........................................VSHE
Q8YWH2_NOSS1/17-343--.---------------------------------........................................INDI
Q9RSM6_DEIRA/32-418--R---------------------------------.........................................GLG
Q9VDS0_DROME/61-500--T---------------------------------CDTSYLTSSSNSSFSISDNQCYVLDESTGTSSECEQFNYVSSFD
Q9I0Y2_PSEAE/28-357--G---------------------------------........................................FQGA
Q92TU0_RHIME/19-421--G---------------------------------D.....................................TYATPD
I3XGH7_RHIFR/18-362--S---------------------------------........................................PSDS
Q8XGP2_RALSO/41-431--H---------------------------------........................................SSEA
YFIS_BACSU/15-364--H---------------------------------........................................ASPL
Q92BU8_LISIN/14-347--G---------------------------------........................................ASHS
Q55937_SYNY3/19-365--.---------------------------------........................................LAGQ
Q9A856_CAUCR/31-388--G---------------------------------........................................WSEH
D6EJD0_STRLI/29-361--T---------------------------------........................................ISDG
Q97BG6_THEVO/17-357--S---------------------------------........................................ISFL
Q9X4X9_9PSED/27-377--G---------------------------------........................................WTRP
Q973J7_SULTO/8-320--G---------------------------------........................................LSPL
O32859_MYCFO/12-364--G---------------------------------.........................................SAL
Q9S243_STRCO/13-352--G---------------------------------........................................ADER
Q8DNZ1_STRR6/13-344--G---------------------------------........................................YSKE
Q97CC5_THEVO/27-411--G---------------------------------WSYSP..............................THLDALAIH
AMPG1_RICPR/10-405--.---------------------------------........................................IALQ
Q9RD97_STRCO/46-435--H---------------------------------........................................TSLS
Q8R8R3_CALS4/20-398--G---------------------------------TYVMFF............................YIDVLKVDPS
O30210_ARCFU/17-354--G---------------------------------........................................IDQT
Q8X120_EXODE/120-524--H---------------------------------.......................................TTNPG
Q9EW91_9ACTN/13-358--G---------------------------------........................................NSGS
Q8MMD6_DROME/21-407--N---------------------------------........................................PNFP
Q8XVV0_RALSO/19-414--G---------------------------------........................................ATST
Q978I2_THEVO/17-358--.---------------------------------........................................KKPL
S22AI_MOUSE/13-363--G---------------------------------........................................LDSV
Q92XG9_RHIME/14-352--G---------------------------------........................................GTAA
Q8P8I8_XANCP/24-370--R---------------------------------.........................................SPL
Q9I1Q7_PSEAE/34-397--Q---------------------------------........................................LTPS
Q9I4J1_PSEAE/26-388--E---------------------------------........................................LDKS
Q9KG22_BACHD/29-373--G---------------------------------.........................................LKT
Q9KYE9_STRCO/8-359--G---------------------------------........................................LGSV
A0A0E1EPV8_STRPY/27-401--Q---------------------------------............................................
O31131_BRELN/13-405--E---------------------------------........................................SAGS
M4U5Z3_9XANT/29-361--H---------------------------------........................................ASAG
Q9ZC50_YERPE/23-431--N---------------------------------........................................VPPT
Q8U366_PYRFU/20-359--H---------------------------------........................................IGKA
Q9C9R9_ARATH/11-379--.---------------------------------........................................TDPT
Q20265_CAEEL/46-427--N---------------------------------........................................FSKF
Q9PCQ0_XYLFA/73-403--A---------------------------------........................................IPAT
Q9I247_PSEAE/4-339--G---------------------------------........................................FGAS
Q9VPX2_DROME/42-442--T---------------------------------AKVE...............................DGPFDWSEP
Q8Y3L9_LISMO/17-359--G---------------------------------........................................FDPS
Q8VUK1_HALHD/23-380--G---------------------------------........................................LDEL
B8FVY2_DESHD/13-347--H---------------------------------........................................VDPT
A9CGF2_AGRFC/30-354--L---------------------------------............................................
O66181_ARTSP/15-353--S---------------------------------........................................LSYQ
Q8KYU7_9PROT/15-359--N---------------------------------........................................LSHG
YJ7D_SCHPO/81-445--H---------------------------------........................................IDGH
Q8XEG8_ECO57/47-408--G---------------------------------........................................LSAT
Q9VY22_DROME/66-470--N---------------------------------LEKACRVNMAYGDEV.........CDALTRRQTANYTLEEETVQ
Q8U4E5_PYRFU/8-345--G---------------------------------........................................ATPV
YFKL_BACSU/12-351--N---------------------------------........................................TDPT
O30679_RHORH/8-341--G---------------------------------........................................VSVP
Q97TH3_CLOAB/16-408--S---------------------------------........................................ANLD
E7KRF3_YEASL/86-451--K---------------------------------..........................................GN
Q9A961_CAUCR/19-356--D---------------------------------............................................
Q97TH7_CLOAB/19-357--S---------------------------------........................................ISVS
A0A0D6HIB6_STAAU/12-398--N---------------------------------.........................................AGN
Q9VPD9_DROME/28-441--G---------------------------------.......................................NRVLL
Q8PVU8_METMA/11-346--K---------------------------------........................................TTSH
F6MF49_STAAU/18-410--N---------------------------------........................................INES
Q97FI4_CLOAB/17-361--K---------------------------------........................................FSMA
Q8KR58_ESCFE/20-359--S---------------------------------............................................
Q8NLD6_CORGL/19-353--G---------------------------------........................................VSES
Q9LAA0_AERHY/27-362--D---------------------------------........................................VSPT
O06742_BACIU/18-364--H---------------------------------........................................LSQF
Q9FCG1_STRCO/24-364--G---------------------------------........................................YSAS
O94019_CANAX/86-529--G---------------------------------........................................ISYD
MOT14_MOUSE/42-459--H---------------------------------........................................QSRG
Q92V77_RHIME/8-347--T---------------------------------.........................................TIP
Q9Y7E0_ASPTE/42-435--D---------------------------------........................................MTVE
Q9I431_PSEAE/11-401--G---------------------------------........................................ASVA
O76837_CAEEL/25-400--.---------------------------------........................................VISE
Q96ZI2_SULTO/36-365--N---------------------------------........................................FSES
Q7BQD2_PSEST/7-367--G---------------------------------........................................WSGA
Q94886_DROME/14-423--A---------------------------------ALAEMNER.......................FSLERWFLDWANI

PF00083

GTR4_MOUSE/27-483--T.WLGRQGPGGPDSI........................................................PQGTLTT
GTR1_MOUSE/14-467--T.WNHRYGEPIPS............................................................TTLTT
QUTD_EMENI/24-490--N.WESLNTDLIS..................................................................
ITR2_YEAST/112-569--K.VLTYGE.KE...................................................................
SNF3_YEAST/100-556--V.APNHDSFTAQ..................................................................
GALP_ECOLI/18-451--F.QITSHT.QE...................................................................
HXT5_YEAST/89-549--G.STRANGTTYL...............................................................SDV
GTR3_MOUSE/13-465--T.LEERLEDLPSE............................................................GLLTA
HXT9_YEAST/64-526--G.QKNDKGTYYL...............................................................SKV
HXT8_YEAST/69-530--GNYSHSKNTYYL...............................................................SNV
HXT6_YEAST/68-528--G.MKHKDGTNYL...............................................................SKV
GTR3_CHICK/14-464--T.LSQRSGETISP............................................................ELLTS
GTR5_HUMAN/20-475--T.YYGRTGEFMED............................................................FPLTL
HXT13_YEAST/60-521--G.SYKHSTGEYY..............................................................LSNV
YB91_YEAST/27-485--A.PDENISYDDTWVGQHG..................................................LKQCIALTDS
PROP_ECOLI/25-453--G.ADPSVQMVAA..................................................................
JEN1_YEAST/125-563--C.VSVSVAPLAELY...........................................................DRPTK
GIT1_YEAST/43-466--Y.GKKNYSSKVS..................................................................
GTR2_MOUSE/13-498--V.LGVPLDDRKAAINYDVNGTDTPLTVTPA...........................YTTPAPWDEEETEGSAHIVTM
HXT2_YEAST/59-519--G.QMKSDGTYYL...............................................................SDV
XYLE_ECOLI/13-478--P.QNLSESAANS..................................................................
LACP_KLULA/75-529--H.LDINSSSG....................................................................
STP1_ARATH/26-489--F.PSVYRKQQEDASTN......................................................QYCQYDSP
MAL31_YEAST/102-561--G.SLNSNTGDYE..............................................................ISVS
QAY_NEUCR/24-494--D.FASYT..PGA...............................................................LAL
GLF_ZYMMO/13-469--I.APRHLSATA................................................................AAS
STL1_YEAST/30-488--P.ATKENGDHDR..............................................................HATV
ARAE_ECOLI/25-461--F.VLTSR..LQE..................................................................
GAL2_YEAST/74-534--G.MKHKDGTHYL...............................................................SNV
A4I0Q6_LEIIN/5-442--G.FSEHSWQYA...................................................................
A4I8N6_LEIIN/77-573--Q.LYNAKKSCETLTAAKCRWFNASTYVSNTTYGEVCGWADRTTCFLKYSDEAGCLSDSACKWSYSANTCGNQVGYSSI
Q38AB8_TRYB2/39-501--S.LFKTTEACKAVGSYGCEWKDTEVCSWKK...........................ECDSDSDGVNPCESLIGYSSL
Q38AB9_TRYB2/39-500--K.FTTEVA.CGGAKIYGCKWSGTTCKFENP...........................KCSEGSDPSDSCKNEVAYTSV

PF11700

AT221_ASPNC/30-582--GVLLSDKKTPCSATWSSLESTSPSGTWNTIFDATAFTKP..........................GSPRTS.QCIIYI
AT221_ASPOR/20-571--GVLLSDKVTPCQATWKAPKQLSPHETLSQTLINALRYGR..........................DVPGAS.QCVVYI
AT222_ASPTN/24-571--GVLLADKTTPCSATWKTPQGTSPTLSADTTGL....WSS..........................QAPRTS.QCIVHI
AT221_EMENI/24-564--GVLLSDKTTPCTAIWKTPESSNTS............WQN..........................SSPAAAGQCIVYI
AT221_ASPFU/24-580--GVLFSDKVTPCSATLNGPSRMSIQARWTLSSRYDA..............................GRPTVANQCVVYI
AT222_ASPCL/24-579--GVLLSDKVTPCSASWNGTETTARTHGISPPW.....YGI..........................NATPGTSQCVVYI
AT221_PENCW/20-562--GVLLSDKTTPCSATWRPP........LPPPGSDAPVYLP..........................QVSDGG.QCIIYF
ATG22_COCIM/35-567--GVLLSDKKTPCSASWPTAPTAYAAADATA....................................SPRVGPPQCVIYV
AT222_PHANO/72-634--GVLLSDRTTPCKAPRPITPSFSASSFEA........LLR..........................PNPEKG.QCVVHI
AT222_SCLS1/72-619--GVLLSDPTQPCGSSSTHLPPG...............LHP..........................GSAKDS.QCVIYL
ATG22_NEUCR/155-689--GVLLSDRSKPCGSSSDKHTTSAEG................................................QCVVYV
AT222_PENCW/33-580--GT.LQTSRLPCVGPSAGNSTNATEHG..............................................QCVVPV
AT222_ASPOR/30-578--GTFKSSHL.PCVGPGSPSTSVNGTAPAM........LRR..........................DEAEND.QCVVGL
AT222_EMENI/31-576--GFLSSSH.LPCVGPDAPPAAGNGTAPANE...........................................ACVVPL
ATG22_YARLI/6-582--AVLADDHSQPCDSPPVPFPGDPGVPTDPGIPPNNSLSSSVPWFLRANEIQLLESPDTVHTMKDHKAKPTQP.TCVIKF
ATG22_CANGA/31-527--GVQLDDHNAPCSTSSSD.......................................................KCVLGL
ATG22_VANPO/27-511--GVTLEDHSVHCTADHD........................................................KCVLGL
ATG22_KLULA/17-487--GVKLDDHSLRCEVNDD........................................................KCVLPM
A9WGR7_CHLAA/9-439--..NAADA.................................................................NGFVYP
A4X7E0_SALTO/18-457--......QAAGCELGAD........................................................SCVGYV
A6H0A9_FLAPJ/7-445--GN.......................................................................NVVYI
ATG22_CRYNJ/1-531--GNIPANHFGTCDGKA.........................................................LQSSDP
ATG22_SCHPO/13-525--GFLRTDHTIPCSLYPEE.......................................................PCSLNI
A7EQB6_SCLS1/56-534--PNILPLGSAPCGDDT.........................................................PCHVFW
A5DD56_PICGU/47-524--GWIKGKRNVSCSDDPNG.......................................................LCVVSF
A0A0D1E381_USTMA/59-561--ATNL..GAGQCGQDGQN.......................................................DCRLLF
Q0TYS2_PHANO/43-505--GD......................................................................AEALEF
Q0CF56_ASPTN/43-493--GD......................................................................ADGLVF
Q0CXZ2_ASPTN/50-478--GG........................................................................TLVF
Q0U0L9_PHANO/44-456--GH.IPGTNKPCAKRGVI.......................................................RCVVPF
A1CD46_ASPCL/43-518--GH.EEGSNKPCPRRGTNI......................................................SCLVKF
ATG22_CANAL/39-496--GK..TKMNQPCGTQGN........................................................DCYVKF
A3LP71_PICST/32-502--G..RNSKGGRCERRGN........................................................DCYIDF
Q75EJ9_ASHGO/58-558--GHPKGHPAAHCRPRGD........................................................DCYIYV
Q6CKN0_KLULA/64-544--GH.PKGSSGPCLATGD........................................................DCYVTF

PF06779

Q986E3_RHILO/34-394--H-------------------------------------------------------------------------LSPA
Q89HQ1_BRADU/48-412--W-------------------------------------------------------------------------FSAS
A9CI18_AGRFC/23-387--P-------------------------------------------------------------------------LSAG
Q88ED9_PSEPK/14-373--Q-------------------------------------------------------------------------FDLT
Q8Y185_RALSO/36-399--S-------------------------------------------------------------------------VTLG
Q9I3T2_PSEAE/20-380--Q-------------------------------------------------------------------------LDLT
Q89X18_BRADU/63-426--G-------------------------------------------------------------------------WSYS
Q92UK2_RHIME/1-365--G-------------------------------------------------------------------------LSPA
YJIJ_ECOLI/23-381--S-------------------------------------------------------------------------FSFS
Q8ZJZ6_SALTY/23-379--Q-------------------------------------------------------------------------LTFN
Q9PGN0_XYLFA/26-385--Q-------------------------------------------------------------------------FTFS

PF05977

Q92LE2_RHIME/11-531--S-------------------------------------------------------------------------ASDL
Q98HB4_RHILO/11-532--A-------------------------------------------------------------------------TSPY
Q92Y88_RHIME/8-530--S-------------------------------------------------------------------------AAPA
A9CFW7_AGRFC/8-530--S-------------------------------------------------------------------------ASPA
Q9HYE1_PSEAE/25-549--H-------------------------------------------------------------------------ASPL
Q989L4_RHILO/31-551--S-------------------------------------------------------------------------TSDV
Q92SW7_RHIME/14-535--S-------------------------------------------------------------------------QSVN
Q989T8_RHILO/11-532--S-------------------------------------------------------------------------TSDV
Q9I0E1_PSEAE/6-529--S-------------------------------------------------------------------------ASPL

PF03137

Q924H6_RAT/144-701--Y-------------------------------------------------------------------------LSHP
A0NEW4_ANOGA/55-618--Q-------------------------------------------------------------------------ISSR
A7S331_NEMVE/27-582--G-------------------------------------------------------------------------YTSL
A7S539_NEMVE/32-576--G-------------------------------------------------------------------------YSSS
A7S542_NEMVE/18-557--G-------------------------------------------------------------------------YSSS
A7SHZ4_NEMVE/19-550--Y-------------------------------------------------------------------------LKTS
A7SQZ6_NEMVE/18-584--S-------------------------------------------------------------------------LSSL
A7SWE4_NEMVE/55-622--G-------------------------------------------------------------------------FNSK
A7SX54_NEMVE/31-599--K-------------------------------------------------------------------------LSSK
A8P8W3_BRUMA/81-731--Q-------------------------------------------------------------------------FNSS
A8PR64_BRUMA/26-571--G-------------------------------------------------------------------------ISSK
B0WEE2_CULQU/64-642--Q-------------------------------------------------------------------------ISSK
B0WEE5_CULQU/105-708--K-------------------------------------------------------------------------IPSR
B0WGA7_CULQU/25-763--K-------------------------------------------------------------------------IPSS
B3DJD4_DANRE/48-631--D-------------------------------------------------------------------------IPSY
B3MGJ1_DROAN/65-620--K-------------------------------------------------------------------------IPTK
B3MGJ2_DROAN/51-611--N-------------------------------------------------------------------------IPTK
B3MNT7_DROAN/36-684--K-------------------------------------------------------------------------IPSQ
B3RLK5_TRIAD/8-577--E-------------------------------------------------------------------------LRST
B3RLK6_TRIAD/21-588--E-------------------------------------------------------------------------LRST
B3RLK7_TRIAD/29-614--E-------------------------------------------------------------------------LRST
B3RLK8_TRIAD/27-595--N-------------------------------------------------------------------------MTSA
B3RLL2_TRIAD/176-721--N-------------------------------------------------------------------------MTST
B3S2R8_TRIAD/18-575--E-------------------------------------------------------------------------LRSA
B3SCA6_TRIAD/44-614--H-------------------------------------------------------------------------LRSA
B4J9Q1_DROGR/61-622--K-------------------------------------------------------------------------IPTK
B4J9Q2_DROGR/50-610--K-------------------------------------------------------------------------IPTK
B4J9Q3_DROGR/52-605--G-------------------------------------------------------------------------IPTR
B4JCP9_DROGR/31-685--K-------------------------------------------------------------------------IPSQ
B4KJ36_DROMO/34-688--K-------------------------------------------------------------------------IPSQ
B4KS84_DROMO/70-629--K-------------------------------------------------------------------------IPTK
B4KS85_DROMO/55-614--K-------------------------------------------------------------------------IPTQ
B4KS86_DROMO/50-605--K-------------------------------------------------------------------------IPTK
B4KS87_DROMO/111-737--K-------------------------------------------------------------------------IPSK
B4MDK1_DROVI/34-691--K-------------------------------------------------------------------------IPSQ
B4MFR1_DROVI/68-626--K-------------------------------------------------------------------------IPTK
B4MFR2_DROVI/57-615--K-------------------------------------------------------------------------IPTK
B4MJH9_DROWI/51-614--K-------------------------------------------------------------------------IPTK
B4MJI0_DROWI/54-620--K-------------------------------------------------------------------------IPTQ
B4MWM1_DROWI/38-693--K-------------------------------------------------------------------------IPSQ
B4N051_DROWI/200-840--E-------------------------------------------------------------------------IPSS
B5DE94_XENTR/28-595--G-------------------------------------------------------------------------LSSS
B5DI87_DROPS/36-609--K-------------------------------------------------------------------------IPSQ
B5E0I0_DROPS/65-626--K-------------------------------------------------------------------------IPTK
B7PPH4_IXOSC/20-614--A-------------------------------------------------------------------------IPSK
B7QN84_IXOSC/6-567--Q-------------------------------------------------------------------------IPSK
C3Y4T6_BRAFL/2-565--E-------------------------------------------------------------------------LQST
C3Y4T7_BRAFL/83-626--S-------------------------------------------------------------------------LQSS
C3YMS7_BRAFL/5-587--E-------------------------------------------------------------------------LHSS
C3ZQA6_BRAFL/26-589--Q-------------------------------------------------------------------------LPSS
C3ZX58_BRAFL/40-591--G-------------------------------------------------------------------------ISSY
D6W853_TRICA/116-732--E-------------------------------------------------------------------------IPSS
D6W895_TRICA/53-625--K-------------------------------------------------------------------------IPSR
E0VXM5_PEDHC/126-706--R-------------------------------------------------------------------------ISSR
E0W488_PEDHC/204-804--E-------------------------------------------------------------------------IPSS
E1C5S3_CHICK/28-603--G-------------------------------------------------------------------------LSSK
E1FKB9_LOALO/26-596--G-------------------------------------------------------------------------ISSK
E1FVI2_LOALO/58-633--H-------------------------------------------------------------------------MTST
E2A200_CAMFO/99-698--Q-------------------------------------------------------------------------IQSK
E2ABP4_CAMFO/74-684--K-------------------------------------------------------------------------IPSK
E2BXT3_HARSA/74-652--K-------------------------------------------------------------------------IPSK
E2RSD4_CANFA/44-638--D-------------------------------------------------------------------------IPSS
E4X1Y1_OIKDI/36-601--S-------------------------------------------------------------------------LKSS
E5S461_TRISP/81-717--N-------------------------------------------------------------------------FRSS
E5SC63_TRISP/58-613--Q-------------------------------------------------------------------------LSSS
E7F5H8_DANRE/27-603--N-------------------------------------------------------------------------LQSA
E9G6H1_DAPPU/44-620--D-------------------------------------------------------------------------LTST
E9GGR7_DAPPU/1-573--Q-------------------------------------------------------------------------IQSK
E9GTG7_DAPPU/37-616--K-------------------------------------------------------------------------LKSQ
E9INY6_SOLIN/50-616--Q-------------------------------------------------------------------------IDLD
F1NQ62_CHICK/86-676--D-------------------------------------------------------------------------LPSS
F1Q3Z3_CANFA/92-650--H-------------------------------------------------------------------------LSNV
F1Q9B1_DANRE/21-583--G-------------------------------------------------------------------------LDSL
F1QBF7_DANRE/27-591--G-------------------------------------------------------------------------FSSS
F1RU07_PIG/132-741--S-------------------------------------------------------------------------LKSS
F1SQZ6_PIG/21-597--N-------------------------------------------------------------------------IPTS
F2U1E1_SALR5/138-886--G-------------------------------------------------------------------------YTNA
F4WH08_ACREC/51-617--Q-------------------------------------------------------------------------IDPY
F4X6X3_ACREC/89-670--G-------------------------------------------------------------------------LKSS
F6RPB8_HORSE/50-647--G-------------------------------------------------------------------------LSSQ
F6SHC6_MONDO/129-692--Q-------------------------------------------------------------------------LSSF
F6SHD5_MONDO/83-645--E-------------------------------------------------------------------------LKSS
F6SNL4_XENTR/97-651--Y-------------------------------------------------------------------------LRSY
F6TIF0_CIOIN/25-583--G-------------------------------------------------------------------------LQSS
F6UFC7_MONDO/37-638--G-------------------------------------------------------------------------LSSQ
F6UHW9_MACMU/29-621--E-------------------------------------------------------------------------ISSS
F6Z8W3_MONDO/36-628--G-------------------------------------------------------------------------TTSS
F6ZVK8_CIOIN/40-603--G-------------------------------------------------------------------------IASS
F6ZXK1_MONDO/21-593--N-------------------------------------------------------------------------LSTS
F7ACE2_CIOIN/22-602--S-------------------------------------------------------------------------LDSA
F7B262_CIOIN/35-639--Q-------------------------------------------------------------------------LTTF
F7B8B6_XENTR/14-595--D-------------------------------------------------------------------------ISSS
F7BQX3_MONDO/39-601--G-------------------------------------------------------------------------LSSS
F7CCC4_MACMU/114-672--S-------------------------------------------------------------------------LKTI
F7D880_XENTR/45-603--D-------------------------------------------------------------------------LNSS
F7DID9_ORNAN/85-636--D-------------------------------------------------------------------------LHSY
F7E5T7_MACMU/28-625--G-------------------------------------------------------------------------LSSQ
F7G693_MONDO/107-666--D-------------------------------------------------------------------------LHSY
F7IM14_CALJA/33-639--G-------------------------------------------------------------------------LSSS
G1KDM6_ANOCA/110-669--D-------------------------------------------------------------------------LQSY
G1KJC8_ANOCA/62-624--G-------------------------------------------------------------------------LSSL
G1KTZ7_ANOCA/42-626--N-------------------------------------------------------------------------IPAS
G1KTZ8_ANOCA/2-594--E-------------------------------------------------------------------------IPSS
G1KU16_ANOCA/44-637--D-------------------------------------------------------------------------IPSS
G1LS58_AILME/38-599--H-------------------------------------------------------------------------LNNV
G1MG68_AILME/111-671--D-------------------------------------------------------------------------LHSY
G1NLJ6_MELGA/21-604--N-------------------------------------------------------------------------IPAS
G1P1F0_MYOLU/56-614--G-------------------------------------------------------------------------LKTI
G1PCN2_MYOLU/58-650--G-------------------------------------------------------------------------LSSQ
G1PGX5_MYOLU/20-594--N-------------------------------------------------------------------------IPTS
G1QXW4_NOMLE/21-597--N-------------------------------------------------------------------------IPTS
G1RKH9_NOMLE/129-734--S-------------------------------------------------------------------------LKSS
G1SJM2_RABIT/94-653--H-------------------------------------------------------------------------LKTF
G1T6Y7_RABIT/47-646--G-------------------------------------------------------------------------LSSQ
G1T960_RABIT/29-621--D-------------------------------------------------------------------------ISSS
G3NAV0_GASAC/31-610--G-------------------------------------------------------------------------FSSQ
G3NHS2_GASAC/34-602--G-------------------------------------------------------------------------LSSY
G3P9F5_GASAC/17-593--N-------------------------------------------------------------------------LQSA
G3Q5Q6_GASAC/29-624--D-------------------------------------------------------------------------IPSS
G3RFJ2_GORGO/108-666--Q-------------------------------------------------------------------------LKTI
G3RW09_GORGO/3-600--E-------------------------------------------------------------------------ISSS
G3THK1_LOXAF/27-590--H-------------------------------------------------------------------------LKAT
G3VZ81_SARHA/19-591--E-------------------------------------------------------------------------LKSS
G3WV28_SARHA/37-630--G-------------------------------------------------------------------------TTSS
G3WVX8_SARHA/40-630--G-------------------------------------------------------------------------ITTS
G3WWQ7_SARHA/43-640--E-------------------------------------------------------------------------IPSS
G4VAF3_SCHMA/62-701--A-------------------------------------------------------------------------IGSS
G5BJ45_HETGA/1-591--D-------------------------------------------------------------------------ISSS
G6D5X6_DANPL/120-675--E-------------------------------------------------------------------------IPSS
G6DHQ3_DANPL/73-638--K-------------------------------------------------------------------------VESK
H0VSG6_CAVPO/50-647--G-------------------------------------------------------------------------LSSQ
H0VU31_CAVPO/105-653--D-------------------------------------------------------------------------LHSY
H0W6D9_CAVPO/29-617--D-------------------------------------------------------------------------LPSS
H0WRN3_OTOGA/1-607--G-------------------------------------------------------------------------LSSS
H0X513_OTOGA/48-645--G-------------------------------------------------------------------------LSSQ
H0XUZ7_OTOGA/29-621--D-------------------------------------------------------------------------ISSS
H0ZQ14_TAEGU/44-636--D-------------------------------------------------------------------------IPSS
H2L5X8_ORYLA/7-609--G-------------------------------------------------------------------------LSSY
H2LW99_ORYLA/3-593--D-------------------------------------------------------------------------IPSY
H2LWK4_ORYLA/34-623--N-------------------------------------------------------------------------LQSA
H2LXV9_ORYLA/4-606--D-------------------------------------------------------------------------LSST
H2ME20_ORYLA/33-598--G-------------------------------------------------------------------------LSSQ
H2NP86_PONAB/41-622--N-------------------------------------------------------------------------LQSA
H2SCH0_TAKRU/44-642--D-------------------------------------------------------------------------IPSS
H2SCH1_TAKRU/29-627--D-------------------------------------------------------------------------IPSS
H2SCH5_TAKRU/21-605--D-------------------------------------------------------------------------ISTT
H2SN38_TAKRU/26-590--G-------------------------------------------------------------------------LSSQ
H2T5W9_TAKRU/22-602--N-------------------------------------------------------------------------LQSA
H2TWS2_TAKRU/7-592--S-------------------------------------------------------------------------LRSS
H2UWX7_TAKRU/9-600--D-------------------------------------------------------------------------IPSY
H2UZN6_TAKRU/20-610--G-------------------------------------------------------------------------LSSY
H2V2U5_TAKRU/20-610--D-------------------------------------------------------------------------TPTY
H2YEL4_CIOSA/27-585--G-------------------------------------------------------------------------LRSS
H2YTS0_CIOSA/2-575--K-------------------------------------------------------------------------IPNT
H2YZB0_CIOSA/24-616--S-------------------------------------------------------------------------LDSA
H2Z037_CIOSA/5-589--G-------------------------------------------------------------------------LSSS
H2Z5W5_CIOSA/21-582--N-------------------------------------------------------------------------LLSS
H2ZCE8_CIOSA/9-615--Q-------------------------------------------------------------------------LTTF
H3ABP2_LATCH/6-582--G-------------------------------------------------------------------------LSSK
H3AUF3_LATCH/60-624--E-------------------------------------------------------------------------LSSS
H3AXL7_LATCH/47-642--E-------------------------------------------------------------------------LPTS
H3B0P1_LATCH/42-638--D-------------------------------------------------------------------------ISSS
H3BW91_TETNG/35-616--G-------------------------------------------------------------------------LSSQ
H3DMV0_TETNG/12-567--G-------------------------------------------------------------------------LSSY
H3DSJ9_PRIPA/41-714--R-------------------------------------------------------------------------LPSK
H3FQI4_PRIPA/22-588--G-------------------------------------------------------------------------ISSS
H9GXA5_DANRE/22-598--E-------------------------------------------------------------------------IPSS
H9GYB5_DANRE/9-610--D-------------------------------------------------------------------------VPSS
H9J2D0_BOMMO/122-735--E-------------------------------------------------------------------------IPSS
A0A088AHC0_APIME/72-668--K-------------------------------------------------------------------------IPSK
A0A088AHB9_APIME/23-630--K-------------------------------------------------------------------------IPSR
I1FF21_AMPQE/83-628--N-------------------------------------------------------------------------FSSV
I1FF22_AMPQE/53-616--H-------------------------------------------------------------------------FTST
I3J8K7_ORENI/27-592--G-------------------------------------------------------------------------LSSQ
I3JPB0_ORENI/4-598--D-------------------------------------------------------------------------IPSY
I3JU44_ORENI/3-598--D-------------------------------------------------------------------------IPSS
I3JU45_ORENI/36-628--D-------------------------------------------------------------------------LSST
I3KD69_ORENI/19-600--N-------------------------------------------------------------------------LQSA
I3KT50_ORENI/9-572--G-------------------------------------------------------------------------LSSY
I3MXD4_SPETR/104-661--D-------------------------------------------------------------------------LHSY
I3MZY5_SPETR/101-669--E-------------------------------------------------------------------------MKSS
J9JWU7_ACYPI/65-667--Q-------------------------------------------------------------------------LQSK
J9K6L3_ACYPI/47-601--K-------------------------------------------------------------------------FSSQ
K1PJB3_CRAGI/119-693--E-------------------------------------------------------------------------IGSS
K1Q6Z9_CRAGI/63-616--S-------------------------------------------------------------------------ISST
K1QB38_CRAGI/29-589--E-------------------------------------------------------------------------LPSS
K1QD74_CRAGI/43-615--K-------------------------------------------------------------------------LPSS
K7IWN1_NASVI/25-629--K-------------------------------------------------------------------------IPSR
K7IWN2_NASVI/77-675--K-------------------------------------------------------------------------IPSK
K7J562_NASVI/209-820--E-------------------------------------------------------------------------IPSS
K7J8P8_NASVI/104-674--Q-------------------------------------------------------------------------IQSK
L5JNP4_PTEAL/43-638--G-------------------------------------------------------------------------LSSQ
L7N264_MOUSE/21-597--G-------------------------------------------------------------------------LLTS
L9L9W1_TUPCH/47-739--G-------------------------------------------------------------------------LTSQ
M3WPK8_FELCA/38-596--H-------------------------------------------------------------------------LGTS
M3XXF4_MUSPF/103-666--E-------------------------------------------------------------------------MKSS
M3XXG5_MUSPF/93-653--H-------------------------------------------------------------------------LNDV
M3YCV1_MUSPF/50-648--G-------------------------------------------------------------------------LSSQ
M3ZWM7_XIPMA/18-618--D-------------------------------------------------------------------------IPSS
M3ZXE4_XIPMA/24-582--G-------------------------------------------------------------------------LSSQ
M4ABK2_XIPMA/34-613--N-------------------------------------------------------------------------LQSA
SO1A3_RAT/21-597--G-------------------------------------------------------------------------IPTA
SO2A1_RAT/33-602--G-------------------------------------------------------------------------LSSS
Q16RK9_AEDAE/100-701--K-------------------------------------------------------------------------IPSK
Q16RL0_AEDAE/55-631--Q-------------------------------------------------------------------------ISSK
Q171D5_AEDAE/25-762--K-------------------------------------------------------------------------IPSS
Q28XS7_DROPS/47-608--K-------------------------------------------------------------------------IPTK
A0A0A6YYJ9_HUMAN/29-621--D-------------------------------------------------------------------------ISSS
SO4C1_RAT/102-664--E-------------------------------------------------------------------------MKSS
Q7Q103_ANOGA/25-768--K-------------------------------------------------------------------------IPSS
Q7Q551_ANOGA/114-716--K-------------------------------------------------------------------------IPSK
SO2B1_MOUSE/42-636--G-------------------------------------------------------------------------LSSQ
Q8C0X7_MOUSE/95-654--S-------------------------------------------------------------------------LTRT
SO1A5_MOUSE/21-597--D-------------------------------------------------------------------------IPTS
Q93550_CAEEL/18-586--G-------------------------------------------------------------------------FSSE
SO4A1_HUMAN/104-663--D-------------------------------------------------------------------------LHSY
SO1A6_MOUSE/21-597--N-------------------------------------------------------------------------ISTS
SO4A1_RAT/103-665--D-------------------------------------------------------------------------LHSY
SO1C1_RAT/44-642--D-------------------------------------------------------------------------IPSS
SO1B2_MOUSE/27-617--D-------------------------------------------------------------------------IPSS
SO1B2_RAT/29-615--D-------------------------------------------------------------------------IPSS
Q9VK84_DROME/36-684--K-------------------------------------------------------------------------IPSQ
Q9VVH9_DROME/175-754--Q-------------------------------------------------------------------------IKSK
Q9W269_DROME/112-731--K-------------------------------------------------------------------------IPSK
Q9W270_DROME/95-661--N-------------------------------------------------------------------------IPTK
Q9W271_DROME/67-626--K-------------------------------------------------------------------------IPTK
Q9XWC5_CAEEL/49-620--K-------------------------------------------------------------------------MTST
R4GBU6_ANOCA/260-819--D-------------------------------------------------------------------------LNSS
T1ER69_HELRO/33-610--N-------------------------------------------------------------------------LPSS
T1G9I5_HELRO/71-663--K-------------------------------------------------------------------------FSST
T1HLF3_RHOPR/50-617--R-------------------------------------------------------------------------IPSK
T1HLL5_RHOPR/20-673--G-------------------------------------------------------------------------IPSK
T1HYS5_RHOPR/25-590--Q-------------------------------------------------------------------------LQSK
T1I8L4_RHOPR/19-568--R-------------------------------------------------------------------------FPSA
T1IDL3_RHOPR/22-585--K-------------------------------------------------------------------------MPST
T1IV13_STRMM/34-600--Q-------------------------------------------------------------------------LPSE
T1J381_STRMM/107-721--Q-------------------------------------------------------------------------IQSK
T1J4Q6_STRMM/53-601--A-------------------------------------------------------------------------VPSK
T1J9S9_STRMM/138-752--D-------------------------------------------------------------------------INSG
T1K555_TETUR/46-593--A-------------------------------------------------------------------------FPSK
U1NEN2_ASCSU/27-606--G-------------------------------------------------------------------------ISSR
U1NQ20_ASCSU/50-610--N-------------------------------------------------------------------------LSST
U3I6L4_ANAPL/103-660--D-------------------------------------------------------------------------LRSY
U3I6Y8_ANAPL/7-588--G-------------------------------------------------------------------------LSSQ
U3K039_FICAL/40-624--N-------------------------------------------------------------------------IPAS
U3K045_FICAL/38-630--E-------------------------------------------------------------------------ISSS
U3KFS6_FICAL/31-593--G-------------------------------------------------------------------------LSSL
V8NPM0_OPHHA/58-605--D-------------------------------------------------------------------------LSSS
W4WD24_ATTCE/23-636--K-------------------------------------------------------------------------IPSR
W4XLX7_STRPU/60-699--Q-------------------------------------------------------------------------LKSS
W4XQW5_STRPU/59-640--K-------------------------------------------------------------------------LPSS
W4XVZ6_STRPU/91-689--H-------------------------------------------------------------------------FSST
W4Z5F6_STRPU/135-671--Q-------------------------------------------------------------------------LTSF
W4Z5F7_STRPU/78-634--S-------------------------------------------------------------------------LPSV
W5J7I4_ANODA/56-623--Q-------------------------------------------------------------------------ISSK
W5JBI4_ANODA/130-794--E-------------------------------------------------------------------------IPSS
W5JW33_ANODA/25-791--K-------------------------------------------------------------------------IPSS
W5KDH2_ASTMX/31-629--D-------------------------------------------------------------------------IPSS
W5KJ52_ASTMX/32-619--N-------------------------------------------------------------------------LQSA
W5LQU9_ASTMX/27-591--G-------------------------------------------------------------------------FSSQ
W5MDQ5_LEPOC/17-593--G-------------------------------------------------------------------------LNSF
W5MFK3_LEPOC/106-669--D-------------------------------------------------------------------------LRSY
W5MRR1_LEPOC/26-603--S-------------------------------------------------------------------------LRTT
W5MRT2_LEPOC/53-615--E-------------------------------------------------------------------------LSST
W5MY22_LEPOC/30-602--G-------------------------------------------------------------------------LSSQ
W5NE89_LEPOC/38-625--E-------------------------------------------------------------------------IPSS
W5NE95_LEPOC/1-594--D-------------------------------------------------------------------------IPSS
W5NE99_LEPOC/24-615--D-------------------------------------------------------------------------IPSS
W5NEA9_LEPOC/1-598--D-------------------------------------------------------------------------IPSY
W5PSU6_SHEEP/93-647--D-------------------------------------------------------------------------LHSY
W5QAF5_SHEEP/107-670--N-------------------------------------------------------------------------LNII
W5QGQ1_SHEEP/21-597--N-------------------------------------------------------------------------IPTS
X5LX59_CAEEL/46-677--K-------------------------------------------------------------------------FSTS
X5M903_CAEEL/27-574--K-------------------------------------------------------------------------LTST

PF06609

Q8NII4_FUSAU/1-598--G-------------------------------------------------------------------------QSEN
Q9C1B3_FUSSP/1-598--G-------------------------------------------------------------------------QSEN

PF05631

Q9N3A9_CAEEL/1-336--L-------------------------------------------------------------------IVYMMAVAGD
Q9FWD6_ORYSJ/4-357--I-------------------------------------------------------------------LVYSLMMSGD

PF01770

S19A1_HUMAN/23-434--N-------------------------------------------------------------------------FTRE
Q9EQN9_MOUSE/28-459--N-------------------------------------------------------------------------LTER
Q9VK64_DROME/2-395--N-------------------------------------------------------------------------LTTD
Q29L76_DROPS/2-397--N-------------------------------------------------------------------------LTSE
Q294A5_DROPS/2-414--H-------------------------------------------------------------------------VTQE
Q9VGV5_DROME/2-408--N-------------------------------------------------------------------------ITEQ
Q16JT2_AEDAE/2-405--N-------------------------------------------------------------------------ISAE
S19A3_HUMAN/10-441--N-------------------------------------------------------------------------LTSA
Q1LV16_DANRE/4-414--N-------------------------------------------------------------------------ISEE
Q9VGV6_DROME/2-411--H-------------------------------------------------------------------------VTQD
FOLT2_CAEEL/2-394--N-------------------------------------------------------------------------MSEQ
Q28C92_XENTR/10-422--N-------------------------------------------------------------------------LTVE
Q7Q5N2_ANOGA/2-422--D-------------------------------------------------------------------------IEPE
A8BIM9_GIAIC/39-447--G-------------------------------------------------------------------------ISMD
A7SN54_NEMVE/6-420--N-------------------------------------------------------------------------ITDE
S19A3_MOUSE/11-435--N-------------------------------------------------------------------------LTSP
F1N2M7_BOVIN/23-430--N-------------------------------------------------------------------------FTQT
F1NVD6_CHICK/32-445--N-------------------------------------------------------------------------FTQV
F7EDM0_XENTR/76-481--N-------------------------------------------------------------------------FTKE
H3CDB6_TETNG/12-433--N-------------------------------------------------------------------------LTAE
S19A1_MOUSE/23-426--K-------------------------------------------------------------------------FTKE

PF00854

PTR7_ARATH/99-532--A-----------------------------------------------------------------------------
F7BBU0_ORNAN/81-472--T-----------------------------------------------------------------------------
PEPT3_CAEEL/82-453--V-----------------------------------------------------------------------------
PEPT1_CAEEL/113-509--A-----------------------------------------------------------------------------
PTR12_ARATH/99-524--F-----------------------------------------------------------------------------
S15A1_RABIT/81-472--T-----------------------------------------------------------------------------
PTR30_ARATH/96-518--V-----------------------------------------------------------------------------
PTR2_ARATH/113-544--F-----------------------------------------------------------------------------
DTPA_ECOLI/88-460--A-----------------------------------------------------------------------------
DTPD_ECOLI/76-458--A-----------------------------------------------------------------------------
DTPC_ECOLI/75-447--T-----------------------------------------------------------------------------
PTR2_SCHPO/158-542--F-----------------------------------------------------------------------------
S15A2_HUMAN/111-487--V-----------------------------------------------------------------------------
PTR2_YEAST/155-533--I-----------------------------------------------------------------------------
S15A1_RAT/81-474--T-----------------------------------------------------------------------------
PTR17_ARATH/124-550--F-----------------------------------------------------------------------------
S15A4_RAT/94-517--L-----------------------------------------------------------------------------
DTPT_LACLA/91-474--T-----------------------------------------------------------------------------
PEPT2_CAEEL/99-494--A-----------------------------------------------------------------------------
DTPB_ECOLI/81-457--A-----------------------------------------------------------------------------
YCLF_BACSU/95-469--M-----------------------------------------------------------------------------

PF05978

Q19933_CAEEL/13-169--S-----------------------------------------------------------------------------
Q9XV34_CAEEL/12-166--A-----------------------------------------------------------------------------
MFS11_MOUSE/14-166--G-----------------------------------------------------------------------------
Q8MYL9_CAEEL/14-170--G-----------------------------------------------------------------------------
Q965T3_CAEEL/14-170--S-----------------------------------------------------------------------------
P91007_CAEEL/16-172--G-----------------------------------------------------------------------------
Q9XWR7_CAEEL/37-194--G-----------------------------------------------------------------------------
Q19932_CAEEL/14-169--S-----------------------------------------------------------------------------
Q21545_CAEEL/14-168--G-----------------------------------------------------------------------------
O61865_CAEEL/27-183--G-----------------------------------------------------------------------------
Q18251_CAEEL/11-167--G-----------------------------------------------------------------------------

PF06813

Q7XGH1_ORYSJ/34-288--S-----------------------------------------------------------------------------
Q9LUF8_ARATH/16-265--G-----------------------------------------------------------------------------
Q8H613_ORYSJ/14-261--A-----------------------------------------------------------------------------
Q94D97_ORYSJ/8-252--P-----------------------------------------------------------------------------
Q9M8M1_ARATH/13-260--P-----------------------------------------------------------------------------
Q9ZUV4_ARATH/17-262--G-----------------------------------------------------------------------------
O80960_ARATH/21-266--G-----------------------------------------------------------------------------
Q8H132_ARATH/7-253--S-----------------------------------------------------------------------------
Q9SLF1_ARATH/14-260--S-----------------------------------------------------------------------------
NFD4_ARATH/43-286--S-----------------------------------------------------------------------------
F4J4R8_ARATH/23-272--S-----------------------------------------------------------------------------
Q9S7R2_ARATH/16-263--G-----------------------------------------------------------------------------

PF07672

Q8EUQ6_MYCPE/191-477--N-----------------------------------------------------------------------------
Y077_MYCPN/209-467--N-----------------------------------------------------------------------------
Q8EVP4_MYCPE/172-441--N-----------------------------------------------------------------------------
Y076_MYCPN/210-484--N-----------------------------------------------------------------------------
Q98PH4_MYCPU/154-430--P-----------------------------------------------------------------------------
Q7NAK7_MYCGA/200-455--N-----------------------------------------------------------------------------

PF03219

TLC2_ARATH/88-571----------------------------------------------------------------------------TKDV
TLC1_CHLTR/2-492----------------------------------------------------------------------------TKDT
Q6MEN4_PARUW/1-484----------------------------------------------------------------------------VKDA
Q6MBI2_PARUW/1-474----------------------------------------------------------------------------LKDT
Q6MEN5_PARUW/4-499----------------------------------------------------------------------------LKDS
Q6MEM5_PARUW/2-491----------------------------------------------------------------------------TKDT
A5CCG3_ORITB/1-504----------------------------------------------------------------------------IKDS
Q1MSG2_LAWIP/9-504----------------------------------------------------------------------------IKDT
C4YY86_9RICK/5-489----------------------------------------------------------------------------IKDG
C4YYY2_9RICK/12-501----------------------------------------------------------------------------IKDS
C4YZB1_9RICK/5-496----------------------------------------------------------------------------IKDS
F8KVN2_PARAV/3-490----------------------------------------------------------------------------TKDT
TLCE_RICPR/7-496----------------------------------------------------------------------------LKDS
TLC2_CHLTR/2-500----------------------------------------------------------------------------TKDS
TLCD_RICPR/14-503----------------------------------------------------------------------------LKDS

PF01733

ENT1_ARATH/167-450--P-------------------------------------------------------------------------ERYM
S29A1_RAT/144-455--P-------------------------------------------------------------------------ANYT
S29A2_HUMAN/131-454--P-------------------------------------------------------------------------STYS
S29A1_HUMAN/144-454--P-------------------------------------------------------------------------ASYT
FUN26_YEAST/180-510--G-------------------------------------------------------------------------SEYS
Q19495_CAEEL/137-426--P-------------------------------------------------------------------------HTYI
Q21145_CAEEL/434-723--P-------------------------------------------------------------------------FKYT

PF03239

FTH1_YEAST/8-404--KQGLSVEDDSPFEGSSSSAGLPSPNTNTNADSTTAFLQAGPSDGNAIGTSATAANNKSRPLNVEEEEEIYEYSNELRD
EFEU_BACSU/9-395--KQMIKSVKDGDMDSAQQTFDTFKAKWKKEEPSI..........KKENLSSHSEMDANIAMISLSFINQDARKLKTQLE
Q9Y8Z4_AERPE/4-268--KK........................................................................MGEH
Y964_SYNY3/6-291--AR........................................................................AQQM
FIP1_SCHPO/7-320--SQ........................................................................TLMD
EFEU_ECOLI/1-276--KR........................................................................TQRG
O83937_TREPA/14-362--WVGVALMC............................................................VAWSVSAAEG
Q9ZC51_YERPE/156-557--QGFKNSEMEMSVRGNRSAQQAAEINQQFTALIDL.......ARQPDKMTEVAYRVTGLLHTIEDILPGLPTTREQQQI
Q9RKQ1_STRCO/1-274--VK........................................................................TDRR
Q9ZDD8_RICPR/1-278--KQ.........................................................................IEK
FTR1_YEAST/7-321--KQ........................................................................AIGE
Y154_ARCFU/4-266--KR........................................................................SGRT
Q9WYP8_THEMA/2-266--KR........................................................................TGRE

PF03209

P73827_SYNY3/40-466V-----A-------AT----A-----IA---M---YQ--FV---SPFKVWC-GQL--SD----SQR.-LWGY-----HR-
PUCC_RHOS4/51-454V-----V-------GI----M-----IS---L---PL--LF---APFRALI-GFK--SD----THVS-ALGW-----RR-
BCH2_RHOCB/28-417L-----P-------GA----L-----VA---L---HY--GL---QIARPAW-GLR--SD----TKG.-....-----NR-
D5AMI6_RHOCB/54-460L-----V-------SV----M-----LA---M---PM--LF---APFRTLI-GFK--SD----THKS-ALGL-----RR-
D5ANS1_RHOCB/51-456V-----V-------AA----M-----IS---I---PV--LV---APFRAIL-GHR--SD----TYRS-ALGW-----KR-
G3XCS5_PROMA/1-413L-----V-------GG----G-----LA---F---EQ--LV---APSRVLF-GNI--SD----SWP.-IKGR-----KR-
I0HT76_RUBGI/55-465I-----V-------AV----M-----VA---L---PL--LF---APFRALI-GFK--SD----NHQS-ALGW-----RR-
Q3J171_RHOS4/51-459V-----V-------AL----M-----IA---L---PV--LS---APFRALM-GHR--SD----NHRS-ALGW-----KR-
Q3J183_RHOS4/28-414L-----S-------GL----L-----VA---L---HY--AV---QVTRPSW-GYR--SD----TCG.-....-----NR-

PF13347

Q2G9N1_NOVAD/15-450L-----V-------SL----AL....LI---A---LV--FD---GLIDPVV-GHI--SD----RTRT.HWGR-----RL.
C4Z9B4_EUBR3/10-441F-----I-------GT----VM....MA---A---RI--FD---AFNDPVM-GII--VA----KTRT.RWGR-----FR.
Q0AL93_MARMM/20-465M-----V-------SL----AI....LV---A---LV--FD---AISDPIV-GQF--SD----SLRT.KWGR-----RH.
Q28K27_JANSC/9-401A-----L-------AA----VL....FG---L---RL--FD---VVQDPVL-GWL--AG----RLRA.ARGA-----...
E6WJ95_PANSA/12-430F-----V-------GT----LF....LL---A---RV--AD---AVIDPAM-GMV--AD----RTRS.RWGR-----FR.
D2VB35_NAEGR/26-486R-----F-------GL----VN....SF---I---RS--LS---LITDFFS-ATL--ID----SSSL...GQ-----QT.
D4LG93_9FIRM/24-452V-----A-------GV----IN....SV---F---TI--VD---ACLSWLY-GGI--IN----GTKAKKWGR-----YR.
Q8I3H5_PLAF7/74-507H-----L-------TL----M.....FL---Y---AF--IE---IFFSYIS-HKF--KS----KCFK.TYGK-----RT.
Q026U3_SOLUE/24-465W-----I-------GV----VA....FV---S---ML--WD---AFMDPYV-GHL--TD----GAQA.KSKR-----FK.
A6TPY1_ALKMQ/12-433A-----M-------GT----IL....LV---A---RI--VD---AISVPIA-GAI--IE----KSNM.KWGK-----YR.
B1ZS00_OPITP/16-436H-----L-------AM----LG....LI---P---RL--ID---AFADIAM-GIY--TD----TRTT.RWGR-----YR.
B2GBT3_LACF3/25-466L-----I-------GL----ITGLV.VI---I---RL--AE---VVIDPIL-GNI--VD----NTKS.RWGK-----FK.
R7CNT8_9FIRM/17-438A-----V-------SA----LM....LF---S---RF--WD---AINDPIV-GGL--TD----KTKT.KWGR-----YR.
D4L2L1_9FIRM/12-431L-----V-------AI----VA....LI---T---KV--WD---AINDPIL-GMI--MD----KVNF.KKGK-----FL.
C5BVC3_BEUC1/25-453Y-----V-------GW----VY....LA---F---NI--WN---VLNDPVF-GVV--ID----RMSY.RTGK-----GKF
A1SNV8_NOCSJ/14-434V-----A-------GF----IV....FL---P---KA--WD---VVLNPIA-GRI--SD----RSVD.PRGP-----RR.
A6TPY6_ALKMQ/13-436V-----V-------GL----IL....LV---A---RI--ID---AISVPIS-GAI--IQ----KTQL.KWGQ-----FR.
NLS1_XENTR/40-494Y-----A-------SI----IL....FS---G---RV--WD---AITDPLV-GFF--VS----KSSWTRLGR-----LL.
A7HQL5_PARL1/12-433A-----V-------GT----MI....ML---A---RL--TD---VVTDPLI-GYF--SD----HTHT.RIGR-----RK.
C3Z8Z9_BRAFL/18-394F-----A-------TS----II....FG---S---RV--VD---VFCNFIL-GPL--ID----RTNT.RWGK-----AK.
Q03PA7_LACBA/7-451L-----A-------SI----VITMV.VV---I---RL--VE---IAFDPMI-GGI--VD----NTDT.KMGK-----FK.
Q2N8H6_ERYLH/15-453L-----V-------GA----AL....AT---A---LI--ID---AFVDPLI-GHL--SD----RTYT.KWGR-----RL.
D1BWG8_XYLCX/33-459A-----A-------AT----MF....LA---V---RL--VD---VVWDPIV-GTI--VD----KNTT.RWGR-----YR.
Q5YU93_NOCFA/41-478W-----G-------GT----FLVVFPIV---A---RL--VD---VLTNLTM-GYL--ID----RTRT.RQGK-----AR.

PF03092

Q25272_LEIDO/59-606M-----Y-------QR----L-----ST---L---YT--LG---WALNAFI-TVM--AD----TFAL-FGYT-----KR-
B3GVG0_TRYBB/138-667L-----Y-------QR----M-----GG---M---SS--LG---YAMKPFA-AMF--SD----LFAL-FGYT-----KR-
Q9UAB8_LEIDO/94-683R-----Y-------QR----L-----AG---I---ST--MG---WSIKALT-AML--CD----GFAF-LGYT-----KR-
Q9UAB7_LEIDO/75-654R-----Y-------QR----L-----ST---I---AT--MG---WSIKAFT-AML--CD----GFAF-LGYT-----KR-
Q9UAC0_LEIDO/76-655R-----Y-------QR----L-----SS---I---ST--MG---WSIKAFT-AML--CD----GFAF-LGYT-----KR-
Q9UAC1_LEIDO/75-651R-----Y-------QR----L-----ST---I---AT--MG---WSIKAFT-AML--CD----GFAF-LGYT-----KR-
FBT8_ARATH/98-515T-----L-------QL----V-----QY---S---CS--LP---MVAKPLY-GVL--SD----VLYI-GSGR-----RV-
FBT7_ARATH/30-441V-----L-------QL----L-----QN---S---AN--LP---MVAKPIY-GVV--SD----SVYF-FGQH-----RI-
FBT3_ARATH/61-473Q-----A-------QI----Y-----VG---L---IQ--IP---WIIKPLW-GLL--TD----VVPV-LGYR-----RR-
FBT1_ARATH/137-553E-----T-------AV----I-----TG---L---SS--LP---WLVKPLY-GFI--SD----SVPL-FGYR-----RR-
FBT_SYNY3/46-457A-----M-------GA----L-----IG---L---GA--AP---WILKPVL-GLM--SD----TVPL-FGYR-----RR-
O68867_SYNE7/38-441Q-----V-------SA----L-----TG---I---AA--LP---WMIKPAF-GLL--SD----GFPL-GGYR-----RR-

PF06963

S40A2_ARATH/31-479L-----T-------AM----YG----VV---E---SG--SA---TLFGPIV-GQM--ID----GMSYVK..V-----LR-
S40A1_ORYSJ/21-450L-----T-------AV----YG----VV---E---AS--AV---AALGPIV-GAV--VD----RLAYLQ..V-----LR-
S40A1_ARATH/35-483L-----A-------AI----YG----AI---E---SG--ST---AIFGPIV-GQW--VE----GMDYVK..V-----LR-
A2R421_ASPNC/42-466Y-----T-------SV----YA----LV---R---SL--SA---VVLSSWL-GSV--VD----RANRLR..A-----IR-
Q5AXY5_EMENI/19-441Y-----A-------SV----YA----LV---R---SL--FA---VLFSSWL-GSL--VD----RTDRLS..A-----IR-
Q8IA95_CAEEL/5-448W-----V-------AV----QQ----LV---D---SV--LK---LVVITIV-GQY--LD----KIDRSK..I-----IQ-
S40A3_ARATH/146-569P-----V-------AV----MG----FV---T---KL--AI---IAGGPVV-GKF--MD----YSPRVP..T-----YI-
Q0CWF0_ASPTN/44-463Y-----A-------SI----YA----LG---R---SL--SA---VLLSSWL-GSM--VD----RSNRLT..T-----IR-
A0A0D1CCA6_USTMA/82-563P-----A-------SI----YG----FV---T---TA--GA---ILFSNNV-GRL--ID----TYAHLKLRT-----LR-
S40A1_HUMAN/22-531L-----T-------AV----YG----LV---V---AG--SV---LVLGAII-GDW--VD----KNARLK..V-----AQ-
S40A1_DANRE/19-522L-----T-------AV----YG----LV---V---AG--SV---LLLGAII-GDW--VD----KNPRLK..V-----AQ-
A8X2J9_CAEBR/13-461V-----V-------SI----EQ----LF---E---GV--LQ---MVLSGYL-GKH--FD----GLSRKR..A-----IM-
A5BT51_VITVI/32-472L-----A-------AV----YG----VV---E---SA--ST---AFLGPSI-GQW--LD----RLTYVK..V-----LQ-
A1CBM9_ASPCL/39-469Y-----A-------SV----YA----LA---R---SL--SA---VVLSSWL-GSR--MD----HSDRLV..T-----IR-
S40A3_ORYSJ/147-569P-----V-------AV----LG----FF---T---KL--VV---FAAGPLV-GEL--IS----SLPRIP..A-----YR-
H3DM67_TETNG/10-523L-----T-------AV----FG----LV---V---AG--SV---LLLGALI-GDW--VD----RNPRNK..V-----AH-

PF13000

C4R336_PICPG/74-584F-----S-------QV----GV----FS---L---AS--YP---YSLKLLW-SPI--VD----SLYFKNIGR-----RR-
G0WCJ0_NAUDC/17-577F-----T-------SL----GV----FS---I---AT--YP---YSLKILW-SPI--ID----SLYSKKIGR-----RR-
G8BYR1_TETPH/85-660F-----T-------QL----GF----FS---I---ST--YP---YSLKILW-SPI--VD----SIYSKKLGR-----RR-
Q75EB1_ASHGO/51-585F-----T-------KL----GL----FG---I---AT--YP---YSLKILW-SPL--VD----SVFSKKIGR-----RR-
E7K9I5_YEASA/17-559F-----T-------SL----GI----FS---M---AT--YP---YSLKIIW-SPI--VD----SLYNKRIGR-----RR-
Q6CKM4_KLULA/10-515F-----V-------TI----GL----FS---M---AT--YP---YSFKILW-SPI--VD----SWYSQKVGR-----RR-
G0VIX6_NAUCC/41-595F-----A-------SL----GV----FS---I---AT--YP---YSLKILW-SPI--VD----SFYSKKIGR-----RR-
H2AY09_KAZAF/18-574F-----T-------SL----GL----FS---M---AT--YP---YSLKILW-SPI--VD----SFYNKRIGR-----RR-
I2H5Y9_TETBL/23-594F-----A-------SL----GF----FS---I---AT--YP---YSLKIFW-SPI--VD----SLYFKKLGR-----RR-
G8JR10_ERECY/17-554F-----T-------KL----GV----FS---M---AT--YP---YSLKILW-SPI--VD----SIFNPKVGR-----RR-
S6E3L5_ZYGB2/13-555F-----T-------TL----GI----FS---I---AT--YP---YSLKILW-SPI--VD----SIYNPKVGR-----RR-
Q6FMM5_CANGA/15-566F-----T-------QL----GI----FS---M---AT--YP---YSLKILW-SPL--VD----SVYFKKIGR-----RR-
C5E2P0_LACTC/16-543F-----T-------QL----GV----FA---L---AT--YP---YSLKIIW-SPI--VD----SIYSKKTGR-----RR-
B6ABL4_CRYMR/9-525Y-----K-------EQ----SI----FS---M---VT--LP---FSLKLLW-APL--VD----SVYIERIGR-----RK-
G8ZXV2_TORDC/17-551F-----T-------TL----GL----FS---I---AT--YP---YSLKIIW-SPI--VD----SIYSKKSGR-----RR-
J7RSN7_KAZNA/20-561F-----T-------SL----GV----FS---V---AT--YP---YSLKILW-SPI--VD----SCYSRKIGR-----RR-

PF03825

YEGT_ECOLI/1-405E-----I-------GW----SY----AC---T---AI--AA---ILSPILV-GSI--TD----R-F-----F-----SA-
Q9A7U2_CAUCR/1-395Q-----Q-------SL----VG----SA---W---GV--AA---LVGIFFS-NQF--AD----R-N-----F-----SA-
XAPB_ECOLI/1-407N-----V-------GM----VY----SS---K---GI--AA---IIMPGIM-GII--AD----K-W-----L-----RA-
NUPG_ECOLI/1-406S-----I-------GA----VY----SS---L---GI--AA---VFMPALL-GIV--AD----K-W-----L-----SA-

PF12832

C3YMP2_BRAFL/15-420Q-----I-------GV----IK----SG---G---KF--IS---VFIRPAL-GSI--AD----I-T-----G-----RA-
B4G7T5_DROPE/37-721E-----I-------AI----IY----LA---L---PF--TT---FLSPPIT-GFL--VD----K-F-----G-----KY-
Q17GA0_AEDAE/15-612E-----S-------QI----IS----VV---A---PL--IA---ILGPLIF-APL--AD----R-L-----A-----GT-
A7UVG6_ANOGA/15-612E-----S-------QL----VT----LI---A---PL--VA---ILGPLII-APL--VD----R-L-----A-----GR-
A7RI07_NEMVE/55-515L-----V-------GL----LA----GI---R---PL--IQ---FASAPFW-SVI--SD----K-F-----K-----AR-
A7SQQ8_NEMVE/56-507L-----V-------GI----IL----GV---R---PF--CL---FISAPIL-GTL--AD----K-Y-----R-----KV-
Q54G39_DICDI/13-544I-----I-------GI----IT----CL---L---PF--LS---FLSSPFW-TNI--SD----R-F-----G-----IQ-
Q55CH3_DICDI/12-488I-----I-------GI----IT----CL---I---PL--IS---FISSPIW-SNI--SD----R-F-----G-----IQ-
B7PL10_IXOSC/11-489E-----V-------GL----VY----TV---A---PF--FS---AASKPIF-GAL--VD----R-S-----R-----KI-
Q6FB61_ACIAD/7-363E-----I-------GL----LS----SI---A---II--TR---FFAPFIW-GWV--AD----K-T-----G-----KR-
Q21IX9_SACD2/6-359L-----I-------GV----VM----AI---P---ML--TR---IVAPNIW-GWV--AS----R-T-----G-----RP-
C5BL70_TERTT/3-356D-----I-------GL----LS----AI---P---MV--TK---IAAPNIW-GFL--AD----Y-S-----G-----RR-
B3PHF3_CELJU/16-370D-----V-------GV----IT----AI---I---LA--TR---IIAPNFW-GWL--AD----K-T-----Q-----RR-
Q3J7E6_NITOC/10-363K-----I-------GE----LM----AL---L---MA--TR---VLAPNIW-GYI--AD----H-S-----G-----KR-
D3SB25_THISK/4-359Q-----I-------GE----LM----AI---V---LA--TK---IIAPNVW-GWL--AD----R-A-----G-----AH-
B8GQD4_THISH/6-360Q-----I-------GE----LM----AI---I---MA--TK---IIAPNVW-GWL--AD----T-T-----G-----RR-
A1WY15_HALHL/15-368E-----I-------GQ----LL----AI---L---HA--TK---IIAPNVW-GVL--AD----R-L-----N-----RR-
Q2SJE3_HAHCH/6-360E-----V-------GQ----LM----SI---L---ML--TR---ILAPNLW-GWI--AD----A-T-----G-----KR-
Q07ZQ8_SHEFN/11-364E-----I-------GF----LL----AI---L---MA--TR---IVAPNVW-AAV--AD----R-T-----G-----MR-
A3QFN3_SHELP/25-378Q-----I-------GF----LL----AI---L---MA--TR---IIAPNIW-AMV--AD----K-T-----G-----MR-

PF01306

LACY_CITFR/1-412D-----T-------GI----IF----AC---I---SL--FS---LLFQPIF-GLL--SD----K-L-----G-----LR-
RAFB_ECOLX/4-415D-----T-------GI----VF----SC---L---SL--FA---ISFQPLL-GVI--SD----R-L-----G-----LK-
A0A017JVR8_ECOLX/4-411E-----L-------GT----LY----SV---N---QF--TS---ILFMMFY-GIV--QD----K-L-----G-----LK-
LACY_KLEOX/6-416E-----T-------GI----VF----SC---I---SL--FA---IIFQPVF-GLI--SD----K-L-----G-----LR-

PF07690

O17785_CAEEL/33-439E.....K-------SL....LF----SL...V---AV..GA...MVAVYPV.MLL..IQ....K.F.....G---..SR-
Y2994_MYCTU/18-356H.....A-------GL....LA----SM...P---SW..GL...VVTMFAW.GYL..LD....H.V.....G---..ER-
ANTR2_ARATH/137-500T.....V-------GL....IQ----SS...F---FW..GY...LLTQILG.GIW..AD....K.F.....G---..GK-
Q19296_CAEEL/16-403YDKVFFG-------GF....LG----SL...F---SA..LQ...FISSPTL.GSL..SD....I.Y.....G---..RR-
A9CFQ9_AGRFC/27-373S.....A-------SL....AV----TV...M---N...GV...QIATMFTLGRA..ID....I.H.....G---..ER-
O25793_HELPY/8-347L.....V-------GL....AV----GG...A---YL..TQ...IVFQTPM.GIL..SD....K.I.....G---..RK-
Q97XW7_SULSO/20-385I.....N-------SV....LF----LLTPTF---AT.......LAGNLAL.SLF..SD....KKL.....G---..RK-
D7GFS1_PROFC/22-419T.....L-------QW....VS----TG...Y---LL..AL...AVAIPFV.SWA..QT....R.F.....G---..GK-
O66589_AQUAE/21-406Q.....K-------GF....MV----AI...P---VI..AA...AIFRLNF.GHM..FQ....Y.I......---..DG-
Q9I0P8_PSEAE/19-362E.....V-------SL....LV----TL...F---GL..AV...AITSPLK.GWL..ID....R.W.....G---..AR-
MFSD9_HUMAN/49-427V.....A-------GI....VG----SS...Y---GI..LQ...LFSSTLV.GCW..SD....V.V.....G---..RR-
Q97CG2_THEVO/16-347L.....I-------GI....AF----GA...Y---GL..TM...ALFQAPF.GII..SD....R.F.....G---..RK-
Q9CF47_LACLA/24-427S.....I-------AL....TQ----TI...F---FT..AA...ALFALFL.PRL..AD....L.I.....G---..RK-
Q92RK8_RHIME/23-360Q.....I-------GL....LT----FT...F---QV..TA...SMLQPAI.GIV..TD....R.W.....A---..LP-
Q8YC70_BRUME/8-339L.....I-------GA....NT----AV...A---GL..AS...IAAAPLA.API..AA....R.L.....G---..VV-
A0A098UI88_SALET/17-369T.....I-------GF......----.....F---SLVGQA...YVFKFLW.SPL..MD....R.YTPPFLG---..RR-
Q8NU65_CORGL/19-414T.....M-------NI....AV----VA...A---AL..FC...GTFIVAA.GGI..AD....V.F.....G---..RV-
Q9YG70_AERPE/18-417E.....A-------SW....IF----TS...Y---LV..TG...SVLIPLM.GRL..GD....A.V.....G---..RR-
Q9HLN0_THEAC/12-329......V-------EV....AF----TL...F---TV..FS...TTFQGVG.GYF..AD....R.D.....G---..PA-
Q8XR21_RALSO/30-433S.....L-------GW....MY----TL...F---FV..FL...GASAALW.GGW..LE....R.V.....G---..PR-
Q7X233_STAAU/33-313E.....L-------GF....AL----SA...V---SI..AY...GFSKFFM.GTV..SD....R.S.....N---..AR-
O87836_STRCO/61-422S.....I-------YW....MM----TA...W---VF..CQ...AAVAFPA.GRLRESG....K.L.....P---..AR-
Q8NNT7_CORGL/10-351V.....A-------GA....TT----GI...F---MA..AT...VITQIFTPAAL........RKI.....G---..YT-
Q92WR7_RHIME/13-355G.....I-------SS....AM----TV...G---FI..AM...ALASMVW.GSA..SD....R.W.....G---..PR-
Q8TZJ0_PYRFU/13-389I.....T-------GF....IM----TI...D---NL..FA...VILLPFL.GAL..SDMTRTR.I.....G---..RR-
O58400_PYRHO/34-380L.....V-------GL....LS----VI...Y---NL..TS...AIFQYPF.GYL..SD....K.I.....G---..KR-
Q9KRL8_VIBCH/16-353Q.....I-------NW....LF----AA...S---TL..AL...SLCLVPW.AVT..SE....A.V.....G---..RR-
Q9KWU2_SPHSX/13-348......A-------GL....AY----GM...Y---SL..LP...ALASIHI.GRW..VD....R.A.....G---..PR-
A0A090LWD5_STAAU/18-353I.....T-------SL....AF----SI...H---FI..AD...ASTNFVI.GFL..LK....K.F.....G---..TK-
Q8Y7M4_LISMO/13-349E.....A-------GF....AS----GI...Y---II..GT...LLARLYM.GKK..LE....L.F.....G---..RK-
NART_STACT/13-344Q.....I-------SI....VL----AI...P---VI..LG...SVLRIPF.GYL..TN....I.I.....G---..AK-
Q9K646_BACHD/13-358L.....V-------A.....MS----GVWIAF---MI..PK...LLTNLVA.GPY..LD....R.F......---..QY-
YLZ2_SCHPO/48-434L.....V-------TL....GA----TL...Y---TL..GI...LFGNLIF.APL..SE....Q.F.....G---..RR-
YWOG_BACSU/15-348Q.....G-------GL....LI----SL...F---LL..SA...IITRPFS.GAI..VE....R.F.....G---..KK-
Q1K517_NEUCR/132-490I.....V-------SL....IF----VG...N---AL..GF...IAGAFFV.DAI..RE....R.L.....G---..RA-
O54179_STRCO/33-428D.....L-------QW....IA----TS...F---AL..SA...AGFTLFL.GRV..GD....L.V.....G---..RK-
Q98B83_RHILO/60-407A.....I-------GL....LF----GC...Y---AG..GE...LLAAPLI.GGI..AD....R.I.....G---..RR-
A0A027U3K7_ECOLX/39-413M.....F-------GL....AT----TL...F---YA..AY...VIFGIPS.NIM..LS....I.V.....G---..AR-
Q9EYN6_SYNPW/18-450Q.....I-------RT....VA----IC...N---VA..LT...IPARVLI.GML..LD....K.F.....G---..PR-
Q9KBG2_BACHD/16-398Q.....V-------SW....VT----SV...Y---GL..IY...GIGTVIY.GKL..AD....R.Y......---..RL-
Q986N1_RHILO/24-356A.....V-------MV....AA----AA...F---GL..GT...SASALFL.ARY..ID....R.L.....G---..AR-
Q93LX8_9ACTN/30-425E.....L-------HW....VV----SG...F---AA..GF...GALLLFG.GRL..VA....I.L.....G---..RR-
Q8KDQ3_CHLTE/9-374M.....I-------GL....IA----SI...Y---ST..MQ...FIFSPIW.GKL..SD....K.I.....G---..RR-
Q9PCL3_XYLFA/32-422G.....L-------QW....VV----DG...Y---TL..MF...GALLLSA.GAL..VD....R.I.....G---..AR-
Q9URI1_CANAX/123-512V.....A-------TL....PL----TL...F---VI..GY...GVGPLVF.SPMSENA....I.F.....G---..RT-
Q9KRK6_VIBCH/22-366A.....V-------QI....TL----TA...Y---TA..GF...AIGQLLH.GPL..AD....S.F.....G---..RR-
Q92Y26_RHIME/19-357A.....A-------SW....LI----SA...F---AI..LG...ALAGAPI.GLA..VD....R.I.....G---..AR-
Q9RSF5_DEIRA/46-397Q.....I-------GW....FS----TS...Y---SL..MQ...FIFSPIW.GNR..SE....H.H.....G---..RR-
LIZ1_SCHPO/36-407E.....L-------QD....IN----VV...F---TC..GY...IIGQLPG.SYA..LQ....R.V......---..PA-
Q97IY3_CLOAB/13-357......V-------NL....VY----IL...Q---SI..PI...LVLGMFA.GNL..VD....K.......K---..NK-
Q9I008_PSEAE/29-430E.....G-------TW....LT----VL...Y---EATQVA...AMAFAPW.CSV........T.F.....S---..LR-
Q9HTX1_PSEAE/12-346Q.....S-------NW....SI----TA...T---TL..AV...ALAAPFV.GRL..SG............G---RERS-
Q9KYI2_STRCO/15-371A.....I-------GS....AV----SA...G---TL..AT...LPTALLA.GWL..VD....R.F.....S---..PK-
Q973W8_SULTO/12-335L.....Y-------GI....AE----AL...N---YG..GG...SLMSILG.GYL..AD....K.Y.....G---..RK-
Q18472_CAEEL/18-397SDEKKYI-------MW....AV----GA....---....GT...IFGTIPT.NWV..VV....K.Y.....G---..AK-
Q8ZXX0_PYRAE/10-352E.....A-------GV....VL----AA...Y---PF..LE...ALGALIA.GRW..SD....T.L.....G---..RK-
Q9AA55_CAUCR/30-391E.....I-------GIPDALVA----GI...F---SL..SAVLWAVTSPFW.ARQ..SD....L.R.....G---..RK-
YN42_SCHPO/141-527V.....S-------LL....TM----TV...F---LL..GY...CSGPIIW.APL..SE....L.S.....G---..RK-
Q2FVB9_STAA8/16-376Q.....F-------GL....LA----SF...F---SL..GY...ALMQVPS.GML..AE....K.F.....G---..PR-
Q961H2_DROME/54-453V.....Q-------TYSANIMM----TT...S---LL..ESIIPAFASLFL.GPW..SD....K.F.....G---..RR-
C3SM02_ECOLX/36-398D.....I-------GL....LA----TL...F---YI..TY...GVSKFVS.GIV..SD....R.S.....N---..AR-
Q8KCE7_CHLTE/27-390E.....Q-------GTISGDLV----FW...T---EI..VT...LLLFGPA.GAI..MD....R.I.....G---..RR-
P95852_SULSF/9-333......L-------SL....LL----PL...V---SFGFVK...GAFNFIA.GKL..SD....D.L.....G---..RK-
O45678_CAEEL/27-403D.....S-------GT....VL----SC...F---FW..GY...ALTQVFA.GRI..AD....K.Y.....G---..AE-
Q9I5C8_PSEAE/21-369Q.....I-------GL....LV----SA...A---QL..VP...IVGLLVA.GEL..LD....R.Y......---..SE-
O30222_ARCFU/15-357T.....A-------SL....MV----TA...N---SI..GM...VVGGFLI.GVL..CD....K.I.....G---..VR-
O54630_HALSA/24-368V.....I-------GS....FV----VS...F---GI..VK...SILNLYA.GKW..GE....A.Y.....G---..RK-
Q8TR38_METAC/18-398V.....Y-------GI....LA----ST...Y---PA..FQ...LIGAPIL.GRW..SD....L.Y.....G---..RK-
Q986D7_RHILO/41-396E.....L-------GL....AL----GV...L---GL..GV...ALSELPW.GLL..TD....R.W.....G---..DR-
O69759_PSEFL/31-392E.....I-------GW....IS----AM...M---LW..CY...AGGQFIN.GNL..GD....K.F.....G---..GK-
Q9HLR9_THEAC/6-377F.....V-------GL....AS----AV...S---SA..AS...VPALILW.GDL..SD....A.V.....S---..KR-
A0A098UKM0_SALET/13-352......Y-------HWDPATPA----LA...F---SINMGI...IPLPMIWGGRM..ID....N.......G---..KG-
O28944_ARCFU/4-328L.....S-------AF....AA----GV...F---AL..FP...AIAMTPF.GML..SE....V.Y.....G---..RR-
Q9KKX8_VIBCH/40-383E.....V-------GA....ML----AT...S---AL..VG...SLTGLYS.GYL..SD....K.F.....G---..RK-
Q96XQ4_SULTO/9-336E.....D-------GI....IF----SL...F---FI..GY...IIVQIPA.GIL..SD....Y.V......---..SP-
Q8Y6H4_LISMO/13-376L.....T-------SL....LL----II...S---QV..LA...VFTALLG.GYF..AD....N.F.....G---..RK-
O62376_CAEEL/16-394F.....L-------GS....LD----AI...F---MA..AY...AAALFFW.GWL..GD....R.L.....N---..PK-
YCUD_SCHPO/89-473......T-------NW....HC----SIQVSY---LVQSLFIVGNAFGPMLLGPM..SD....I.F.....G---..RK-
Y1634_MYCTU/25-423L.....Y-------AW....VT----TL...Y---LV..GS...VVAATTV.NTM..LL....R.V.....G---..AR-
Q9KG75_BACHD/5-341L.....V-------GG....IV----AI...Y---SL..AN...MVGNIIG.GHW..VD....R.F.....G---..RK-
Q7JZE2_DROME/46-458ETQSGDL-------PWTRNQEL----TFPGVY---YY..GY...VVSISLS.GYL..AD....R.C.....S---..SK-
Q9KLN6_VIBCH/36-395E.....L-------GI....MG----SA...F---FF..TY...AFGKFLN.GFL..SD......Y.....A---..NI-
Q8P881_XANCP/26-418A.....M-------SI....AM----TS...Y---LL..AL...AVLIPAS.GAI..AD....R.F.....G---..LR-
H1XFL1_9XANT/19-356S.....A-------GA....VV----TA...A---QL..AY...AAGLLLL.VPL..GD....R.L......---..ER-
YQ92_SCHPO/20-407R.....V-------QSVISTLL----AV...Y---AV..AN...IAASSPI.GFL..AD....KFL......---..TR-
O16697_CAEEL/36-432F.....L-------GW....IV----AA...C---SI..GC...TISNPIY.GFW..NQ....KTM.....S---..VK-
A0A0E1EPM8_STRPY/10-353ELVEYYA-------GL....AV----AV...T---AL..AS...ALFAPVW.GKL..AD....C.Y.....G---..RK-
Q1K880_NEUCR/87-498T.....A-------SW....LT----TA...Y---LV..TS...TAFQPLY.GRV..SD....I.F.....G---..RR-
Q8XKW0_CLOPE/26-404A.....V-------SW....QV----TL...A---GL..VI...GIGAVVY.ASL..SD....S.I.....S---..VR-
O58488_PYRHO/9-354E.....F-------EL....QH----IA...Y---VF.......GLFIAFLLGST........RIY.....E---GSFR-
Q9K9F3_BACHD/14-368S.....I-------SL....IS----TL...S---FI..VY...GISQPLI.GKL..VD....R.L.....G---..AR-
O29880_ARCFU/11-360I.....A-------SL....PF----SI...F---LL..IF...ALMMVPA.GRT..QD....R.I.....G---..PR-
Q97C48_THEVO/19-351F.....V-------GF....IF----TL...N---AA..LS...IVFSLFA.GYL..SD....V.I.....G---..RK-
Q9Y7D4_ASPTE/35-449D.....V-------GW....YG----SA...Y---LL..SS...CALQPLA.GKL..YT....L.L......---..TL-
Q97DX4_CLOAB/23-413T.....V-------QW....LI----TG...N---VL..VV...GILVPVT.AFL..LH....T.F.....T---..TK-
Q8MPU6_CAEEL/90-445Q.....T-------GI....VF----GI...F---EF..TM...FIISPLF.GKY..II....F.I.....G---..AR-
Q96Y06_SULTO/9-344L.....V-------GL....LG----TI...F---FA..LS...ALASPFV.SYI..AD....K.T.....G---..KP-
A9CIR5_AGRFC/18-359V.....M-------QF....AV----SG...Y---LA..AT...ALLQLVI.GPL..SD....L.F.....G---..RR-
Q8ZWZ3_PYRAE/12-326Y.....A-------GL....LP----AA...F---II..GA...AVTQIPA.SYL..GA....V.Y.....G---..HD-
A0A027YK03_ECOLX/20-357M.....V-------GF....FF----TG...S---AV..IG...VLVSQFLAGRS..DK....R.......G---..DR-
G4UU99_NEUT9/52-417Q.....F-------NW....AL----SI...F---YI..IY...LLFEVPS.NVL..LK....A.L.....G---..PR-
Y2456_MYCTU/16-365S.....I-------GF....VM----AV...G---GI..AA...IVAQTPI.GAL..VD....RTT.....A---..KR-
Q19845_CAEEL/45-446S.....F-------GI....VV----AM...Y---SV..SQ...AIFSPVF.GFW..SN....R.I.....G---..QV-
YHJO_BACSU/19-353M.....P-------ML....II----SL...Q---PF..AD...IFLTLAA.GRV..TD....R.L.....G---..RR-
Q8ZVF8_PYRAE/4-322V.....I-------GA....IV----ST...A---FF..VS...IIARPLS.GLL..GE....K.M.....G---..YS-
O58825_PYRHO/10-360......S-------GT....MM----SA...F---VMAELIP.RIILNPLA.GVI..GD....R.Y......---..NR-
A0A029L256_ECOLX/8-341A.....A-------GH....MI----SY...Y---AL..GV...VVGAPII.ALF..SS....R.Y.....S---..LK-
Q9L8Q4_PSEST/17-351Q.....L-------GW....LT----AS..TF---GL.......AALLSPWAGAL..VQ....R.M.....G---..TR-
Q9XXC1_CAEEL/44-436Q.....K-------SL....GF----AA...G---FL..GA...IAAVVPM.SRL..TA....R.F.....G---..VH-
Y4007_STRCO/39-376A.....V-------AW....LA----SV...A---QL..GY...AAGLLFF.APL..GD....S.V.....N---..RR-
Q8YQ15_NOSS1/8-358V.....I-------GF......----.....L---GLLILP...SGLKFLW.SPF..ID....R.YRLGKLG---..HY-
O93992_CANAX/65-459V.....A-------IL....NI----SF...F---IL..GL...GTGGCFL.SPI..SE....F.H.....G---..RR-
Q8YWH2_NOSS1/17-343V.....I-------GA....NS----TL...Y---FF..II...AIGTPLVTKIL........RQI.....G---..LR-
Q9RSM6_DEIRA/32-418L.....Y-------GW....AS----SA...F---ML..AN...LLGAIVA.GLL..TD....R.R.....G---..AA-
Q9VDS0_DROME/61-500S.....L-------IMQFNLVC----LRDIFV---AW..TQYWHLFGVLVG.GVM..GT....KMM....LG---ISPR-
Q9I0Y2_PSEAE/28-357S......-------......LL----TVLPVL---CM..GL...VALLLPWLGRW..........L.....A---..EH-
Q92TU0_RHIME/19-421E.....F-------AW....LD----VG...Y---TT..FK...LIGFMAA.SWL..MS....R.F.....D---..PR-
I3XGH7_RHIFR/18-362V.....F-------GLAGIGVY----VC...P---ML..GV...SLTSAFW.GRM..GD....R.Y.....G---..NR-
Q8XGP2_RALSO/41-431T.....I-------IW....VT----NA...Y---QI..AM...IAALLPF.AAL..GE....S.I.....G---..YR-
YFIS_BACSU/15-364D.....M-------SL....LM----MS...F---AL..PV...IVLGPVS.GLL..AD....R.F.....D---..RK-
Q92BU8_LISIN/14-347Q.....V-------EM....LF----TA...Y---IF..TM...AIMMIPI.GIV..AG....K.L.....G---..DK-
Q55937_SYNY3/19-365G.....A-------GLILAGAL----TL...R---VT..VF...VLLSPIA.GAI..AD....R.Y.....D---..RK-
Q9A856_CAUCR/31-388D.....Y-------AN....LV----FY...F---QL..SY...AVAYLVW.GKV..MD....K.I.....G---..AR-
D6EJD0_STRLI/29-361M.....A-------GL....MM----TM...P---GF..LA...AVSAPVV.TVA..TG....R.I......---..DR-
Q97BG6_THEVO/17-357I.....T-------GL....IL----GS...S---AI..AM...AFVQYYS.GRW..TD....R.I.....G---..RR-
Q9X4X9_9PSED/27-377E.....L-------QA....CI----T....F---LF..GG...AVISLQLVGWF..NL....R.Y.....G---..IK-
Q973J7_SULTO/8-320L.....I-------GE....IL----SG...S---II..AS...TFLSLLW.GVL..GD....A.Y.....G---..RK-
O32859_MYCFO/12-364D.....A-------SI....VA----MA...G---TL..PL...LVATLIA.GAA..VD....Y.L.....G---..RR-
Q9S243_STRCO/13-352A.....V-------GV....IA----GV...Y---AL..LP...LFAAVPL.GRR..TD....H.......G---..RC-
Q8DNZ1_STRR6/13-344Q.....I-------EL....LV----SL...P---SF