Sequence alignment for CL0015

PF03825

YEGT_ECOLI/1-405----------------------------MKTTAKLSFMM----------------FVEWFI-W-----GA----------
NUPG_SHIFL/1-407----------------------------MNLKLQLKILS----------------FLQFCL-W-----GS----------
Q9A7U2_CAUCR/1-395----------------------------MGTSFRLFVMM----------------VLQLAI-W-----GA----------
XAPB_ECOLI/1-407----------------------------MSIAMRLKVMS----------------FLQYFI-W-----GS----------

PF07690

O17785_CAEEL/33-439----------------------------------VICTL----------------CLSIAQ-S-----DT..........
Y2994_MYCTU/18-356----------------------------------SLGVT----------------ASSFLF-I-----NG..........
ANTR2_ARATH/137-500----------------------------------LCFSS----------------FLLCNM-D-----RV..........
Q19296_CAEEL/16-403----------------------------------LIPAL----------------ICNMLA-F-----TS..........
A9CFQ9_AGRT5/27-373----------------------------------AVGTQ----------------TAGSFV-S-----QG..........
Q8NW16_STAAW/10-348----------------------------------LVIGM----------------ALNITG-S-----SF..........
O25793_HELPY/8-347----------------------------------LALVS----------------SLRFLG-L-----FI..........
Q97XW7_SULSO/20-385----------------------------------LMFAS----------------LAIGYF-M-----WG..........
P72184_9ACTO/22-419----------------------------------LVVGG----------------ITAIMD-T-----TI..........
O66589_AQUAE/21-406----------------------------------ASFIY----------------FDHSFS-I-----WL..........
Q9I0P8_PSEAE/19-362----------------------------------VAIML----------------GPTGIL-L-----NT..........
MFSD9_HUMAN/49-427----------------------------------LYLVG----------------FLDLFG-V-----SM..........
Q97CG2_THEVO/16-347----------------------------------VAVIE----------------VLRMFG-I-----FL..........
Q9CF47_LACLA/24-427----------------------------------LLVAI----------------FAFQLN-A-----SM..........
Q92RK8_RHIME/23-360----------------------------------VSFCH----------------MLNDIM-Q-----SL..........
Q8YC70_BRUME/8-339----------------------------------AAIAT----------------ISAVGA-A-----IG..........
Q8Z8V3_SALTI/17-369----------------------------------LLILG----------------FASGLP-L-----AL..........
Q8NU65_CORGL/19-414----------------------------------SVLTF----------------WLFAQS-T-----LN..........
Q9YG70_AERPE/18-417----------------------------------LALTA----------------FLVMYV-E-----AV..........
Q9HLN0_THEAC/12-329----------------------------------VMSMN----------------SLYQYS-W-----NV..........
Q8XR21_RALSO/30-433----------------------------------ALAIH----------------LCIGMA-Y-----GF..........
Q932J3_STAAM/33-313----------------------------------IFIGY----------------AGYYLL-R-----KN..........
O87836_STRCO/61-422----------------------------------PWIGM----------------MGISSA-E-----YA..........
Q8NNT7_CORGL/10-351----------------------------------VLVAV----------------AAAFGS-W-----SL..........
Q92WR7_RHIME/13-355----------------------------------AGGLL----------------GCIAIG-A-----MF..........
Q8TZJ0_PYRFU/13-389----------------------------------LGFGF----------------FGISII-W-----SL..........
O58400_PYRHO/34-380----------------------------------FAIGM----------------FFANLA-W-----GI..........
Q9KRL8_VIBCH/16-353----------------------------------LAFGS----------------FLVFCN-L-----YL..........
Q9KWU2_SPHSX/13-348----------------------------------MSLMA----------------HVTMSG-G-----RV..........
LTAA_STAAW/18-353----------------------------------MLIIL----------------FLMEFA-R-----GM..........
Q8Y7M4_LISMO/13-349----------------------------------ITLIN----------------FVVYLV-Y-----YL..........
NART_STACT/13-344----------------------------------QTLSL----------------VAGFMV-W-----SI..........
Q9K646_BACHD/13-358----------------------------------LWIAQ----------------SVSALG-G-----TF..........
YLZ2_SCHPO/48-434----------------------------------ISSMT----------------FLNQYG-D-----SV..........
YWOG_BACSU/15-348----------------------------------VLLVN----------------LFVFVF-F-----YT..........
Q8WZT8_NEUCS/132-490----------------------------------MCLIS----------------LSNGMS-D-----SA..........
O54179_STRCO/33-428----------------------------------LLVAQ----------------FMLAVD-F-----SI..........
Q98B83_RHILO/60-407----------------------------------GLLLF----------------FCAGFA-D-----GA..........
Q46984_ECOLX/39-413----------------------------------FLFVL----------------FIFSFL-D-----RI..........
Q9EYN6_SYNPW/18-450----------------------------------TWFAF----------------FLTFVV-W-----FN..........
Q9KBG2_BACHD/16-398----------------------------------VMCTL----------------ALSAMS-V-----LI..........
Q986N1_RHILO/24-356----------------------------------LLTGC----------------IAVIGS-N-----SL..........
Q93LX8_9ACTO/30-425----------------------------------LAANM----------------LIDALE-V-----SV..........
Q8KDQ3_CHLTE/9-374----------------------------------LFLTV----------------LLDLIG-F-----GI..........
Q9PCL3_XYLFA/32-422----------------------------------VLLGF----------------FVITLD-A-----VV..........
Q9URI1_CANAX/123-512----------------------------------ISFLT----------------TSVYMG-S-----AV..........
Q9KRK6_VIBCH/22-366----------------------------------LGALG----------------ALTPLA-I-----DM..........
Q92Y26_RHIME/19-357----------------------------------VVGAG----------------VVSAFQ-V-----GK..........
Q9RSF5_DEIRA/46-397----------------------------------LFLTI----------------FIAMLG-L-----SV..........
Q8WU09_HUMAN/27-274----------------------------------FFLVN----------------VFVMGM-T-----KT..........
LIZ1_SCHPO/36-407----------------------------------CCVSY----------------FINYLD-R-----SS..........
Q97IY3_CLOAB/13-357----------------------------------YLIGI----------------FISGIG-T-----KL..........
Q9I008_PSEAE/29-430----------------------------------GLLGV----------------LLASLT-A-----GLN.........
Q9HTX1_PSEAE/12-346----------------------------------LFLCG----------------CAAFLN-L-----YT..........
Q9KYI2_STRCO/15-371----------------------------------IFSSV----------------FIDTFG-W-----GL..........
Q973W8_SULTO/12-335----------------------------------ISFSA----------------FFADLG-Y-----QA..........
Q18472_CAEEL/18-397----------------------------------GFLCL----------------ASVCSN-Y-----II..........
Q8ZXX0_PYRAE/10-352----------------------------------ILIAR----------------IGSGAS-A-----FL..........
Q9AA55_CAUCR/30-391----------------------------------LFGVS----------------VATALG-N-----TG..........
YN42_SCHPO/141-527----------------------------------LAYVA----------------LCSSFA-S-----SV..........
Q8NUU1_STAAW/16-376----------------------------------FFFIG----------------VIAYMD-R-----AN..........
Q961H2_DROME/54-453----------------------------------LEPAV----------------FLIFFA-R-----NL..........
Q8X543_ECO57/36-398----------------------------------IWLGY----------------ALFYFT-R-----KS..........
Q8KCE7_CHLTE/27-390----------------------------------FLFAS----------------FFSIGM-V-----TF..........
P95852_SULSF/9-333----------------------------------FTILV----------------FFTGLY-L-----GT..........
O45678_CAEEL/27-403----------------------------------TMFSG----------------TCVLYA-S-----RA..........
Q9I5C8_PSEAE/21-369----------------------------------ATFAQ----------------ACACFF-V-----QG..........
O30222_ARCFU/15-357----------------------------------GAMLA----------------FTVRWL-H-----YL..........
O54630_HALSA/24-368----------------------------------LVFAT----------------GLTIGS-E-----RT..........
Q8TR38_METAC/18-398----------------------------------LYTIT----------------FIGTLG-F-----GI..........
Q986D7_RHILO/41-396----------------------------------VAANA----------------SFSATF-S-----GI..........
O69759_PSEFL/31-392----------------------------------VTFCY----------------LFYYTG-R-----QT..........
Q9HLR9_THEAC/6-377----------------------------------WFASY----------------LMSSMA-S-----GI..........
Q8Z4K9_SALTI/13-352----------------------------------AHVCI----------------NFVLGG-V-----YA..........
O28944_ARCFU/4-328----------------------------------LILSG----------------FFAYAS-L-----SC..........
Q9KKX8_VIBCH/40-383----------------------------------VLIGT----------------LFARTS-F-----FM..........
Q96XQ4_SULTO/9-336----------------------------------VFISS----------------LSFFLS-Y-----FSR.........
Q8Y6H4_LISMO/13-376----------------------------------RLFGE----------------ALLDIS-F-----WM..........
O62376_CAEEL/16-394----------------------------------TFVSY----------------GLYHAS-R-----KAL.........
YCUD_SCHPO/89-473----------------------------------LFVAT----------------VYTFLE-V-----YV..........
Y1634_MYCTU/25-423----------------------------------LAGGV----------------ALYATN-E-----FL..........
Q9KG75_BACHD/5-341----------------------------------IYIIL----------------VVAFID-T-----FI..........
Q7JZE2_DROME/46-458----------------------------------AFLAT----------------CLHAAM-R-----NM..........
Q9KLN6_VIBCH/36-395----------------------------------LIFGY----------------AMFYVV-R-----MA..........
Q8P881_XANCP/26-418----------------------------------LACAI----------------FMEQMD-A-----TV..........
Q8PQ23_XANAC/19-356----------------------------------MAAAT----------------GLAVAS-N-----YY..........
YQ92_SCHPO/20-407----------------------------------IAIAL----------------FTDLFL-Y-----GI..........
O16697_CAEEL/36-432----------------------------------CIFLQ----------------FIVGVQ-I-----SV..........
Q8K8C8_STRP3/10-353----------------------------------AWLGN----------------FFTGAS-F-----SL..........
Q8X0G2_NEUCS/87-498----------------------------------LMSNV----------------FLYGFD-G-----TI..........
Q8XKW0_CLOPE/26-404----------------------------------LMIFA----------------LVIDNS-F-----KI..........
O58488_PYRHO/9-354----------------------------------LDTIL----------------MTAGFG-T-----LT..........
Q9K9F3_BACHD/14-368----------------------------------VTFLT----------------FLAVQG-V-----RL..........
O29880_ARCFU/11-360----------------------------------GFLLN----------------LMLGIV-Y-----AW..........
Q97C48_THEVO/19-351----------------------------------VSTAA----------------AVRSIG-Y-----GA..........
Q9Y7D4_ASPTE/35-449----------------------------------VTLVA----------------FLMLLD-M-----SI..........
Q97DX4_CLOAB/23-413----------------------------------LLLAG----------------FLSLFN-E-----TV..........
Q8MPU6_CAEEL/90-445----------------------------------LSLAN----------------LCSTIA-F-----SC..........
Q96Y06_SULTO/9-344----------------------------------TSISH----------------FINDGN-T-----WV..........
A9CIR5_AGRT5/18-359----------------------------------LVVIA----------------GVAALC-M-----NL..........
Q8ZWZ3_PYRAE/12-326----------------------------------VLFSR----------------GVYSLM-W-----FF..........
Q8X5A4_ECO57/20-357----------------------------------FLIVA----------------FLTGIA-G-----AL..........
Q9P397_NEUCS/52-417----------------------------------VTLLY----------------MLCFLD-R-----VN..........
Y2456_MYCTU/16-365----------------------------------LDLLN----------------FSLADV-R-----DG..........
Q19845_CAEEL/45-446----------------------------------AGSCA----------------FIQATQ-F-----AI..........
Q8NUX5_STAAW/12-354----------------------------------LYILT----------------LMFFSA-N-----AI..........
YHJO_BACSU/19-353----------------------------------RFFGE----------------LLTSLT-G-----AM..........
Q8ZVF8_PYRAE/4-322----------------------------------VNLAT----------------LLFFTA-N-----GI..........
O58825_PYRHO/10-360----------------------------------FSVGR----------------WISTAG-W-----TI..........
Q8X5A5_ECO57/8-341----------------------------------LALGT----------------FGLGMA-E-----FG..........
Q9L8Q4_PSEST/17-351----------------------------------LLLIA----------------MGMPMM-I-----FY..........
Q9XXC1_CAEEL/44-436----------------------------------FLLSS----------------IICYNA-C-----YV..........
Q9ADP8_STRCO/39-376----------------------------------IALCT----------------AVTAAN-I-----YL..........
Q8YQ15_NOSS1/8-358----------------------------------LATLY----------------ISQFIP-T-----TF..........
O93992_CANAX/65-459----------------------------------ISIGS----------------VCVTCI-S-----SS..........
Q8YWH2_NOSS1/17-343----------------------------------LYIVA----------------FLSGIS-L-----GL..........
Q9RSM6_DEIRA/32-418----------------------------------LLIVI----------------LVVAFE-S-----AA..........
Q9VDS0_DROME/61-500----------------------------------IFLCK----------------IPAAWF-M-----AC..........
Q9I0Y2_PSEAE/28-357----------------------------------IFCLG----------------INLRPI-L-----TG..........
Q92TU0_RHIME/19-421----------------------------------LVAGI----------------VLATLT-E-----AI..........
Q8RQC1_RHIFR/18-362----------------------------------LFGLQ----------------FISMGA-M-----EM..........
Q8XGP2_RALSO/41-431----------------------------------LMTAA----------------ILAALD-T-----TI..........
YFIS_BACSU/15-364----------------------------------LLASQ----------------TISSLG-D-----WL..........
Q92BU8_LISIN/14-347----------------------------------TAAAS----------------LLAFMG-I-----GV..........
Q55937_SYNY3/19-365----------------------------------LYLAQ----------------AISLLG-D-----AL..........
Q9A856_CAUCR/31-388----------------------------------LFLAM----------------VINYVD-R-----QT..........
P72472_STRLI/29-361----------------------------------VMLGI----------------FSIITT-E-----IL..........
Q97BG6_THEVO/17-357----------------------------------LALSR----------------LIRASG-R-----VS..........
Q9X4X9_9PSED/27-377----------------------------------AGVAI----------------SINAAL-L-----YG..........
Q973J7_SULTO/8-320----------------------------------LILSS----------------SLNGII-W-----GA..........
O32859_MYCFO/12-364----------------------------------ILFAA----------------LTAGAG-N-----GI..........
Q9S243_STRCO/13-352----------------------------------LVIAF----------------GFAQAA-V-----SM..........
Q97PK9_STRPN/13-344----------------------------------LSLVL----------------ITSFSI-S-----SA..........
Q97CC5_THEVO/27-411----------------------------------LFIAI----------------LFNYAD-R-----E...........
AMPG1_RICPR/10-405----------------------------------IWLFG----------------FISGFN-V-----MI..........
Q9RD97_STRCO/46-435----------------------------------TSAAT----------------AVALMA-F-----TA..........
Q8R8R3_THETN/20-398----------------------------------FLMLF----------------SVRFLR-K-----EINMTTL...KK
O30210_ARCFU/17-354----------------------------------LFGTL----------------FLFWYD-M-----GT..........
Q8X120_EXODE/120-524----------------------------------TVISA----------------AQLLTQ-A-----AL..........
Q9EW91_9ACTO/13-358----------------------------------YLIGQ----------------LTSNIG-T-----WM..........
Q8MMD6_DROME/21-407----------------------------------LFLSI----------------VVNYMA-K-----FN..........
Q8XVV0_RALSO/19-414----------------------------------GTLGA----------------MMATLD-I-----SI..........
Q978I2_THEVO/17-358----------------------------------LVSSV----------------WFSHTA-F-----SA..........
S22AI_MOUSE/13-363----------------------------------TYVLA----------------ALELTC-L-----FM..........
Q92XG9_RHIME/14-352----------------------------------ISFGT----------------VLGIAG-T-----DL..........
Q8P8I8_XANCP/24-370----------------------------------ILLYR----------------VSAMLS-Y-----QI..........
Q9I1Q7_PSEAE/34-397----------------------------------VFALT----------------VINLVD-R-----VS..........
Q9I4J1_PSEAE/26-388----------------------------------TWLAY----------------AAFYFT-R-----KA..........
Q9KG22_BACHD/29-373----------------------------------LWVAS----------------IFSGLS-F-----SI..........
Q9KYE9_STRCO/8-359----------------------------------IHVGN----------------ALSAFG-L-----GF..........
Q8K8F6_STRP3/27-401----------------------------------AFFGY----------------VCAYLV-R-----NN..........
O31131_BRELN/13-405----------------------------------ILLGG----------------VLLPLA-M-----SG..........
Q8PQM0_XANAC/29-361----------------------------------MSLCV----------------ALLIAS-E-----FM..........
Q9ZC50_YERPE/23-431----------------------------------IALAQ----------------ILMSFN-V-----AS..........
Q8U366_PYRFU/20-359----------------------------------LGLVS----------------FLNDMS-S-----EM..........
Q9C9R9_ARATH/11-379----------------------------------VNLAG----------------IMERAD-E-----SL..........
Q20265_CAEEL/46-427----------------------------------TLVQA----------------NVHVYN-F-----TV..........
Q9PCQ0_XYLFA/73-403----------------------------------LAMTG----------------FIAIVT-E-----TL..........
Q9I247_PSEAE/4-339----------------------------------IFSGY----------------FAAEGL-I-----YP..........
Q9VPX2_DROME/42-442----------------------------------VAMVA----------------MVNHTA-I-----KAHGDGGGHGGH
Q8Y3L9_LISMO/17-359----------------------------------LFIGY----------------TSVYVD-K-----YT..........
Q8VUK1_HALHD/23-380----------------------------------LSPLV----------------FALVFA-S-----WT..........
Q8RPH1_DESHA/13-347----------------------------------AISSV----------------SLLVMT-Y-----SS..........
A9CGF2_AGRT5/30-354----------------------------------MAPIG----------------IVAMLS-Q-----TH..........
O66181_ARTSP/15-353----------------------------------TIATI----------------TAVGFG-R-----MA..........
Q8KYU7_9PROT/15-359----------------------------------GALLT----------------LISSFG-Q-----TY..........
YJ7D_SCHPO/81-445----------------------------------MCITY----------------MIQYLD-K-----TA..........
Q8XEG8_ECO57/47-408----------------------------------LFFAA----------------VINYLD-R-----SS..........
Q9VY22_DROME/66-470----------------------------------VANNV----------------TVEPIL-A-----AY..........
Q8U4E5_PYRFU/8-345----------------------------------LNFST----------------LFFFLG-V-----SI..........
YFKL_BACSU/12-351----------------------------------MYINY----------------FFLGMV-N-----II..........
O30679_RHORH/8-341----------------------------------LGLAV----------------FAQGTS-E-----FM..........
Q97TH3_CLOAB/16-408----------------------------------IFLGS----------------FLVSLG-T-----ST..........
THI73_YEAST/86-451----------------------------------LCCTY----------------LLMFLD-K-----AL..........
Q9A961_CAUCR/19-356----------------------------------TYLMF----------------MMFAMT-T-----DS..........
Q97TH7_CLOAB/19-357----------------------------------LGLAG----------------FVSAAD-N-----WF..........
Q8NVE0_STAAW/12-398----------------------------------LILIM----------------FMSAIE-S-----SI..........
Q9VPD9_DROME/28-441----------------------------------AVIVT----------------FMHYFS-W-----GL..........
Q8PVU8_METMA/11-346----------------------------------LCITA----------------CFAMAG-G-----SL..........
Q8NVE2_STAAW/18-410----------------------------------MLISA----------------FVAILN-Q-----TL..........
Q97FI4_CLOAB/17-361----------------------------------LFLVQ----------------VINRLG-D-----FV..........
Q8KR58_ESCFE/20-359----------------------------------LALCA----------------GLLGIG-Q-----NG..........
Q8NLD6_CORGL/19-353----------------------------------MSFAA----------------FVYVTF-E-----MF..........
Q9LAA0_AERHY/27-362----------------------------------AAFIQ----------------LVSALD-F-----MM..........
O06742_BACIU/18-364----------------------------------IGSIP----------------LILTLG-N-----SM..........
Q9FCG1_STRCO/24-364----------------------------------LWTST----------------LVNRLG-A-----FV..........
O94019_CANAX/86-529----------------------------------FFIVI----------------FITAFT-A-----AT..........
MOT14_MOUSE/42-459----------------------------------SFFVH----------------ILIMGS-Q-----MA..........
Q92V77_RHIME/8-347----------------------------------LAVGS----------------FTMSTV-G-----FV..........
Q9Y7E0_ASPTE/42-435----------------------------------VSWMT----------------LVVTFS-S-----TC..........
Q9I431_PSEAE/11-401----------------------------------YLLGF----------------ALDLVN-I-----FI..........
O76837_CAEEL/25-400----------------------------------LIIGL----------------CCICCT-N-----AN..........
Q96ZI2_SULTO/36-365----------------------------------IIPLT----------------IAIRAS-N-----NM..........
Q9L8R0_PSEST/7-367----------------------------------VGLQL----------------LFGWMN-L-----VLAV........
Q94886_DROME/14-423----------------------------------TFIGF----------------IVNYMI-R-----IN..........

PF00083

GTR4_MOUSE/27-483----------------------------------AVFSAVLGS.-----------LQFGYN-I-----GV----------
GTR1_MOUSE/14-467----------------------------------LAVGGAVLGS-----------LQFGYN-T-----GV----------
QUTD_EMENI/24-490----------------------------------LAAVASFTS.-----------CMIGYD-S-----AF----------
ITR2_YEAST/112-569----------------------------------LTFVASISG.-----------FMFGYD-T-----GY----------
SNF3_YEAST/100-556----------------------------------VGVFVAVGG.-----------FLFGYD-T-----GL----------
GALP_ECOLI/18-451----------------------------------VCFLAALAG.-----------LLFGLD-I-----GV----------
HXT5_YEAST/89-549----------------------------------CCLMVAFGG.-----------FVFGWD-T-----GT----------
GTR3_MOUSE/13-465----------------------------------AVTVATIGS.-----------FQFGYN-T-----GV----------
HXT9_YEAST/64-526----------------------------------LCLMIAFGG.-----------FIFGWD-T-----GT----------
HXT3_YEAST/65-525----------------------------------CCVMVAFGG.-----------FVFGWD-T-----GT----------
HXT8_YEAST/69-530----------------------------------MCLCMAFGG.-----------FMSGWD-T-----GT----------
YJHB_ECOLI/15-405----------------------------------KALFSAWLGY-----------VFDGFD-F-----MM----------
HXT6_YEAST/68-528----------------------------------MCIMIAFGG.-----------FVFGWD-T-----GT----------
SUT_SPIOL/38-486----------------------------------LGLVASVAAG-----------VQFGWA-L-----QL----------
GTR3_CHICK/14-464----------------------------------AVSVAAIGS.-----------LQFGYN-T-----GV----------
GTR5_HUMAN/20-475----------------------------------ATLIAAFGSS-----------FQYGYN-V-----AA----------
PRO1_LEIEN/95-540----------------------------------CKWFVSPTGS-----------SYCGWP-E-----VT----------
HXT13_YEAST/60-521----------------------------------LCYPISFGG.-----------FLPGWD-S-----GI----------
RAG1_KLULA/66-528----------------------------------CCVMVAFGG.-----------FVFGWD-T-----GT----------
YB91_YEAST/27-485----------------------------------GTIVACLGS.-----------IQYGYH-I-----AE----------
GTR1_LEIDO/5-442----------------------------------VMLCAALGG.-----------FLFGYD-T-----GV----------
HUP1_PARKE/30-492----------------------------------VAFMAACGG.-----------LLLGYD-N-----GV----------
PROP_ECOLI/25-453----------------------------------KAITAASLGN-----------AMEWFD-F-----GV----------
JEN1_YEAST/125-563----------------------------------VNPIPELRKM-----------TWQNWN-Y-----FF----------
GIT1_YEAST/43-466----------------------------------KNIVTIIASG-----------FALISD-G-----YV----------
GTR2_MOUSE/13-498----------------------------------TVFTAVLSS.-----------FQFGYD-I-----GV----------
HXT2_YEAST/59-519----------------------------------LCLMIAFGG.-----------FVFGWD-T-----GT----------
XYLE_ECOLI/13-478----------------------------------ITLVATLGG.-----------LLFGYD-T-----AV----------
LACP_KLULA/75-529----------------------------------LCFITYLCA.-----------TMQGYD-G-----AL----------
STP1_ARATH/26-489----------------------------------TCVVAAMGG.-----------LIFGYD-I-----GI----------
MAL31_YEAST/102-561----------------------------------WSLLVSTTL.-----------IQEGYD-T-----AI----------
GTR2_LEIDO/41-538----------------------------------VATPIILTP.-----------LLYGYN-L-----GF----------
Q57RP5_SALCH/23-420----------------------------------GNFLEQFDF.-----------FLFGFY-A-----TY----------
TH2A_TRYBB/39-502----------------------------------VAQVQVVGG.-----------TLNGFS-I-----GF----------
GTR3_HUMAN/12-465----------------------------------FAITVATIGS-----------FQFGYN-T-----GV----------
GTR2_HUMAN/13-499----------------------------------TVITAVLGS.-----------FQFGYD-I-----GV----------
TH12_TRYBB/39-501----------------------------------VAQVQVVGG.-----------TLNGYV-I-----GY----------
QAY_NEUCR/24-494----------------------------------CAAIASFAS.-----------CMIGYD-S-----AF----------
GLF_ZYMMO/13-469----------------------------------LALIAAIGG.-----------LLFGYD-S-----AV----------
HXT4_YEAST/74-534----------------------------------CCLMVAFGG.-----------FVFGWD-T-----GT----------
ITR1_YEAST/89-546----------------------------------LTFVASISG.-----------FMFGYD-T-----GY----------
STL1_YEAST/30-488----------------------------------FITIASMTGF-----------SLFGYD-Q-----GL----------
ARAE_ECOLI/25-461----------------------------------VSVAAAVAG.-----------LLFGLD-I-----GV----------
GAL2_YEAST/74-534----------------------------------LCLCVAFGG.-----------FMFGWD-T-----GT----------

PF05977

Q92LE2_RHIME/11-531----------------------------------STALAPLRNG-----------VFRSIW-T-----AS----------
Q98HB4_RHILO/11-532----------------------------------VSALAPFRHG-----------IFRAVW-S-----AS----------
Q92Y88_RHIME/8-530----------------------------------TSGFAPLRQK-----------VFAVLW-I-----AT----------
Q9X4X4_9PSED/20-540----------------------------------ASAWAPIRNR-----------SFRWLW-C-----GG----------
A9CFW7_AGRT5/8-530----------------------------------ASSFAPLAQP-----------VFAVLW-A-----AT----------
Q9HYE1_PSEAE/25-549----------------------------------TGTWAPFSIQ-----------AFRIIW-I-----CN----------
Q989L4_RHILO/31-551----------------------------------SATFPPLENS-----------TFRPIW-I-----AT----------
Q92SW7_RHIME/14-535----------------------------------ISPLAPFRHD-----------IFRTIW-I-----AS----------
Q989T8_RHILO/11-532----------------------------------PAAFAPLRNS-----------TFRSIW-L-----AI----------
Q9I0E1_PSEAE/6-529----------------------------------ASPWSPLRQT-----------TFRWLW-L-----AS----------

PF01306

LACY_CITFR/1-412----------------------------MYYLKNTNFWMFGFFF-----------FFYFFI.M-----GA----------
RAFB_ECOLX/4-415----------------------------ASTHKNTDFWIFGLFF-----------FLYFFI.M-----AT----------
CSCB_ECOLX/4-411----------------------------NIPFRN.AYYRFASSY-----------SFLFFISW-----SL----------
LACY_KLEOX/6-416----------------------------LAPRERHNFIYFMLFF-----------FFYYFI.M-----SA----------

PF03137

SO2A1_RAT/31-603----------------------------------IKV------------------FVLCHGLL-----QL----------
SO1B2_RAT/27-616----------------------------------FKL------------------FLAALSFS-----YI----------
SO2B1_HUMAN/48-648----------------------------------IKL------------------FVLCHSLL-----QL----------
SO3A1_HUMAN/39-623----------------------------------IKI------------------FLVSECAL-----ML----------
Q20702_CAEEL/102-763----------------------------------QLP------------------MIVLLCVY-----CS----------
SO2A1_HUMAN/31-603----------------------------------IKV------------------FVLCQGLL-----QL----------
Q9VVH9_DROME/173-755----------------------------------THV------------------FMVVFLLA-----YI----------
Q93550_CAEEL/16-587----------------------------------INI------------------FVLLMVLV-----IA----------
Q9W271_DROME/65-627----------------------------------EHM------------------YVILYGLA-----GC----------
SO1A3_RAT/19-598----------------------------------IKV------------------FLMALTCA-----YV----------
SO1B1_HUMAN/27-622----------------------------------LKM------------------FLAALSLS-----FI----------
Q21157_CAEEL/48-598----------------------------------FIP------------------FMSILSAN-----AM----------
SO4A1_HUMAN/102-664----------------------------------PKG------------------ILFFLCAA-----AF----------
Q9XWC5_CAEEL/47-621----------------------------------AKC------------------LLVVLGIC-----AF----------
Q9W269_DROME/110-732----------------------------------QTA------------------YVLLYGIV-----GC----------
SO1A2_HUMAN/19-598----------------------------------LKM------------------FLLAITCA-----FV----------

PF06779

Q89X18_BRAJA/64-148--------------------------------------------------------------T-----VG----------
Q92UK2_RHIME/2-86--------------------------------------------------------------A-----VA----------
Q8YFG7_BRUME/2-86--------------------------------------------------------------A-----AA----------
Q986E3_RHILO/35-119--------------------------------------------------------------A-----VA----------
Q8Z0X3_SALTI/24-110--------------------------------------------------------------T-----LG----------
Q9I3T2_PSEAE/21-105--------------------------------------------------------------V-----VA----------
Q88ED9_PSEPK/15-99--------------------------------------------------------------M-----MA----------
Q89HQ1_BRAJA/50-128--------------------------------------------------------------.-----VG----------
A9CI18_AGRT5/24-108--------------------------------------------------------------A-----SA----------
Q8Y185_RALSO/37-119--------------------------------------------------------------S-----VA----------
Q87ES9_XYLFT/27-113--------------------------------------------------------------S-----LG----------
YJIJ_ECOLI/24-110--------------------------------------------------------------T-----LG----------

PF06609

Q8NII4_FUSAU/1-598MTATVHEKGVDLESQPDDRLRAQALATTADELPEGYYTSPRVIA-----------SFAGFS-L-----NV----------
Q9C1B3_FUSSP/1-598MTVVVPEEGLDLESQPDDRMRAKALATSAAELPDGYYRSPRIVA-----------SFAAFS-M-----NV----------

PF12832

A7SQQ8_NEMVE/55-132-------------------------------------------------------ALLIYK-------------------
Q6FB61_ACIAD/6-82-------------------------------------------------------ITTKLG-------------------
B7P8Y1_IXOSC/9-85-------------------------------------------------------KLLPLM-------------------
Q17GA0_AEDAE/14-90-------------------------------------------------------NLISLK-------------------
A7RI07_NEMVE/54-130-------------------------------------------------------KLLSYK-------------------
A4Y888_SHEPC/10-86-------------------------------------------------------QLRWLC-------------------
A4BSZ3_9GAMM/7-83-------------------------------------------------------PYWRLA-------------------
Q2BMQ1_9GAMM/3-79-------------------------------------------------------SYIRLS-------------------
Q54SK7_DICDI/682-755-------------------------------------------------------GFAYIV-------------------
A7EK42_SCLS1/450-504-------------------------------------------------------MLTFLG-------------------
B2AA42_PODAN/619-697-------------------------------------------------------MLAFLG-------------------
A1WY15_HALHL/14-90-------------------------------------------------------PYWRLS-------------------
Q54G39_DICDI/12-88-------------------------------------------------------KHTNIK-------------------
B3PHF3_CELJU/15-91-------------------------------------------------------PYWRLS-------------------
Q07ZQ8_SHEFN/10-86-------------------------------------------------------DLRWLS-------------------
D3SB25_THISK/3-79-------------------------------------------------------PSARLS-------------------
B0X8B9_CULQU/11-87-------------------------------------------------------HCLSLK-------------------
YJBC_SCHPO/418-493-------------------------------------------------------MLSFLG-------------------
Q16KC8_AEDAE/34-110-------------------------------------------------------HLVLMK-------------------
Q21IX9_SACD2/5-81-------------------------------------------------------PYWRLA-------------------
B4G7T5_DROPE/36-112-------------------------------------------------------NLIMLK-------------------
C3YMP2_BRAFL/14-90-------------------------------------------------------DLLVVK-------------------
Q0A9B1_ALHEH/6-82-------------------------------------------------------PYWRLS-------------------
A3QFN3_SHELP/24-100-------------------------------------------------------QLHWIS-------------------
Q55CH3_DICDI/11-87-------------------------------------------------------RHTNLK-------------------
B8GQD4_THISH/5-81-------------------------------------------------------PYWKLS-------------------
A1S7K7_SHEAM/12-88-------------------------------------------------------QLRWLG-------------------
C5BL70_TERTT/2-78-------------------------------------------------------PYWRLS-------------------
B1KKS0_SHEWM/10-86-------------------------------------------------------QLRWIS-------------------
B0V728_ACIBY/7-83-------------------------------------------------------IQTRLG-------------------
B0W437_CULQU/30-106-------------------------------------------------------NLVLLK-------------------
A7UVG6_ANOGA/14-90-------------------------------------------------------NLISLK-------------------
Q2SJE3_HAHCH/5-81-------------------------------------------------------PIWKLA-------------------
B7PL10_IXOSC/7-83-------------------------------------------------------KELPMK-------------------
A7C0B5_9GAMM/6-82-------------------------------------------------------YYWRLS-------------------
A8PWD3_MALGO/544-619-------------------------------------------------------MLAFLG-------------------
B6C555_9GAMM/9-85-------------------------------------------------------PYWRLS-------------------
B6K1R3_SCHJY/414-489-------------------------------------------------------LMAFLG-------------------
Q4PB45_USTMA/688-764-------------------------------------------------------MLAFLG-------------------

PF01770

Q29L76_DROPS/2-397----------------------------------EYWLK----------------ISLLLCTF-----GF----------
Q294A5_DROPS/2-414----------------------------------ESWLK----------------ISWVLCIF-----GF----------
Y2544_DICDI/95-457----------------------------------QE.IK----------------PFLKYCSF-----SF----------
Q9EQN9_MOUSE/28-459----------------------------------ECWFL----------------PTALLCAY-----GF----------
Q9VK64_DROME/2-395----------------------------------KSWLK----------------ISLLLCTF-----GF----------
Q9BTX8_HUMAN/23-434----------------------------------RSWRR----------------LVCYLCFY-----GF----------
Q9VGV5_DROME/2-408----------------------------------KEWLK----------------ISCLLCVF-----GC----------
S19A3_HUMAN/10-441----------------------------------SSWIY----------------PTVILCLF-----GF----------
Q4T7Q4_TETNG/6-427----------------------------------ENWKY----------------PTFILCIY-----GF----------
Q6GN45_XENLA/68-474----------------------------------TQWKF----------------LLFYLCLY-----GF----------
Q17QC9_BOVIN/23-434----------------------------------QSWWC----------------LVFFLCFY-----GF----------
Q1LV16_DANRE/4-414----------------------------------SDWVF----------------PTVLLSLY-----GF----------
Q16JT2_AEDAE/2-405----------------------------------EQWGK----------------IAIVLTLF-----GF----------
Q6NRB3_XENLA/18-453----------------------------------GTWLL----------------PTCLLCAY-----GF----------
Q9VGV6_DROME/2-411----------------------------------ESWLK----------------ISCLLCIF-----GF----------
FOLT2_CAEEL/2-394----------------------------------EQW.K----------------VMVLICMY-----GA----------
Q542F3_MOUSE/23-427----------------------------------KSWRC----------------LVFYLCFF-----GF----------
Q28C92_XENTR/10-422----------------------------------SGWKY----------------PTILLCLF-----GF----------
Q6DIK7_XENTR/10-424----------------------------------SGWKF----------------PTVLLCLY-----GL----------
Q7Q5N2_ANOGA/2-422----------------------------------QPWLR----------------VSLLLCVF-----GF----------
A8BIM9_GIAIC/39-447----------------------------------GSFNA----------------LLFLQVLL-----GI----------
A7SN54_NEMVE/6-420----------------------------------EFWQK----------------ATLLLCLY-----GF----------
S19A3_MOUSE/11-435----------------------------------NSWVY----------------PTVILCLF-----GF----------
Q5ZMS7_CHICK/32-445----------------------------------QRWKL----------------QVFYLCFY-----GF----------

PF05631

Q9M3A1_ARATH/4-380----------------------------------FYYLVFGV-------------MAAVVAAL-----ELSKTNKDRINT
Q9N3A9_CAEEL/1-336----------------------------------MFVGVFYG-------------LAAVCGLL-----YFYTRSATESND
Q9FWD6_ORYSJ/4-357----------------------------------FYYLVFGG-------------LAAVVAGL-----ELGKSGKDRVAT

PF00854

PTR12_ARATH/99-497----------------------------------FVIFL-----------------------------------------
PTR17_ARATH/124-523----------------------------------YWTIA-----------------------------------------
YCLF_BACSU/95-444----------------------------------ANTVF-----------------------------------------
S15A2_HUMAN/111-494----------------------------------FKTII-----------------------------------------
DTPT_LACLC/90-449----------------------------------SRTIF-----------------------------------------
S15A1_RAT/81-476----------------------------------FKTIV-----------------------------------------
PEPT3_CAEEL/82-469----------------------------------FKVIL-----------------------------------------
YJDL_ECOLI/75-420----------------------------------RTAVI-----------------------------------------
DTPA_ECOLI/88-431----------------------------------KRVIM-----------------------------------------
PTR2_ARATH/113-517----------------------------------YWTIA-----------------------------------------
PEPT1_CAEEL/113-557----------------------------------FWTIF-----------------------------------------
PTR2_YEAST/155-515----------------------------------YNTIC-----------------------------------------
PTR7_ARATH/99-507----------------------------------YLTIA-----------------------------------------
O22305_LOTJA/95-494----------------------------------FWTIT-----------------------------------------
PTR2_SCHPO/158-520----------------------------------YNTIV-----------------------------------------
PEPT1_DROME/101-444----------------------------------YKTIL-----------------------------------------
Q96400_CUCSA/121-513----------------------------------MVTIT-----------------------------------------
DTPD_ECOLI/76-426----------------------------------RMAVM-----------------------------------------
PTR2_CANAX/161-542----------------------------------WKAIQ-----------------------------------------
S15A1_HUMAN/81-475----------------------------------FKTIV-----------------------------------------
S15A1_RABIT/81-474----------------------------------FKTIV-----------------------------------------
PTR30_ARATH/96-491----------------------------------FWTFT-----------------------------------------
PEPT2_CAEEL/99-526----------------------------------FWTIF-----------------------------------------
S15A4_RAT/94-495----------------------------------ARAIL-----------------------------------------
DTPB_ECOLI/81-428----------------------------------KRTIV-----------------------------------------

PF06813

Q7XGH1_ORYSJ/34-288----------------------------------RWFMMLACMV-----------IMSASG-G-----TN----------
Q9LUF8_ARATH/16-265----------------------------------RWLVFVCAMW-----------VQSVAG-V-----GY----------
Q8H613_ORYSJ/14-261----------------------------------PWVGLGAAVW-----------VQVAGG-A-----SS----------
Q94D97_ORYSJ/8-252----------------------------------HWLSLVGSIW-----------LQTING-P-----NS----------
Q9C862_ARATH/7-251----------------------------------KWTVLVAAIW-----------IQASTG-T-----NF----------
O81121_ARATH/16-263----------------------------------RWLVFVAAMW-----------IQSCAG-I-----GY----------
O81120_LOTJA/26-271----------------------------------RWFMMLASFM-----------IMAVSG-A-----SY----------
Q9M8M1_ARATH/13-260----------------------------------PWVGLAAAAW-----------VQVSAG-S-----GS----------
Q9ZUV4_ARATH/17-262----------------------------------RWFMVFASFL-----------IMACAG-A-----TY----------
O22926_ARATH/7-235----------------------------------PWLSLVAILW-----------LQSFNG-T-----NL----------
O80960_ARATH/21-266----------------------------------RWFMFFGSLL-----------IMSTAG-A-----TY----------
Q8H6R3_PONTR/13-260----------------------------------PWVGLAAAVW-----------VEIAAG-N-----AY----------
Q8H132_ARATH/7-253----------------------------------KWMILVATIW-----------IQAFTG-T-----NF----------
Q9SLF1_ARATH/14-260----------------------------------KWLGFVTAVW-----------VQSISG-N-----NY----------
Q9SS92_ARATH/41-290----------------------------------RWTVLVAAIW-----------IQAFTG-T-----NF----------

PF05978

Q19933_CAEEL/13-169----------------------------------LSISI----------------VILFSA-------------------
Q9XV34_CAEEL/12-166----------------------------------LAFGF----------------FVNFVA-------------------
MFS11_MOUSE/14-166----------------------------------LGVAF----------------MFMFTA-------------------
Q8MYL9_CAEEL/14-170----------------------------------LGLGQ----------------LCIMVG-------------------
Q965T3_CAEEL/14-170----------------------------------VSTSF----------------LILFSA-------------------
P91007_CAEEL/16-172----------------------------------LGFAQ----------------LCMNTA-------------------
Q9XWR7_CAEEL/37-194----------------------------------LGIGT----------------LFLYTG-------------------
Q19932_CAEEL/14-169----------------------------------LSVSF----------------MLLFFA-------------------
Q21545_CAEEL/14-168----------------------------------LGFGF----------------FATFFA-------------------
O61865_CAEEL/27-183----------------------------------LGFGH----------------LCIMTG-------------------
Q18251_CAEEL/11-167----------------------------------LGASF----------------AFIFSA-------------------

PF07672

Q8EUQ6_MYCPE/191-477----------------------------------KD.RP----------------KFMTINQF-----GF----------
Y077_MYCPN/209-467----------------------------------NRKKS----------------ILSNANFW-----GF----------
Q8EVP4_MYCPE/172-441----------------------------------NK.KS----------------KYIASNTF-----GL----------
Q9KX64_MYCGL/1-256----------------------------------MKTKT----------------TLSVINSF-----GF----------
Y076_MYCPN/210-484----------------------------------QRRKS----------------VLSNANLW-----GF----------
Q98PH4_MYCPU/154-430----------------------------------AKTKG----------------KISIFTTW-----GY----------
Y061_MYCGE/119-383----------------------------------NRKKS----------------ILSNANLW-----GF----------

PF02487

CLN3_CANFA/37-438----------------------------------NVMGF----------------WLLGLCNN-----FS----------
BTN1_YEAST/8-397----------------------------------IYCYF----------------WLFGLINN-----VL----------

PF03219

A6XGR5_9CHLO/42-534----------------------------------SASSDASKPA...........EKKHFLGV-----APLTWAK-----
TLC2_ARATH/88-571----------------------------------FDEGDTAAMA...........VSPKIFGV-----EVTTLKK-----
TLCB_RICCN/9-501----------------------------------TIWNKARNSK...........FRHIVWPI-----RSYELTK-----
Q842J1_9RICK/3-491----------------------------------NSQKSSFTAE...........LRRVFWPI-----EWHENKK-----
TLC1_CHLTR/2-492----------------------------------TQTAEKPFGK...........LRSFLWPI-----HMHELKK-----
Q70GF8_9CHLA/1-443----------------------------------IA...........................-----.......-----
Q6MEN4_PARUW/1-484----------------------------------MSQQESEFGK...........LRAFFWPI-----HGHEVKK-----
TLCD_RICFE/12-503----------------------------------PSKINSRFSK...........LTDYIWPI-----KRHEVSK-----
Q9X9D2_CHLTH/1-500----------------------------------MSSEVKSFSK...........FRGYFFPI-----YRSEFSK-----
Q8WH67_GALSU/142-638----------------------------------FLQANGSAGSTDGSASVGADGIAKALPP.-----.KNELKK-----
Q6H8E4_ORYSJ/76-563----------------------------------SAAAPEPVGS...........ASPKFLGV-----ETKTLKK-----
Q252Y6_CHLFF/2-510----------------------------------QSSEMKSFSR...........LRAYFCPI-----YRSEFPK-----
A5CCY4_ORITB/4-486----------------------------------GMNTNQTFNK...........LRQIFWPI-----EYHENKK-----
Q71JS5_9CHLA/2-490----------------------------------TNESKPEFGP...........LRSFFWPV-----HNYELRK-----
A5CDU3_ORITB/11-501----------------------------------SYLQKLRNSK...........LRQILWPI-----RSPELMK-----
Q6MBI2_PARUW/1-474----------------------------------MKNQQNSVSS...................-----TLLILKK-----
A8F0G0_RICM5/3-489----------------------------------TSKSDNYLSE...........LRKVIWPI-----ERYENKK-----
A8GSF7_RICRS/1-496----------------------------------MLPPKIFFEK...........VKEIIWPI-----ERKELKL-----
Q83W26_RICTP/4-496----------------------------------TSPSRSFKTK...........FRAAFWPV-----HNYELGK-----
A5CES7_ORITB/3-495----------------------------------ISKIKLFFSR...........LVIHLWPV-----HRHELQK-----
A5CCG2_ORITB/17-505----------------------------------RSSMSFNLSK...........IFNHIWPV-----HRCELPR-----
Q6MEN5_PARUW/4-499----------------------------------TPTGSREFSP...........WRSNLWPV-----HRYELKK-----
TLC2_CHLPN/2-503----------------------------------QSSEVKPFSR...........LRAYLCPI-----YKSEFSK-----
Q6MEM5_PARUW/2-491----------------------------------SQDAKQDFGK...........WRAFFWPV-----HGYELKK-----
A5CCG3_ORITB/1-504----------------------------------MQKTNI.LKK...........FTKALWPI-----ELHEMKL-----
Q8KPN2_HOLOB/2-501----------------------------------SNLSTSRMSK...........WRERLWPV-----YPEEMSI-----
Q1MSG2_LAWIP/9-504----------------------------------GSMPEEDFTG...........WRAILWPV-----YNFELKK-----

PF01733

S29A1_RAT/144-455----------------------------------MIKIV----------------LINS.F-G-----AI----------
S29A2_HUMAN/131-454----------------------------------MASVC----------------FINS.F-S-----AV----------
S29A1_HUMAN/144-454----------------------------------MIKIV----------------LINS.F-G-----AI----------
FUN26_YEAST/180-510----------------------------------IMMLV----------------VISSMG-T-----AM----------
Q19495_CAEEL/137-426----------------------------------LGMAT----------------SINF.S-N-----GL----------
Q21145_CAEEL/434-723----------------------------------LGTIV----------------VLNA.A-N-----GL----------
O64603_ARATH/145-428----------------------------------SAAVA----------------LSGL.G-D-----AL----------

PF03239

FTH1_YEAST/8-404----------------------------------SFQIF----------------FIFLRESL-----EI----------
EFEU_BACSU/9-395----------------------------------LFSLL----------------MVFGSAAH-----AE----------
Q9Y8Z4_AERPE/4-268----------------------------------ALATG----------------LVAFREAF-----EA----------
Y964_SYNY3/6-291----------------------------------GLPIF----------------IVTLREAL-----EA----------
FIP1_SCHPO/7-320----------------------------------SVAIF----------------FIVLRETL-----EA----------
EFEU_ECOLI/1-276----------------------------------MFVPF----------------LIMLREGL-----EA----------
O83937_TREPA/14-362----------------------------------VYGMG----------------CTMVAPGM-----PA----------
Q9ZC51_YERPE/156-557----------------------------------LLAQA----------------ISEYQDGK-----YA----------
Q9RKQ1_STRCO/1-274----------------------------------MFSNY----------------LIGLREGL-----EA----------
Q9ZDD8_RICPR/1-278----------------------------------MFKIA----------------LVVFRECL-----EI----------
FTR1_YEAST/7-321----------------------------------NVAVF----------------FVVFRECL-----EA----------
Y154_ARCFU/4-266----------------------------------MMGQM----------------VITLREGF-----EA----------
Q9WYP8_THEMA/2-266----------------------------------HLGAL----------------LITFREAL-----EA----------

PF13347

C3W9X3_FUSMR/14-452--------------------------------------D----------------KIG.YLFG...D.FG----------
Q8I3H5_PLAF7/62-507--------------------------------------E----------------KIRKLKLCTILS.FS----------
D2VB35_NAEGR/31-486--------------------------------------A----------------ILPTFLTSI.LD.VY----------
Q28K27_JANSC/6-401--------------------------------------P----------------SLPGYAVF.....AA----------
A6E455_9RHOB/14-411--------------------------------------P----------------RLPGYALF.....GA----------
B6AV21_9RHOB/12-414--------------------------------------S----------------ALGGYAVF.....AA----------
B9KP25_RHOSK/3-400--------------------------------------A----------------RLLPWSLL.....AG----------
A3V2V1_9RHOB/6-408--------------------------------------D----------------RLPAFSLF.....AA----------
A8TM36_9PROT/9-426--------------------------------------P----------------VLMAYGIP...G.LP----------
A7HQL5_PARL1/9-433--------------------------------------S----------------IYMHGSIG.....LP----------
Q73MQ4_TREDE/4-434--------------------------------------N----------------RWT.FGLG...T.IG----------
B2GBT3_LACF3/22-466--------------------------------------E----------------RIS.FCFG...N.LG----------
E7FT79_9LACO/16-461--------------------------------------S----------------KFA.FAMG...N.MG----------
C0WMV6_LACBU/20-464--------------------------------------S----------------RLS.YSFG...A.FG----------
D0DS55_LACFE/13-457--------------------------------------S----------------RIA.YSFG...A.FG----------
Q6SCS3_STRTR/10-454--------------------------------------S----------------RLS.YAAG...A.FG----------
B1SH60_9STRE/18-462--------------------------------------S----------------RIS.YAFG...A.FG----------
C8P5V7_9LACO/2-447--------------------------------------K----------------KYFAYALG...T.FG----------
Q03PA7_LACBA/3-451--------------------------------------K----------------QYLSYAAG...A.LG----------
C5RC37_WEIPA/5-451--------------------------------------K----------------QYLSYAAG...A.FG----------
C7XWC4_9LACO/5-449--------------------------------------K----------------NIICYGLG...A.FG----------
B0NX91_9CLOT/12-438--------------------------------------V----------------KYT.FAFG...A.LG----------
C3WB69_FUSMR/6-433--------------------------------------M----------------KLS.YGIG...A.LG----------
C0BFD6_9FIRM/20-452--------------------------------------E----------------KLC.FGIG...A.IG----------
C3WEF2_FUSMR/7-437--------------------------------------E----------------KYS.FGIG...A.FG----------
C9QHC7_VIBOR/7-438--------------------------------------T----------------KLS.YGFG...A.FG----------
C0BCF9_9FIRM/22-465--------------------------------------E----------------KFA.YGIG...A.VG----------
C4Z9B4_EUBR3/7-441--------------------------------------Q----------------KCA.FGFG...A.FG----------
B7GTV4_BIFLS/22-444--------------------------------------E----------------YVAYFCYG.....FG----------
B3W8U5_LACCB/11-452--------------------------------------D----------------RQTLFGINT.MG.LM----------
B0NCA5_EUBSP/62-493--------------------------------------N----------------KVG.YGSG...D.IA----------
D4L2L1_9FIRM/9-431--------------------------------------E----------------KIS.YGLY...F.MG----------
A6DP62_9BACT/9-590--------------------------------------E----------------KFG.YGLG...D.LA----------
A6G4R1_9DELT/26-447--------------------------------------E----------------KLG.YGFG...D.LG----------
A4AAW4_9GAMM/15-443--------------------------------------E----------------KVG.YGLG...D.MA----------
C1MDP3_9ENTR/24-449--------------------------------------E----------------KIG.YGLG...D.AG----------
D2ZB78_9ENTR/9-430--------------------------------------E----------------KIS.YGLG...D.MA----------
E6WJ95_PANSA/9-430--------------------------------------E----------------KIS.YGLG...D.MA----------
B2NKK3_ECO57/10-432--------------------------------------E----------------KIG.YGMG...D.AA----------
C9XVR9_CROTZ/33-456--------------------------------------E----------------KIG.YGMG...D.AG----------
D1RSQ2_SEROD/19-442--------------------------------------E----------------KVG.YGMG...D.AG----------
D4GIM8_PANAM/27-451--------------------------------------E----------------KAG.FGAG...D.AA----------
D1RQG9_SEROD/8-433--------------------------------------E----------------KIG.YGLG...D.GA----------
D0KF27_PECWW/10-433--------------------------------------E----------------KIG.YGLG...D.TA----------
D3RGD6_KLEVT/10-434--------------------------------------E----------------KFS.YGLG...D.TG----------
D2TGV7_CITRI/11-433--------------------------------------D----------------KIG.YGLG...D.MA----------
B1ZS00_OPITP/13-436--------------------------------------E----------------KIG.FGAG...D.AA----------
B3HTC5_ECOLX/7-428--------------------------------------E----------------KIG.FGAG...D.MA----------
A6DPD4_9BACT/7-427--------------------------------------S----------------NIFAYSLG...D.LG----------
D4F9L7_EDWTA/8-430--------------------------------------R----------------AVIGYGCG...D.MA----------
D4BGD4_9ENTR/25-444--------------------------------------A----------------SLASYVLG...G.IG----------
B0NC69_EUBSP/24-452--------------------------------------R----------------KLA.FGSG...E.IV----------
A8RLH8_9CLOT/23-450--------------------------------------K----------------RMY.YALG...D.FG----------
C6JEB9_9FIRM/14-438--------------------------------------S----------------KIA.YGFG...D.VG----------
C6PWS4_9CLOT/17-439--------------------------------------E----------------KIS.YGFG...D.FG----------
Q97L68_CLOAB/8-431--------------------------------------E----------------KIS.YGLG...D.FG----------
A9QSF4_LACLK/37-463--------------------------------------Q----------------QLL.YGFG...D.FG----------
A9MYD9_SALPB/15-438--------------------------------------E----------------KLA.YGAG...D.IG----------
D1PII8_9FIRM/14-445--------------------------------------D----------------KVG.YLFG...D.FG----------
C9BIA1_ENTFC/23-456--------------------------------------D----------------KLG.YMFG...D.LG----------
B1BWZ1_CLOPF/8-434--------------------------------------D----------------KIG.YTLG...D.LG----------
C8P9N3_9LACO/19-468--------------------------------------E----------------RIC.YGAG...D.LA----------
A4WD81_ENT38/20-469--------------------------------------E----------------RIG.YGMG...D.FA----------
D1BWG8_XYLCX/30-459--------------------------------------Q----------------RIG.FGSG...D.LA----------
C8P9N0_9LACO/19-447--------------------------------------Q----------------KFG.WATG...D.FA----------
Q04EN5_OENOB/11-431--------------------------------------E----------------RIS.YGLS...D.AA----------
Q5YU93_NOCFA/38-478--------------------------------------A----------------WLG.YLLG...P.SG----------
C6LHW9_9FIRM/40-483--------------------------------------E----------------MWLGYFAG...PCLL----------
A6NPU4_9FIRM/27-469--------------------------------------E----------------MLLGYFIGPFGALLS----------
A6TPY1_ALKMQ/8-433--------------------------------------G----------------IINAYGFG...E.LG----------
A6TPY6_ALKMQ/9-436--------------------------------------K----------------VVYGYGVP...D.LT----------
D4LG93_9FIRM/20-452--------------------------------------A----------------LKYFFGVG...D.AG----------
C9XL03_CLODC/24-461--------------------------------------K----------------KRAIYTYSSSIN.LA----------
C0D597_9CLOT/17-465--------------------------------------W----------------QIGFFSLN...N.CA----------
C5EQ37_9FIRM/9-441--------------------------------------K----------------EILGYTVGSIGDSTC----------
C5BVC3_BEUC1/22-453--------------------------------------E----------------KVL.IAMP.....LP----------
Q2G9N1_NOVAD/11-450--------------------------------------R----------------LALFNGLG...S.VA----------
Q2N8H6_ERYLH/11-453--------------------------------------R----------------IKLINGSG...A.VA----------
Q0AL93_MARMM/17-465--------------------------------------T----------------KLL.YGVG...S.MA----------
Q026U3_SOLUE/20-465--------------------------------------R----------------VKIMYGVGEIANAVK----------
Q0F3N0_9PROT/18-595--------------------------------------K----------------QKLAWGVGGFGENIA----------
A4AJK9_9ACTN/12-439--------------------------------------S----------------TIATYAIG...S.LG----------
E8WA27_STRFA/17-443--------------------------------------T----------------VRIGYGLG...S.LC----------
A1SNV8_NOCSJ/10-434--------------------------------------G----------------VRVGYGSG...S.VA----------
B9N6J9_POPTR/21-445--------------------------------------R----------------CVFYYGVGHMLNDIT----------
B8B7S1_ORYSI/21-442--------------------------------------V----------------PILSYGSGHMLNDIT----------
B5X2T0_SALSA/37-502--------------------------------------S----------------RKISYAVG...G.MP----------
Q5RFV6_DANRE/4-463--------------------------------------C----------------SKLCFAIG...G.AP----------
MFS2A_XENTR/36-494--------------------------------------C----------------SKICFAIG...G.AP----------
C3Z8Z9_BRAFL/14-394--------------------------------------V----------------AKLCYGIG...G.AG----------
D0KIC2_PECWW/8-445--------------------------------------K----------------HTFCYGSANLLGSGA----------
B1S9F4_9BIFI/13-474--------------------------------------I----------------SAIGYGMGDLYGGGQ----------

PF11700

AT221_EMENI/24-564----------------------------------TNKKE----------------LLGWYSYG-----WA----------
ATG22_CRYNJ/1-531----------------------------------MPPPH----------------VRAWYSYA-----FA----------
AT221_ASPFU/24-580----------------------------------TSKKE----------------LAGWYSYG-----WA----------
Q75EJ9_ASHGO/58-558----------------------------------RGRWV----------------FPAWLLVC-----FS----------
AT222_PHANO/72-634----------------------------------TSNKE----------------LSGFYMYG-----WA----------
AT222_ASPOR/30-578----------------------------------TSKRE----------------IWGWYAYG-----IA----------
Q0U0L9_PHANO/44-456----------------------------------ATKRA----------------LIAWLVLC-----FS----------
A5DD56_PICGU/47-524----------------------------------TTKWE----------------VLMYALYY-----FG----------
ATG22_COCIM/93-625----------------------------------TSKKE----------------LAGWYSYG-----WA----------
AT221_ASPNC/30-582----------------------------------TSKKE----------------LAGWYSYG-----WA----------
ATG22_SCHPO/13-525----------------------------------TTVWH----------------VLSWILYA-----VG----------
A7K364_VIBSE/8-434----------------------------------LTNKE----------------LMSYFGYG-----VG----------
B9LBL3_CHLSY/9-439----------------------------------DNRRE----------------QVGWYFYD-----WA----------
Q5B0Q4_EMENI/43-494----------------------------------TARLE----------------IWAYYAYY-----IG----------
Q4PA89_USTMA/59-561----------------------------------TGRYE----------------LWSFYIYY-----IG----------
ATG22_MAGO7/99-626----------------------------------TSEKE----------------LAGWYMYS-----FA----------
A6E856_9SPHI/5-431----------------------------------NDKKV----------------IRSWAFFD-----WA----------
ATG22_YARLI/6-582----------------------------------TTQKE----------------LYGWYAYA-----WA----------
Q26DY7_FLABB/8-443----------------------------------GHKKL----------------LHAWAFYD-----WA----------
ATG22_CANAL/39-496----------------------------------NKKSI----------------FHTWLLLC-----YS----------
ATG22_ASHGO/19-490----------------------------------ATNRN----------------VFGWYLYA-----FS----------
ATG22_KLULA/17-487----------------------------------QAKRN----------------IKGWYFYC-----FS----------
Q5KBK3_CRYNJ/49-483----------------------------------TTRKE----------------VWSWYIYY-----VG----------
AT221_PENCW/20-562----------------------------------TSKRE----------------LAGWYCYG-----WA----------
ATG22_YEAST/20-514----------------------------------KAQNN----------------IKGWYAYS-----FS----------
A1CD46_ASPCL/43-518----------------------------------NSKRA----------------LWGYLVLC-----FS----------
Q4JAW8_SULAC/5-379----------------------------------IRKDN----------------LISYFLLL-----FV----------
A3LP71_PICST/32-502----------------------------------AKKSI----------------YRAWLLLC-----YS----------
ATG22_NEUCR/155-689----------------------------------TSQKE----------------LAGWYAYA-----FA----------
Q6CKN0_KLULA/64-544----------------------------------DTRKT----------------YLVWLLIC-----FS----------
A7EQB6_SCLS1/56-534----------------------------------ATRKE----------------LWSYYAYY-----AG----------
AT221_BOTFB/21-562----------------------------------TTDRE----------------LRGFFCYG-----LA----------
AT222_ASPCL/24-579----------------------------------TSKKE----------------LAGWYSYG-----WA----------
Q0BZH6_HYPNA/25-469----------------------------------KLDRS----------------AWSWATYQ-----AG----------
AT222_EMENI/31-576----------------------------------TGRRE----------------IWGWYAYG-----VA----------
AT222_ASPTN/24-571----------------------------------TSKKE----------------LVGWYSYG-----WA----------
A6H0A9_FLAPJ/7-445----------------------------------GDKKL----------------LNAWAFYD-----WA----------
AT222_SCLS1/72-619----------------------------------TSRKE----------------LSGWYAYG-----FA----------
Q0CF56_ASPTN/43-493----------------------------------ATKWE----------------IWAYYSF.-----..----------
A1DH52_NEOFI/48-512----------------------------------TTKWE----------------IWAYYAYY-----IG----------
ATG22_VANPO/27-511----------------------------------RTKQN----------------IVGWYFYS-----FS----------
AT222_PENCW/33-580----------------------------------TSRRE----------------ILGWYSYG-----IA----------
Q0CXZ2_ASPTN/50-478----------------------------------TTKWE----------------IWAY..YA-----WV----------
AT221_ASPOR/20-571----------------------------------TSRKE----------------LAGWYSYS-----WA----------
Q0BXU5_HYPNA/23-495----------------------------------ALGKT----------------GFAWAWFE-----AA----------
Q0TYS2_PHANO/43-505----------------------------------TTRKE----------------IWSYYSYY-----VG----------
ATG22_PICAN/27-551----------------------------------TTGAE----------------VFGWCLYS-----WA----------
ATG22_CANGA/31-527----------------------------------AARDN----------------IKGWYLYS-----FS----------
Q8DIR0_THEEB/14-463----------------------------------GAPPS----------------LSLWTKLA-----FG----------
A4X7E0_SALTO/18-457----------------------------------SSRRE----------------RTGWYVYD-----WA----------

PF03209

Q9S313_RHOAC/55-461--------------------------------------------------------------------------------
PUCC_RHOCA/54-461--------------------------------------------------------------------------------
P73827_SYNY3/40-467--------------------------------------------------------------------------------
Q9Z5D5_RHOSH/28-417--------------------------------------------------------------------------------
PUCC_RHOS4/51-455--------------------------------------------------------------------------------
BCH2_RHOCB/28-418--------------------------------------------------------------------------------
PUCC_RHOSU/55-451--------------------------------------------------------------------------------
Q9RFD8_RHOSH/51-461--------------------------------------------------------------------------------
Q9S333_PROMR/1-414--------------------------------------------------------------------------------
YPUM_RHOCA/51-458--------------------------------------------------------------------------------
Q9RAD4_RUBGE/55-466--------------------------------------------------------------------------------

PF03092

Q55721_SYNY3/46-457-------------------------------------------------------------QG-----VL----------
O23028_ARATH/1-404-------------------------------------------------------------MG-----EA----------
Q9UAB7_LEIDO/75-654-------------------------------------------------------------RG-----VA----------
Q25272_LEIDO/59-606-------------------------------------------------------------KG-----LA----------
Q9SKZ5_ARATH/137-553-------------------------------------------------------------QG-----VL----------
Q9SQN2_ARATH/61-473-------------------------------------------------------------QG-----LG----------
Q9UAC0_LEIDO/76-655-------------------------------------------------------------KG-----VA----------
Q9UAB8_LEIDO/94-683-------------------------------------------------------------KG-----IA----------
Q9XIQ7_ARATH/30-441-------------------------------------------------------------QG-----FR----------
O68867_SYNE7/38-441-------------------------------------------------------------QG-----IL----------
Q07492_9TRYP/138-667-------------------------------------------------------------KG-----IA----------
Q9UAC1_LEIDO/75-651-------------------------------------------------------------RG-----VA----------

PF06963

S40A2_ARATH/31-479-------------------------------------RS----------------MVISLYLGYFLARWG----------
Q4WVQ3_ASPFU/39-421-------------------------------------RS----------------VLIRIYVSHFLSTWN----------
S40A1_ORYSJ/21-450-------------------------------------AA----------------LLRRLYVGHFLARWG----------
Q55HR8_CRYNB/34-481-------------------------------------TW----------------ALACLLLQHLSNTFN----------
S40A1_ARATH/35-483-------------------------------------RR----------------FVIYLYVGYFLARWS----------
A2R421_ASPNC/42-466-------------------------------------TR----------------ILFRLYISHFLSTWN----------
Q4RHW0_TETNG/8-534-------------------------------------KG----------------PKFLIYVSGALSMWG----------
Q2U620_ASPOR/31-411-------------------------------------KP----------------VLVRLYISHSLSTWN----------
Q5AXY5_EMENI/19-441-------------------------------------NR----------------VLLRLYTSHFLSTWN----------
Q8IA95_CAEEL/5-448-------------------------------------SG----------------KELQLNSAFLLTTLG----------
S40A3_ARATH/146-569-------------------------------------PE----------------GLYVLYASCLVGNLV----------
Q0CWF0_ASPTN/44-463-------------------------------------KH----------------VLFRLYVSHTLSTWN----------
Q4PD48_USTMA/82-563-------------------------------------AR----------------GTLLLAVQHATLSWG----------
S40A1_HUMAN/22-531-------------------------------------TS----------------AKFLLYLGHSLSTWG----------
A2Y023_ORYSI/145-569-------------------------------------PA----------------AMNALYAACLAGNAT----------
S40A1_DANRE/19-522-------------------------------------KS----------------AKFLIYVGHALSTWG----------
A8X2J9_CAEBR/13-461-------------------------------------SK----------------ASIFLYCAYISTCLE----------
A5BT51_VITVI/32-472-------------------------------------SS----------------LIIYLYVGHFLARWG----------
A1CBM9_ASPCL/39-469-------------------------------------KH----------------VLARLYVSHFLSTWN----------

PF13000

YHZ9_SCHPO/51-519----------------------------------NIYFL----------------ILLYLIQG-----VP----------
YB70_YEAST/17-560----------------------------------QFYLL----------------IMLYLAQG-----IP----------

PF03825

YEGT_ECOLI/1-405---WFVPL-------WL-WL--------------SKS------------------------------------------G
NUPG_SHIFL/1-407---WLTTL-------GS-YM--------------FVT------------------------------------------L
Q9A7U2_CAUCR/1-395---WAPKI-------FP-YM--------------GML------------------------------------------G
XAPB_ECOLI/1-407---WLVTL-------GS-YM--------------INT------------------------------------------L

PF07690

O17785_CAEEL/33-439...LTLNF.......TIICM..............SGDGAPVSNRSALTNLENMEMTLVNASGSLTDNVENMEHKIADGRY
Y2994_MYCTU/18-356...VAFLI.......P..RL..............ENA..........................................R
ANTR2_ARATH/137-500...NMSIA.......IL.PM..............SQE..........................................Y
Q19296_CAEEL/16-403...ILPLF.......PT.IL..............NYYSKEG.................................HRDWLY
A9CFQ9_AGRT5/27-373...IYILV.......P..FW..............REA..........................................F
Q8NW16_STAAW/10-348...LWPLN.......TI.YM..............KQE..........................................L
O25793_HELPY/8-347...VLPVI.......S..LY..............ADS..........................................F
Q97XW7_SULSO/20-385...VIASI..........................APL...........................................
P72184_9ACTO/22-419...VAIGM.......H..TL..............TEA..........................................L
O66589_AQUAE/21-406...LLGAL.......GP.FI..............AES..........................................F
Q9I0P8_PSEAE/19-362...FSLFI.......AP..M..............SAE..........................................Y
MFSD9_HUMAN/49-427...VVPLL.......SL.HV...............KS..........................................L
Q97CG2_THEVO/16-347...VVPVF.......T..LY..............GKL..........................................F
Q9CF47_LACLA/24-427...LSPAL.......V..TM..............QTQ..........................................L
Q92RK8_RHIME/23-360...LTALY.......P..LL..............KEN..........................................Y
Q8YC70_BRUME/8-339...LGIPL.......LS.VL..............LES..........................................R
Q8Z8V3_SALTI/17-369...TSGTL.......QA.WM..............TVE..........................................N
Q8NU65_CORGL/19-414...IGPDM..........................ATD..........................................L
Q9YG70_AERPE/18-417...LYTSV.......P..AI..............QAE..........................................L
Q9HLN0_THEAC/12-329...LEPMI.......SIDLH..............TST..........................................V
Q8XR21_RALSO/30-433...SVFWL.......PL.................SRA..........................................L
Q932J3_STAAM/33-313...FSLAM.......PA.................LQE..........................................Q
O87836_STRCO/61-422...FASAE.......DTLHE..............AQH...........................................
Q8NNT7_CORGL/10-351...LLPVV.......PLAVL..............NNG...........................................
Q92WR7_RHIME/13-355...SLPVF.......LV.PI..............SRD..........................................T
Q8TZJ0_PYRFU/13-389...YNAYI.......PI.FL..............QET..........................................F
O58400_PYRHO/34-380...GYPYL.......T..VY..............MKI..........................................I
Q9KRL8_VIBCH/16-353...FQPML.......P..YL..............ANH..........................................F
Q9KWU2_SPHSX/13-348...SASLF.......ALQHN..............DSN..........................................F
LTAA_STAAW/18-353...YILSY.......IN.FL..............PTV..........................................T
Q8Y7M4_LISMO/13-349...LMVII.......AV.IA..............QEE..........................................L
NART_STACT/13-344...IAPLM.......P..MI..............SQD..........................................I
Q9K646_BACHD/13-358...TTFTV.......SW.LM...........................................................Y
YLZ2_SCHPO/48-434...FAPSI.......S..NI..............AEQ..........................................F
YWOG_BACSU/15-348...FLTVL.......PI.YT..............LQE..........................................L
Q8WZT8_NEUCS/132-490...PGALI.......P..SI..............EKY..........................................Y
O54179_STRCO/33-428...LNVAL.......P..AI..............GDG..........................................L
Q98B83_RHILO/60-407...LMPFF.......PL.WA..............SSE..........................................A
Q46984_ECOLX/39-413...NIGFA.......GL.TM..............GRD..........................................L
Q9EYN6_SYNPW/18-450...LAPLA.......T..TV..............KAD..........................................L
Q9KBG2_BACHD/16-398...FNFVL.......A..DI..............QDT..........................................F
Q986N1_RHILO/24-356..VLGPIA.......P..AV..............ASS..........................................F
Q93LX8_9ACTO/30-425...ALVAL.......P..AI..............GDD..........................................L
Q8KDQ3_CHLTE/9-374...VLPLL.......P..TY..............AKE..........................................L
Q9PCL3_XYLFA/32-422...VNVAL.......P..TL..............AHD..........................................L
Q9URI1_CANAX/123-512...YTPGI.......E..EL..............MHD..........................................F
Q9KRK6_VIBCH/22-366...YLPAM.......P..TI..............ARD..........................................F
Q92Y26_RHIME/19-357...APAAL.......A..AV..............QGD..........................................L
Q9RSF5_DEIRA/46-397...LFPII.......GP..L..............GRQ..........................................L
Q8WU09_HUMAN/27-274...FAIFF.......V..VF..............QEE..........................................F
LIZ1_SCHPO/36-407...INNAY.......LS.GM..............QED..........................................L
Q97IY3_CLOAB/13-357...TTIAL.......ANKVIG...........FSGGD..........................................F
Q9I008_PSEAE/29-430..GHVTEI.......AMTDV..............RGA..........................................L
Q9HTX1_PSEAE/12-346...TQGIF.......D..EL..............AAS..........................................F
Q9KYI2_STRCO/15-371...FAPLA.......FL.YF..............SYN..........................................T
Q973W8_SULTO/12-335...AVASF.......PIIFV..............FY...........................................F
Q18472_CAEEL/18-397...INFTF.......I..CM..............KED..........................................N
Q8ZXX0_PYRAE/10-352..................VV..............KLA..........................................S
Q9AA55_CAUCR/30-391...MLSVL.......PA..............................................................I
YN42_SCHPO/141-527.....FAV.......PAEAI..............TTV..........................................F
Q8NUU1_STAAW/16-376...ISYIA.......KQ.MM...............DD..........................................L
Q961H2_DROME/54-453...IGAVY.......QNQILYQT........CITIEKFNAT.................................QCEPLL
Q8X543_ECO57/36-398...FNAAV.......PE.IL..............ANG..........................................V
Q8KCE7_CHLTE/27-390...VSIGQ.......AY.IL..............NEH..........................................L
P95852_SULSF/9-333...LRIII.......P..VF..............EKQ..........................................I
O45678_CAEEL/27-403...SLPIS.......AA.AV..............AKE..........................................F
Q9I5C8_PSEAE/21-369...IGAIA.......V..FV..............QND..........................................L
O30222_ARCFU/15-357...YSFTA.......P..QI..............MDE..........................................F
O54630_HALSA/24-368...VVPVL.......GEDVL..............GVE...........................................
Q8TR38_METAC/18-398...ILTFL.......V..FL..............VTK..........................................Y
Q986D7_RHILO/41-396...PATAV..........VL..............RQG..........................................Y
O69759_PSEFL/31-392...LGFAI.......P..GI..............QHD..........................................Y
Q9HLR9_THEAC/6-377...TNPMI.......PL.FV..............VVY..........................................L
Q8Z4K9_SALTI/13-352...FSYFK.......TP.LM...........................................................A
O28944_ARCFU/4-328...VIPII.......P..SY..............ASS..........................................L
Q9KKX8_VIBCH/40-383...AWPFL.......VV.FL..............YQD..........................................Y
Q96XQ4_SULTO/9-336..IAWSIV..........SV..............YSS..........................................L
Q8Y6H4_LISMO/13-376...VFPFL.......TI.YF..............SES..........................................I
O62376_CAEEL/16-394.SGVKSSI.......KADWL..............SNS..........................................S
YCUD_SCHPO/89-473...IWSST.......ACINF..............FDI..........................................Y
Y1634_MYCTU/25-423...TISLL.......PS.TI...............AD..........................................I
Q9KG75_BACHD/5-341...QLPII.......TPYAL................S..........................................L
Q7JZE2_DROME/46-458...LGMIILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCG.................................SPRVVF
Q9KLN6_VIBCH/36-395...LGVVK.......KPMLD..............AGI...........................................
Q8P881_XANCP/26-418...LATAL.......P..TL..............ARD..........................................F
Q8PQ23_XANAC/19-356...AQPLL.......E..TL..............AQA..........................................F
YQ92_SCHPO/20-407...ITPIL.......PF.SL..............VDR..........................................V
O16697_CAEEL/36-432...YYMSM.......WPYLS..............GLD..........................................K
Q8K8C8_STRP3/10-353...VMPFM.......A..LY..............VEN..........................................L
Q8X0G2_NEUCS/87-498...TAAVY.......S..II..............SAE..........................................F
Q8XKW0_CLOPE/26-404...ISPDL..........................AKA..........................................F
O58488_PYRHO/9-354...FMGVA.......KP.DI..............IHH..........................................F
Q9K9F3_BACHD/14-368...SFGAF.......VQ.PW..............ETE..........................................F
O29880_ARCFU/11-360...SVFVN.......PL.................MNT..........................................F
Q97C48_THEVO/19-351...TWPFM.......AV.YF..............NEY..........................................L
Q9Y7D4_ASPTE/35-449...IVTAI.......P..HI..............TAQ..........................................F
Q97DX4_CLOAB/23-413...LNVAF.......P..TL..............MKE..........................................M
Q8MPU6_CAEEL/90-445...IAPFY.......PAEAK..............LKN...........................................
Q96Y06_SULTO/9-344...LPTVY.......G..FM..............VKY..........................................L
A9CIR5_AGRT5/18-359...FLPSL.......SAMAL..............YFE..........................................I
Q8ZWZ3_PYRAE/12-326...LAPVL.......P..AI..............LRE..........................................F
Q8X5A4_ECO57/20-357...QTPTL.......SI.FL..............TDE..........................................V
Q9P397_NEUCS/52-417...IGNAR.......IQ.GL..............ATD..........................................L
Y2456_MYCTU/16-365...LGPYL.......SI.YL..............LLI..........................................H
Q19845_CAEEL/45-446...FFTSM.......YPYIL..............TLE..........................................H
Q8NUX5_STAAW/12-354...LNVFI.......P..LR..............GHD..........................................L
YHJO_BACSU/19-353...MGPFM.......VL.YL..............HEQ..........................................L
Q8ZVF8_PYRAE/4-322...AIIAI.......PP.YL...............RD..........................................L
O58825_PYRHO/10-360...QDVAV.......PL.YV..............LDK..........................................T
Q8X5A5_ECO57/8-341...IMGVL.......T..EL..............AHN..........................................V
Q9L8Q4_PSEST/17-351...AIGIL.......GP.HL..............VAD..........................................L
Q9XXC1_CAEEL/44-436...SMVNP.......QSSPY..............WED..........................................F
Q9ADP8_STRCO/39-376...AAPLL.......P..LI..............AHD..........................................M
Q8YQ15_NOSS1/8-358...FIQAL.......PV.FM..............RQQ..........................................K
O93992_CANAX/65-459...VALAT.......P..QI..............MEH..........................................L
Q8YWH2_NOSS1/17-343...FNPFI.......STLMK..............QNN...........................................
Q9RSM6_DEIRA/32-418...VGTMM.......P..RV..............ATE..........................................L
Q9VDS0_DROME/61-500...IIFTG.......PELYP..............GSE..........................................F
Q9I0Y2_PSEAE/28-357...IGPLL.......EEITA..............GTG..........................................L
Q92TU0_RHIME/19-421...ASTVL.......SL.GR..............GDI..........................................I
Q8RQC1_RHIFR/18-362...NGPFW.......P..IQ..............IKA..........................................L
Q8XGP2_RALSO/41-431...ANTAL.......P..EI..............AVD..........................................L
YFIS_BACSU/15-364...HILAV.......LT.LA..............AFQ..........................................L
Q92BU8_LISIN/14-347...VDPLL.......P..SI..............AES..........................................I
Q55937_SYNY3/19-365...TWVGL.......A..LL..............AFE...........................................
Q9A856_CAUCR/31-388...IGFLK.......H..DL..............SVE..........................................F
P72472_STRLI/29-361...PIGLL.......T..SI..............GSS..........................................F
Q97BG6_THEVO/17-357...SFIFL.......PL.IF..............IEI..........................................Y
Q9X4X9_9PSED/27-377...FGTLV.......V..PL..............NQA..........................................F
Q973J7_SULTO/8-320...NIIII.......AL.YF...............KS..........................................L
O32859_MYCFO/12-364...TIVAF.......PW.LV..............LQH..........................................N
Q9S243_STRCO/13-352...ARPAV.......S..YR..............ALA..........................................L
Q97PK9_STRPN/13-344...LPAMF.......D..YY...........................................................Q
Q97CC5_THEVO/27-411...IWIVS.......EP.AF..............AYS..........................................F
AMPG1_RICPR/10-405...TGNTL.......NYWFA..............KKD...........................................
Q9RD97_STRCO/46-435...PMVTL.......P..ET..............AAD..........................................L
Q8R8R3_THETN/20-398VAYSFGNF.......PIGIM..............LEA..........................................F
O30210_ARCFU/17-354...LAPVL..........................MET..........................................Y
Q8X120_EXODE/120-524...AMSIA.......PLHII..............GNT..........................................F
Q9EW91_9ACTO/13-358...QRAAQ.......DL.LV..............LHL..........................................T
Q8MMD6_DROME/21-407...AGVAV.......VAMTN..............AEN..........................................T
Q8XVV0_RALSO/19-414...VNSAL.......P..TI..............QGE..........................................I
Q978I2_THEVO/17-358...YNLIV.......IWVVL..............FIT...........................................
S22AI_MOUSE/13-363...QFSIL.......P..YL..............SRT..........................................L
Q92XG9_RHIME/14-352...VLPAI.......P..AM..............PTA..........................................L
Q8P8I8_XANCP/24-370...VAVTV.......GW.HI..............YEI..........................................T
Q9I1Q7_PSEAE/34-397...LSIAM.......P..TI..............AGE..........................................F
Q9I4J1_PSEAE/26-388...FSVAK.......LGIAE..............DPS..........................................F
Q9KG22_BACHD/29-373...YFLTK.......SW.YV..............VDE..........................................L
Q9KYE9_STRCO/8-359...TVPYL.......YV.YV..............AQV..........................................R
Q8K8F6_STRP3/27-401...FKLMS.......NT.IM...........................................................V
O31131_BRELN/13-405...ASVAV.......P..AI..............GDD..........................................L
Q8PQM0_XANAC/29-361...PVSLL.......TP..I..............ASD..........................................L
Q9ZC50_YERPE/23-431...LPVAL.......G..GM..............VKS..........................................F
Q8U366_PYRFU/20-359...IAPIV.......PT.YL..............TDV..........................................L
Q9C9R9_ARATH/11-379...LPGVY.......KEVGL..............ALH...........................................
Q20265_CAEEL/46-427...LCMQE.......EQEKANNESLSRNETILPSSLN..........................................F
Q9PCQ0_XYLFA/73-403...PAGLL.......P..QI..............AQD..........................................L
Q9I247_PSEAE/4-339...FWPTW..........................LAS..........................................L
Q9VPX2_DROME/42-442GSVILSNA.......SQVSL..............VEECNPP.................................GGASNV
Q8Y3L9_LISMO/17-359...IGISL.......V..TV..............SQD..........................................L
Q8VUK1_HALHD/23-380...IFAVL.......GL.EL..............REP..........................................L
Q8RPH1_DESHA/13-347...ISVIM.......AD.LI..............KAF..........................................P
A9CGF2_AGRT5/30-354..................................GEY..........................................W
O66181_ARTSP/15-353...YGILM.......P..FM..............KES..........................................L
Q8KYU7_9PROT/15-359...FISIF.......AG.EI..............RAA..........................................F
YJ7D_SCHPO/81-445...LSYAA.......LY.GM..............KTD..........................................T
Q8XEG8_ECO57/47-408...LSVAN.......L..TI..............REE..........................................L
Q9VY22_DROME/66-470...IMPSV.......LSNLA..............TQN..........................................L
Q8U4E5_PYRFU/8-345...LNPLV.......SPYAI................T..........................................L
YFKL_BACSU/12-351...LASNM.......S..SL..............TKQ..........................................W
O30679_RHORH/8-341...LSGLI.......P..DM..............ARD..........................................L
Q97TH3_CLOAB/16-408...INLAL.......P..FL..............MKS..........................................F
THI73_YEAST/86-451...LNYAA.......SM.GI..............KDH..........................................L
Q9A961_CAUCR/19-356...VGVII.......P..HV..............IKT..........................................F
Q97TH7_CLOAB/19-357...VSPAL.......Q..PI..............ASE..........................................L
Q8NVE0_STAAW/12-398...ISLAL.......P..TI..............KQD..........................................L
Q9VPD9_DROME/28-441...LTVPF.......IE.KL..............SGS..........................................F
Q8PVU8_METMA/11-346...LTPVL.......P..DM..............VEP..........................................L
Q8NVE2_STAAW/18-410...LNTAL.......P..SI..............MRE..........................................L
Q97FI4_CLOAB/17-361....FPFL.......SL.LL..............TQK..........................................L
Q8KR58_ESCFE/20-359...LLVML.......PQLVT..............LTG..........................................L
Q8NLD6_CORGL/19-353...AVGLI.......K..PM..............ASD..........................................L
Q9LAA0_AERHY/27-362...IMPLG.......P..DL..............SRA..........................................L
O06742_BACIU/18-364...LIPIL.......P..KM..............KSE..........................................L
Q9FCG1_STRCO/24-364..ATFMAL..........YL..............TID..........................................R
O94019_CANAX/86-529..SNDAGS.......IQDSL..............NEK..........................................Y
MOT14_MOUSE/42-459...LGVLN.......VE.WL...............EE..........................................F
Q92V77_RHIME/8-347...FSSLL.......PS.IA..............ADT..........................................H
Q9Y7E0_ASPTE/42-435...LLPAA.......P..EI..............ANE..........................................F
Q9I431_PSEAE/11-401...ASVAY.......P..DI..............GRS..........................................L
O76837_CAEEL/25-400...YNAIN.......FSVIC..............MQD...........................................
Q96ZI2_SULTO/36-365...LMTTI.......PL.VT..............KYI..........................................F
Q9L8R0_PSEST/7-367.PSIYLML.......GMPLV..............MRQ..........................................H
Q94886_DROME/14-423...LNITI.......VD.MIAGKGAITSNETHENSTD..........................................L

PF00083

GTR4_MOUSE/27-483---INAPQ-------KVIEQ--------------SYN------------------------------------------A
GTR1_MOUSE/14-467---INAPQ-------KVIEE--------------FYN------------------------------------------Q
QUTD_EMENI/24-490---IGTTL-------SLQSF--------------QNE------------------------------------------F
ITR2_YEAST/112-569---ISSAL-------ISINR--------------DLD------------------------------------------N
SNF3_YEAST/100-556---INSIT-------SMNY.--------------VKS------------------------------------------H
GALP_ECOLI/18-451---IAGAL-------PFIA.--------------..D------------------------------------------E
HXT5_YEAST/89-549---ISGFV-------RQTDF--------------IRR------------------------------------------F
GTR3_MOUSE/13-465---INAPE-------TILKD--------------FLN------------------------------------------Y
HXT9_YEAST/64-526---ISGFV-------NLSDF--------------IRR------------------------------------------F
HXT3_YEAST/65-525---ISGFV-------AQTDF--------------LRR------------------------------------------F
HXT8_YEAST/69-530---ISGFV-------NQTDF--------------LRR------------------------------------------F
YJHB_ECOLI/15-405---IFYIL-------HIIK.--------------..A------------------------------------------D
HXT6_YEAST/68-528---ISGFI-------NQTDF--------------IRR------------------------------------------F
SUT_SPIOL/38-486---SLLTP-------YVQLL--------------GIP------------------------------------------H
GTR3_CHICK/14-464---INAPE-------KIIQA--------------FYN------------------------------------------R
GTR5_HUMAN/20-475---VNSPA-------LLMQQ--------------FYN------------------------------------------E
PRO1_LEIEN/95-540---CRKEY-------AYSSP--------------AEM------------------------------------------P
HXT13_YEAST/60-521---TAGFI-------NMDNF--------------KMN------------------------------------------F
RAG1_KLULA/66-528---ISGFV-------NQTDF--------------LRR------------------------------------------F
YB91_YEAST/27-485---LNAPQ-------EFLSC--------------SRF------------------------------------------E
GTR1_LEIDO/5-442---INAAL-------FQMK.--------------.DH------------------------------------------F
HUP1_PARKE/30-492---TGGVV-------SLEAF--------------EKK------------------------------------------F
PROP_ECOLI/25-453---YGFVA-------YALGK--------------VFF------------------------------------------P
JEN1_YEAST/125-563---MGYFA-------WLSAA--------------WAF------------------------------------------F
GIT1_YEAST/43-466---NGSMS-------MLNKV--------------FVM------------------------------------------E
GTR2_MOUSE/13-498---INAPQ-------EVIIS--------------HYR------------------------------------------H
HXT2_YEAST/59-519---ISGFV-------NQTDF--------------KRR------------------------------------------F
XYLE_ECOLI/13-478---ISGTV-------ESLNT--------------VFV------------------------------------------A
LACP_KLULA/75-529---MGSIY-------TEDAY--------------LKY------------------------------------------Y
STP1_ARATH/26-489---SGGVT-------SMPSF--------------LKR------------------------------------------F
MAL31_YEAST/102-561---LGAFY-------ALPVF--------------QKK------------------------------------------Y
GTR2_LEIDO/41-538---VGPYS-------TMYGY--------------ASN------------------------------------------C
Q57RP5_SALCH/23-420---IARTF-------FPAES--------------EFA------------------------------------------S
TH2A_TRYBB/39-502---VAVYI-------LLYEV--------------ATN------------------------------------------C
GTR3_HUMAN/12-465---INAPE-------KIIK.--------------..E------------------------------------------F
GTR2_HUMAN/13-499---INAPQ-------QVIIS--------------HYR------------------------------------------H
TH12_TRYBB/39-501---V.AVY-------LLLYL--------------TAT------------------------------------------E
QAY_NEUCR/24-494---IGTTL-------ALPSF--------------TKE------------------------------------------F
GLF_ZYMMO/13-469---IAAIG-------TPVD.--------------.IH------------------------------------------F
HXT4_YEAST/74-534---ISGFV-------AQTDF--------------IRR------------------------------------------F
ITR1_YEAST/89-546---ISSAL-------ISIGT--------------DLD------------------------------------------H
STL1_YEAST/30-488---MASLI-------TGKQF--------------NYE------------------------------------------F
ARAE_ECOLI/25-461---IAGAL-------PFIT.--------------..D------------------------------------------H
GAL2_YEAST/74-534---ISGFV-------VQTDF--------------LRR------------------------------------------F

PF05977

Q92LE2_RHIME/11-531---QISSLGWLVQTVAISWL--------------MAS------------------------------------------I
Q98HB4_RHILO/11-532---LVSNFGGLIQGVGAAWM--------------MTT------------------------------------------I
Q92Y88_RHIME/8-530---IVGNTGSFIRDVASSWL--------------VTD------------------------------------------L
Q9X4X4_9PSED/20-540---AMVNLAIWMQTVGAAWI--------------MTL------------------------------------------L
A9CFW7_AGRT5/8-530---VLGNTGSFMRDVASSWL--------------MTD------------------------------------------L
Q9HYE1_PSEAE/25-549---LFANLGTWAQSVAAAWV--------------VTD------------------------------------------A
Q989L4_RHILO/31-551---QVSSLGWLIQMVAISWL--------------MAT------------------------------------------I
Q92SW7_RHIME/14-535---LASNFGGLIQAVGAAWL--------------MTS------------------------------------------I
Q989T8_RHILO/11-532---QVANLGWLMQAVAISWL--------------MAT------------------------------------------I
Q9I0E1_PSEAE/6-529---IASNIGTWMHEVGAGWL--------------MTS------------------------------------------L

PF01306

LACY_CITFR/1-412---YFPFF-------PI-WL--------------HEV------------------------------------------N
RAFB_ECOLX/4-415---CFPFL-------PV-WL--------------SDV------------------------------------------V
CSCB_ECOLX/4-411---WWSLY-------AI-WL--------------KGH------------------------------------------L
LACY_KLEOX/6-416---YFPFF-------PV-WL--------------AEV------------------------------------------N

PF03137

SO2A1_RAT/31-603---CQ.LLYSAYFKSSLTTI--------------EKR------------------------------------------F
SO1B2_RAT/27-616---CK.ALGGVVMKSSITQI--------------ERR------------------------------------------F
SO2B1_HUMAN/48-648---AQ.LMISGYLKSSISTV--------------EKR------------------------------------------F
SO3A1_HUMAN/39-623---AQ.GTVGAYLVSVLTTL--------------ERR------------------------------------------F
Q20702_CAEEL/102-763---IQGLIVNGLVPSAISSI--------------ERR------------------------------------------F
SO2A1_HUMAN/31-603---CQ.LLYSAYFKSSLTTI--------------EKR------------------------------------------F
Q9VVH9_DROME/173-755---LQ.GMYMTYFVSVITTI--------------EKL------------------------------------------F
Q93550_CAEEL/16-587---VQ.GTYLGYVVGMLTTL--------------EKR------------------------------------------F
Q9W271_DROME/65-627---VM.TMTFAYFNGTITTL--------------EKR------------------------------------------Y
SO1A3_RAT/19-598---SK.SLSGTFMSSMLTQI--------------ERQ------------------------------------------F
SO1B1_HUMAN/27-622---AK.TLGAIIMKSSIIHI--------------ERR------------------------------------------F
Q21157_CAEEL/48-598---LQGAIVNGLVSVSISSI--------------EKR------------------------------------------F
SO4A1_HUMAN/102-664---LQGMTVNGFINTVITSL--------------ERR------------------------------------------Y
Q9XWC5_CAEEL/47-621---IQSFVVNAIFPVGLSTL--------------ERR------------------------------------------F
Q9W269_DROME/110-732---IF.SMTYAYFNGTITTI--------------EKR------------------------------------------F
SO1A2_HUMAN/19-598---SK.TLSGSYMNSMLTQI--------------ERQ------------------------------------------F

PF06779

Q89X18_BRAJA/64-148--------------------------------------------------------------------------------
Q92UK2_RHIME/2-86--------------------------------------------------------------------------------
Q8YFG7_BRUME/2-86--------------------------------------------------------------------------------
Q986E3_RHILO/35-119--------------------------------------------------------------------------------
Q8Z0X3_SALTI/24-110--------------------------------------------------------------------------------
Q9I3T2_PSEAE/21-105--------------------------------------------------------------------------------
Q88ED9_PSEPK/15-99--------------------------------------------------------------------------------
Q89HQ1_BRAJA/50-128--------------------------------------------------------------------------------
A9CI18_AGRT5/24-108--------------------------------------------------------------------------------
Q8Y185_RALSO/37-119--------------------------------------------------------------------------------
Q87ES9_XYLFT/27-113--------------------------------------------------------------------------------
YJIJ_ECOLI/24-110--------------------------------------------------------------------------------

PF06609

Q8NII4_FUSAU/1-598---CATYFVLQASASALPNI--------------LQD------------------------------------------I
Q9C1B3_FUSSP/1-598---VATYFVLQASASALPNI--------------LQD------------------------------------------V

PF12832

A7SQQ8_NEMVE/55-132--------------------------------------------------------------------------------
Q6FB61_ACIAD/6-82--------------------------------------------------------------------------------
B7P8Y1_IXOSC/9-85--------------------------------------------------------------------------------
Q17GA0_AEDAE/14-90--------------------------------------------------------------------------------
A7RI07_NEMVE/54-130--------------------------------------------------------------------------------
A4Y888_SHEPC/10-86--------------------------------------------------------------------------------
A4BSZ3_9GAMM/7-83--------------------------------------------------------------------------------
Q2BMQ1_9GAMM/3-79--------------------------------------------------------------------------------
Q54SK7_DICDI/682-755--------------------------------------------------------------------------------
A7EK42_SCLS1/450-504--------------------------------------------------------------------------------
B2AA42_PODAN/619-697--------------------------------------------------------------------------------
A1WY15_HALHL/14-90--------------------------------------------------------------------------------
Q54G39_DICDI/12-88--------------------------------------------------------------------------------
B3PHF3_CELJU/15-91--------------------------------------------------------------------------------
Q07ZQ8_SHEFN/10-86--------------------------------------------------------------------------------
D3SB25_THISK/3-79--------------------------------------------------------------------------------
B0X8B9_CULQU/11-87--------------------------------------------------------------------------------
YJBC_SCHPO/418-493--------------------------------------------------------------------------------
Q16KC8_AEDAE/34-110--------------------------------------------------------------------------------
Q21IX9_SACD2/5-81--------------------------------------------------------------------------------
B4G7T5_DROPE/36-112--------------------------------------------------------------------------------
C3YMP2_BRAFL/14-90--------------------------------------------------------------------------------
Q0A9B1_ALHEH/6-82--------------------------------------------------------------------------------
A3QFN3_SHELP/24-100--------------------------------------------------------------------------------
Q55CH3_DICDI/11-87--------------------------------------------------------------------------------
B8GQD4_THISH/5-81--------------------------------------------------------------------------------
A1S7K7_SHEAM/12-88--------------------------------------------------------------------------------
C5BL70_TERTT/2-78--------------------------------------------------------------------------------
B1KKS0_SHEWM/10-86--------------------------------------------------------------------------------
B0V728_ACIBY/7-83--------------------------------------------------------------------------------
B0W437_CULQU/30-106--------------------------------------------------------------------------------
A7UVG6_ANOGA/14-90--------------------------------------------------------------------------------
Q2SJE3_HAHCH/5-81--------------------------------------------------------------------------------
B7PL10_IXOSC/7-83--------------------------------------------------------------------------------
A7C0B5_9GAMM/6-82--------------------------------------------------------------------------------
A8PWD3_MALGO/544-619--------------------------------------------------------------------------------
B6C555_9GAMM/9-85--------------------------------------------------------------------------------
B6K1R3_SCHJY/414-489--------------------------------------------------------------------------------
Q4PB45_USTMA/688-764--------------------------------------------------------------------------------

PF01770

Q29L76_DROPS/2-397---LRELR-------PSEPY--------------VTE-------------------------------------------
Q294A5_DROPS/2-414---LREIR-------PSEPY--------------HAE-------------------------------------------
Y2544_DICDI/95-457---LFSFD-------PSEPY--------------LVD-------------------------------------------
Q9EQN9_MOUSE/28-459---FANLR-------PSEPF--------------LTP-------------------------------------------
Q9VK64_DROME/2-395---FREFR-------PSEPY--------------VTE-------------------------------------------
Q9BTX8_HUMAN/23-434---MAQIR-------PGESF--------------ITP-------------------------------------------
Q9VGV5_DROME/2-408---IREIR-------PSEPY--------------VTE-------------------------------------------
S19A3_HUMAN/10-441---FSMMR-------PSEPF--------------LIP-------------------------------------------
Q4T7Q4_TETNG/6-427---FSTVR-------PIEPF--------------LFA-------------------------------------------
Q6GN45_XENLA/68-474---MTQLR-------PGESF--------------ITP-------------------------------------------
Q17QC9_BOVIN/23-434---MAQMR-------PGESF--------------ITP-------------------------------------------
Q1LV16_DANRE/4-414---FANCR-------PAEPF--------------LTP-------------------------------------------
Q16JT2_AEDAE/2-405---LKDFR-------PSDPF--------------VVQ-------------------------------------------
Q6NRB3_XENLA/18-453---FANLR-------PSEPF--------------LTP-------------------------------------------
Q9VGV6_DROME/2-411---LRELR-------PSEPY--------------HAE-------------------------------------------
FOLT2_CAEEL/2-394---VKEFR-------PTEPY--------------MYE-------------------------------------------
Q542F3_MOUSE/23-427---MAQLR-------PGESF--------------ITP-------------------------------------------
Q28C92_XENTR/10-422---FADMR-------AVDPF--------------TAQ-------------------------------------------
Q6DIK7_XENTR/10-424---FANLR-------PLDPF--------------FIA-------------------------------------------
Q7Q5N2_ANOGA/2-422---FRELR-------VSEPF--------------VTE-------------------------------------------
A8BIM9_GIAIC/39-447---LCAFK-------PAEPF--------------VVP-------------------------------------------
A7SN54_NEMVE/6-420---FKEMK-------PSEPF--------------LTP-------------------------------------------
S19A3_MOUSE/11-435---FSMFR-------PSEAF--------------LIP-------------------------------------------
Q5ZMS7_CHICK/32-445---MTQIR-------PGESF--------------ITP-------------------------------------------

PF05631

Q9M3A1_ARATH/4-380SSSFNSFKNNYLLVFSIMMA--------------GDW------------------------------------------L
Q9N3A9_CAEEL/1-336DPKFKSFQRTYLIVYMMAVA--------------GDW------------------------------------------L
Q9FWD6_ORYSJ/4-357TPAFNAFKNNYILVYSLMMS--------------GDW------------------------------------------L

PF00854

PTR12_ARATH/99-497---ISASI------------------------------------------------------------------------
PTR17_ARATH/124-523---SFSAI------------------------------------------------------------------------
YCLF_BACSU/95-444---YGGIF------------------------------------------------------------------------
S15A2_HUMAN/111-494---YLSLV------------------------------------------------------------------------
DTPT_LACLC/90-449---LGGIL------------------------------------------------------------------------
S15A1_RAT/81-476---SLSIV------------------------------------------------------------------------
PEPT3_CAEEL/82-469---YGSSI------------------------------------------------------------------------
YJDL_ECOLI/75-420---AGALL------------------------------------------------------------------------
DTPA_ECOLI/88-431---LGAIV------------------------------------------------------------------------
PTR2_ARATH/113-517---CFSGI------------------------------------------------------------------------
PEPT1_CAEEL/113-557---SVSIL------------------------------------------------------------------------
PTR2_YEAST/155-515---CGTAI------------------------------------------------------------------------
PTR7_ARATH/99-507---IFAAI------------------------------------------------------------------------
O22305_LOTJA/95-494---FSLLI------------------------------------------------------------------------
PTR2_SCHPO/158-520---CSAVI------------------------------------------------------------------------
PEPT1_DROME/101-444---YLSLV------------------------------------------------------------------------
Q96400_CUCSA/121-513---ISAIL------------------------------------------------------------------------
DTPD_ECOLI/76-426---LGALL------------------------------------------------------------------------
PTR2_CANAX/161-542---WGVFF------------------------------------------------------------------------
S15A1_HUMAN/81-475---SLSIV------------------------------------------------------------------------
S15A1_RABIT/81-474---WLSIV------------------------------------------------------------------------
PTR30_ARATH/96-491---ASSLI------------------------------------------------------------------------
PEPT2_CAEEL/99-526---FISIF------------------------------------------------------------------------
S15A4_RAT/94-495---LSLAL------------------------------------------------------------------------
DTPB_ECOLI/81-428---LGALV------------------------------------------------------------------------

PF06813

Q7XGH1_ORYSJ/34-288---IFS.I-------YSGAL--------------KSS------------------------------------------L
Q9LUF8_ARATH/16-265---LFGGS-------MSPAI--------------KTS------------------------------------------L
Q8H613_ORYSJ/14-261---TFA.L-------YSHAL--------------KVA------------------------------------------L
Q94D97_ORYSJ/8-252---DFP.V-------YSSQL--------------KEL------------------------------------------K
Q9C862_ARATH/7-251---DFS.A-------YSSHL--------------KSV------------------------------------------L
O81121_ARATH/16-263---LFG.S-------ISPVI--------------KSS------------------------------------------L
O81120_LOTJA/26-271---MFS.L-------YSREI--------------KFA------------------------------------------L
Q9M8M1_ARATH/13-260---TFP.L-------YSSAL--------------KSV------------------------------------------L
Q9ZUV4_ARATH/17-262---LFG.T-------YSKDI--------------KST------------------------------------------L
O22926_ARATH/7-235---SFP.A-------YSSQL--------------KEL------------------------------------------L
O80960_ARATH/21-266---MFG.I-------YSGDI--------------KET------------------------------------------L
Q8H6R3_PONTR/13-260---NFP.L-------YSPAL--------------KSV------------------------------------------M
Q8H132_ARATH/7-253---DFS.A-------YSSDL--------------KSV------------------------------------------L
Q9SLF1_ARATH/14-260---TFS.N-------YSGAL--------------KSL------------------------------------------M
Q9SS92_ARATH/41-290---DFS.A-------YSSDM--------------KSS------------------------------------------M

PF05978

Q19933_CAEEL/13-169--------------------------------------------------------------------------------
Q9XV34_CAEEL/12-166--------------------------------------------------------------------------------
MFS11_MOUSE/14-166--------------------------------------------------------------------------------
Q8MYL9_CAEEL/14-170--------------------------------------------------------------------------------
Q965T3_CAEEL/14-170--------------------------------------------------------------------------------
P91007_CAEEL/16-172--------------------------------------------------------------------------------
Q9XWR7_CAEEL/37-194--------------------------------------------------------------------------------
Q19932_CAEEL/14-169--------------------------------------------------------------------------------
Q21545_CAEEL/14-168--------------------------------------------------------------------------------
O61865_CAEEL/27-183--------------------------------------------------------------------------------
Q18251_CAEEL/11-167--------------------------------------------------------------------------------

PF07672

Q8EUQ6_MYCPE/191-477---NGGAF------------------------------------------------------------------------
Y077_MYCPN/209-467---NVGLV------------------------------------------------------------------------
Q8EVP4_MYCPE/172-441---NIGAI------------------------------------------------------------------------
Q9KX64_MYCGL/1-256---NIGAA------------------------------------------------------------------------
Y076_MYCPN/210-484---NSGIV------------------------------------------------------------------------
Q98PH4_MYCPU/154-430---PLGTI------------------------------------------------------------------------
Y061_MYCGE/119-383---NIGIA------------------------------------------------------------------------

PF02487

CLN3_CANFA/37-438---YVVML-----SAAHDILSHQRASGNQSHVDPDPP------------------------------------------P
BTN1_YEAST/8-397---YVVIL-----SAAVDIVG...............P------------------------------------------.

PF03219

A6XGR5_9CHLO/42-534---VIPLSLMFFCILFNYTV--------------LRS------------------------------------------C
TLC2_ARATH/88-571---IVPLGLMFFCILFNYTI--------------LRD------------------------------------------T
TLCB_RICCN/9-501---FIPMALLMFFILLNQNL--------------VRS------------------------------------------I
Q842J1_9RICK/3-491---FLPMAAMMFCILFNYST--------------LRS------------------------------------------I
TLC1_CHLTR/2-492---VLPMFLMFFCISFNYTI--------------LRD------------------------------------------T
Q70GF8_9CHLA/1-443---...............ST--------------...------------------------------------------.
Q6MEN4_PARUW/1-484---VLPMMLMLFLICFNYSI--------------LRN------------------------------------------V
TLCD_RICFE/12-503---FLFITLLMFCILFIQNL--------------IRA------------------------------------------L
Q9X9D2_CHLTH/1-500---FIPLFFLAFFVGVNYAL--------------LKT------------------------------------------T
Q8WH67_GALSU/142-638---ILPLGVMFFMILFNYTI--------------LRD------------------------------------------T
Q6H8E4_ORYSJ/76-563---IVPLGLMFFCILFNYTI--------------LRD------------------------------------------T
Q252Y6_CHLFF/2-510---FFPLFWLAFFVGFNYCL--------------LKS------------------------------------------M
A5CCY4_ORITB/4-486---FLPMALMMFFILFNYSA--------------LRS------------------------------------------I
Q71JS5_9CHLA/2-490---LLPMFLMFFCISFNYTI--------------LRD------------------------------------------T
A5CDU3_ORITB/11-501---FILMALLMFAVLLNQNV--------------VRA------------------------------------------I
Q6MBI2_PARUW/1-474---RSLILFQFFLIIIVYHT--------------LKD------------------------------------------L
A8F0G0_RICM5/3-489---FLPMAFMMFCILLNYST--------------LRS------------------------------------------I
A8GSF7_RICRS/1-496---FIPMALMMLCILFNFGA--------------LRS------------------------------------------I
Q83W26_RICTP/4-496---FIPISALMFCILFNQNI--------------LRI------------------------------------------L
A5CES7_ORITB/3-495---FIPTALLMFFILFNQNI--------------LRI------------------------------------------L
A5CCG2_ORITB/17-505---FLLMTALMFCILLIQNL--------------IRA------------------------------------------L
Q6MEN5_PARUW/4-499---LIPMLLIFFFISFDYNI--------------LRT------------------------------------------L
TLC2_CHLPN/2-503---FVPLFLLAFFVGFNYCL--------------LKN------------------------------------------M
Q6MEM5_PARUW/2-491---LLPMFFMFFFISFNYTI--------------LRD------------------------------------------T
A5CCG3_ORITB/1-504---FMPMALIIFCLLFNFSA--------------LRA------------------------------------------I
Q8KPN2_HOLOB/2-501---FLPMVVIMFSILFNYTV--------------ARN------------------------------------------V
Q1MSG2_LAWIP/9-504---FLPMGLMMLCILFIYRL--------------VRD------------------------------------------I

PF01733

S29A1_RAT/144-455---LQASL------------------------------------------------------------------------
S29A2_HUMAN/131-454---LQGSL------------------------------------------------------------------------
S29A1_HUMAN/144-454---LQGSL------------------------------------------------------------------------
FUN26_YEAST/180-510---TQNGI------------------------------------------------------------------------
Q19495_CAEEL/137-426---YENSV------------------------------------------------------------------------
Q21145_CAEEL/434-723---FQNSM------------------------------------------------------------------------
O64603_ARATH/145-428---MQGGL------------------------------------------------------------------------

PF03239

FTH1_YEAST/8-404---VVIVS-------ILLTI-----------------------------------------------------------V
EFEU_BACSU/9-395---DDPIA-------ALIQL-----------------------------------------------------------N
Q9Y8Z4_AERPE/4-268---ILLST-------IIIML-----------------------------------------------------------L
Y964_SYNY3/6-291---SLVVG-------IVLAC-----------------------------------------------------------L
FIP1_SCHPO/7-320---SIIVS-------VLMSF-----------------------------------------------------------I
EFEU_ECOLI/1-276---ALIVS-------LIASY-----------------------------------------------------------L
O83937_TREPA/14-362---AFARS-------VVRAS-----------------------------------------------------------A
Q9ZC51_YERPE/156-557---EASKS-------VQQAH-----------------------------------------------------------Y
Q9RKQ1_STRCO/1-274---SLVVC-------ILIAY-----------------------------------------------------------L
Q9ZDD8_RICPR/1-278---SLLLS-------VILAV-----------------------------------------------------------T
FTR1_YEAST/7-321---VIVIS-------VLLSF-----------------------------------------------------------L
Y154_ARCFU/4-266---ALLVA-------VLVAY-----------------------------------------------------------L
Q9WYP8_THEMA/2-266---SVIIA-------VILAY-----------------------------------------------------------L

PF13347

C3W9X3_FUSMR/14-452---NDVMLI....FVSQ.FL--------------MVF-------------------------------------------
Q8I3H5_PLAF7/62-507---CPMIGVGGMNLISTIYT--------------SYF-------------------------------------------
D2VB35_NAEGR/31-486---IDMHLT....KYYMEDI--------------CKY-------------------------------------------
Q28K27_JANSC/6-401---MLASAG....LPIYIHA--------------PKF-------------------------------------------
A6E455_9RHOB/14-411---LLAAAG....LPLYIHA--------------PKF-------------------------------------------
B6AV21_9RHOB/12-414---LLSAAG....LPIYIHA--------------PKF-------------------------------------------
B9KP25_RHOSK/3-400---LIAAAG....LPIYIHA--------------PKV-------------------------------------------
A3V2V1_9RHOB/6-408---VLSGAG....LPIYIYA--------------PKY-------------------------------------------
A8TM36_9PROT/9-426---AAALGV....PLYI.FL--------------PTF-------------------------------------------
A7HQL5_PARL1/9-433---IAMFGY....PVAV.WL--------------PPF-------------------------------------------
Q73MQ4_TREDE/4-434---RDMVYS....LISM.YL--------------IFY-------------------------------------------
B2GBT3_LACF3/22-466---HSAFYG....ALST.YF--------------IVY-------------------------------------------
E7FT79_9LACO/16-461---HAAFYA....ALSN.YF--------------IIF-------------------------------------------
C0WMV6_LACBU/20-464---HDMFYA....TLST.YF--------------MIF-------------------------------------------
D0DS55_LACFE/13-457---HDMFYG....MLST.YF--------------MMF-------------------------------------------
Q6SCS3_STRTR/10-454---NDVFYA....TLST.YF--------------IMF-------------------------------------------
B1SH60_9STRE/18-462---HDIFYA....TLST.YF--------------ITF-------------------------------------------
C8P5V7_9LACO/2-447---HDAFYN....TLSI.YF--------------MMF-------------------------------------------
Q03PA7_LACBA/3-451---HDAFYA....TLST.YF--------------AMF-------------------------------------------
C5RC37_WEIPA/5-451---HDAFYA....TLST.YF--------------MMF-------------------------------------------
C7XWC4_9LACO/5-449---HDSFYG....ILNT.YM--------------LMF-------------------------------------------
B0NX91_9CLOT/12-438---KDLIYG....MMAT.FA--------------MIY-------------------------------------------
C3WB69_FUSMR/6-433---KDYACA....IIYI.FL--------------MYY-------------------------------------------
C0BFD6_9FIRM/20-452---KDAICN....LVGA.FL--------------MLY-------------------------------------------
C3WEF2_FUSMR/7-437---KDIILA....YVGV.FL--------------MIY-------------------------------------------
C9QHC7_VIBOR/7-438---KDFAIT....IVYM.YL--------------MFY-------------------------------------------
C0BCF9_9FIRM/22-465---KDMVYM....LSAS.YV--------------LYY-------------------------------------------
C4Z9B4_EUBR3/7-441---KDIVYM....LISS.YL--------------LYY-------------------------------------------
B7GTV4_BIFLS/22-444---QCFSYG....IIGS.FI--------------LIY-------------------------------------------
B3W8U5_LACCB/11-452---STTAYY....LYTA.VL--------------MMF-------------------------------------------
B0NCA5_EUBSP/62-493---GNVVYA....FLSA.FV--------------MIY-------------------------------------------
D4L2L1_9FIRM/9-431---QNVFYG....LVG..YM--------------TTY-------------------------------------------
A6DP62_9BACT/9-590---SNLFWM....QFIW.YL--------------NYF-------------------------------------------
A6G4R1_9DELT/26-447---FNLYWT....TIAS.FL--------------AAF-------------------------------------------
A4AAW4_9GAMM/15-443---SNFYMG....FFGL.FL--------------LYY-------------------------------------------
C1MDP3_9ENTR/24-449---GTVITC....LIMN.FL--------------TFF-------------------------------------------
D2ZB78_9ENTR/9-430---SHIGLD....NVII.FL--------------TFY-------------------------------------------
E6WJ95_PANSA/9-430---SHIAID....NVII.FL--------------TFY-------------------------------------------
B2NKK3_ECO57/10-432---SHIIFD....NVML.YM--------------MFF-------------------------------------------
C9XVR9_CROTZ/33-456---CNIIFG....AIML.FV--------------NYF-------------------------------------------
D1RSQ2_SEROD/19-442---SCMIWS....VLAL.YL--------------TWF-------------------------------------------
D4GIM8_PANAM/27-451---CNMLFN....PITM.FL--------------SFF-------------------------------------------
D1RQG9_SEROD/8-433---SNIIWQ....TIML.FM--------------AYF-------------------------------------------
D0KF27_PECWW/10-433---CNLVWQ....TVML.FM--------------AYF-------------------------------------------
D3RGD6_KLEVT/10-434---CNLVWQ....TVML.FM--------------AWF-------------------------------------------
D2TGV7_CITRI/11-433---SALVWQ....TATL.FL--------------AFF-------------------------------------------
B1ZS00_OPITP/13-436---VNVVWS....ALAI.II--------------TFF-------------------------------------------
B3HTC5_ECOLX/7-428---IAIVMM....SLAM.II--------------TYF-------------------------------------------
A6DPD4_9BACT/7-427---MNLNFQ....LIGF.YL--------------AYF-------------------------------------------
D4F9L7_EDWTA/8-430---NNFAFA....MGAL.FL--------------LSY-------------------------------------------
D4BGD4_9ENTR/25-444---DNVICT....MIVT.FL--------------MLY-------------------------------------------
B0NC69_EUBSP/24-452---HNVPWM....LVSA.YL--------------AFY-------------------------------------------
A8RLH8_9CLOT/23-450---YNFMYY....WLST.YL--------------MIY-------------------------------------------
C6JEB9_9FIRM/14-438---CNFSWM....FVSN.FL--------------MIF-------------------------------------------
C6PWS4_9CLOT/17-439---NGFMFD....LGQA.YL--------------SKF-------------------------------------------
Q97L68_CLOAB/8-431---NGFMFD....LGQS.YL--------------LKF-------------------------------------------
A9QSF4_LACLK/37-463---NGFMFD....LGQA.YL--------------TKF-------------------------------------------
A9MYD9_SALPB/15-438---SNLMLS....IGTL.YF--------------LKF-------------------------------------------
D1PII8_9FIRM/14-445---NDFTFI....FSTM.ML--------------MKF-------------------------------------------
C9BIA1_ENTFC/23-456---NCFILG....LVNS.FL--------------MIY-------------------------------------------
B1BWZ1_CLOPF/8-434---CCCTEQ....FRAM.FL--------------TVF-------------------------------------------
C8P9N3_9LACO/19-468---QNLIFG....TIGS.ML--------------LFY-------------------------------------------
A4WD81_ENT38/20-469---QNLVFG....TIGG.FL--------------ALH-------------------------------------------
D1BWG8_XYLCX/30-459---QNLIYN....TVST.YL--------------LFF-------------------------------------------
C8P9N0_9LACO/19-447---QNLIYT....TIST.YL--------------LFF-------------------------------------------
Q04EN5_OENOB/11-431---DNLVFQ....MLTT.YL--------------LFF-------------------------------------------
Q5YU93_NOCFA/38-478---ALLLNA....VLAT.YL--------------NVY-------------------------------------------
C6LHW9_9FIRM/40-483---YMVYYS....VAGT.YL--------------TQF-------------------------------------------
A6NPU4_9FIRM/27-469---SGIFTS.........FL--------------NKY-------------------------------------------
A6TPY1_ALKMQ/8-433---FIIMMT....LATT.YY--------------SYF-------------------------------------------
A6TPY6_ALKMQ/9-436---CNLMMM....GAVT.YY--------------AYF-------------------------------------------
D4LG93_9FIRM/20-452---FVLMSN....IETF.YF--------------MTF-------------------------------------------
C9XL03_CLODC/24-461---YNFIGY....FVST.VT--------------NIF-------------------------------------------
C0D597_9CLOT/17-465---TNIAMF....LMMQ.Y.--------------SYF-------------------------------------------
C5EQ37_9FIRM/9-441---YNFVLS.........FF--------------SFF-------------------------------------------
C5BVC3_BEUC1/22-453---AAMMSS....VLIHNVY--------------VKF-------------------------------------------
Q2G9N1_NOVAD/11-450---YGIKDN....GFAT.FL--------------LLF-------------------------------------------
Q2N8H6_ERYLH/11-453---FGVKDL....GFSF.FL--------------LPY-------------------------------------------
Q0AL93_MARMM/17-465---YGVKDV....AFRA.YL--------------LWY-------------------------------------------
Q026U3_SOLUE/20-465---TVTFAL.........YG--------------LFF-------------------------------------------
Q0F3N0_9PROT/18-595---NAAILS.........LV--------------YPI-------------------------------------------
A4AJK9_9ACTN/12-439---TGGFGA....LPGL.VL--------------VYF-------------------------------------------
E8WA27_STRFA/17-443---TGTFAT....VPGL.IL--------------LYY-------------------------------------------
A1SNV8_NOCSJ/10-434---TGAFGT....VPGL.ML--------------LPY-------------------------------------------
B9N6J9_POPTR/21-445---AACWFT.........YL--------------LLF-------------------------------------------
B8B7S1_ORYSI/21-442---SSCWFT.........YL--------------LVF-------------------------------------------
B5X2T0_SALSA/37-502---YQMTAN....AKGF.FL--------------QIF-------------------------------------------
Q5RFV6_DANRE/4-463---NQVAGS....ATAF.FL--------------QIY-------------------------------------------
MFS2A_XENTR/36-494---YQITGC....ALGF.FL--------------QIF-------------------------------------------
C3Z8Z9_BRAFL/14-394---IEITWT....VLGA.YT--------------STF-------------------------------------------
D0KIC2_PECWW/8-445---LAISGA.........WL--------------MYF-------------------------------------------
B1S9F4_9BIFI/13-474---GALVAT.........YL--------------ALF-------------------------------------------

PF11700

AT221_EMENI/24-564---AEVFTV----CAMGSFL--------------PIT-------------------------------------------
ATG22_CRYNJ/1-531---AEVFSS----YPSGNIP--------------ANH-------------------------------------------
AT221_ASPFU/24-580---AEVFTV----CAMGSFL--------------PIT-------------------------------------------
Q75EJ9_ASHGO/58-558---TGP.TY----VMMRSFV--------------PAS-------------------------------------------
AT222_PHANO/72-634---AEVFVV----CGIGSFI--------------PVT-------------------------------------------
AT222_ASPOR/30-578---AEVFAV----CGVGSFL--------------PLT-------------------------------------------
Q0U0L9_PHANO/44-456---TGP.TA----GMAFRYV--------------PAV-------------------------------------------
A5DD56_PICGU/47-524---NN...A----TGPYTFT--------------PTQ-------------------------------------------
ATG22_COCIM/93-625---AEVFAV----CAMGSFL--------------PIT-------------------------------------------
AT221_ASPNC/30-582---AEVFTV----CAMGSFL--------------PIT-------------------------------------------
ATG22_SCHPO/13-525---AGPTAI----ISMGVYV--------------PLI-------------------------------------------
A7K364_VIBSE/8-434---.QCFSF----GLVGSFI--------------LYF-------------------------------------------
B9LBL3_CHLSY/9-439---NSAFST----TVVTVFL--------------GPY-------------------------------------------
Q5B0Q4_EMENI/43-494---NNGLSL----...FNFA--------------PTA-------------------------------------------
Q4PA89_USTMA/59-561---N...CG----LGPFNFA--------------PSQ-------------------------------------------
ATG22_MAGO7/99-626---AETYVI----CAISSFI--------------PIL-------------------------------------------
A6E856_9SPHI/5-431---NSAYNL----VITSTIF--------------PAY-------------------------------------------
ATG22_YARLI/6-582---AEPFMV----VAVATYI--------------PQL-------------------------------------------
Q26DY7_FLABB/8-443---NSVYSL----VITSAIF--------------PIF-------------------------------------------
ATG22_CANAL/39-496---TGP.VA----SMSRTYI--------------PAS-------------------------------------------
ATG22_ASHGO/19-490---SEPFIV----SAMSTYF--------------PLL-------------------------------------------
ATG22_KLULA/17-487---SEPFIV----SAVSTYV--------------PLL-------------------------------------------
Q5KBK3_CRYNJ/49-483---NS...G----LGPFNFA--------------ISA-------------------------------------------
AT221_PENCW/20-562---AEVFVV----CAMGSFL--------------PIT-------------------------------------------
ATG22_YEAST/20-514---SEPFVV----SAVSTYI--------------PLL-------------------------------------------
A1CD46_ASPCL/43-518---TGP.TS----SMVNNYV--------------TAA-------------------------------------------
Q4JAW8_SULAC/5-379---NS...A----SAQYFYL--------------PVY-------------------------------------------
A3LP71_PICST/32-502---TGP.VA----SMSRTYV--------------PAV-------------------------------------------
ATG22_NEUCR/155-689---AEVYVI----CGIGSFI--------------PIL-------------------------------------------
Q6CKN0_KLULA/64-544---TGP.TA----AMMRSYV--------------PAT-------------------------------------------
A7EQB6_SCLS1/56-534---NN...G----IGSFQYS--------------SLL-------------------------------------------
AT221_BOTFB/21-562---AEVFAV----CAVGSFL--------------PVT-------------------------------------------
AT222_ASPCL/24-579---AEVFTV----CAMGSFL--------------PIT-------------------------------------------
Q0BZH6_HYPNA/25-469---RDPYIG----LVNGFLF--------------APY-------------------------------------------
AT222_EMENI/31-576---AEVFAV----CGVGSFL--------------PLT-------------------------------------------
AT222_ASPTN/24-571---AEVFTV----CAMGSFL--------------PIT-------------------------------------------
A6H0A9_FLAPJ/7-445---NSVYSL----VIASAIF--------------PIF-------------------------------------------
AT222_SCLS1/72-619---AEVFVI----CGIGSFI--------------PIT-------------------------------------------
Q0CF56_ASPTN/43-493---...FYL----LTDIDFA--------------PTA-------------------------------------------
A1DH52_NEOFI/48-512---NNGLSL----...FNFA--------------PTA-------------------------------------------
ATG22_VANPO/27-511---SEPFVV----SAIATYI--------------PLL-------------------------------------------
AT222_PENCW/33-580---AEVFAV----CGVGSFL--------------PLT-------------------------------------------
Q0CXZ2_ASPTN/50-478---NN....----....HFG--------------PTA-------------------------------------------
AT221_ASPOR/20-571---AEVFTV----CAMGSFL--------------PIT-------------------------------------------
Q0BXU5_HYPNA/23-495---RNPYYI----LIVIYVF--------------APY-------------------------------------------
Q0TYS2_PHANO/43-505---DNGLTL----...FNFG--------------PTA-------------------------------------------
ATG22_PICAN/27-551---AEPFIV----SVVGTYV--------------PLL-------------------------------------------
ATG22_CANGA/31-527---SEPFVV----SAVATYV--------------PLL-------------------------------------------
Q8DIR0_THEEB/14-463---AGDLGA----AITANLQ--------------VFF-------------------------------------------
A4X7E0_SALTO/18-457---NSAFQT----TVITVFL--------------GPF-------------------------------------------

PF03209

Q9S313_RHOAC/55-461------------------TL--------------NRV-------------------------------------------
PUCC_RHOCA/54-461------------------TL--------------NRV-------------------------------------------
P73827_SYNY3/40-467------------------VL--------------NRV-------------------------------------------
Q9Z5D5_RHOSH/28-417------------------TL--------------NRL-------------------------------------------
PUCC_RHOS4/51-455------------------TL--------------NRV-------------------------------------------
BCH2_RHOCB/28-418------------------TL--------------NRL-------------------------------------------
PUCC_RHOSU/55-451------------------TL--------------NRV-------------------------------------------
Q9RFD8_RHOSH/51-461------------------TL--------------NRV-------------------------------------------
Q9S333_PROMR/1-414------------------ML--------------NRI-------------------------------------------
YPUM_RHOCA/51-458------------------TL--------------NRV-------------------------------------------
Q9RAD4_RUBGE/55-466------------------TL--------------NRV-------------------------------------------

PF03092

Q55721_SYNY3/46-457---G.LSRL---------AV--------------SFF-------------------------------------------
O23028_ARATH/1-404---R.PRRA---------TT--------------FAC-------------------------------------------
Q9UAB7_LEIDO/75-654---DRILTG---------QT--------------YAM-------------------------------------------
Q25272_LEIDO/59-606---NGLMRL---------SM--------------QPM-------------------------------------------
Q9SKZ5_ARATH/137-553---G.LARL---------AV--------------SFY-------------------------------------------
Q9SQN2_ARATH/61-473---KGLSKV---------ST--------------QYY-------------------------------------------
Q9UAC0_LEIDO/76-655---DQILYG---------QT--------------YAM-------------------------------------------
Q9UAB8_LEIDO/94-683---DQLISY---------SR--------------QPM-------------------------------------------
Q9XIQ7_ARATH/30-441---G.FPWL---------GA--------------NFF-------------------------------------------
O68867_SYNE7/38-441---G.LSRL---------AV--------------SFF-------------------------------------------
Q07492_9TRYP/138-667---HDMIRT---------TL--------------FPM-------------------------------------------
Q9UAC1_LEIDO/75-651---DRILTG---------QT--------------YAM-------------------------------------------

PF06963

S40A2_ARATH/31-479---ARTWEF----SVAL-YM--------------IYL-------------------------------------------
Q4WVQ3_ASPFU/39-421---SRMFEF----GAVL-FL--------------ASI-------------------------------------------
S40A1_ORYSJ/21-450---ARMWEF----SVGL-YM--------------IRI-------------------------------------------
Q55HR8_CRYNB/34-481---TGLYQF----AIFL-FL--------------IEV-------------------------------------------
S40A1_ARATH/35-483---ARTWEF----SVAL-YM--------------IHL-------------------------------------------
A2R421_ASPNC/42-466---SRMFEF----GAVL-FL--------------ATI-------------------------------------------
Q4RHW0_TETNG/8-534---DRMWHF----AISV-FL--------------IEL-------------------------------------------
Q2U620_ASPOR/31-411---SRMFEF----GAVL-FL--------------ASI-------------------------------------------
Q5AXY5_EMENI/19-441---SRMFEF----GAVV-FL--------------ASI-------------------------------------------
Q8IA95_CAEEL/5-448---DRMWAF----VIGL-FM--------------HQL-------------------------------------------
S40A3_ARATH/146-569---EQLWNF----AWPS-AI--------------AML-------------------------------------------
Q0CWF0_ASPTN/44-463---SRMFEF----GSVL-FL--------------ASI-------------------------------------------
Q4PD48_USTMA/82-563---YRSAEF----AYPL-MM--------------VQL-------------------------------------------
S40A1_HUMAN/22-531---DRMWHF----AVSV-FL--------------VEL-------------------------------------------
A2Y023_ORYSI/145-569---EQLWNF----TWPA-AV--------------AVL-------------------------------------------
S40A1_DANRE/19-522---DRMWNF----AVAV-FL--------------VEL-------------------------------------------
A8X2J9_CAEBR/13-461---DRAWSF----CVSL-CM--------------DLL-------------------------------------------
A5BT51_VITVI/32-472---ARMWEF----SVGL-YM--------------INI-------------------------------------------
A1CBM9_ASPCL/39-469---SRMFEF----GAIL-FL--------------ASI-------------------------------------------

PF13000

YHZ9_SCHPO/51-519---MGLVRG----SIPY-FL--------------KP.-------------------------------------------
YB70_YEAST/17-560---VGLAFG----TVPF-LL--------------KSL-------------------------------------------

PF03825

YEGT_ECOLI/1-405.-------------------------------------------------------------------------FSAGE-
NUPG_SHIFL/1-407K-------------------------------------------------------------------------FDGAS-
Q9A7U2_CAUCR/1-395.-------------------------------------------------------------------------FAPWQ-
XAPB_ECOLI/1-407H-------------------------------------------------------------------------FTGAN-

PF07690

O17785_CAEEL/33-439N---------------------------------........................................YSPSE.
Y2994_MYCTU/18-356G---------------------------------........................................TPLSH.
ANTR2_ARATH/137-500N---------------------------------........................................WSSAT.
Q19296_CAEEL/16-403D---------------------------------ISVKGLQS........................FQEAIGVPHSERYD
A9CFQ9_AGRT5/27-373G---------------------------------........................................VSLAS.
Q8NW16_STAAW/10-348G---------------------------------........................................KSLTV.
O25793_HELPY/8-347H---------------------------------.......................................SSSPLL.
Q97XW7_SULSO/20-385.---------------------------------........................................IYPNI.
P72184_9ACTO/22-419H---------------------------------........................................APVST.
O66589_AQUAE/21-406G---------------------------------........................................LSGAQ.
Q9I0P8_PSEAE/19-362A---------------------------------........................................WDRAE.
MFSD9_HUMAN/49-427G---------------------------------........................................ASPTV.
Q97CG2_THEVO/16-347S---------------------------------........................................NSPIL.
Q9CF47_LACLA/24-427H---------------------------------........................................TTASS.
Q92RK8_RHIME/23-360A---------------------------------........................................LDFVQ.
Q8YC70_BRUME/8-339G---------------------------------........................................YSASL.
Q8Z8V3_SALTI/17-369I---------------------------------.........................................DLKT.
Q8NU65_CORGL/19-414G---------------------------------........................................MSDGT.
Q9YG70_AERPE/18-417G---------------------------------........................................ISPVE.
Q9HLN0_THEAC/12-329Y---------------------------------..............................................
Q8XR21_RALSO/30-433G---------------------------------ITQSHTCGADV.................SLIAELFTTSCDWRISS.
Q932J3_STAAM/33-313G---------------------------------........................................FTKAE.
O87836_STRCO/61-422.---------------------------------........................................WSSGS.
Q8NNT7_CORGL/10-351.---------------------------------........................................GSSAV.
Q92WR7_RHIME/13-355G---------------------------------........................................WSVTG.
Q8TZJ0_PYRFU/13-389K---------------------------------........................................MNRTI.
O58400_PYRHO/34-380G---------------------------------........................................GTMFL.
Q9KRL8_VIBCH/16-353A---------------------------------........................................VSETQ.
Q9KWU2_SPHSX/13-348M---------------------------------..............................................
LTAA_STAAW/18-353S---------------------------------........................................IAVAI.
Q8Y7M4_LISMO/13-349N---------------------------------........................................ASLGE.
NART_STACT/13-344K---------------------------------........................................ITSSQ.
Q9K646_BACHD/13-358Q---------------------------------........................................LTDSL.
YLZ2_SCHPO/48-434H---------------------------------........................................ASRTL.
YWOG_BACSU/15-348G---------------------------------........................................GTESQ.
Q8WZT8_NEUCS/132-490N---------------------------------........................................IGYAI.
O54179_STRCO/33-428G---------------------------------........................................FALSD.
Q98B83_RHILO/60-407G---------------------------------........................................IPVGA.
Q46984_ECOLX/39-413G---------------------------------........................................LSATM.
Q9EYN6_SYNPW/18-450G---------------------------------........................................LTVGQ.
Q9KBG2_BACHD/16-398Q---------------------------------........................................ISTAQ.
Q986N1_RHILO/24-356A---------------------------------........................................TSVPA.
Q93LX8_9ACTO/30-425G---------------------------------........................................LAPHE.
Q8KDQ3_CHLTE/9-374G---------------------------------........................................ASPFM.
Q9PCL3_XYLFA/32-422G---------------------------------........................................ASVDG.
Q9URI1_CANAX/123-512G---------------------------------........................................IGRVV.
Q9KRK6_VIBCH/22-366G---------------------------------........................................VNAGA.
Q92Y26_RHIME/19-357A---------------------------------........................................LSLAA.
Q9RSF5_DEIRA/46-397G---------------------------------........................................LTPAQ.
Q8WU09_HUMAN/27-274E---------------------------------........................................GTSEQ.
LIZ1_SCHPO/36-407K---------------------------------........................................MHGNE.
Q97IY3_CLOAB/13-357N---------------------------------..............................................
Q9I008_PSEAE/29-430A---------------------------------........................................IGHDE.
Q9HTX1_PSEAE/12-346H---------------------------------........................................ISAHQ.
Q9KYI2_STRCO/15-371G---------------------------------........................................LSFSA.
Q973W8_SULTO/12-335H---------------------------------........................................APIFL.
Q18472_CAEEL/18-397S---------------------------------EMHLVN............................GTMRSIYDYTSD
Q8ZXX0_PYRAE/10-352G---------------------------------.........................................GKLE.
Q9AA55_CAUCR/30-391G---------------------------------...........................................RE.
YN42_SCHPO/141-527H---------------------------------........................................ISLTV.
Q8NUU1_STAAW/16-376G---------------------------------........................................MTKPQ.
Q961H2_DROME/54-453G---------------------------------IDRGS..............................DADKEVEVIV.
Q8X543_ECO57/36-398L---------------------------------.........................................SRSD.
Q8KCE7_CHLTE/27-390G---------------------------------........................................IPVSE.
P95852_SULSF/9-333N---------------------------------........................................ISIM..
O45678_CAEEL/27-403A---------------------------------........................................WNKTD.
Q9I5C8_PSEAE/21-369Q---------------------------------........................................LSSLQ.
O30222_ARCFU/15-357G---------------------------------........................................VPAAT.
O54630_HALSA/24-368.---------------------------------.........................................SFLV.
Q8TR38_METAC/18-398G---------------------------------........................................GNALV.
Q986D7_RHILO/41-396H---------------------------------........................................LSNAE.
O69759_PSEFL/31-392C---------------------------------........................................LSKYE.
Q9HLR9_THEAC/6-377H---------------------------------........................................SNVFF.
Q8Z4K9_SALTI/13-352Q---------------------------------..............................................
O28944_ARCFU/4-328G---------------------------------........................................ASVFL.
Q9KKX8_VIBCH/40-383H---------------------------------........................................ATATE.
Q96XQ4_SULTO/9-336K---------------------------------........................................PTVIE.
Q8Y6H4_LISMO/13-376G---------------------------------..........................................REL.
O62376_CAEEL/16-394G---------------------------------HAPL...............................FTNEADAKHF.
YCUD_SCHPO/89-473Q---------------------------------..............................................
Y1634_MYCTU/25-423G---------------------------------.........................................GSRL.
Q9KG75_BACHD/5-341G---------------------------------........................................ASETL.
Q7JZE2_DROME/46-458N---------------------------------........................................PQIQET
Q9KLN6_VIBCH/36-395.---------------------------------........................................VTLEE.
Q8P881_XANCP/26-418G---------------------------------........................................VAAPA.
Q8PQ23_XANAC/19-356G---------------------------------........................................IQVRS.
YQ92_SCHPO/20-407G---------------------------------........................................ISPDR.
O16697_CAEEL/36-432T---------------------------------........................................ADVDF.
Q8K8C8_STRP3/10-353G---------------------------------.........................................TPTEL
Q8X0G2_NEUCS/87-498G---------------------------------.........................................AANT.
Q8XKW0_CLOPE/26-404N---------------------------------........................................ISATA.
O58488_PYRHO/9-354G---------------------------------........................................ISSNE.
Q9K9F3_BACHD/14-368S---------------------------------........................................MDRGS.
O29880_ARCFU/11-360G---------------------------------........................................WSKTI.
Q97C48_THEVO/19-351H---------------------------------........................................LSLIF.
Q9Y7D4_ASPTE/35-449H---------------------------------.........................................SLGD.
Q97DX4_CLOAB/23-413N---------------------------------........................................VTALT.
Q8MPU6_CAEEL/90-445.---------------------------------........................................LSETQ.
Q96Y06_SULTO/9-344G---------------------------------........................................FSNLL.
A9CIR5_AGRT5/18-359D---------------------------------..........................................YAV.
Q8ZWZ3_PYRAE/12-326R---------------------------------........................................VDPAY.
Q8X5A4_ECO57/20-357H---------------------------------........................................ARPAM.
Q9P397_NEUCS/52-417H---------------------------------........................................LEGTQ.
Y2456_MYCTU/16-365D---------------------------------........................................WDQAS.
Q19845_CAEEL/45-446N---------------------------------........................................VTQTS.
Q8NUX5_STAAW/12-354G---------------------------------........................................ATNTV.
YHJO_BACSU/19-353N---------------------------------........................................GSIMM.
Q8ZVF8_PYRAE/4-322G---------------------------------.......................................VQSETV.
O58825_PYRHO/10-360G---------------------------------..............................................
Q8X5A5_ECO57/8-341G---------------------------------........................................ISIPA.
Q9L8Q4_PSEST/17-351G---------------------------------........................................ISRQQ.
Q9XXC1_CAEEL/44-436V---------------------------------NSNKSLDEINWN................DPDLPLSQRRFAFDTTQ.
Q9ADP8_STRCO/39-376G---------------------------------........................................STPSA.
Q8YQ15_NOSS1/8-358M---------------------------------.........................................SLDV.
O93992_CANAX/65-459D---------------------------------........................................VSHEV.
Q8YWH2_NOSS1/17-343.---------------------------------........................................INDIV.
Q9RSM6_DEIRA/32-418R---------------------------------.........................................GLGL.
Q9VDS0_DROME/61-500T---------------------------------CDTSYLTSSSNSSFSISDNQCYVLDESTGTSSECEQFNYVSSFDS.
Q9I0Y2_PSEAE/28-357G---------------------------------........................................FQGAS.
Q92TU0_RHIME/19-421G---------------------------------D.....................................TYATPDE.
Q8RQC1_RHIFR/18-362S---------------------------------........................................PSDSV.
Q8XGP2_RALSO/41-431H---------------------------------........................................SSEAT.
YFIS_BACSU/15-364H---------------------------------........................................ASPLD.
Q92BU8_LISIN/14-347G---------------------------------........................................ASHSQ.
Q55937_SYNY3/19-365.---------------------------------........................................LAGQG.
Q9A856_CAUCR/31-388G---------------------------------........................................WSEHD.
P72472_STRLI/29-361T---------------------------------........................................ISDGM.
Q97BG6_THEVO/17-357S---------------------------------........................................ISFLI.
Q9X4X9_9PSED/27-377G---------------------------------........................................WTRPE.
Q973J7_SULTO/8-320G---------------------------------........................................LSPLL.
O32859_MYCFO/12-364G---------------------------------.........................................SALD.
Q9S243_STRCO/13-352G---------------------------------........................................ADERA.
Q97PK9_STRPN/13-344G---------------------------------........................................YSKEQ.
Q97CC5_THEVO/27-411G---------------------------------WSYSP..............................THLDALAIHN.
AMPG1_RICPR/10-405.---------------------------------........................................IALQT.
Q9RD97_STRCO/46-435H---------------------------------........................................TSLSA.
Q8R8R3_THETN/20-398G---------------------------------TYVMFF............................YIDVLKVDPSF.
O30210_ARCFU/17-354G---------------------------------........................................IDQTT.
Q8X120_EXODE/120-524H---------------------------------.......................................TTNPGQ.
Q9EW91_9ACTO/13-358G---------------------------------........................................NSGSA.
Q8MMD6_DROME/21-407N---------------------------------........................................PNFPE.
Q8XVV0_RALSO/19-414G---------------------------------........................................ATSTE.
Q978I2_THEVO/17-358.---------------------------------........................................KKPLL.
S22AI_MOUSE/13-363G---------------------------------........................................LDSVS.
Q92XG9_RHIME/14-352G---------------------------------........................................GTAAL.
Q8P8I8_XANCP/24-370R---------------------------------.........................................SPLS.
Q9I1Q7_PSEAE/34-397Q---------------------------------........................................LTPSM.
Q9I4J1_PSEAE/26-388E---------------------------------........................................LDKSA.
Q9KG22_BACHD/29-373G---------------------------------.........................................LKTF.
Q9KYE9_STRCO/8-359G---------------------------------........................................LGSVT.
Q8K8F6_STRP3/27-401Q---------------------------------..............................................
O31131_BRELN/13-405E---------------------------------........................................SAGSA.
Q8PQM0_XANAC/29-361H---------------------------------........................................ASAGM.
Q9ZC50_YERPE/23-431N---------------------------------........................................VPPTT.
Q8U366_PYRFU/20-359H---------------------------------........................................IGKAL.
Q9C9R9_ARATH/11-379.---------------------------------........................................TDPTG.
Q20265_CAEEL/46-427N---------------------------------........................................FSKFE.
Q9PCQ0_XYLFA/73-403A---------------------------------........................................IPATA.
Q9I247_PSEAE/4-339G---------------------------------........................................FGASQ.
Q9VPX2_DROME/42-442T---------------------------------AKVE...............................DGPFDWSEPL.
Q8Y3L9_LISMO/17-359G---------------------------------........................................FDPSQ.
Q8VUK1_HALHD/23-380G---------------------------------........................................LDELG.
Q8RPH1_DESHA/13-347H---------------------------------........................................VDPTV.
A9CGF2_AGRT5/30-354L---------------------------------..............................................
O66181_ARTSP/15-353S---------------------------------........................................LSYQQ.
Q8KYU7_9PROT/15-359N---------------------------------........................................LSHGD.
YJ7D_SCHPO/81-445H---------------------------------........................................IDGHT.
Q8XEG8_ECO57/47-408G---------------------------------........................................LSATE.
Q9VY22_DROME/66-470N---------------------------------LEKACRVNMAYGDEV.........CDALTRRQTANYTLEEETVQQM
Q8U4E5_PYRFU/8-345G---------------------------------........................................ATPVI.
YFKL_BACSU/12-351N---------------------------------........................................TDPTG.
O30679_RHORH/8-341G---------------------------------........................................VSVPA.
Q97TH3_CLOAB/16-408S---------------------------------........................................ANLDT.
THI73_YEAST/86-451K---------------------------------..........................................GNE.
Q9A961_CAUCR/19-356D---------------------------------..............................................
Q97TH7_CLOAB/19-357S---------------------------------........................................ISVST.
Q8NVE0_STAAW/12-398N---------------------------------.........................................AGNL.
Q9VPD9_DROME/28-441G---------------------------------.......................................NRVLLV.
Q8PVU8_METMA/11-346K---------------------------------........................................TTSHE.
Q8NVE2_STAAW/18-410N---------------------------------........................................INEST.
Q97FI4_CLOAB/17-361K---------------------------------........................................FSMAT.
Q8KR58_ESCFE/20-359S---------------------------------..............................................
Q8NLD6_CORGL/19-353G---------------------------------........................................VSESS.
Q9LAA0_AERHY/27-362D---------------------------------........................................VSPTY.
O06742_BACIU/18-364H---------------------------------........................................LSQFQ.
Q9FCG1_STRCO/24-364G---------------------------------........................................YSASY.
O94019_CANAX/86-529G---------------------------------........................................ISYDA.
MOT14_MOUSE/42-459H---------------------------------........................................QSRGL.
Q92V77_RHIME/8-347T---------------------------------.........................................TIPR.
Q9Y7E0_ASPTE/42-435D---------------------------------........................................MTVET.
Q9I431_PSEAE/11-401G---------------------------------........................................ASVAT.
O76837_CAEEL/25-400.---------------------------------........................................VISEQS
Q96ZI2_SULTO/36-365N---------------------------------........................................FSESE.
Q9L8R0_PSEST/7-367G---------------------------------........................................WSGAE.
Q94886_DROME/14-423A---------------------------------ALAEMNER.......................FSLERWFLDWANIPY

PF00083

GTR4_MOUSE/27-483T.WLGRQGPGGPDSI........................................................PQGTLTTL-
GTR1_MOUSE/14-467T.WNHRYGEPIPS............................................................TTLTTL-
QUTD_EMENI/24-490N.WESLNTDLIS...................................................................-
ITR2_YEAST/112-569K.VLTYGE.KE....................................................................-
SNF3_YEAST/100-556V.APNHDSFTAQ..................................................................Q-
GALP_ECOLI/18-451F.QITSHT.QE....................................................................-
HXT5_YEAST/89-549G.STRANGTTYL...............................................................SDVR-
GTR3_MOUSE/13-465T.LEERLEDLPSE............................................................GLLTAL-
HXT9_YEAST/64-526G.QKNDKGTYYL...............................................................SKVR-
HXT3_YEAST/65-525G.MKHKDGSYYL...............................................................SKVR-
HXT8_YEAST/69-530GNYSHSKNTYYL...............................................................SNVR-
YJHB_ECOLI/15-405L.GITDIQA......................................................................-
HXT6_YEAST/68-528G.MKHKDGTNYL...............................................................SKVR-
SUT_SPIOL/38-486T.WAAYIWLCG....................................................................-
GTR3_CHICK/14-464T.LSQRSGETISP............................................................ELLTSL-
GTR5_HUMAN/20-475T.YYGRTGEFMED............................................................FPLTLL-
PRO1_LEIEN/95-540G.ALARCEADSRCRWSYSDE...............................................ECQNPSGYSSSE-
HXT13_YEAST/60-521G.SYKHSTGEYY..............................................................LSNVR-
RAG1_KLULA/66-528G.QEKADGSHYL...............................................................SNVR-
YB91_YEAST/27-485A.PDENISYDDTWVGQHG..................................................LKQCIALTDSQ-
GTR1_LEIDO/5-442G.FSEHSWQYA....................................................................-
HUP1_PARKE/30-492F.PDVWAKKQEVHEDS......................................................PYCTYDNAK-
PROP_ECOLI/25-453G.ADPSVQMVAA...................................................................-
JEN1_YEAST/125-563C.VSVSVAPLAELY...........................................................DRPTKD-
GIT1_YEAST/43-466Y.GKKNYSSKVS...................................................................-
GTR2_MOUSE/13-498V.LGVPLDDRKAAINYDVNGTDTPLTVTPA...........................YTTPAPWDEEETEGSAHIVTML-
HXT2_YEAST/59-519G.QMKSDGTYYL...............................................................SDVR-
XYLE_ECOLI/13-478P.QNLSESAANS..................................................................L-
LACP_KLULA/75-529H.LDINSSSG.....................................................................-
STP1_ARATH/26-489F.PSVYRKQQEDASTN......................................................QYCQYDSPT-
MAL31_YEAST/102-561G.SLNSNTGDYE..............................................................ISVSW-
GTR2_LEIDO/41-538Q.LYSAKKSCETLTAAKCRWFNASTYVSNTTYGEVCGWADRTTCFLKYSDEAGCLSDSACKWSYSANTCGNQVGYSSIQ-
Q57RP5_SALCH/23-420L.MLTFA........................................................................-
TH2A_TRYBB/39-502S.LFKTTEACKAVGSYGCEWKDTEVCSWKK...........................ECDSDSDGVNPCESLIGYSSLY-
GTR3_HUMAN/12-465I.NKTLTDKGNAPPS.........................................................EVLLTSL-
GTR2_HUMAN/13-499V.LGVPLDDRKAINNYVINSTDELPTISYS..........................MNPKPTPWAEEETVAAAQLITML-
TH12_TRYBB/39-501C.KFTTEGACGGRKIYGCKWSGTTCKFENP...........................KCSEGSDPSDSCKNEVAYTSVY-
QAY_NEUCR/24-494D.FASYT..PGA...............................................................LALL-
GLF_ZYMMO/13-469I.APRHLSATA................................................................AASL-
HXT4_YEAST/74-534G.MKHHDGTYYL...............................................................SKVR-
ITR1_YEAST/89-546K.VLTYGE.KE....................................................................-
STL1_YEAST/30-488P.ATKENGDHDR..............................................................HATVV-
ARAE_ECOLI/25-461F.VLTSR..LQE...................................................................-
GAL2_YEAST/74-534G.MKHKDGTHYL...............................................................SNVR-

PF05977

Q92LE2_RHIME/11-531S-------------------------------------------------------------------------ASDLM-
Q98HB4_RHILO/11-532A-------------------------------------------------------------------------TSPYQ-
Q92Y88_RHIME/8-530S-------------------------------------------------------------------------AAPAA-
Q9X4X4_9PSED/20-540S-------------------------------------------------------------------------TSPLM-
A9CFW7_AGRT5/8-530S-------------------------------------------------------------------------ASPAA-
Q9HYE1_PSEAE/25-549H-------------------------------------------------------------------------ASPLM-
Q989L4_RHILO/31-551S-------------------------------------------------------------------------TSDVM-
Q92SW7_RHIME/14-535S-------------------------------------------------------------------------QSVNM-
Q989T8_RHILO/11-532S-------------------------------------------------------------------------TSDVM-
Q9I0E1_PSEAE/6-529S-------------------------------------------------------------------------ASPLN-

PF01306

LACY_CITFR/1-412H-------------------------------------------------------------------------ISKGD-
RAFB_ECOLX/4-415G-------------------------------------------------------------------------LSKTD-
CSCB_ECOLX/4-411G-------------------------------------------------------------------------LTGTE-
LACY_KLEOX/6-416H-------------------------------------------------------------------------LTKTE-

PF03137

SO2A1_RAT/31-603G-------------------------------------------------------------------------LSSSS-
SO1B2_RAT/27-616D-------------------------------------------------------------------------IPSSI-
SO2B1_HUMAN/48-648G-------------------------------------------------------------------------LSSQT-
SO3A1_HUMAN/39-623N-------------------------------------------------------------------------LQSAD-
Q20702_CAEEL/102-763K-------------------------------------------------------------------------FSTSH-
SO2A1_HUMAN/31-603G-------------------------------------------------------------------------LSSSS-
Q9VVH9_DROME/173-755Q-------------------------------------------------------------------------IKSKT-
Q93550_CAEEL/16-587G-------------------------------------------------------------------------FSSEK-
Q9W271_DROME/65-627K-------------------------------------------------------------------------IPTKV-
SO1A3_RAT/19-598G-------------------------------------------------------------------------IPTAI-
SO1B1_HUMAN/27-622E-------------------------------------------------------------------------ISSSL-
Q21157_CAEEL/48-598K-------------------------------------------------------------------------LTSTQ-
SO4A1_HUMAN/102-664D-------------------------------------------------------------------------LHSYQ-
Q9XWC5_CAEEL/47-621K-------------------------------------------------------------------------MTSTH-
Q9W269_DROME/110-732K-------------------------------------------------------------------------IPSKN-
SO1A2_HUMAN/19-598N-------------------------------------------------------------------------IPTSL-

PF06779

Q89X18_BRAJA/64-148--------------------------------------------------------------------------------
Q92UK2_RHIME/2-86--------------------------------------------------------------------------------
Q8YFG7_BRUME/2-86--------------------------------------------------------------------------------
Q986E3_RHILO/35-119--------------------------------------------------------------------------------
Q8Z0X3_SALTI/24-110--------------------------------------------------------------------------------
Q9I3T2_PSEAE/21-105--------------------------------------------------------------------------------
Q88ED9_PSEPK/15-99--------------------------------------------------------------------------------
Q89HQ1_BRAJA/50-128--------------------------------------------------------------------------------
A9CI18_AGRT5/24-108--------------------------------------------------------------------------------
Q8Y185_RALSO/37-119--------------------------------------------------------------------------------
Q87ES9_XYLFT/27-113--------------------------------------------------------------------------------
YJIJ_ECOLI/24-110--------------------------------------------------------------------------------

PF06609

Q8NII4_FUSAU/1-598G--------------------------------------------------------------------------QSEN-
Q9C1B3_FUSSP/1-598G--------------------------------------------------------------------------QSEN-

PF12832

A7SQQ8_NEMVE/55-132--------------------------------------------------------------------------------
Q6FB61_ACIAD/6-82--------------------------------------------------------------------------------
B7P8Y1_IXOSC/9-85--------------------------------------------------------------------------------
Q17GA0_AEDAE/14-90--------------------------------------------------------------------------------
A7RI07_NEMVE/54-130--------------------------------------------------------------------------------
A4Y888_SHEPC/10-86--------------------------------------------------------------------------------
A4BSZ3_9GAMM/7-83--------------------------------------------------------------------------------
Q2BMQ1_9GAMM/3-79--------------------------------------------------------------------------------
Q54SK7_DICDI/682-755--------------------------------------------------------------------------------
A7EK42_SCLS1/450-504--------------------------------------------------------------------------------
B2AA42_PODAN/619-697--------------------------------------------------------------------------------
A1WY15_HALHL/14-90--------------------------------------------------------------------------------
Q54G39_DICDI/12-88--------------------------------------------------------------------------------
B3PHF3_CELJU/15-91--------------------------------------------------------------------------------
Q07ZQ8_SHEFN/10-86--------------------------------------------------------------------------------
D3SB25_THISK/3-79--------------------------------------------------------------------------------
B0X8B9_CULQU/11-87--------------------------------------------------------------------------------
YJBC_SCHPO/418-493--------------------------------------------------------------------------------
Q16KC8_AEDAE/34-110--------------------------------------------------------------------------------
Q21IX9_SACD2/5-81--------------------------------------------------------------------------------
B4G7T5_DROPE/36-112--------------------------------------------------------------------------------
C3YMP2_BRAFL/14-90--------------------------------------------------------------------------------
Q0A9B1_ALHEH/6-82--------------------------------------------------------------------------------
A3QFN3_SHELP/24-100--------------------------------------------------------------------------------
Q55CH3_DICDI/11-87--------------------------------------------------------------------------------
B8GQD4_THISH/5-81--------------------------------------------------------------------------------
A1S7K7_SHEAM/12-88--------------------------------------------------------------------------------
C5BL70_TERTT/2-78--------------------------------------------------------------------------------
B1KKS0_SHEWM/10-86--------------------------------------------------------------------------------
B0V728_ACIBY/7-83--------------------------------------------------------------------------------
B0W437_CULQU/30-106--------------------------------------------------------------------------------
A7UVG6_ANOGA/14-90--------------------------------------------------------------------------------
Q2SJE3_HAHCH/5-81--------------------------------------------------------------------------------
B7PL10_IXOSC/7-83--------------------------------------------------------------------------------
A7C0B5_9GAMM/6-82--------------------------------------------------------------------------------
A8PWD3_MALGO/544-619--------------------------------------------------------------------------------
B6C555_9GAMM/9-85--------------------------------------------------------------------------------
B6K1R3_SCHJY/414-489--------------------------------------------------------------------------------
Q4PB45_USTMA/688-764--------------------------------------------------------------------------------

PF01770

Q29L76_DROPS/2-397--------------------------------------------------------------------------YLAGDY
Q294A5_DROPS/2-414--------------------------------------------------------------------------ILMSDW
Y2544_DICDI/95-457--------------------------------------------------------------------------YFTNV.
Q9EQN9_MOUSE/28-459--------------------------------------------------------------------------YLLGPD
Q9VK64_DROME/2-395--------------------------------------------------------------------------YLASDY
Q9BTX8_HUMAN/23-434--------------------------------------------------------------------------YLLGPD
Q9VGV5_DROME/2-408--------------------------------------------------------------------------YLLGPW
S19A3_HUMAN/10-441--------------------------------------------------------------------------YLSGPD
Q4T7Q4_TETNG/6-427--------------------------------------------------------------------------YLTGPD
Q6GN45_XENLA/68-474--------------------------------------------------------------------------YLLSTE
Q17QC9_BOVIN/23-434--------------------------------------------------------------------------YLLGPD
Q1LV16_DANRE/4-414--------------------------------------------------------------------------YLVGP.
Q16JT2_AEDAE/2-405--------------------------------------------------------------------------FLNGSW
Q6NRB3_XENLA/18-453--------------------------------------------------------------------------YLLGPD
Q9VGV6_DROME/2-411--------------------------------------------------------------------------ILMGEW
FOLT2_CAEEL/2-394--------------------------------------------------------------------------YQHTV.
Q542F3_MOUSE/23-427--------------------------------------------------------------------------FLL..E
Q28C92_XENTR/10-422--------------------------------------------------------------------------YFTGSY
Q6DIK7_XENTR/10-424--------------------------------------------------------------------------YLVGPH
Q7Q5N2_ANOGA/2-422--------------------------------------------------------------------------FLSGEW
A8BIM9_GIAIC/39-447--------------------------------------------------------------------------YYID..
A7SN54_NEMVE/6-420--------------------------------------------------------------------------YLRAPP
S19A3_MOUSE/11-435--------------------------------------------------------------------------FLSEPS
Q5ZMS7_CHICK/32-445--------------------------------------------------------------------------YLLGHD

PF05631

Q9M3A1_ARATH/4-380Q-------------------------------------------------------------------------GPYVYY
Q9N3A9_CAEEL/1-336Q-------------------------------------------------------------------------GPHVYA
Q9FWD6_ORYSJ/4-357Q-------------------------------------------------------------------------GPYVYY

PF00854

PTR12_ARATH/99-497--------------------------------------------------------------------------------
PTR17_ARATH/124-523--------------------------------------------------------------------------------
YCLF_BACSU/95-444--------------------------------------------------------------------------------
S15A2_HUMAN/111-494--------------------------------------------------------------------------------
DTPT_LACLC/90-449--------------------------------------------------------------------------------
S15A1_RAT/81-476--------------------------------------------------------------------------------
PEPT3_CAEEL/82-469--------------------------------------------------------------------------------
YJDL_ECOLI/75-420--------------------------------------------------------------------------------
DTPA_ECOLI/88-431--------------------------------------------------------------------------------
PTR2_ARATH/113-517--------------------------------------------------------------------------------
PEPT1_CAEEL/113-557--------------------------------------------------------------------------------
PTR2_YEAST/155-515--------------------------------------------------------------------------------
PTR7_ARATH/99-507--------------------------------------------------------------------------------
O22305_LOTJA/95-494--------------------------------------------------------------------------------
PTR2_SCHPO/158-520--------------------------------------------------------------------------------
PEPT1_DROME/101-444--------------------------------------------------------------------------------
Q96400_CUCSA/121-513--------------------------------------------------------------------------------
DTPD_ECOLI/76-426--------------------------------------------------------------------------------
PTR2_CANAX/161-542--------------------------------------------------------------------------------
S15A1_HUMAN/81-475--------------------------------------------------------------------------------
S15A1_RABIT/81-474--------------------------------------------------------------------------------
PTR30_ARATH/96-491--------------------------------------------------------------------------------
PEPT2_CAEEL/99-526--------------------------------------------------------------------------------
S15A4_RAT/94-495--------------------------------------------------------------------------------
DTPB_ECOLI/81-428--------------------------------------------------------------------------------

PF06813

Q7XGH1_ORYSJ/34-288G-------------------------------------------------------------------------YDQRT-
Q9LUF8_ARATH/16-265G-------------------------------------------------------------------------YNQKQ-
Q8H613_ORYSJ/14-261A-------------------------------------------------------------------------ADQRR-
Q94D97_ORYSJ/8-252S-------------------------------------------------------------------------ISQVQ-
Q9C862_ARATH/7-251G-------------------------------------------------------------------------ISQVR-
O81121_ARATH/16-263N-------------------------------------------------------------------------YNQKQ-
O81120_LOTJA/26-271G-------------------------------------------------------------------------YDQST-
Q9M8M1_ARATH/13-260G-------------------------------------------------------------------------FSQQQ-
Q9ZUV4_ARATH/17-262G-------------------------------------------------------------------------YDQTT-
O22926_ARATH/7-235K-------------------------------------------------------------------------ISQFK-
O80960_ARATH/21-266G-------------------------------------------------------------------------YDQTT-
Q8H6R3_PONTR/13-260G-------------------------------------------------------------------------YNQQQ-
Q8H132_ARATH/7-253G-------------------------------------------------------------------------ISQVQ-
Q9SLF1_ARATH/14-260N-------------------------------------------------------------------------LNQLE-
Q9SS92_ARATH/41-290G-------------------------------------------------------------------------VSQSR-

PF05978

Q19933_CAEEL/13-169--------------------------------------------------------------------------------
Q9XV34_CAEEL/12-166--------------------------------------------------------------------------------
MFS11_MOUSE/14-166--------------------------------------------------------------------------------
Q8MYL9_CAEEL/14-170--------------------------------------------------------------------------------
Q965T3_CAEEL/14-170--------------------------------------------------------------------------------
P91007_CAEEL/16-172--------------------------------------------------------------------------------
Q9XWR7_CAEEL/37-194--------------------------------------------------------------------------------
Q19932_CAEEL/14-169--------------------------------------------------------------------------------
Q21545_CAEEL/14-168--------------------------------------------------------------------------------
O61865_CAEEL/27-183--------------------------------------------------------------------------------
Q18251_CAEEL/11-167--------------------------------------------------------------------------------

PF07672

Q8EUQ6_MYCPE/191-477--------------------------------------------------------------------------------
Y077_MYCPN/209-467--------------------------------------------------------------------------------
Q8EVP4_MYCPE/172-441--------------------------------------------------------------------------------
Q9KX64_MYCGL/1-256--------------------------------------------------------------------------------
Y076_MYCPN/210-484--------------------------------------------------------------------------------
Q98PH4_MYCPU/154-430--------------------------------------------------------------------------------
Y061_MYCGE/119-383--------------------------------------------------------------------------------

PF02487

CLN3_CANFA/37-438T-------------------------------------------------------------------------AHNSSS
BTN1_YEAST/8-397.-------------------------------------------------------------------------TLP...

PF03219

A6XGR5_9CHLO/42-534K-------------------------------------------------------------------------DVLIIT
TLC2_ARATH/88-571K-------------------------------------------------------------------------DVLVVT
TLCB_RICCN/9-501K-------------------------------------------------------------------------DSFVVT
Q842J1_9RICK/3-491K-------------------------------------------------------------------------DGFVVT
TLC1_CHLTR/2-492K-------------------------------------------------------------------------DTLIVT
Q70GF8_9CHLA/1-443.-------------------------------------------------------------------------DT...P
Q6MEN4_PARUW/1-484K-------------------------------------------------------------------------DAIVVT
TLCD_RICFE/12-503K-------------------------------------------------------------------------DSIVTT
Q9X9D2_CHLTH/1-500K-------------------------------------------------------------------------DSLVLV
Q8WH67_GALSU/142-638K-------------------------------------------------------------------------DVLVVT
Q6H8E4_ORYSJ/76-563K-------------------------------------------------------------------------DVLVVT
Q252Y6_CHLFF/2-510K-------------------------------------------------------------------------DTLVVV
A5CCY4_ORITB/4-486K-------------------------------------------------------------------------DSLVIT
Q71JS5_9CHLA/2-490K-------------------------------------------------------------------------DTLIVT
A5CDU3_ORITB/11-501K-------------------------------------------------------------------------NTIVTT
Q6MBI2_PARUW/1-474K-------------------------------------------------------------------------DTIVIT
A8F0G0_RICM5/3-489K-------------------------------------------------------------------------DGFVVT
A8GSF7_RICRS/1-496K-------------------------------------------------------------------------DSLVVP
Q83W26_RICTP/4-496K-------------------------------------------------------------------------DSILIS
A5CES7_ORITB/3-495K-------------------------------------------------------------------------DSIVIP
A5CCG2_ORITB/17-505K-------------------------------------------------------------------------DSIVIT
Q6MEN5_PARUW/4-499K-------------------------------------------------------------------------DSLLIT
TLC2_CHLPN/2-503K-------------------------------------------------------------------------DTLVIV
Q6MEM5_PARUW/2-491K-------------------------------------------------------------------------DTLIVT
A5CCG3_ORITB/1-504K-------------------------------------------------------------------------DSLVVP
Q8KPN2_HOLOB/2-501K-------------------------------------------------------------------------DSLLVN
Q1MSG2_LAWIP/9-504K-------------------------------------------------------------------------DTLMVS

PF01733

S29A1_RAT/144-455--------------------------------------------------------------------------------
S29A2_HUMAN/131-454--------------------------------------------------------------------------------
S29A1_HUMAN/144-454--------------------------------------------------------------------------------
FUN26_YEAST/180-510--------------------------------------------------------------------------------
Q19495_CAEEL/137-426--------------------------------------------------------------------------------
Q21145_CAEEL/434-723--------------------------------------------------------------------------------
O64603_ARATH/145-428--------------------------------------------------------------------------------

PF03239

FTH1_YEAST/8-404KQGLSVEDDSPFEGSSSSAGLPSPNTNTNADSTTAFLQAGPSDGNAIGTSATAANNKSRPLNVEEEEEIYEYSNELRDQD
EFEU_BACSU/9-395KQMIKSVKDGDMDSAQQTFDTFKAKWKKEEPSI..........KKENLSSHSEMDANIAMISLSFINQDARKLKTQLEEL
Q9Y8Z4_AERPE/4-268KK........................................................................MGEHGK
Y964_SYNY3/6-291AR........................................................................AQQMQL
FIP1_SCHPO/7-320SQ........................................................................TLMDKD
EFEU_ECOLI/1-276KR........................................................................TQRGMX
O83937_TREPA/14-362WVGVALMC............................................................VAWSVSAAEGTR
Q9ZC51_YERPE/156-557QGFKNSEMEMSVRGNRSAQQAAEINQQFTALIDL.......ARQPDKMTEVAYRVTGLLHTIEDILPGLPTTREQQQITV
Q9RKQ1_STRCO/1-274VK........................................................................TDRRDA
Q9ZDD8_RICPR/1-278KQ.........................................................................IEKSR
FTR1_YEAST/7-321KQ........................................................................AIGEHD
Y154_ARCFU/4-266KR........................................................................SGRTEE
Q9WYP8_THEMA/2-266KR........................................................................TGRETQ

PF13347

C3W9X3_FUSMR/14-452--------------------------------------------------------------------------YTQVW.
Q8I3H5_PLAF7/62-507--------------------------------------------------------------------------YTNIV.
D2VB35_NAEGR/31-486--------------------------------------------------------------------------YSDKS.
Q28K27_JANSC/6-401--------------------------------------------------------------------------YVDTY.
A6E455_9RHOB/14-411--------------------------------------------------------------------------YVDEY.
B6AV21_9RHOB/12-414--------------------------------------------------------------------------YVDEF.
B9KP25_RHOSK/3-400--------------------------------------------------------------------------YVDEY.
A3V2V1_9RHOB/6-408--------------------------------------------------------------------------YADTY.
A8TM36_9PROT/9-426--------------------------------------------------------------------------YTAGL.
A7HQL5_PARL1/9-433--------------------------------------------------------------------------YAGEL.
Q73MQ4_TREDE/4-434--------------------------------------------------------------------------MTDVI.
B2GBT3_LACF3/22-466--------------------------------------------------------------------------VTSGMF
E7FT79_9LACO/16-461--------------------------------------------------------------------------VTSGLF
C0WMV6_LACBU/20-464--------------------------------------------------------------------------ITSHLF
D0DS55_LACFE/13-457--------------------------------------------------------------------------VTGHLF
Q6SCS3_STRTR/10-454--------------------------------------------------------------------------VTTHLF
B1SH60_9STRE/18-462--------------------------------------------------------------------------ITSHLF
C8P5V7_9LACO/2-447--------------------------------------------------------------------------ITSQLF
Q03PA7_LACBA/3-451--------------------------------------------------------------------------VTSVLF
C5RC37_WEIPA/5-451--------------------------------------------------------------------------VTSQLF
C7XWC4_9LACO/5-449--------------------------------------------------------------------------ITSLMF
B0NX91_9CLOT/12-438--------------------------------------------------------------------------FTDVL.
C3WB69_FUSMR/6-433--------------------------------------------------------------------------LTDVV.
C0BFD6_9FIRM/20-452--------------------------------------------------------------------------FTDTL.
C3WEF2_FUSMR/7-437--------------------------------------------------------------------------FTDVL.
C9QHC7_VIBOR/7-438--------------------------------------------------------------------------YTDVV.
C0BCF9_9FIRM/22-465--------------------------------------------------------------------------YQDIM.
C4Z9B4_EUBR3/7-441--------------------------------------------------------------------------YNVVL.
B7GTV4_BIFLS/22-444--------------------------------------------------------------------------YTDVV.
B3W8U5_LACCB/11-452--------------------------------------------------------------------------ITDYS.
B0NCA5_EUBSP/62-493--------------------------------------------------------------------------LTNTV.
D4L2L1_9FIRM/9-431--------------------------------------------------------------------------FTDI..
A6DP62_9BACT/9-590--------------------------------------------------------------------------YTDVF.
A6G4R1_9DELT/26-447--------------------------------------------------------------------------YTDYF.
A4AAW4_9GAMM/15-443--------------------------------------------------------------------------YTDVF.
C1MDP3_9ENTR/24-449--------------------------------------------------------------------------YTDVF.
D2ZB78_9ENTR/9-430--------------------------------------------------------------------------YTDVV.
E6WJ95_PANSA/9-430--------------------------------------------------------------------------YTDVV.
B2NKK3_ECO57/10-432--------------------------------------------------------------------------YTDNF.
C9XVR9_CROTZ/33-456--------------------------------------------------------------------------YTDIF.
D1RSQ2_SEROD/19-442--------------------------------------------------------------------------YTDVY.
D4GIM8_PANAM/27-451--------------------------------------------------------------------------YTDIF.
D1RQG9_SEROD/8-433--------------------------------------------------------------------------YTDIY.
D0KF27_PECWW/10-433--------------------------------------------------------------------------YTDVF.
D3RGD6_KLEVT/10-434--------------------------------------------------------------------------YTDVF.
D2TGV7_CITRI/11-433--------------------------------------------------------------------------YTDVF.
B1ZS00_OPITP/13-436--------------------------------------------------------------------------YTDVY.
B3HTC5_ECOLX/7-428--------------------------------------------------------------------------YTDVF.
A6DPD4_9BACT/7-427--------------------------------------------------------------------------YTDVF.
D4F9L7_EDWTA/8-430--------------------------------------------------------------------------YTDVA.
D4BGD4_9ENTR/25-444--------------------------------------------------------------------------YTDYV.
B0NC69_EUBSP/24-452--------------------------------------------------------------------------MTDIA.
A8RLH8_9CLOT/23-450--------------------------------------------------------------------------YTDTI.
C6JEB9_9FIRM/14-438--------------------------------------------------------------------------YTDVF.
C6PWS4_9CLOT/17-439--------------------------------------------------------------------------FTDVC.
Q97L68_CLOAB/8-431--------------------------------------------------------------------------YTDVV.
A9QSF4_LACLK/37-463--------------------------------------------------------------------------WIDVV.
A9MYD9_SALPB/15-438--------------------------------------------------------------------------YTDEL.
D1PII8_9FIRM/14-445--------------------------------------------------------------------------YTDVM.
C9BIA1_ENTFC/23-456--------------------------------------------------------------------------YTNVL.
B1BWZ1_CLOPF/8-434--------------------------------------------------------------------------YTLVL.
C8P9N3_9LACO/19-468--------------------------------------------------------------------------LTTVF.
A4WD81_ENT38/20-469--------------------------------------------------------------------------MLTVN.
D1BWG8_XYLCX/30-459--------------------------------------------------------------------------YTEVF.
C8P9N0_9LACO/19-447--------------------------------------------------------------------------YTNVY.
Q04EN5_OENOB/11-431--------------------------------------------------------------------------YTDVY.
Q5YU93_NOCFA/38-478--------------------------------------------------------------------------YTDVL.
C6LHW9_9FIRM/40-483--------------------------------------------------------------------------YTDVL.
A6NPU4_9FIRM/27-469--------------------------------------------------------------------------FTDVL.
A6TPY1_ALKMQ/8-433--------------------------------------------------------------------------LTDVA.
A6TPY6_ALKMQ/9-436--------------------------------------------------------------------------LTDII.
D4LG93_9FIRM/20-452--------------------------------------------------------------------------LTDLA.
C9XL03_CLODC/24-461--------------------------------------------------------------------------LTDVA.
C0D597_9CLOT/17-465--------------------------------------------------------------------------TQNVL.
C5EQ37_9FIRM/9-441--------------------------------------------------------------------------MITVA.
C5BVC3_BEUC1/22-453--------------------------------------------------------------------------YTDVI.
Q2G9N1_NOVAD/11-450--------------------------------------------------------------------------YNQVL.
Q2N8H6_ERYLH/11-453--------------------------------------------------------------------------YNLVL.
Q0AL93_MARMM/17-465--------------------------------------------------------------------------YNYVI.
Q026U3_SOLUE/20-465--------------------------------------------------------------------------ATVVK.
Q0F3N0_9PROT/18-595--------------------------------------------------------------------------FNVAL.
A4AJK9_9ACTN/12-439--------------------------------------------------------------------------LTDTL.
E8WA27_STRFA/17-443--------------------------------------------------------------------------LTDVL.
A1SNV8_NOCSJ/10-434--------------------------------------------------------------------------LTDSL.
B9N6J9_POPTR/21-445--------------------------------------------------------------------------LTEI..
B8B7S1_ORYSI/21-442--------------------------------------------------------------------------LTDI..
B5X2T0_SALSA/37-502--------------------------------------------------------------------------LLDVV.
Q5RFV6_DANRE/4-463--------------------------------------------------------------------------LLDIA.
MFS2A_XENTR/36-494--------------------------------------------------------------------------LLDIA.
C3Z8Z9_BRAFL/14-394--------------------------------------------------------------------------LVQVA.
D0KIC2_PECWW/8-445--------------------------------------------------------------------------YTTFC.
B1S9F4_9BIFI/13-474--------------------------------------------------------------------------WNRFC.

PF11700

AT221_EMENI/24-564--------------------------------------------------------------------------LEQMAR
ATG22_CRYNJ/1-531--------------------------------------------------------------------------FGTCDG
AT221_ASPFU/24-580--------------------------------------------------------------------------LEQMAR
Q75EJ9_ASHGO/58-558--------------------------------------------------------------------------LQTIAH
AT222_PHANO/72-634--------------------------------------------------------------------------LEQLAR
AT222_ASPOR/30-578--------------------------------------------------------------------------LEQLAR
Q0U0L9_PHANO/44-456--------------------------------------------------------------------------LQSAAN
A5DD56_PICGU/47-524--------------------------------------------------------------------------YQNLLS
ATG22_COCIM/93-625--------------------------------------------------------------------------LEQMTR
AT221_ASPNC/30-582--------------------------------------------------------------------------LEQMAR
ATG22_SCHPO/13-525--------------------------------------------------------------------------VMKNAH
A7K364_VIBSE/8-434--------------------------------------------------------------------------YTDIL.
B9LBL3_CHLSY/9-439--------------------------------------------------------------------------LTSITR
Q5B0Q4_EMENI/43-494--------------------------------------------------------------------------FQNLLS
Q4PA89_USTMA/59-561--------------------------------------------------------------------------FQNLLS
ATG22_MAGO7/99-626--------------------------------------------------------------------------LESLAR
A6E856_9SPHI/5-431--------------------------------------------------------------------------YTIITT
ATG22_YARLI/6-582--------------------------------------------------------------------------LQSYAR
Q26DY7_FLABB/8-443--------------------------------------------------------------------------YSVVSK
ATG22_CANAL/39-496--------------------------------------------------------------------------IQSIAK
ATG22_ASHGO/19-490--------------------------------------------------------------------------LEEFAR
ATG22_KLULA/17-487--------------------------------------------------------------------------LEQFGR
Q5KBK3_CRYNJ/49-483--------------------------------------------------------------------------WQNLLY
AT221_PENCW/20-562--------------------------------------------------------------------------LEQMAR
ATG22_YEAST/20-514--------------------------------------------------------------------------LQQFAS
A1CD46_ASPCL/43-518--------------------------------------------------------------------------ILSAAN
Q4JAW8_SULAC/5-379--------------------------------------------------------------------------FE....
A3LP71_PICST/32-502--------------------------------------------------------------------------IQSIAT
ATG22_NEUCR/155-689--------------------------------------------------------------------------LESLAR
Q6CKN0_KLULA/64-544--------------------------------------------------------------------------IQTTAH
A7EQB6_SCLS1/56-534--------------------------------------------------------------------------FQNLIY
AT221_BOTFB/21-562--------------------------------------------------------------------------LEQLAR
AT222_ASPCL/24-579--------------------------------------------------------------------------LEQMAR
Q0BZH6_HYPNA/25-469--------------------------------------------------------------------------FATLVV
AT222_EMENI/31-576--------------------------------------------------------------------------LEQLAR
AT222_ASPTN/24-571--------------------------------------------------------------------------LEQMAR
A6H0A9_FLAPJ/7-445--------------------------------------------------------------------------YEMIFK
AT222_SCLS1/72-619--------------------------------------------------------------------------LEQLAR
Q0CF56_ASPTN/43-493--------------------------------------------------------------------------FQNLLY
A1DH52_NEOFI/48-512--------------------------------------------------------------------------FQNLLY
ATG22_VANPO/27-511--------------------------------------------------------------------------LEQFAR
AT222_PENCW/33-580--------------------------------------------------------------------------LEQLAR
Q0CXZ2_ASPTN/50-478--------------------------------------------------------------------------FQNLLS
AT221_ASPOR/20-571--------------------------------------------------------------------------LEQMAR
Q0BXU5_HYPNA/23-495--------------------------------------------------------------------------FARDIV
Q0TYS2_PHANO/43-505--------------------------------------------------------------------------FQNLMY
ATG22_PICAN/27-551--------------------------------------------------------------------------LEQIAR
ATG22_CANGA/31-527--------------------------------------------------------------------------LEQFAR
Q8DIR0_THEEB/14-463--------------------------------------------------------------------------LMVF..
A4X7E0_SALTO/18-457--------------------------------------------------------------------------LTTVAE

PF03209

Q9S313_RHOAC/55-461--------------------------------------------------------------------------MIVEL-
PUCC_RHOCA/54-461--------------------------------------------------------------------------MIVEL-
P73827_SYNY3/40-467--------------------------------------------------------------------------LIDEL-
Q9Z5D5_RHOSH/28-417--------------------------------------------------------------------------MVVEL-
PUCC_RHOS4/51-455--------------------------------------------------------------------------MIVEL-
BCH2_RHOCB/28-418--------------------------------------------------------------------------MVVEL-
PUCC_RHOSU/55-451--------------------------------------------------------------------------MIVEL-
Q9RFD8_RHOSH/51-461--------------------------------------------------------------------------MIVEL-
Q9S333_PROMR/1-414--------------------------------------------------------------------------MITEL-
YPUM_RHOCA/51-458--------------------------------------------------------------------------MILEL-
Q9RAD4_RUBGE/55-466--------------------------------------------------------------------------MIVEL-

PF03092

Q55721_SYNY3/46-457--------------------------------------------------------------------------LKDEL-
O23028_ARATH/1-404--------------------------------------------------------------------------LSIRR-
Q9UAB7_LEIDO/75-654--------------------------------------------------------------------------MIDRY-
Q25272_LEIDO/59-606--------------------------------------------------------------------------LTGRY-
Q9SKZ5_ARATH/137-553--------------------------------------------------------------------------LKDDL-
Q9SQN2_ARATH/61-473--------------------------------------------------------------------------FKDEQ-
Q9UAC0_LEIDO/76-655--------------------------------------------------------------------------MIDRY-
Q9UAB8_LEIDO/94-683--------------------------------------------------------------------------FMSRY-
Q9XIQ7_ARATH/30-441--------------------------------------------------------------------------LTEQL-
O68867_SYNE7/38-441--------------------------------------------------------------------------LKDDL-
Q07492_9TRYP/138-667--------------------------------------------------------------------------FTYTF-
Q9UAC1_LEIDO/75-651--------------------------------------------------------------------------MIDRY-

PF06963

S40A2_ARATH/31-479--------------------------------------------------------------------------WPNSL-
Q4WVQ3_ASPFU/39-421--------------------------------------------------------------------------FQGTL-
S40A1_ORYSJ/21-450--------------------------------------------------------------------------WPGSL-
Q55HR8_CRYNB/34-481--------------------------------------------------------------------------YANTL-
S40A1_ARATH/35-483--------------------------------------------------------------------------WPNSL-
A2R421_ASPNC/42-466--------------------------------------------------------------------------FPGTL-
Q4RHW0_TETNG/8-534--------------------------------------------------------------------------YGRNL-
Q2U620_ASPOR/31-411--------------------------------------------------------------------------FPGTL-
Q5AXY5_EMENI/19-441--------------------------------------------------------------------------FPGTL-
Q8IA95_CAEEL/5-448--------------------------------------------------------------------------..GGM-
S40A3_ARATH/146-569--------------------------------------------------------------------------YP.SL-
Q0CWF0_ASPTN/44-463--------------------------------------------------------------------------FPGTL-
Q4PD48_USTMA/82-563--------------------------------------------------------------------------FTNTL-
S40A1_HUMAN/22-531--------------------------------------------------------------------------YGNSL-
A2Y023_ORYSI/145-569--------------------------------------------------------------------------HPASI-
S40A1_DANRE/19-522--------------------------------------------------------------------------YGNSL-
A8X2J9_CAEBR/13-461--------------------------------------------------------------------------..GGM-
A5BT51_VITVI/32-472--------------------------------------------------------------------------WPNSL-
A1CBM9_ASPCL/39-469--------------------------------------------------------------------------FQDTL-

PF13000

YHZ9_SCHPO/51-519--------------------------------------------------------------------------..NVSY
YB70_YEAST/17-560--------------------------------------------------------------------------AKETSF

PF03825

YEGT_ECOLI/1-405----I---------------------------------------------------------------------------
NUPG_SHIFL/1-407----I---------------------------------------------------------------------------
Q9A7U2_CAUCR/1-395----Q---------------------------------------------------------------------------
XAPB_ECOLI/1-407----V---------------------------------------------------------------------------

PF07690

O17785_CAEEL/33-439....K---------------------------------------------------------------------------
Y2994_MYCTU/18-356....A---------------------------------------------------------------------------
ANTR2_ARATH/137-500....V---------------------------------------------------------------------------
Q19296_CAEEL/16-403KVFFG---------------------------------------------------------------------------
A9CFQ9_AGRT5/27-373....A---------------------------------------------------------------------------
Q8NW16_STAAW/10-348....A---------------------------------------------------------------------------
O25793_HELPY/8-347....V---------------------------------------------------------------------------
Q97XW7_SULSO/20-385....N---------------------------------------------------------------------------
P72184_9ACTO/22-419....L---------------------------------------------------------------------------
O66589_AQUAE/21-406....K---------------------------------------------------------------------------
Q9I0P8_PSEAE/19-362....V---------------------------------------------------------------------------
MFSD9_HUMAN/49-427....A---------------------------------------------------------------------------
Q97CG2_THEVO/16-347....I---------------------------------------------------------------------------
Q9CF47_LACLA/24-427....I---------------------------------------------------------------------------
Q92RK8_RHIME/23-360....I---------------------------------------------------------------------------
Q8YC70_BRUME/8-339....I---------------------------------------------------------------------------
Q8Z8V3_SALTI/17-369....I---------------------------------------------------------------------------
Q8NU65_CORGL/19-414....M---------------------------------------------------------------------------
Q9YG70_AERPE/18-417....A---------------------------------------------------------------------------
Q9HLN0_THEAC/12-329....V---------------------------------------------------------------------------
Q8XR21_RALSO/30-433....L---------------------------------------------------------------------------
Q932J3_STAAM/33-313....L---------------------------------------------------------------------------
O87836_STRCO/61-422....I---------------------------------------------------------------------------
Q8NNT7_CORGL/10-351....A---------------------------------------------------------------------------
Q92WR7_RHIME/13-355....I---------------------------------------------------------------------------
Q8TZJ0_PYRFU/13-389....T---------------------------------------------------------------------------
O58400_PYRHO/34-380....V---------------------------------------------------------------------------
Q9KRL8_VIBCH/16-353....I---------------------------------------------------------------------------
Q9KWU2_SPHSX/13-348....A---------------------------------------------------------------------------
LTAA_STAAW/18-353....T---------------------------------------------------------------------------
Q8Y7M4_LISMO/13-349....A---------------------------------------------------------------------------
NART_STACT/13-344....I---------------------------------------------------------------------------
Q9K646_BACHD/13-358....V---------------------------------------------------------------------------
YLZ2_SCHPO/48-434....V---------------------------------------------------------------------------
YWOG_BACSU/15-348....G---------------------------------------------------------------------------
Q8WZT8_NEUCS/132-490....V---------------------------------------------------------------------------
O54179_STRCO/33-428....L---------------------------------------------------------------------------
Q98B83_RHILO/60-407....I---------------------------------------------------------------------------
Q46984_ECOLX/39-413....F---------------------------------------------------------------------------
Q9EYN6_SYNPW/18-450....I---------------------------------------------------------------------------
Q9KBG2_BACHD/16-398....V---------------------------------------------------------------------------
Q986N1_RHILO/24-356....V---------------------------------------------------------------------------
Q93LX8_9ACTO/30-425....L---------------------------------------------------------------------------
Q8KDQ3_CHLTE/9-374....I---------------------------------------------------------------------------
Q9PCL3_XYLFA/32-422....L---------------------------------------------------------------------------
Q9URI1_CANAX/123-512....A---------------------------------------------------------------------------
Q9KRK6_VIBCH/22-366....V---------------------------------------------------------------------------
Q92Y26_RHIME/19-357....A---------------------------------------------------------------------------
Q9RSF5_DEIRA/46-397....I---------------------------------------------------------------------------
Q8WU09_HUMAN/27-274....I---------------------------------------------------------------------------
LIZ1_SCHPO/36-407....L---------------------------------------------------------------------------
Q97IY3_CLOAB/13-357....V---------------------------------------------------------------------------
Q9I008_PSEAE/29-430....G---------------------------------------------------------------------------
Q9HTX1_PSEAE/12-346....S---------------------------------------------------------------------------
Q9KYI2_STRCO/15-371....I---------------------------------------------------------------------------
Q973W8_SULTO/12-335....Y---------------------------------------------------------------------------
Q18472_CAEEL/18-397EKKYI---------------------------------------------------------------------------
Q8ZXX0_PYRAE/10-352....A---------------------------------------------------------------------------
Q9AA55_CAUCR/30-391....I---------------------------------------------------------------------------
YN42_SCHPO/141-527....S---------------------------------------------------------------------------
Q8NUU1_STAAW/16-376....F---------------------------------------------------------------------------
Q961H2_DROME/54-453....Q---------------------------------------------------------------------------
Q8X543_ECO57/36-398....I---------------------------------------------------------------------------
Q8KCE7_CHLTE/27-390....Q---------------------------------------------------------------------------
P95852_SULSF/9-333....L---------------------------------------------------------------------------
O45678_CAEEL/27-403....S---------------------------------------------------------------------------
Q9I5C8_PSEAE/21-369....I---------------------------------------------------------------------------
O30222_ARCFU/15-357....A---------------------------------------------------------------------------
O54630_HALSA/24-368....I---------------------------------------------------------------------------
Q8TR38_METAC/18-398....Y---------------------------------------------------------------------------
Q986D7_RHILO/41-396....L---------------------------------------------------------------------------
O69759_PSEFL/31-392....I---------------------------------------------------------------------------
Q9HLR9_THEAC/6-377....V---------------------------------------------------------------------------
Q8Z4K9_SALTI/13-352....Y---------------------------------------------------------------------------
O28944_ARCFU/4-328....S---------------------------------------------------------------------------
Q9KKX8_VIBCH/40-383....V---------------------------------------------------------------------------
Q96XQ4_SULTO/9-336....D---------------------------------------------------------------------------
Q8Y6H4_LISMO/13-376....T---------------------------------------------------------------------------
O62376_CAEEL/16-394....L---------------------------------------------------------------------------
YCUD_SCHPO/89-473....T---------------------------------------------------------------------------
Y1634_MYCTU/25-423....Y---------------------------------------------------------------------------
Q9KG75_BACHD/5-341....V---------------------------------------------------------------------------
Q7JZE2_DROME/46-458QSGDL---------------------------------------------------------------------------
Q9KLN6_VIBCH/36-395....L---------------------------------------------------------------------------
Q8P881_XANCP/26-418....M---------------------------------------------------------------------------
Q8PQ23_XANAC/19-356....A---------------------------------------------------------------------------
YQ92_SCHPO/20-407....V---------------------------------------------------------------------------
O16697_CAEEL/36-432....L---------------------------------------------------------------------------
Q8K8C8_STRP3/10-353VEYYA---------------------------------------------------------------------------
Q8X0G2_NEUCS/87-498....A---------------------------------------------------------------------------
Q8XKW0_CLOPE/26-404....V---------------------------------------------------------------------------
O58488_PYRHO/9-354....F---------------------------------------------------------------------------
Q9K9F3_BACHD/14-368....I---------------------------------------------------------------------------
O29880_ARCFU/11-360....A---------------------------------------------------------------------------
Q97C48_THEVO/19-351....V---------------------------------------------------------------------------
Q9Y7D4_ASPTE/35-449....V---------------------------------------------------------------------------
Q97DX4_CLOAB/23-413....V---------------------------------------------------------------------------
Q8MPU6_CAEEL/90-445....T---------------------------------------------------------------------------
Q96Y06_SULTO/9-344....V---------------------------------------------------------------------------
A9CIR5_AGRT5/18-359....M---------------------------------------------------------------------------
Q8ZWZ3_PYRAE/12-326....A---------------------------------------------------------------------------
Q8X5A4_ECO57/20-357....V---------------------------------------------------------------------------
Q9P397_NEUCS/52-417....F---------------------------------------------------------------------------
Y2456_MYCTU/16-365....I---------------------------------------------------------------------------
Q19845_CAEEL/45-446....F---------------------------------------------------------------------------
Q8NUX5_STAAW/12-354....I---------------------------------------------------------------------------
YHJO_BACSU/19-353....P---------------------------------------------------------------------------
Q8ZVF8_PYRAE/4-322....I---------------------------------------------------------------------------
O58825_PYRHO/10-360....S---------------------------------------------------------------------------
Q8X5A5_ECO57/8-341....A---------------------------------------------------------------------------
Q9L8Q4_PSEST/17-351....L---------------------------------------------------------------------------
Q9XXC1_CAEEL/44-436....K---------------------------------------------------------------------------
Q9ADP8_STRCO/39-376....V---------------------------------------------------------------------------
Q8YQ15_NOSS1/8-358....I---------------------------------------------------------------------------
O93992_CANAX/65-459....A---------------------------------------------------------------------------
Q8YWH2_NOSS1/17-343....I---------------------------------------------------------------------------
Q9RSM6_DEIRA/32-418....Y---------------------------------------------------------------------------
Q9VDS0_DROME/61-500....L---------------------------------------------------------------------------
Q9I0Y2_PSEAE/28-357.....---------------------------------------------------------------------------
Q92TU0_RHIME/19-421....F---------------------------------------------------------------------------
Q8RQC1_RHIFR/18-362....F---------------------------------------------------------------------------
Q8XGP2_RALSO/41-431....I---------------------------------------------------------------------------
YFIS_BACSU/15-364....M---------------------------------------------------------------------------
Q92BU8_LISIN/14-347....V---------------------------------------------------------------------------
Q55937_SYNY3/19-365....A---------------------------------------------------------------------------
Q9A856_CAUCR/31-388....Y---------------------------------------------------------------------------
P72472_STRLI/29-361....A---------------------------------------------------------------------------
Q97BG6_THEVO/17-357....T---------------------------------------------------------------------------
Q9X4X9_9PSED/27-377....L---------------------------------------------------------------------------
Q973J7_SULTO/8-320....I---------------------------------------------------------------------------
O32859_MYCFO/12-364....A---------------------------------------------------------------------------
Q9S243_STRCO/13-352....V---------------------------------------------------------------------------
Q97PK9_STRPN/13-344....I---------------------------------------------------------------------------
Q97CC5_THEVO/27-411....I---------------------------------------------------------------------------
AMPG1_RICPR/10-405....I---------------------------------------------------------------------------
Q9RD97_STRCO/46-435....Q---------------------------------------------------------------------------
Q8R8R3_THETN/20-398....I---------------------------------------------------------------------------
O30210_ARCFU/17-354....Y---------------------------------------------------------------------------
Q8X120_EXODE/120-524....L---------------------------------------------------------------------------
Q9EW91_9ACTO/13-358....V---------------------------------------------------------------------------
Q8MMD6_DROME/21-407....Y---------------------------------------------------------------------------
Q8XVV0_RALSO/19-414....G---------------------------------------------------------------------------
Q978I2_THEVO/17-358....A---------------------------------------------------------------------------
S22AI_MOUSE/13-363....F---------------------------------------------------------------------------
Q92XG9_RHIME/14-352....A---------------------------------------------------------------------------
Q8P8I8_XANCP/24-370....L---------------------------------------------------------------------------
Q9I1Q7_PSEAE/34-397....Q---------------------------------------------------------------------------
Q9I4J1_PSEAE/26-388....M---------------------------------------------------------------------------
Q9KG22_BACHD/29-373....L---------------------------------------------------------------------------
Q9KYE9_STRCO/8-359....A---------------------------------------------------------------------------
Q8K8F6_STRP3/27-401....N---------------------------------------------------------------------------
O31131_BRELN/13-405....A---------------------------------------------------------------------------
Q8PQM0_XANAC/29-361....A---------------------------------------------------------------------------
Q9ZC50_YERPE/23-431....I---------------------------------------------------------------------------
Q8U366_PYRFU/20-359....S---------------------------------------------------------------------------
Q9C9R9_ARATH/11-379....L---------------------------------------------------------------------------
Q20265_CAEEL/46-427....Q---------------------------------------------------------------------------
Q9PCQ0_XYLFA/73-403....A---------------------------------------------------------------------------
Q9I247_PSEAE/4-339....I---------------------------------------------------------------------------
Q9VPX2_DROME/42-442....Q---------------------------------------------------------------------------
Q8Y3L9_LISMO/17-359....K---------------------------------------------------------------------------
Q8VUK1_HALHD/23-380....F---------------------------------------------------------------------------
Q8RPH1_DESHA/13-347....V---------------------------------------------------------------------------
A9CGF2_AGRT5/30-354....A---------------------------------------------------------------------------
O66181_ARTSP/15-353....M---------------------------------------------------------------------------
Q8KYU7_9PROT/15-359.....---------------------------------------------------------------------------
YJ7D_SCHPO/81-445....Y---------------------------------------------------------------------------
Q8XEG8_ECO57/47-408....I---------------------------------------------------------------------------
Q9VY22_DROME/66-470VARMA---------------------------------------------------------------------------
Q8U4E5_PYRFU/8-345....V---------------------------------------------------------------------------
YFKL_BACSU/12-351....I---------------------------------------------------------------------------
O30679_RHORH/8-341....A---------------------------------------------------------------------------
Q97TH3_CLOAB/16-408....V---------------------------------------------------------------------------
THI73_YEAST/86-451....F---------------------------------------------------------------------------
Q9A961_CAUCR/19-356....L---------------------------------------------------------------------------
Q97TH7_CLOAB/19-357....A---------------------------------------------------------------------------
Q8NVE0_STAAW/12-398....I---------------------------------------------------------------------------
Q9VPD9_DROME/28-441....D---------------------------------------------------------------------------
Q8PVU8_METMA/11-346....V---------------------------------------------------------------------------
Q8NVE2_STAAW/18-410....S---------------------------------------------------------------------------
Q97FI4_CLOAB/17-361....T---------------------------------------------------------------------------
Q8KR58_ESCFE/20-359....L---------------------------------------------------------------------------
Q8NLD6_CORGL/19-353....I---------------------------------------------------------------------------
Q9LAA0_AERHY/27-362....I---------------------------------------------------------------------------
O06742_BACIU/18-364....V---------------------------------------------------------------------------
Q9FCG1_STRCO/24-364....A---------------------------------------------------------------------------
O94019_CANAX/86-529....M---------------------------------------------------------------------------
MOT14_MOUSE/42-459....T---------------------------------------------------------------------------
Q92V77_RHIME/8-347....S---------------------------------------------------------------------------
Q9Y7E0_ASPTE/42-435....I---------------------------------------------------------------------------
Q9I431_PSEAE/11-401....L---------------------------------------------------------------------------
O76837_CAEEL/25-400VVNQT---------------------------------------------------------------------------
Q96ZI2_SULTO/36-365....I---------------------------------------------------------------------------
Q9L8R0_PSEST/7-367....I---------------------------------------------------------------------------
Q94886_DROME/14-423EKNGF---------------------------------------------------------------------------

PF00083

GTR4_MOUSE/27-483----W---------------------------------------------------------------------------
GTR1_MOUSE/14-467----W---------------------------------------------------------------------------
QUTD_EMENI/24-490----.---------------------------------------------------------------------------
ITR2_YEAST/112-569----.---------------------------------------------------------------------------
SNF3_YEAST/100-556----M---------------------------------------------------------------------------
GALP_ECOLI/18-451----.---------------------------------------------------------------------------
HXT5_YEAST/89-549----T---------------------------------------------------------------------------
GTR3_MOUSE/13-465----W---------------------------------------------------------------------------
HXT9_YEAST/64-526----M---------------------------------------------------------------------------
HXT3_YEAST/65-525----T---------------------------------------------------------------------------
HXT8_YEAST/69-530----T---------------------------------------------------------------------------
YJHB_ECOLI/15-405----.---------------------------------------------------------------------------
HXT6_YEAST/68-528----T---------------------------------------------------------------------------
SUT_SPIOL/38-486----.---------------------------------------------------------------------------
GTR3_CHICK/14-464----W---------------------------------------------------------------------------
GTR5_HUMAN/20-475----W---------------------------------------------------------------------------
PRO1_LEIEN/95-540----S---------------------------------------------------------------------------
HXT13_YEAST/60-521----M---------------------------------------------------------------------------
RAG1_KLULA/66-528----T---------------------------------------------------------------------------
YB91_YEAST/27-485----Y---------------------------------------------------------------------------
GTR1_LEIDO/5-442----.---------------------------------------------------------------------------
HUP1_PARKE/30-492----L---------------------------------------------------------------------------
PROP_ECOLI/25-453----.---------------------------------------------------------------------------
JEN1_YEAST/125-563----I---------------------------------------------------------------------------
GIT1_YEAST/43-466----.---------------------------------------------------------------------------
GTR2_MOUSE/13-498----W---------------------------------------------------------------------------
HXT2_YEAST/59-519----T---------------------------------------------------------------------------
XYLE_ECOLI/13-478----L---------------------------------------------------------------------------
LACP_KLULA/75-529----T---------------------------------------------------------------------------
STP1_ARATH/26-489----L---------------------------------------------------------------------------
MAL31_YEAST/102-561----Q---------------------------------------------------------------------------
GTR2_LEIDO/41-538----S---------------------------------------------------------------------------
Q57RP5_SALCH/23-420----.---------------------------------------------------------------------------
TH2A_TRYBB/39-502----S---------------------------------------------------------------------------
GTR3_HUMAN/12-465----W---------------------------------------------------------------------------
GTR2_HUMAN/13-499----W---------------------------------------------------------------------------
TH12_TRYBB/39-501----S---------------------------------------------------------------------------
QAY_NEUCR/24-494----Q---------------------------------------------------------------------------
GLF_ZYMMO/13-469----S---------------------------------------------------------------------------
HXT4_YEAST/74-534----T---------------------------------------------------------------------------
ITR1_YEAST/89-546----.---------------------------------------------------------------------------
STL1_YEAST/30-488----Q---------------------------------------------------------------------------
ARAE_ECOLI/25-461----.---------------------------------------------------------------------------
GAL2_YEAST/74-534----T---------------------------------------------------------------------------

PF05977

Q92LE2_RHIME/11-531----V---------------------------------------------------------------------------
Q98HB4_RHILO/11-532----V---------------------------------------------------------------------------
Q92Y88_RHIME/8-530----V---------------------------------------------------------------------------
Q9X4X4_9PSED/20-540----V---------------------------------------------------------------------------
A9CFW7_AGRT5/8-530----V---------------------------------------------------------------------------
Q9HYE1_PSEAE/25-549----V---------------------------------------------------------------------------
Q989L4_RHILO/31-551----V---------------------------------------------------------------------------
Q92SW7_RHIME/14-535----V---------------------------------------------------------------------------
Q989T8_RHILO/11-532----V---------------------------------------------------------------------------
Q9I0E1_PSEAE/6-529----V---------------------------------------------------------------------------

PF01306

LACY_CITFR/1-412----T---------------------------------------------------------------------------
RAFB_ECOLX/4-415----T---------------------------------------------------------------------------
CSCB_ECOLX/4-411----L---------------------------------------------------------------------------
LACY_KLEOX/6-416----T---------------------------------------------------------------------------

PF03137

SO2A1_RAT/31-603----S---------------------------------------------------------------------------
SO1B2_RAT/27-616----S---------------------------------------------------------------------------
SO2B1_HUMAN/48-648----S---------------------------------------------------------------------------
SO3A1_HUMAN/39-623----V---------------------------------------------------------------------------
Q20702_CAEEL/102-763----M---------------------------------------------------------------------------
SO2A1_HUMAN/31-603----S---------------------------------------------------------------------------
Q9VVH9_DROME/173-755----T---------------------------------------------------------------------------
Q93550_CAEEL/16-587----S---------------------------------------------------------------------------
Q9W271_DROME/65-627----S---------------------------------------------------------------------------
SO1A3_RAT/19-598----V---------------------------------------------------------------------------
SO1B1_HUMAN/27-622----V---------------------------------------------------------------------------
Q21157_CAEEL/48-598----S---------------------------------------------------------------------------
SO4A1_HUMAN/102-664----S---------------------------------------------------------------------------
Q9XWC5_CAEEL/47-621----T---------------------------------------------------------------------------
Q9W269_DROME/110-732----T---------------------------------------------------------------------------
SO1A2_HUMAN/19-598----V---------------------------------------------------------------------------

PF06779

Q89X18_BRAJA/64-148----L---------------------------------------------------------------------------
Q92UK2_RHIME/2-86----M---------------------------------------------------------------------------
Q8YFG7_BRUME/2-86----M---------------------------------------------------------------------------
Q986E3_RHILO/35-119----M---------------------------------------------------------------------------
Q8Z0X3_SALTI/24-110----M---------------------------------------------------------------------------
Q9I3T2_PSEAE/21-105----M---------------------------------------------------------------------------
Q88ED9_PSEPK/15-99----M---------------------------------------------------------------------------
Q89HQ1_BRAJA/50-128----L---------------------------------------------------------------------------
A9CI18_AGRT5/24-108----M---------------------------------------------------------------------------
Q8Y185_RALSO/37-119----M---------------------------------------------------------------------------
Q87ES9_XYLFT/27-113----I---------------------------------------------------------------------------
YJIJ_ECOLI/24-110----M---------------------------------------------------------------------------

PF06609

Q8NII4_FUSAU/1-598----Q---------------------------------------------------------------------------
Q9C1B3_FUSSP/1-598----S---------------------------------------------------------------------------

PF12832

A7SQQ8_NEMVE/55-132--------------------------------------------------------------------------------
Q6FB61_ACIAD/6-82--------------------------------------------------------------------------------
B7P8Y1_IXOSC/9-85--------------------------------------------------------------------------------
Q17GA0_AEDAE/14-90--------------------------------------------------------------------------------
A7RI07_NEMVE/54-130--------------------------------------------------------------------------------
A4Y888_SHEPC/10-86--------------------------------------------------------------------------------
A4BSZ3_9GAMM/7-83--------------------------------------------------------------------------------
Q2BMQ1_9GAMM/3-79--------------------------------------------------------------------------------
Q54SK7_DICDI/682-755--------------------------------------------------------------------------------
A7EK42_SCLS1/450-504--------------------------------------------------------------------------------
B2AA42_PODAN/619-697--------------------------------------------------------------------------------
A1WY15_HALHL/14-90--------------------------------------------------------------------------------
Q54G39_DICDI/12-88--------------------------------------------------------------------------------
B3PHF3_CELJU/15-91--------------------------------------------------------------------------------
Q07ZQ8_SHEFN/10-86--------------------------------------------------------------------------------
D3SB25_THISK/3-79--------------------------------------------------------------------------------
B0X8B9_CULQU/11-87--------------------------------------------------------------------------------
YJBC_SCHPO/418-493--------------------------------------------------------------------------------
Q16KC8_AEDAE/34-110--------------------------------------------------------------------------------
Q21IX9_SACD2/5-81--------------------------------------------------------------------------------
B4G7T5_DROPE/36-112--------------------------------------------------------------------------------
C3YMP2_BRAFL/14-90--------------------------------------------------------------------------------
Q0A9B1_ALHEH/6-82--------------------------------------------------------------------------------
A3QFN3_SHELP/24-100--------------------------------------------------------------------------------
Q55CH3_DICDI/11-87--------------------------------------------------------------------------------
B8GQD4_THISH/5-81--------------------------------------------------------------------------------
A1S7K7_SHEAM/12-88--------------------------------------------------------------------------------
C5BL70_TERTT/2-78--------------------------------------------------------------------------------
B1KKS0_SHEWM/10-86--------------------------------------------------------------------------------
B0V728_ACIBY/7-83--------------------------------------------------------------------------------
B0W437_CULQU/30-106--------------------------------------------------------------------------------
A7UVG6_ANOGA/14-90--------------------------------------------------------------------------------
Q2SJE3_HAHCH/5-81--------------------------------------------------------------------------------
B7PL10_IXOSC/7-83--------------------------------------------------------------------------------
A7C0B5_9GAMM/6-82--------------------------------------------------------------------------------
A8PWD3_MALGO/544-619--------------------------------------------------------------------------------
B6C555_9GAMM/9-85--------------------------------------------------------------------------------
B6K1R3_SCHJY/414-489--------------------------------------------------------------------------------
Q4PB45_USTMA/688-764--------------------------------------------------------------------------------

PF01770

Q29L76_DROPS/2-397GNLTS---------------------------------------------------------------------------
Q294A5_DROPS/2-414YHVTQ---------------------------------------------------------------------------
Y2544_DICDI/95-457LGINQ---------------------------------------------------------------------------
Q9EQN9_MOUSE/28-459KNLTE---------------------------------------------------------------------------
Q9VK64_DROME/2-395GNLTT---------------------------------------------------------------------------
Q9BTX8_HUMAN/23-434KNFTR---------------------------------------------------------------------------
Q9VGV5_DROME/2-408RNITE---------------------------------------------------------------------------
S19A3_HUMAN/10-441KNLTS---------------------------------------------------------------------------
Q4T7Q4_TETNG/6-427KNLTA---------------------------------------------------------------------------
Q6GN45_XENLA/68-474RNFTR---------------------------------------------------------------------------
Q17QC9_BOVIN/23-434KNFTQ---------------------------------------------------------------------------
Q1LV16_DANRE/4-414KNISE---------------------------------------------------------------------------
Q16JT2_AEDAE/2-405HNISA---------------------------------------------------------------------------
Q6NRB3_XENLA/18-453KNLTE---------------------------------------------------------------------------
Q9VGV6_DROME/2-411YHVTQ---------------------------------------------------------------------------
FOLT2_CAEEL/2-394LNMSE---------------------------------------------------------------------------
Q542F3_MOUSE/23-427RKFTK---------------------------------------------------------------------------
Q28C92_XENTR/10-422HNLTV---------------------------------------------------------------------------
Q6DIK7_XENTR/10-424HNLTT---------------------------------------------------------------------------
Q7Q5N2_ANOGA/2-422RDIEP---------------------------------------------------------------------------
A8BIM9_GIAIC/39-447NGISM---------------------------------------------------------------------------
A7SN54_NEMVE/6-420KNITD---------------------------------------------------------------------------
S19A3_MOUSE/11-435KNLTS---------------------------------------------------------------------------
Q5ZMS7_CHICK/32-445KNFTQ---------------------------------------------------------------------------

PF05631

Q9M3A1_ARATH/4-380LYSTY---------------------------------------------------------------------------
Q9N3A9_CAEEL/1-336LYESY---------------------------------------------------------------------------
Q9FWD6_ORYSJ/4-357LYSQY---------------------------------------------------------------------------

PF00854

PTR12_ARATH/99-497--------------------------------------------------------------------------------
PTR17_ARATH/124-523--------------------------------------------------------------------------------
YCLF_BACSU/95-444--------------------------------------------------------------------------------
S15A2_HUMAN/111-494--------------------------------------------------------------------------------
DTPT_LACLC/90-449--------------------------------------------------------------------------------
S15A1_RAT/81-476--------------------------------------------------------------------------------
PEPT3_CAEEL/82-469--------------------------------------------------------------------------------
YJDL_ECOLI/75-420--------------------------------------------------------------------------------
DTPA_ECOLI/88-431--------------------------------------------------------------------------------
PTR2_ARATH/113-517--------------------------------------------------------------------------------
PEPT1_CAEEL/113-557--------------------------------------------------------------------------------
PTR2_YEAST/155-515--------------------------------------------------------------------------------
PTR7_ARATH/99-507--------------------------------------------------------------------------------
O22305_LOTJA/95-494--------------------------------------------------------------------------------
PTR2_SCHPO/158-520--------------------------------------------------------------------------------
PEPT1_DROME/101-444--------------------------------------------------------------------------------
Q96400_CUCSA/121-513--------------------------------------------------------------------------------
DTPD_ECOLI/76-426--------------------------------------------------------------------------------
PTR2_CANAX/161-542--------------------------------------------------------------------------------
S15A1_HUMAN/81-475--------------------------------------------------------------------------------
S15A1_RABIT/81-474--------------------------------------------------------------------------------
PTR30_ARATH/96-491--------------------------------------------------------------------------------
PEPT2_CAEEL/99-526--------------------------------------------------------------------------------
S15A4_RAT/94-495--------------------------------------------------------------------------------
DTPB_ECOLI/81-428--------------------------------------------------------------------------------

PF06813

Q7XGH1_ORYSJ/34-288----L---------------------------------------------------------------------------
Q9LUF8_ARATH/16-265----I---------------------------------------------------------------------------
Q8H613_ORYSJ/14-261----L---------------------------------------------------------------------------
Q94D97_ORYSJ/8-252----L---------------------------------------------------------------------------
Q9C862_ARATH/7-251----L---------------------------------------------------------------------------
O81121_ARATH/16-263----L---------------------------------------------------------------------------
O81120_LOTJA/26-271----L---------------------------------------------------------------------------
Q9M8M1_ARATH/13-260----V---------------------------------------------------------------------------
Q9ZUV4_ARATH/17-262----L---------------------------------------------------------------------------
O22926_ARATH/7-235----L---------------------------------------------------------------------------
O80960_ARATH/21-266----L---------------------------------------------------------------------------
Q8H6R3_PONTR/13-260----L---------------------------------------------------------------------------
Q8H132_ARATH/7-253----L---------------------------------------------------------------------------
Q9SLF1_ARATH/14-260----L---------------------------------------------------------------------------
Q9SS92_ARATH/41-290----L---------------------------------------------------------------------------

PF05978

Q19933_CAEEL/13-169--------------------------------------------------------------------------------
Q9XV34_CAEEL/12-166--------------------------------------------------------------------------------
MFS11_MOUSE/14-166--------------------------------------------------------------------------------
Q8MYL9_CAEEL/14-170--------------------------------------------------------------------------------
Q965T3_CAEEL/14-170--------------------------------------------------------------------------------
P91007_CAEEL/16-172--------------------------------------------------------------------------------
Q9XWR7_CAEEL/37-194--------------------------------------------------------------------------------
Q19932_CAEEL/14-169--------------------------------------------------------------------------------
Q21545_CAEEL/14-168--------------------------------------------------------------------------------
O61865_CAEEL/27-183--------------------------------------------------------------------------------
Q18251_CAEEL/11-167--------------------------------------------------------------------------------

PF07672

Q8EUQ6_MYCPE/191-477--------------------------------------------------------------------------------
Y077_MYCPN/209-467--------------------------------------------------------------------------------
Q8EVP4_MYCPE/172-441--------------------------------------------------------------------------------
Q9KX64_MYCGL/1-256--------------------------------------------------------------------------------
Y076_MYCPN/210-484--------------------------------------------------------------------------------
Q98PH4_MYCPU/154-430--------------------------------------------------------------------------------
Y061_MYCGE/119-383--------------------------------------------------------------------------------

PF02487

CLN3_CANFA/37-438RFDCN---------------------------------------------------------------------------
BTN1_YEAST/8-397....K---------------------------------------------------------------------------

PF03219

A6XGR5_9CHLO/42-534AP.GS---------------------------------------------------------------------------
TLC2_ARATH/88-571AK.GS---------------------------------------------------------------------------
TLCB_RICCN/9-501LI...---------------------------------------------------------------------------
Q842J1_9RICK/3-491GI...---------------------------------------------------------------------------
TLC1_CHLTR/2-492AP.GS---------------------------------------------------------------------------
Q70GF8_9CHLA/1-443AS...---------------------------------------------------------------------------
Q6MEN4_PARUW/1-484AK.AS---------------------------------------------------------------------------
TLCD_RICFE/12-503MI...---------------------------------------------------------------------------
Q9X9D2_CHLTH/1-500GS.RA---------------------------------------------------------------------------
Q8WH67_GALSU/142-638TT...---------------------------------------------------------------------------
Q6H8E4_ORYSJ/76-563AK.GS---------------------------------------------------------------------------
Q252Y6_CHLFF/2-510GS.DA---------------------------------------------------------------------------
A5CCY4_ORITB/4-486SI...---------------------------------------------------------------------------
Q71JS5_9CHLA/2-490SS...---------------------------------------------------------------------------
A5CDU3_ORITB/11-501QI...---------------------------------------------------------------------------
Q6MBI2_PARUW/1-474AS.DA---------------------------------------------------------------------------
A8F0G0_RICM5/3-489DI...---------------------------------------------------------------------------
A8GSF7_RICRS/1-496SM...---------------------------------------------------------------------------
Q83W26_RICTP/4-496EI...---------------------------------------------------------------------------
A5CES7_ORITB/3-495EI...---------------------------------------------------------------------------
A5CCG2_ORITB/17-505MI...---------------------------------------------------------------------------
Q6MEN5_PARUW/4-499AK.SS---------------------------------------------------------------------------
TLC2_CHLPN/2-503GS.DA---------------------------------------------------------------------------
Q6MEM5_PARUW/2-491SA...---------------------------------------------------------------------------
A5CCG3_ORITB/1-504SV...---------------------------------------------------------------------------
Q8KPN2_HOLOB/2-501SP.GS---------------------------------------------------------------------------
Q1MSG2_LAWIP/9-504QATGG---------------------------------------------------------------------------

PF01733

S29A1_RAT/144-455----F---------------------------------------------------------------------------
S29A2_HUMAN/131-454----F---------------------------------------------------------------------------
S29A1_HUMAN/144-454----F---------------------------------------------------------------------------
FUN26_YEAST/180-510----M---------------------------------------------------------------------------
Q19495_CAEEL/137-426----Y---------------------------------------------------------------------------
Q21145_CAEEL/434-723----F---------------------------------------------------------------------------
O64603_ARATH/145-428----I---------------------------------------------------------------------------

PF03239

FTH1_YEAST/8-404RESDE---------------------------------------------------------------------------
EFEU_BACSU/9-395A....---------------------------------------------------------------------------
Q9Y8Z4_AERPE/4-268I....---------------------------------------------------------------------------
Y964_SYNY3/6-291K....---------------------------------------------------------------------------
FIP1_SCHPO/7-320GNVTD---------------------------------------------------------------------------
EFEU_ECOLI/1-276D....---------------------------------------------------------------------------
O83937_TREPA/14-362SGGQA---------------------------------------------------------------------------
Q9ZC51_YERPE/156-557DQPIS---------------------------------------------------------------------------
Q9RKQ1_STRCO/1-274L....---------------------------------------------------------------------------
Q9ZDD8_RICPR/1-278.....---------------------------------------------------------------------------
FTR1_YEAST/7-321RALY.---------------------------------------------------------------------------
Y154_ARCFU/4-266V....---------------------------------------------------------------------------
Q9WYP8_THEMA/2-266K....---------------------------------------------------------------------------

PF13347

C3W9X3_FUSMR/14-452.GMKP.--------------------------------------------------------------------------
Q8I3H5_PLAF7/62-507.GLRN.--------------------------------------------------------------------------
D2VB35_NAEGR/31-486.CIEA.--------------------------------------------------------------------------
Q28K27_JANSC/6-401.GVSL.--------------------------------------------------------------------------
A6E455_9RHOB/14-411.GVSL.--------------------------------------------------------------------------
B6AV21_9RHOB/12-414.GVSL.--------------------------------------------------------------------------
B9KP25_RHOSK/3-400.GVSL.--------------------------------------------------------------------------
A3V2V1_9RHOB/6-408.GVSL.--------------------------------------------------------------------------
A8TM36_9PROT/9-426.GLPL.--------------------------------------------------------------------------
A7HQL5_PARL1/9-433.GVSL.--------------------------------------------------------------------------
Q73MQ4_TREDE/4-434.YVPTN--------------------------------------------------------------------------
B2GBT3_LACF3/22-466SGIPNK--------------------------------------------------------------------------
E7FT79_9LACO/16-461VGLPKN--------------------------------------------------------------------------
C0WMV6_LACBU/20-464DKNSSA--------------------------------------------------------------------------
D0DS55_LACFE/13-457NSNAGG--------------------------------------------------------------------------
Q6SCS3_STRTR/10-454NTGDPK--------------------------------------------------------------------------
B1SH60_9STRE/18-462NTGDAA--------------------------------------------------------------------------
C8P5V7_9LACO/2-447TNSSDT--------------------------------------------------------------------------
Q03PA7_LACBA/3-451VGKGAG--------------------------------------------------------------------------
C5RC37_WEIPA/5-451NTSDAG--------------------------------------------------------------------------
C7XWC4_9LACO/5-449SNGSKS--------------------------------------------------------------------------
B0NX91_9CLOT/12-438.KVSP.--------------------------------------------------------------------------
C3WB69_FUSMR/6-433.GLVP.--------------------------------------------------------------------------
C0BFD6_9FIRM/20-452.YLAP.--------------------------------------------------------------------------
C3WEF2_FUSMR/7-437.YLSP.--------------------------------------------------------------------------
C9QHC7_VIBOR/7-438.GISA.--------------------------------------------------------------------------
C0BCF9_9FIRM/22-465.GVSA.--------------------------------------------------------------------------
C4Z9B4_EUBR3/7-441.GMSS.--------------------------------------------------------------------------
B7GTV4_BIFLS/22-444.GISS.--------------------------------------------------------------------------
B3W8U5_LACCB/11-452.GIYSG--------------------------------------------------------------------------
B0NCA5_EUBSP/62-493.GLNP.--------------------------------------------------------------------------
D4L2L1_9FIRM/9-431.GITA.--------------------------------------------------------------------------
A6DP62_9BACT/9-590.GLAP.--------------------------------------------------------------------------
A6G4R1_9DELT/26-447.GLSA.--------------------------------------------------------------------------
A4AAW4_9GAMM/15-443.GISP.--------------------------------------------------------------------------
C1MDP3_9ENTR/24-449.GLTP.--------------------------------------------------------------------------
D2ZB78_9ENTR/9-430.GLPA.--------------------------------------------------------------------------
E6WJ95_PANSA/9-430.GLPA.--------------------------------------------------------------------------
B2NKK3_ECO57/10-432.GIPA.--------------------------------------------------------------------------
C9XVR9_CROTZ/33-456.GLAP.--------------------------------------------------------------------------
D1RSQ2_SEROD/19-442.GLDP.--------------------------------------------------------------------------
D4GIM8_PANAM/27-451.GLAP.--------------------------------------------------------------------------
D1RQG9_SEROD/8-433.GLSA.--------------------------------------------------------------------------
D0KF27_PECWW/10-433.GLSP.--------------------------------------------------------------------------
D3RGD6_KLEVT/10-434.GLSP.--------------------------------------------------------------------------
D2TGV7_CITRI/11-433.GLPA.--------------------------------------------------------------------------
B1ZS00_OPITP/13-436.RLNV.--------------------------------------------------------------------------
B3HTC5_ECOLX/7-428.GLKP.--------------------------------------------------------------------------
A6DPD4_9BACT/7-427.GISA.--------------------------------------------------------------------------
D4F9L7_EDWTA/8-430.GVGA.--------------------------------------------------------------------------
D4BGD4_9ENTR/25-444.GIPA.--------------------------------------------------------------------------
B0NC69_EUBSP/24-452.MIPA.--------------------------------------------------------------------------
A8RLH8_9CLOT/23-450.GIPA.--------------------------------------------------------------------------
C6JEB9_9FIRM/14-438.GISM.--------------------------------------------------------------------------
C6PWS4_9CLOT/17-439.GIPA.--------------------------------------------------------------------------
Q97L68_CLOAB/8-431.GIAA.--------------------------------------------------------------------------
A9QSF4_LACLK/37-463.GIGP.--------------------------------------------------------------------------
A9MYD9_SALPB/15-438.GMPA.--------------------------------------------------------------------------
D1PII8_9FIRM/14-445.GVSA.--------------------------------------------------------------------------
C9BIA1_ENTFC/23-456.GVSG.--------------------------------------------------------------------------
B1BWZ1_CLOPF/8-434.KINP.--------------------------------------------------------------------------
C8P9N3_9LACO/19-468.GISA.--------------------------------------------------------------------------
A4WD81_ENT38/20-469.TIST.--------------------------------------------------------------------------
D1BWG8_XYLCX/30-459.GLSA.--------------------------------------------------------------------------
C8P9N0_9LACO/19-447.GLPA.--------------------------------------------------------------------------
Q04EN5_OENOB/11-431.GLQA.--------------------------------------------------------------------------
Q5YU93_NOCFA/38-478.GLTAV--------------------------------------------------------------------------
C6LHW9_9FIRM/40-483.GIAG.--------------------------------------------------------------------------
A6NPU4_9FIRM/27-469.ALDE.--------------------------------------------------------------------------
A6TPY1_ALKMQ/8-433.YIGA.--------------------------------------------------------------------------
A6TPY6_ALKMQ/9-436.RINA.--------------------------------------------------------------------------
D4LG93_9FIRM/20-452.GFAA.--------------------------------------------------------------------------
C9XL03_CLODC/24-461.KLGV.--------------------------------------------------------------------------
C0D597_9CLOT/17-465.GLAA.--------------------------------------------------------------------------
C5EQ37_9FIRM/9-441.GVSP.--------------------------------------------------------------------------
C5BVC3_BEUC1/22-453.GLEP.--------------------------------------------------------------------------
Q2G9N1_NOVAD/11-450.GMDA.--------------------------------------------------------------------------
Q2N8H6_ERYLH/11-453.GVEA.--------------------------------------------------------------------------
Q0AL93_MARMM/17-465.GADA.--------------------------------------------------------------------------
Q026U3_SOLUE/20-465.GLPG.--------------------------------------------------------------------------
Q0F3N0_9PROT/18-595.GLST.--------------------------------------------------------------------------
A4AJK9_9ACTN/12-439.GIAA.--------------------------------------------------------------------------
E8WA27_STRFA/17-443.AVPA.--------------------------------------------------------------------------
A1SNV8_NOCSJ/10-434.GISA.--------------------------------------------------------------------------
B9N6J9_POPTR/21-445.GLSP.--------------------------------------------------------------------------
B8B7S1_ORYSI/21-442.GLSP.--------------------------------------------------------------------------
B5X2T0_SALSA/37-502.QMGA.--------------------------------------------------------------------------
Q5RFV6_DANRE/4-463.QINP.--------------------------------------------------------------------------
MFS2A_XENTR/36-494.QVPP.--------------------------------------------------------------------------
C3Z8Z9_BRAFL/14-394.QMPP.--------------------------------------------------------------------------
D0KIC2_PECWW/8-445.GLTL.--------------------------------------------------------------------------
B1S9F4_9BIFI/13-474.GMDI.--------------------------------------------------------------------------

PF11700

AT221_EMENI/24-564E.RGVLLSDKTTPCTAIWKTPESSN.....................................TSWQNSSPAAAGQCIVYI
ATG22_CRYNJ/1-531K.ALQS.................................................................SDPRGMDRY
AT221_ASPFU/24-580D.RGVLFSDKVTPCSATLNGPSRMSIQAR.............................WTLSSRYDAGRPTVANQCVVYI
Q75EJ9_ASHGO/58-558E.LGHPKGHPAAHCRP.......................................................RGDDCYIYV
AT222_PHANO/72-634E.NGVLLSDRTTPCKAPRPITPSFSA..................................SSFEALLRPNPEKGQCVVHI
AT222_ASPOR/30-578E.QGTFKSSHL.PCVGPGSPSTSVNG..................................TAPAMLRRDEAENDQCVVGL
Q0U0L9_PHANO/44-456V.LGHIPGTNK.PCAK......................................................RGVIRCVVPF
A5DD56_PICGU/47-524Q.SGWIKGKRNVSCSD......................................................DPNGLCVVSF
ATG22_COCIM/93-625D.QGVLLSDKKTPCSASWPTAPTAYA...................................AADATASPRVGPPQCVIYV
AT221_ASPNC/30-582E.RGVLLSDKKTPCSATWSSLESTSPSGTW..........................NTIFDATAFTKPGSPRTSQCIIYI
ATG22_SCHPO/13-525D.HGFLRTDHTIPCSL......................................................YPEEPCSLNI
A7K364_VIBSE/8-434...........................................................................GISPI
B9LBL3_CHLSY/9-439N.A....................................................................ADANGFVYP
Q5B0Q4_EMENI/43-494Q.ATDEN....................................................................GQLFF
Q4PA89_USTMA/59-561Q.QATNLGAGQCGQD........................................................GQNDCRLLF
ATG22_MAGO7/99-626E.NGVLLKDRTSPCKASYDKT.............................................PDGGNDDNQCVVHV
A6E856_9SPHI/5-431T.AEHG.....................................................................DKVSF
ATG22_YARLI/6-582Q.NAVLADDHSQPCDSPPVPFPGDPGVPTDPGIPPNNSLSSSVPWFLRANEIQLLESPDTVHTMKDHKAKPTQPTCVIKF
Q26DY7_FLABB/8-443T.AYEE.....................................................................GNVPT
ATG22_CANAL/39-496N.VGKT..KMNQPCGT.......................................................QGNDCYVKF
ATG22_ASHGO/19-490N.NGVQVDDHTVACGA.......................................................EDKHCVLPL
ATG22_KLULA/17-487I.NGVKLDDHSLRCEV.......................................................NDDKCVLPM
Q5KBK3_CRYNJ/49-483L.AGWDPAYPTGTVPC.......................................................GDGACNLIA
AT221_PENCW/20-562D.RGVLLSDKTTPCSATWRPPLPPPG..................................SDAPVYLPQVSDGGQCIIYF
ATG22_YEAST/20-514I.NGVKVHDHSIPCLSET...................................................GSDSDKCVLGL
A1CD46_ASPCL/43-518L.LGHEEGSNK.PCPRR.....................................................GTNISCLVKF
Q4JAW8_SULAC/5-379................................................................................
A3LP71_PICST/32-502E.VGRN..SKGGRCER.......................................................RGNDCYIDF
ATG22_NEUCR/155-689E.NGVLLSDRSKPCGSSSDK...............................................HTTSAEGQCVVYV
Q6CKN0_KLULA/64-544A.LGHPKGSSG.PCLA.......................................................TGDDCYVTF
A7EQB6_SCLS1/56-534Q.AGFNPNILPLGSAPC.....................................................GDDTPCHVFW
AT221_BOTFB/21-562E.QGVLFTDKITPCTAKNATAIANAT..................................VNALMSRAEGPDTHQCIVNV
AT222_ASPCL/24-579D.RGVLLSDKVTPCSASWNGTETTARTH..............................GISPPWYGINATPGTSQCVVYI
Q0BZH6_HYPNA/25-469G.DG............................................................................
AT222_EMENI/31-576E.QGFLSSSHL.PCVGPDAPPA..........................................AGNGTAPANEACVVPL
AT222_ASPTN/24-571D.SGVLLADKTTPCSATWKTPQGTSPTL..............................SADTTGLWSSQAPRTSQCIVHI
A6H0A9_FLAPJ/7-445K.RGNN......................................................................VVYI
AT222_SCLS1/72-619E.NGVLLSDPTQPCGSSSTHLPP.........................................GLHPGSAKDSQCVIYL
Q0CF56_ASPTN/43-493Q.A....................................................................AGDADGLVF
A1DH52_NEOFI/48-512Q.AAGDQ....................................................................GTLPF
ATG22_VANPO/27-511H.NGVTLEDHSVHCTA.......................................................DHDKCVLGL
AT222_PENCW/33-580E.RGTLQTSRL.PCVGPSAGN.............................................STNATEHGQCVVPV
Q0CXZ2_ASPTN/50-478Q.AAGSG....................................................................GTLVF
AT221_ASPOR/20-571D.RGVLLSDKVTPCQATWKAPKQLSPHETL..........................SQTLINALRYGRDVPGASQCVVYI
Q0BXU5_HYPNA/23-495G.ADILASGRLEGLSP......................................................D....EARRV
Q0TYS2_PHANO/43-505Q.AAGDA....................................................................EALEF
ATG22_PICAN/27-551D.NGVKLIDKITPCNQPHDPTIPIPSPPK.............................DGDFPNSTLTYASQNDSCVLPM
ATG22_CANGA/31-527I.NGVQLDDHNAPCST......................................................SSSDKCVLGL
Q8DIR0_THEEB/14-463............................................................................LTNV
A4X7E0_SALTO/18-457QAAGCELGADS................................................................CVGYV

PF03209

Q9S313_RHOAC/55-461-GAPA---------------------------------------------------------------------------
PUCC_RHOCA/54-461-AVPA---------------------------------------------------------------------------
P73827_SYNY3/40-467-AVLP---------------------------------------------------------------------------
Q9Z5D5_RHOSH/28-417-ALPA---------------------------------------------------------------------------
PUCC_RHOS4/51-455-KVPA---------------------------------------------------------------------------
BCH2_RHOCB/28-418-ALPA---------------------------------------------------------------------------
PUCC_RHOSU/55-451-EVPA---------------------------------------------------------------------------
Q9RFD8_RHOSH/51-461-AVPA---------------------------------------------------------------------------
Q9S333_PROMR/1-414-AFPA---------------------------------------------------------------------------
YPUM_RHOCA/51-458-GVPA---------------------------------------------------------------------------
Q9RAD4_RUBGE/55-466-AVPA---------------------------------------------------------------------------

PF03092

Q55721_SYNY3/46-457-GLSP---------------------------------------------------------------------------
O23028_ARATH/1-404-RRNN---------------------------------------------------------------------------
Q9UAB7_LEIDO/75-654-GIDV---------------------------------------------------------------------------
Q25272_LEIDO/59-606-GLTG---------------------------------------------------------------------------
Q9SKZ5_ARATH/137-553-HLDP---------------------------------------------------------------------------
Q9SQN2_ARATH/61-473-KIQP---------------------------------------------------------------------------
Q9UAC0_LEIDO/76-655-GIDV---------------------------------------------------------------------------
Q9UAB8_LEIDO/94-683-GIDG---------------------------------------------------------------------------
Q9XIQ7_ARATH/30-441-RVNP---------------------------------------------------------------------------
O68867_SYNE7/38-441-GLSP---------------------------------------------------------------------------
Q07492_9TRYP/138-667-GADA---------------------------------------------------------------------------
Q9UAC1_LEIDO/75-651-GIDV---------------------------------------------------------------------------

PF06963

S40A2_ARATH/31-479--------------------------------------------------------------------------------
Q4WVQ3_ASPFU/39-421--------------------------------------------------------------------------------
S40A1_ORYSJ/21-450--------------------------------------------------------------------------------
Q55HR8_CRYNB/34-481--------------------------------------------------------------------------------
S40A1_ARATH/35-483--------------------------------------------------------------------------------
A2R421_ASPNC/42-466--------------------------------------------------------------------------------
Q4RHW0_TETNG/8-534--------------------------------------------------------------------------------
Q2U620_ASPOR/31-411--------------------------------------------------------------------------------
Q5AXY5_EMENI/19-441--------------------------------------------------------------------------------
Q8IA95_CAEEL/5-448--------------------------------------------------------------------------------
S40A3_ARATH/146-569--------------------------------------------------------------------------------
Q0CWF0_ASPTN/44-463--------------------------------------------------------------------------------
Q4PD48_USTMA/82-563--------------------------------------------------------------------------------
S40A1_HUMAN/22-531--------------------------------------------------------------------------------
A2Y023_ORYSI/145-569--------------------------------------------------------------------------------
S40A1_DANRE/19-522--------------------------------------------------------------------------------
A8X2J9_CAEBR/13-461--------------------------------------------------------------------------------
A5BT51_VITVI/32-472--------------------------------------------------------------------------------
A1CBM9_ASPCL/39-469--------------------------------------------------------------------------------

PF13000

YHZ9_SCHPO/51-519SDLATY--------------------------------------------------------------------------
YB70_YEAST/17-560TSLGIF--------------------------------------------------------------------------

PF03825

YEGT_ECOLI/1-405----------GW----SYAC---TAI--AA---ILSPILV-GSI--TD----RFF--------SAQKVLAV-LMFAGA--
NUPG_SHIFL/1-407----------GA----VYSS---LGI--AA---VFMPALL-GIV--AD----KWL--------SAKWVYAI-CHTIGA--
Q9A7U2_CAUCR/1-395----------SL----VGSA---WGV--AA---LVGIFFS-NQF--AD----RNF--------SAERFLAV-SHLIGG--
XAPB_ECOLI/1-407----------GM----VYSS---KGI--AA---IIMPGIM-GII--AD----KWL--------RAERAYML-CHLVCA--

PF07690

O17785_CAEEL/33-439----------SL....LFSL...VAV..GA...MVAVYPV.MLL..IQ....K.F.....G..SRSIVFWV-GMLSTV--
Y2994_MYCTU/18-356----------GL....LASM...PSW..GL...VVTMFAW.GYL..LD....H.V.....G..ERM.VMAV-GSALTA--
ANTR2_ARATH/137-500----------GL....IQSS...FFW..GY...LLTQILG.GIW..AD....K.F.....G..GKV.VLGF-GVVWWS--
Q19296_CAEEL/16-403----------GF....LGSL...FSA..LQ...FISSPTL.GSL..SD....I.Y.....G..RRAVISLC-CIMTFI--
A9CFQ9_AGRT5/27-373----------SL....AVTV...MN...GV...QIATMFTLGRA..ID....I.H.....G..ERR.IVGI-AMLGMA--
Q8NW16_STAAW/10-348----------GL....VLMI...NSF..GM...VIGNLLG.GSL..FD....K.L.....G..GYK.TILI-GTFTCL--
O25793_HELPY/8-347----------GL....AVGG...AYL..TQ...IVFQTPM.GIL..SD....K.I.....G..RKV.VVMV-CLLLFL--
Q97XW7_SULSO/20-385----------SV....LFLLTPTFAT.......LAGNLAL.SLF..SD....KKL.....G..RKT.TFFI-TMSLYS--
P72184_9ACTO/22-419----------QW....VSTG...YLL..AL...AVAIPFV.SWA..QT....R.F.....G..GKR.LWLF-ALGLFT--
O66589_AQUAE/21-406----------GF....MVAI...PVI..AA...AIFRLNF.GHM..FQ....Y.I........DGKYIAIM-GIILSS--
Q9I0P8_PSEAE/19-362----------SL....LVTL...FGL..AV...AITSPLK.GWL..ID....R.W.....G..ARRTMLGL-TAALSL--
MFSD9_HUMAN/49-427----------GI....VGSS...YGI..LQ...LFSSTLV.GCW..SD....V.V.....G..RRS.SLLA-CILLSA--
Q97CG2_THEVO/16-347----------GI....AFGA...YGL..TM...ALFQAPF.GII..SD....R.F.....G..RKN.VIIL-GMIPYI--
Q9CF47_LACLA/24-427----------AL....TQTI...FFT..AA...ALFALFL.PRL..AD....L.I.....G..RKK.VLIG-MLTLTM--
Q92RK8_RHIME/23-360----------GL....LTFT...FQV..TA...SMLQPAI.GIV..TD....R.W.....A..LPY.SLPF-AMLSTC--
Q8YC70_BRUME/8-339----------GA....NTAV...AGL..AS...IAAAPLA.API..AA....R.L.....G..VVKAILLM-LLIGGG--
Q8Z8V3_SALTI/17-369----------GF...........FSLVGQA...YVFKFLW.SPL..MD....R.YTPPFLG..RRRGWLLA-TQLLLL--
Q8NU65_CORGL/19-414----------NI....AVVA...AAL..FC...GTFIVAA.GGI..AD....V.F.....G..RVR.IMMI-GNILNI--
Q9YG70_AERPE/18-417----------SW....IFTS...YLV..TG...SVLIPLM.GRL..GD....A.V.....G..RRR.TLIL-ILIIFG--
Q9HLN0_THEAC/12-329----------EV....AFTL...FTV..FS...TTFQGVG.GYF..AD....R.D.....G..PAR.IGMI-SAILSA--
Q8XR21_RALSO/30-433----------GW....MYTL...FFV..FL...GASAALW.GGW..LE....R.V.....G..PRK.AGVV-SAVCWC--
Q932J3_STAAM/33-313----------GF....ALSA...VSI..AY...GFSKFFM.GTV..SD....R.S.....N..ARI.FLVL-GLALTA--
O87836_STRCO/61-422----------YW....MMTA...WVF..CQ...AAVAFPA.GRLRESG....K.L.....P..ARW.AMML-GSAGTL--
Q8NNT7_CORGL/10-351----------GA....TTGI...FMA..AT...VITQIFTPAAL........RKI.....G..YTP.VMAF-AAFMLG--
Q92WR7_RHIME/13-355----------SS....AMTV...GFI..AM...ALASMVW.GSA..SD....R.W.....G..PRS.VVLI-GSALLA--
Q8TZJ0_PYRFU/13-389----------GF....IMTI...DNL..FA...VILLPFL.GAL..SDMTRTR.I.....G..RRKPYILL-GAPSAA--
O58400_PYRHO/34-380----------GL....LSVI...YNL..TS...AIFQYPF.GYL..SD....K.I.....G..KRKPFIIL-GVLFSG--
Q9KRL8_VIBCH/16-353----------NW....LFAA...STL..AL...SLCLVPW.AVT..SE....A.V.....G..RRL.VMLT-GLFAMP--
Q9KWU2_SPHSX/13-348----------GL....AYGM...YSL..LP...ALASIHI.GRW..VD....R.A.....G..PRR.VMNT-SLVVMM--
LTAA_STAAW/18-353----------SL....AFSI...HFI..AD...ASTNFVI.GFL..LK....K.F.....G..TKI.VLTT-GFILAF--
Q8Y7M4_LISMO/13-349----------GF....ASGI...YII..GT...LLARLYM.GKK..LE....L.F.....G..RKR.VLRF-GILFFL--
NART_STACT/13-344----------SI....VLAI...PVI..LG...SVLRIPF.GYL..TN....I.I.....G..AKW.VFFS-SFIILL--
Q9K646_BACHD/13-358----------A.....MSGVWIAFMI..PK...LLTNLVA.GPY..LD....R.F........QYKVVMVA-SEWIRA--
YLZ2_SCHPO/48-434----------TL....GATL...YTL..GI...LFGNLIF.APL..SE....Q.F.....G..RRP.IYLI-GYSVFA--
YWOG_BACSU/15-348----------GL....LISL...FLL..SA...IITRPFS.GAI..VE....R.F.....G..KKR.MAIV-SMALFA--
Q8WZT8_NEUCS/132-490----------SL....IFVG...NAL..GF...IAGAFFV.DAI..RE....R.L.....G..RAK.TLAV-GQGLIS--
O54179_STRCO/33-428----------QW....IATS...FAL..SA...AGFTLFL.GRV..GD....L.V.....G..RKR.IFMG-GIGLLG--
Q98B83_RHILO/60-407----------GL....LFGC...YAG..GE...LLAAPLI.GGI..AD....R.I.....G..RRP.VLIV-SSIGVG--
Q46984_ECOLX/39-413----------GL....ATTL...FYA..AY...VIFGIPS.NIM..LS....I.V.....G..ARR.WIAT-IMVLWG--
Q9EYN6_SYNPW/18-450----------RT....VAIC...NVA..LT...IPARVLI.GML..LD....K.F.....G..PRL.TYST-LLVFSV--
Q9KBG2_BACHD/16-398----------SW....VTSV...YGL..IY...GIGTVIY.GKL..AD....R.Y........RLKHVLTF-GLVIFA--
Q986N1_RHILO/24-356----------MV....AAAA...FGL..GT...SASALFL.ARY..ID....R.L.....G..ARR.MLQG-ALLLLA--
Q93LX8_9ACTO/30-425----------HW....VVSG...FAA..GF...GALLLFG.GRL..VA....I.L.....G..RRP.VYLA-ALLVFA--
Q8KDQ3_CHLTE/9-374----------GL....IASI...YST..MQ...FIFSPIW.GKL..SD....K.I.....G..RRP.VMLS-SIFLTL--
Q9PCL3_XYLFA/32-422----------QW....VVDG...YTL..MF...GALLLSA.GAL..VD....R.I.....G..ARR.AFGL-GLVVFI--
Q9URI1_CANAX/123-512----------TL....PLTL...FVI..GY...GVGPLVF.SPMSENA....I.F.....G..RTS.IYII-TLFLFV--
Q9KRK6_VIBCH/22-366----------QI....TLTA...YTA..GF...AIGQLLH.GPL..AD....S.F.....G..RRP.VMLC-GIFLFG--
Q92Y26_RHIME/19-357----------SW....LISA...FAI..LG...ALAGAPI.GLA..VD....R.I.....G..ART.MASL-GLLLQA--
Q9RSF5_DEIRA/46-397----------GW....FSTS...YSL..MQ...FIFSPIW.GNR..SE....H.H.....G..RRP.TLLM-GLVGFS--
Q8WU09_HUMAN/27-274----------GW....IGSI...MSS..LR...FCAGPLV.AII..CD....I.L.....G..EKT.TSIL-GAFVVT--
LIZ1_SCHPO/36-407----------QD....INVV...FTC..GY...IIGQLPG.SYA..LQ....R.V........PARLWFSV-MNILWG--
Q97IY3_CLOAB/13-357----------NL....VYIL...QSI..PI...LVLGMFA.GNL..VD....K.......K..NKKIVFIM-LNIMLS--
Q9I008_PSEAE/29-430----------TW....LTVL...YEATQVA...AMAFAPW.CSV........T.F.....S..LRR.FTLF-AIGGFA--
Q9HTX1_PSEAE/12-346----------NW....SITA...TTL..AV...ALAAPFV.GRL..SG............GRERSR.VIAF-AASLLC--
Q9KYI2_STRCO/15-371----------GS....AVSA...GTL..AT...LPTALLA.GWL..VD....R.F.....S..PKA.VLVS-SNLVTA--
Q973W8_SULTO/12-335----------GI....AEAL...NYG..GG...SLMSILG.GYL..AD....K.Y.....G..RKM.IAVI-GNALIV--
Q18472_CAEEL/18-397----------MW....AVGA........GT...IFGTIPT.NWV..VV....K.Y.....G..AKWPFLVA-GLVSLF--
Q8ZXX0_PYRAE/10-352----------GV....VLAA...YPF..LE...ALGALIA.GRW..SD....T.L.....G..RKK.TLVL-GYVARS--
Q9AA55_CAUCR/30-391----------GIPDALVAGI...FSL..SAVLWAVTSPFW.ARQ..SD....L.R.....G..RKP.LIML-GLAGFA--
YN42_SCHPO/141-527----------LL....TMTV...FLL..GY...CSGPIIW.APL..SE....L.S.....G..RKP.PILI-GMLGFG--
Q8NUU1_STAAW/16-376----------GL....LASF...FSL..GY...ALMQVPS.GML..AE....K.F.....G..PRK.MITI-ALVWWS--
Q961H2_DROME/54-453----------TYSANIMMTT...SLL..ESIIPAFASLFL.GPW..SD....K.F.....G..RRP.ILLT-TFTGYL--
Q8X543_ECO57/36-398----------GL....LATL...FYI..TY...GVSKFVS.GIV..SD....R.S.....N..ARY.FMGI-GLIATG--
Q8KCE7_CHLTE/27-390----------GTISGDLVFW...TEI..VT...LLLFGPA.GAI..MD....R.I.....G..RRP.VYAV-GFIILA--
P95852_SULSF/9-333----------SL....LLPL...VSFGFVK...GAFNFIA.GKL..SD....D.L.....G..RKR.VLVI-GWLVAL--
O45678_CAEEL/27-403----------GT....VLSC...FFW..GY...ALTQVFA.GRI..AD....K.Y.....G..AEK.ILPY-SSLAWT--
Q9I5C8_PSEAE/21-369----------GL....LVSA...AQL..VP...IVGLLVA.GEL..LD....R.Y........SERLVVGL-GTLIVA--
O30222_ARCFU/15-357----------SL....MVTA...NSI..GM...VVGGFLI.GVL..CD....K.I.....G..VRV.TLSI-AAVVVG--
O54630_HALSA/24-368----------GS....FVVS...FGI..VK...SILNLYA.GKW..GE....A.Y.....G..RKP.VLIA-GWATAL--
Q8TR38_METAC/18-398----------GI....LAST...YPA..FQ...LIGAPIL.GRW..SD....L.Y.....G..RKK.ILLL-SQIGTL--
Q986D7_RHILO/41-396----------GL....ALGV...LGL..GV...ALSELPW.GLL..TD....R.W.....G..DRR.VLLI-GLGATA--
O69759_PSEFL/31-392----------GW....ISAM...MLW..CY...AGGQFIN.GNL..GD....K.F.....G..GKR.MMIA-GAILSL--
Q9HLR9_THEAC/6-377----------GL....ASAV...SSA..AS...VPALILW.GDL..SD....A.V.....S..KRKIFVLI-GFFGAF--
Q8Z4K9_SALTI/13-352----------HWDPATPALA...FSINMGI...IPLPMIWGGRM..ID....N.......G..KGKQAIVI-GGILFS--
O28944_ARCFU/4-328----------AF....AAGV...FAL..FP...AIAMTPF.GML..SE....V.Y.....G..RRR.FLVA-GAVTSL--
Q9KKX8_VIBCH/40-383----------GA....MLAT...SAL..VG...SLTGLYS.GYL..SD....K.F.....G..RKW.VMVS-GTLIAT--
Q96XQ4_SULTO/9-336----------GI....IFSL...FFI..GY...IIVQIPA.GIL..SD....Y.V........SPKIIALL-SLVGLA--
Q8Y6H4_LISMO/13-376----------SL....LLII...SQV..LA...VFTALLG.GYF..AD....N.F.....G..RKR.MMSI-SVIGEG--
O62376_CAEEL/16-394----------GS....LDAI...FMA..AY...AAALFFW.GWL..GD....R.L.....N..PKL.VVAA-GMVGSA--
YCUD_SCHPO/89-473----------NW....HCSIQVSYLVQSLFIVGNAFGPMLLGPM..SD....I.F.....G..RKW.VYVG-SLILYI--
Y1634_MYCTU/25-423----------AW....VTTL...YLV..GS...VVAATTV.NTM..LL....R.V.....G..ARS.SYLM-GLAVFG--
Q9KG75_BACHD/5-341----------GG....IVAI...YSL..AN...MVGNIIG.GHW..VD....R.F.....G..RKR.MLYM-GMLAVG--
Q7JZE2_DROME/46-458----------PWTRNQELTFPGVYYY..GY...VVSISLS.GYL..AD....R.C.....S..SKR.LFIV-SLIFEA--
Q9KLN6_VIBCH/36-395----------GI....MGSA...FFF..TY...AFGKFLN.GFL..SD......Y.....A..NIGRFMSF-SLLLSG--
Q8P881_XANCP/26-418----------SI....AMTS...YLL..AL...AVLIPAS.GAI..AD....R.F.....G..LRR.VFSA-SIWVFI--
Q8PQ23_XANAC/19-356----------GA....VVTA...AQL..AY...AAGLLLL.VPL..GD....R.L........ERRGLIVG-LFVLSA--
YQ92_SCHPO/20-407----------QSVISTLLAV...YAV..AN...IAASSPI.GFL..AD....KFL........TRKVPMLI-GLIFLT--
O16697_CAEEL/36-432----------GW....IVAA...CSI..GC...TISNPIY.GFW..NQ....KTM.....S..VKW.PAIT-GFLIAA--
Q8K8C8_STRP3/10-353----------GL....AVAV...TAL..AS...ALFAPVW.GKL..AD....C.Y.....G..RKPMMLRA-SFVMTF--
Q8X0G2_NEUCS/87-498----------SW....LTTA...YLV..TS...TAFQPLY.GRV..SD....I.F.....G..RRV.CFFI-STVTFA--
Q8XKW0_CLOPE/26-404----------SW....QVTL...AGL..VI...GIGAVVY.ASL..SD....S.I.....S..VRT.LLVL-GIILIC--
O58488_PYRHO/9-354----------EL....QHIA...YVF.......GLFIAFLLGST........RIY.....EGSFRR.SVGI-AISWAA--
Q9K9F3_BACHD/14-368----------SL....ISTL...SFI..VY...GISQPLI.GKL..VD....R.L.....G..ARF.ILSC-STLLVG--
O29880_ARCFU/11-360----------SL....PFSI...FLL..IF...ALMMVPA.GRT..QD....R.I.....G..PRK.VAML-GGVLLG--
Q97C48_THEVO/19-351----------GF....IFTL...NAA..LS...IVFSLFA.GYL..SD....V.I.....G..RKWTLISG-SVAGFI--
Q9Y7D4_ASPTE/35-449----------GW....YGSA...YLL..SS...CALQPLA.GKL..YT....L.L........TLKYTFLA-FLGLFE--
Q97DX4_CLOAB/23-413----------QW....LITG...NVL..VV...GILVPVT.AFL..LH....T.F.....T..TKQ.LYLS-SILFLL--
Q8MPU6_CAEEL/90-445----------GI....VFGI...FEF..TM...FIISPLF.GKY..II....F.I.....G..ART.MFIV-GIAVTG--
Q96Y06_SULTO/9-344----------GL....LGTI...FFA..LS...ALASPFV.SYI..AD....K.T.....G..KPLQAMSL-GIILWG--
A9CIR5_AGRT5/18-359----------QF....AVSG...YLA..AT...ALLQLVI.GPL..SD....L.F.....G..RRP.VMLA-SITIMI--
Q8ZWZ3_PYRAE/12-326----------GL....LPAA...FII..GA...AVTQIPA.SYL..GA....V.Y.....G..HDK.VAGL-GMLIFG--
Q8X5A4_ECO57/20-357----------GF....FFTG...SAV..IG...VLVSQFLAGRS..DK....R.......G..DRKSLIVF-CCLLGV--
Q9P397_NEUCS/52-417----------NW....ALSI...FYI..IY...LLFEVPS.NVL..LK....A.L.....G..PRF.YLPL-LVCGFG--
Y2456_MYCTU/16-365----------GF....VMAV...GGI..AA...IVAQTPI.GAL..VD....RTT.....A..KRALVVAG-AVLVTA--
Q19845_CAEEL/45-446----------GI....VVAM...YSV..SQ...AIFSPVF.GFW..SN....R.I.....G..QVRFPLIV-GFIVMA--
Q8NUX5_STAAW/12-354----------GI....VMGA...YML..TA...MVFRPWA.GQI..IA....R.V.....G..PIK.VLRI-ILIINA--
YHJO_BACSU/19-353----------ML....IISL...QPF..AD...IFLTLAA.GRV..TD....R.L.....G..RRT.AILT-ALLLQS--
Q8ZVF8_PYRAE/4-322----------GA....IVST...AFF..VS...IIARPLS.GLL..GE....K.M.....G..YST.MMSA-GIAMAV--
O58825_PYRHO/10-360----------GT....MMSA...FVMAELIP.RIILNPLA.GVI..GD....R.Y........NRKHLMVG-FDLARG--
Q8X5A5_ECO57/8-341----------GH....MISY...YAL..GV...VVGAPII.ALF..SS....R.Y.....S..LKH.ILLF-LVALCV--
Q9L8Q4_PSEST/17-351----------GW....LTAS..TFGL.......AALLSPWAGAL..VQ....R.M.....G..TRA.GLIC-MFLLVG--
Q9XXC1_CAEEL/44-436----------SL....GFAA...GFL..GA...IAAVVPM.SRL..TA....R.F.....G..VHK.VMTL-SGILGT--
Q9ADP8_STRCO/39-376----------AW....LASV...AQL..GY...AAGLLFF.APL..GD....S.V.....N..RRRLVAAL-SLVATA--
Q8YQ15_NOSS1/8-358----------GF...........LGLLILP...SGLKFLW.SPF..ID....R.YRLGKLG..HYR.GWII-CFQLLL--
O93992_CANAX/65-459----------IL....NISF...FIL..GL...GTGGCFL.SPI..SE....F.H.....G..RRI.VYIG-GLTTMI--
Q8YWH2_NOSS1/17-343----------GA....NSTL...YFF..II...AIGTPLVTKIL........RQI.....G..LRK.TMML-GFLLMG--
Q9RSM6_DEIRA/32-418----------GW....ASSA...FML..AN...LLGAIVA.GLL..TD....R.R.....G..AAW.GAGL-GLGLFG--
Q9VDS0_DROME/61-500----------IMQFNLVCLRDIFVAW..TQYWHLFGVLVG.GVM..GT....KMM....LGISPRS.TYCV-GAVAQI--
Q9I0Y2_PSEAE/28-357----------......LLTVLPVLCM..GL...VALLLPWLGRW..........L.....A..EHR.GIVC-GLLAIA--
Q92TU0_RHIME/19-421----------AW....LDVG...YTT..FK...LIGFMAA.SWL..MS....R.F.....D..PRN.LVVG-STLAMG--
Q8RQC1_RHIFR/18-362----------GLAGIGVYVC...PML..GV...SLTSAFW.GRM..GD....R.Y.....G..NRL.MMVR-ALLGLA--
Q8XGP2_RALSO/41-431----------IW....VTNA...YQI..AM...IAALLPF.AAL..GE....S.I.....G..YRR.VFIG-GLTLFG--
YFIS_BACSU/15-364----------SL....LMMS...FAL..PV...IVLGPVS.GLL..AD....R.F.....D..RKT.IMFL-SEIGRA--
Q92BU8_LISIN/14-347----------EM....LFTA...YIF..TM...AIMMIPI.GIV..AG....K.L.....G..DKK.LIVI-GLFIVT--
Q55937_SYNY3/19-365----------GLILAGALTL...RVT..VF...VLLSPIA.GAI..AD....R.Y.....D..RKQMMVIT-HLARLG--
Q9A856_CAUCR/31-388----------AN....LVFY...FQL..SY...AVAYLVW.GKV..MD....K.I.....G..ARW.GFGI-AFLIWQ--
P72472_STRLI/29-361----------GL....MMTM...PGF..LA...AVSAPVV.TVA..TG....R.I........DRRLMLGT-FILLLA--
Q97BG6_THEVO/17-357----------GL....ILGS...SAI..AM...AFVQYYS.GRW..TD....R.I.....G..RRF.FLIV-IPIPAA--
Q9X4X9_9PSED/27-377----------QA....CIT....FLF..GG...AVISLQLVGWF..NL....R.Y.....G..IKR.VTVI-SLLLLV--
Q973J7_SULTO/8-320----------GE....ILSG...SII..AS...TFLSLLW.GVL..GD....A.Y.....G..RKK.FFFV-SRGLSA--
O32859_MYCFO/12-364----------SI....VAMA...GTL..PL...LVATLIA.GAA..VD....Y.L.....G..RRR.VSMI-SDLLSA--
Q9S243_STRCO/13-352----------GV....IAGV...YAL..LP...LFAAVPL.GRR..TD....H.......G..RCAPLLPA-GVVLIA--
Q97PK9_STRPN/13-344----------EL....LVSL...PSF..GI...MMMLLLN.GFL..EK....I.F........PERLQISL-GLLILS--
Q97CC5_THEVO/27-411----------SL....ILFF...WSL..SY...AIFNFPG.GWI..VD....K.L.....G..LRK.SMTT-MFAIWS--
AMPG1_RICPR/10-405----------GM....LSFITLPYSI..NF...LLAPVFDTVQIKYLN....KIL.....G..HRL.SWIC-LTSTTL--
Q9RD97_STRCO/46-435----------AW....LLNG...TPL..GL...AALLLVA.GSL..AD....D.Y.....G..RRR.LFVS-GTLALG--
Q8R8R3_THETN/20-398----------SL....AFVI...HGI..IF...AIFNPLI.GYV..SDKTETR.W.....G..RRRPYIAF-GIVPLA--
O30210_ARCFU/17-354----------SL....AFTL...PWL..IA...GLLSFPA.GMF..AD....R.V.....G..VRT.AATI-GGVIAA--
Q8X120_EXODE/120-524----------SW....LPAA...YSL..TV...GTFILPA.GRW..GD....L.Y.....G..HRK.LFVF-GYLWFA--
Q9EW91_9ACTO/13-358----------GL....VTAL...QFL..PQ...TLFGLTG.GVL..AD....R.F.....P..KRR.LLLI-TQTAMA--
Q8MMD6_DROME/21-407----------DWNEMERSYILSSFFW..GY...ILTQFMG.GWL..CR....R.Y.....G..ARI.TMFV-STIGSA--
Q8XVV0_RALSO/19-414----------TW....IATA...YLV..AE...IIIIPLA.GWL..EK....L.L.....G..LRNLLLAA-TGLFTG--
Q978I2_THEVO/17-358----------GF....SDSL...LTL.......PLMISVLVGAY..VD....K.......S..KRKKTLAF-ISSLFR--
S22AI_MOUSE/13-363----------GY....LQTT...FGV..LQ...LLGGPVF.GRF..AD....Q.C.....G..ARA.ALSL-SFLAAS--
Q92XG9_RHIME/14-352----------QM....VLAA...YAG..GT...LVGLLTF.GEL..GA....R.Y.....S..RRK.LLVW-SLGLFA--
Q8P8I8_XANCP/24-370----------GL....IGLA...EIL..PF...FCIAPFA.GYL..VD....H.L.....P..RRRLGMTA-ALGLVA--
Q9I1Q7_PSEAE/34-397----------GL....ILSS...FFW..AY...ALLQIPG.GWL..ID....R.Y.....G..PRR.VIGW-STGLWG--
Q9I4J1_PSEAE/26-388----------AD....LDAL...YLA..AY...AVGQFMW.GVF..AD....R.F.....G..TRV.VVLG-GLLTSA--
Q9KG22_BACHD/29-373----------GV....VLMA...MTV..PR...VLLMMIG.GVL..AD....R.F........RRSTIMFC-SLITRS--
Q9KYE9_STRCO/8-359----------GL....VLAV...FAV..AA...LIVLPFA.GRA..IV....R.R.....G..PLP.VLLV-ALVTAA--
Q8K8F6_STRP3/27-401----------GWDKAQIATLLSCLTV..SY...GLAKFYM.GAL..GD....R.V.....S..LRK.LFSI-SLGASA--
O31131_BRELN/13-405----------SW....VVTG...YFL..AA...SSLMLVT.GSL..GD....N.L.....G..RRR.TYRL-GVVIYV--
Q8PQM0_XANAC/29-361----------GQ....AISI...SGL..FA...VVASLLI.APL..SS....R.F.....N..RRH.VLIA-LTGMML--
Q9ZC50_YERPE/23-431----------AT....AIVM...YSL..SV...AGFVMLG.AKL..NQ....R.F.....G..PLI.VFRC-TVLLFG--
Q8U366_PYRFU/20-359----------GS....IMGL...IES..LS...SLFKVLF.GYI..SD....K.F.....R..RRKVFVAL-GYTLSA--
Q9C9R9_ARATH/11-379----------GS....LTLL...RSM..VQ...AACYPLA.AYM..AI....R.H........NRAHVIAL-GAFLWS--
Q20265_CAEEL/46-427----------DL....LFSA...AYI..AP...LPSIIIL.YFL..TN....R.S.....G..VKTTFLIC-SMLSFL--
Q9PCQ0_XYLFA/73-403----------GQ....MVTV...YAA..GS...LLAAIPLVSLT..QT....R..........RRKPVLML-ALAGFL--
Q9I247_PSEAE/4-339----------GL....LIAA...AYW..PQ...VIAGVAL.TYV..AD......W........RIDQLRLA-TLLAAL--
Q9VPX2_DROME/42-442----------GT....LLSC...YFW..GY...LVSQIPL.AHV..AE....N.F.....S..AKW.VMLF-SVAINV--
Q8Y3L9_LISMO/17-359----------GL....ILSA...FFL..GY...TLFQIPM.GYL..NN....R.I.....G..ARP.VLAI-SIIIVG--
Q8VUK1_HALHD/23-380----------AF....MLAT...PML..TG...ALAALPM.AAL..AR....R.H.....G..GRR.VMIA-CLLLIC--
Q8RPH1_DESHA/13-347----------QS....VLTI...SAL..AI...VFGTLLT.GLT..AE....I.V.....G..KRK.LLLL-GIALYT--
A9CGF2_AGRT5/30-354----------GA....VSAT...FAL..TN...AAAAPQI.SRL..VD....R.M.....G..QSR.VLIP-ATIISV--
O66181_ARTSP/15-353----------GM....LGTS...TAI..GY...LSLVLFA.GIL..AA....K.W.....G..SKK.LVVL-GNLLVA--
Q8KYU7_9PROT/15-359----------......WGAI...YGFGTFA...SAIVMVWSGGL..TD....V.M........RVRHLGPI-VLAALA--
YJ7D_SCHPO/81-445----------SS....MTTL...FYA..GY...LVAQYPA.AIL..MQ....K.C........RLSYFIFC-NVFLWS--
Q8XEG8_ECO57/47-408----------GA....LLSV...FSL..AY...GIAQLPC.GPL..LD....R.K.....G..PRL.MLGL-GMFFWS--
Q9VY22_DROME/66-470----------AW....KTVI...QSL..FP...CLLILFW.GSW..SD....R.H.....R..RRKPCILI-PVVGEF--
Q8U4E5_PYRFU/8-345----------GI....VAGT...VSI..VS...LSSKPLG.GYL..GD....R.......G..FKFHAMFI-GNIIGI--
YFKL_BACSU/12-351----------SY....VIAA...IGF..GK...LLTYGIS.GVL..SD....K.I.....G..RKP.LVVA-SAGIMA--
O30679_RHORH/8-341----------GL....LTSA...FAV..GM...IIGAPLM.AIA..SM....R.W........PRRRALLT-FLITFM--
Q97TH3_CLOAB/16-408----------KW....TLTG...FML..AM...GTMAPLT.AYL..GE....R.F.....S..YKR.VYLT-SIVGFI--
THI73_YEAST/86-451----------SN....LGTI...FSA..AY...IFMEPVV.TYL..IQ....K.F.....P..ISK.ILGT-FITVWG--
Q9A961_CAUCR/19-356----------GM....AAAGSFHYASMTGI...ALGGVCL.GFL..AD....R.L.....G..RKA.TIVL-GLVAFA--
Q97TH7_CLOAB/19-357----------GI....ILTS...YMI..PY...GVMQPVY.GFF..SD....R.W........SKASVLKI-IVGGLA--
Q8NVE0_STAAW/12-398----------SL....IFTA...YFI..AL...VIANPIV.GEL..LS....R.F........KIIYVAIA-GLLLFS--
Q9VPD9_DROME/28-441----------GL....VYGV...RGI..LG...FVTTPVM.GAI..SD....F.H.....G..RKVVMLLA-VATTYA--
Q8PVU8_METMA/11-346----------GL....LIST...YAI..ST...AIFALVI.GHF..ID....R.V........NRKKILVP-CLVIYG--
Q8NVE2_STAAW/18-410----------QW....LVTG...FML..VN...GVMIPLT.AYL..MD....R.I........KTRPLYLA-AMGTFL--
Q97FI4_CLOAB/17-361----------GT....IVMI...ASV..VG...VPASFIG.GKI..AD....K.......S..SRKLTYIL-GQSFAA--
Q8KR58_ESCFE/20-359----------SV....WAGL...LMF..GSMLFLPASPWW.GRQ..SE....R.H.....GCKVVMQASLS-GYLASF--
Q8NLD6_CORGL/19-353----------GL....LMTV...YAT..VV...AVVTIPA.MLW..VS....R.F........NKRTVFLI-TLAFLA--
Q9LAA0_AERHY/27-362----------GY....LGGG...YAL..AA...ALSSLLC.ARY..ID....R.F........DRKQVALL-SLLGGT--
O06742_BACIU/18-364----------SL....VITV...FSL..IA...AFAIPIV.GYL..AD....R.F........SRKVIIIP-CLILYG--
Q9FCG1_STRCO/24-364----------GL....VAAL...HGL..GG...VVSSLGA.GVM..TD....R.L.....G..RRP.TLLV-AQTSTA--
O94019_CANAX/86-529----------NT....GAGV...LFL..GI...GWGTFFL.TPA..SS....L.Y.....G..RKI.TYFI-CIFLGL--
MOT14_MOUSE/42-459----------AW....VSSL...SMG..IT...LIVGPFI.GLF..IN....T.C.....G..CRQ.TAII-GGLVNS--
Q92V77_RHIME/8-347----------GH....LITL...FSL..SY...AIGAPLL.SAL..AG....A.A.....D..RRR.LLVT-AMLVFV--
Q9Y7E0_ASPTE/42-435----------NI....SNAG...VLV..AM...GYSSLIW.GPM..NK....L.V.....G..RRT.SYNL-AISMLC--
Q9I431_PSEAE/11-401----------AW....IGNT...YLL..GL...TLVIPLS.VWL..AS....R.L.....G..ERR.LMLL-ALAGFA--
O76837_CAEEL/25-400----------HWLENTADVS...FIFSAGAAGAIIGLFPS.VPL..TT....K.F.....G..VRN.VLSF-YGLLTA--
Q96ZI2_SULTO/36-365----------GI....ISAL...TSL..FT...FIGSGVINSRL...K....RDM........RKK.VFRA-SGIVYA--
Q9L8R0_PSEST/7-367----------GLF..QLAAL...PAI..FK...FLLAVPV.QRV........R.L.....G..RGH.FVHW-LLLLCA--
Q94886_DROME/14-423----------HWNEKQQGALLGSFFW..AH...WTLQIPG.GIL..AT....K.Y.....G..TKL.VFGW-SNGIGV--

PF00083

GTR4_MOUSE/27-483----------AL----SVAI---FSV--GG---MISSFLI-GII--SQ----W-L-----G--RK.RAMLA.NNVLAV--
GTR1_MOUSE/14-467----------SL----SVAI---FSV--GG---MIGSFSV-GLF--VN----R-F-----G--RR.NSMLM.MNLLAF--
QUTD_EMENI/24-490----------AN----IVSL---YQA--GA---FFGALFA-YPI--GH----F-W-----G--RR.WGLMF.SALIFF--
ITR2_YEAST/112-569----------.L----ITAA---TSL--GA---LITSVGA-GTA--AD----V-F-----G--RR.PCLMF.SNLMFL--
SNF3_YEAST/100-556----------SI----LVSF---LSL--GT---FFGALTA-PFI--SD----S-Y-----G--RK.PTIIFSTIFIFS--
GALP_ECOLI/18-451----------.W----VVSS---MMF--GA---AVGAVGS-GWL--SF----K-L-----G--RK.KSLMI.GAILFV--
HXT5_YEAST/89-549----------GL----MVSI---FNI--GC---AIGGIVL-SKL--GD----M-Y-----G--RK.IGLMT.VVVIYS--
GTR3_MOUSE/13-465----------SL----CVAI---FSV--GG---MIGSFSV-GLF--VN----R-F-----G--RR.NSMLL.VNLLAI--
HXT9_YEAST/64-526----------GL----IVSI---FNI--GC---AIGGIVL-SKV--GD----I-Y-----G--RR.IGLIT.VTAIYV--
HXT3_YEAST/65-525----------GL----IVSI---FNI--GC---AIGGIIL-AKL--GD----M-Y-----G--RK.MGLIV.VVVIYI--
HXT8_YEAST/69-530----------GL----IVSI---FNV--GS---AIGCLFL-SKL--GD----I-Y-----G--RC.MGLII.VIVVYM--
YJHB_ECOLI/15-405----------TL----IGTV---AFI--AR---PIGGGFF-GAM--AD----K-Y-----G--RK.PMMMW.AIFIYS--
HXT6_YEAST/68-528----------GL----IVSI---FNI--GC---AIGGIIL-SKL--GD----M-Y-----G--RK.VGLIV.VVVIYI--
SUT_SPIOL/38-486----------..----PISG---MIV--QP---LVGYYSD-R.C--TS----R-F-----G--RRRPFIAA.GAALVA--
GTR3_CHICK/14-464----------SL----SVAI---FSV--GG---MIGSFSV-SLF--FN----R-F-----G--RR.NSMLL.VNVLAF--
GTR5_HUMAN/20-475----------SV----TVSM---FPF--GG---FIGSLLV-GPL--VN----K-F-----G--RK.GALLF.NNIFSI--
PRO1_LEIEN/95-540----------GI----FAGS---MIA--GC---LIGSVFA-GPL--AS----K-I-----G--ARLSFLLV.GLVGVV--
HXT13_YEAST/60-521----------GL----LVAM---FSI--GC---AIGGLIF-ARL--AD----T-L-----G--RR.LAIVI.VVLVYM--
RAG1_KLULA/66-528----------GL----IVSI---FNI--GC---AVGGIVL-SNI--GD----R-W-----G--RR.IGLIT.VIIIYV--
YB91_YEAST/27-485----------GA----ITSI---FSI--GG---LFGSYYA-GNW--AN----R-Y-----G--RK.YVSMG.ASAMCM--
GTR1_LEIDO/5-442----------.L----IVAI---AIA--GA---FVGAFIS-GFI--SA----A-F-----G--RR.PCIAV.ADALFV--
HUP1_PARKE/30-492----------QL----FVSS---LFL--AG---LVSCLFA-SWI--TR----N-W-----G--RK.VTMGI.GGAFFV--
PROP_ECOLI/25-453----------LA----TFSV---PFL--IR---PLGGLFF-GML--GD----K-Y-----G--RQ.KILAI.TIVIMS--
JEN1_YEAST/125-563----------TW----GLGL---VLF--VR---SAGAVIF-GLW--TD----K-S-----S--RK.WPYIT.CLFLFV--
GIT1_YEAST/43-466----------TR----VSNA---ALV--GI---IFGQFFM-GIA--AD----Y-Y-----S--RK.SCILV.ATAILV--
GTR2_MOUSE/13-498----------SL----SVSS---FAV--GG---MVASFFG-GWL--GD----K-L-----G--RI.KAMLA.ANSLSL--
HXT2_YEAST/59-519----------GL----IVGI---FNI--GC---AFGGLTL-GRL--GD----M-Y-----G--RR.IGLMC.VVLVYI--
XYLE_ECOLI/13-478----------GF----CVAS---ALI--GC---IIGGALG-GYC--SN----R-F-----G--RR.DSLKI.AAVLFF--
LACP_KLULA/75-529----------GL----VFSI---FNV--GQ---ICGAFFV-P.L--MD----W-K-----G--RK.PAILI.GCLGVV--
STP1_ARATH/26-489----------TM----FTSS---LYL--AA---LISSLVA-STV--TR----K-F-----G--RR.LSMLF.GGILFC--
MAL31_YEAST/102-561----------IG----LCLC---YMA--GE---IVGLQMT-GPS--VD----Y-M-----G--NR.YTLIM.ALFFLA--
GTR2_LEIDO/41-538----------GV----FAGS---LVI--GS---TMGALMG-GYL--TK----R-L-----D--YC.KSFLF.IGLLSV--
Q57RP5_SALCH/23-420----------..----VFGS---GFL--MR---PVGAIVL-GAY--ID----R-I-----G--RR.KGLMV.TLAIMG--
TH2A_TRYBB/39-502----------GI----FASA---MIV--GS---MVGSIIA-GKC--IT----M-F-----G--LK.KSFII.VGVMSV--
GTR3_HUMAN/12-465----------SL----SVAI---FSV--GG---MIGSFSV-GLF--VN----R-F-----G--RR.NSMLI.VNLLAV--
GTR2_HUMAN/13-499----------SL----SVSS---FAV--GG---MTASFFG-GWL--GD----T-L-----G--RI.KAMLV.ANILSL--
TH12_TRYBB/39-501----------GI----FACA---MIV--GS---MVGSIIA-GKC--IT----T-F-----G--LKKSFIIV.SITCTI--
QAY_NEUCR/24-494----------SN----IVSV---YQA--GA---FFGCLFA-YAT--SY----F-L-----G--RR.KSLIA.FSVVFI--
GLF_ZYMMO/13-469----------GM----VVVA---VLV--GC---VTGSLLS-GWI--GI----R-F-----G--RR.GGLLM.SSICFV--
HXT4_YEAST/74-534----------GL----IVSI---FNI--GC---AIGGIIL-AKL--GD----M-Y-----G--RK.MGLIV.VVVIYI--
ITR1_YEAST/89-546----------.I----VTAA---TSL--GA---LITSIFA-GTA--AD----I-F-----G--RK.RCLMG.SNLMFV--
STL1_YEAST/30-488----------GA----TTSC---YEL--GC---FAGSLFV-MFC--GE----R-I-----G--RK.PLILM.GSVITI--
ARAE_ECOLI/25-461----------.W----VVSS---MML--GA---AIGALFN-GWL--SF----R-L-----G--RK.YSLMA.GAILFV--
GAL2_YEAST/74-534----------GL----IVAI---FNI--GC---AFGGIIL-SKG--GD----M-Y-----G--RK.KGLSI.VVSVYI--

PF05977

Q92LE2_RHIME/11-531----------AL----VQAA---STL--PV---FFLSILA-GAI--AD----N-F-----S--RRWVMFAG-HCLLAL--
Q98HB4_RHILO/11-532----------AL----VQAS---TTL--PI---MLFALVA-GAI--AD----S-F-----D--RRKVMLVA-QTFMLV--
Q92Y88_RHIME/8-530----------AM----VQAA---ATL--PI---FLLAIPA-GVL--SD----I-L-----D--RRKFLIVI-QLLLAA--
Q9X4X4_9PSED/20-540----------SL----VQTA---ISL--PA---FLFGLPG-GVI--AD----L-V-----D--RRKWLMMT-QGVMLI--
A9CFW7_AGRT5/8-530----------AL----VQAA---GTL--PI---FLLAIPA-GVL--TD----I-L-----D--RRKFLIAV-QLLLAS--
Q9HYE1_PSEAE/25-549----------AM----IQVA---AAL--PL---VLLSILS-GVI--AD----N-H-----D--RRKIMLWG-LSFEMT--
Q989L4_RHILO/31-551----------AL----VQAS---TTL--PT---FLLSIIA-GAL--AD----N-Y-----S--RRNLMFAG-WCVIAS--
Q92SW7_RHIME/14-535----------AL----VQAS---TSL--PI---MLFSLVS-GAL--AD----N-F-----D--RRRIMLVA-QSFMLA--
Q989T8_RHILO/11-532----------AL----VQAS---ATL--PA---FILSVFV-GAI--AD----N-F-----S--RRRVMFAG-WCLMAI--
Q9I0E1_PSEAE/6-529----------AL----VQVA---GSL--PM---FFLALPA-GAL--AD----I-V-----D--KRRYLLGV-QLWMAL--

PF01306

LACY_CITFR/1-412----------GI----IFAC---ISL--FS---LLFQPIF-GLL--SD----K-L-----G--LRKHLLWVITGMLVM--
RAFB_ECOLX/4-415----------GI----VFSC---LSL--FA---ISFQPLL-GVI--SD----R-L-----G--LKKNLIWSISLLLVF--
CSCB_ECOLX/4-411----------GT----LYSV---NQF--TS---ILFMMFY-GIV--QD----K-L-----G--LKKPLIWCMSFILVL--
LACY_KLEOX/6-416----------GI----VFSC---ISL--FA---IIFQPVF-GLI--SD----K-L-----G--LRKHLLWTITILLIL--

PF03137

SO2A1_RAT/31-603----------GL----ISSL---NEI--SN---ATLIIFI-SYF--GS----R-------V--NRPRMIGI-GGLLLA--
SO1B2_RAT/27-616----------GL----IDGG---FEI--GN---LLVIVFV-SYF--GS----K-------L--HRPKLIGI-GCFIMG--
SO2B1_HUMAN/48-648----------GL----LASF---NEV--GN---TALIVFV-SYF--GS----R-------V--HRPRMIGY-GAILVA--
SO3A1_HUMAN/39-623----------GV----IASS---FEI--GN---LALILFV-SYF--GA----R-------G--HRPRLIGC-GGIVMA--
Q20702_CAEEL/102-763----------GR----IVQF---YDF--GY---VLLCIPV-SYF--GG----R-------H--SKPAVLAA-GLACMA--
SO2A1_HUMAN/31-603----------GL----ISSL---NEI--SN---AILIIFV-SYF--GS----R-------V--HRPRLIGI-GGLFLA--
Q9VVH9_DROME/173-755----------GI----LLSA---SEM--GQ---ICTAMLL-TYF--AG----R-------G--HRPRWIAC-GMVLFS--
Q93550_CAEEL/16-587----------GW----LLSL---YDI--GH---TMAILLI-GYI--GS----H-------Y--HLPRITGI-GVILSS--
Q9W271_DROME/65-627----------GI----ISVG---NDI--ST---MLTAAIL-GYY--AG----H-------R--HRPRWMGI-GLLTIV--
SO1A3_RAT/19-598----------GF----INGS---FEI--GN---LLLIIFV-SYF--GM----K-------L--HRPIVIGV-GCAVMG--
SO1B1_HUMAN/27-622----------GF----IDGS---FEI--GN---LLVIVFV-SYF--GS----K-------L--HRPKLIGI-GCFIMG--
Q21157_CAEEL/48-598----------GI----FAAT---YDV--FV---TVMLIPL-ALY--AT----K-------V--NKVKCIGL-GMMIVG--
SO4A1_HUMAN/102-664----------GL----IASS---YDI--AA---CLCLTFV-SYF--GG----S-------G--HKPRWLGW-GVLLMG--
Q9XWC5_CAEEL/47-621----------GI----ISSW---YDF--AV---LLVVFPV-CHW--GN----N-------G--HKGRWIGW-GGVIMA--
Q9W269_DROME/110-732----------GI----ISVG---NDI--SQ---TLVSAVL-AYY--AG----K-------G--HRPRWIGF-GLLTIV--
SO1A2_HUMAN/19-598----------GF----INGS---FEI--GN---LLLIIFV-SYF--GT----K-------L--HRPIMIGI-GCVVMG--

PF06779

Q89X18_BRAJA/64-148----------GI----------------GR---FAYALVLPDMR--ET----L-------G-------------------
Q92UK2_RHIME/2-86----------GF----------------GR---FSYTPILPAMM--TD----T-------G-------------------
Q8YFG7_BRUME/2-86----------GV----------------GR---FIYTPILPGMM--AD----I-------G-------------------
Q986E3_RHILO/35-119----------GI----------------GR---FVYTPILPGMM--EE----L-------H-------------------
Q8Z0X3_SALTI/24-110----------GV----------------GR---FLYTPMLPVML--AE----K-------Q-------------------
Q9I3T2_PSEAE/21-105----------GV----------------GR---FSLTPQLPHLI--RE----G-------Q-------------------
Q88ED9_PSEPK/15-99----------GI----------------GR---FALTPQLPQLI--AE----G-------Q-------------------
Q89HQ1_BRAJA/50-128----------GL----------------AR---FSYTPLIPALI--AA----K-------W-------------------
A9CI18_AGRT5/24-108----------GF----------------GR---FSFTPILPGMM--AD----V-------P-------------------
Q8Y185_RALSO/37-119----------GI----------------GR---FAFTPILPMML--HD----G-------S-------------------
Q87ES9_XYLFT/27-113----------GI----------------GR---FLHTPILPVML--HE----G-------Q-------------------
YJIJ_ECOLI/24-110----------GL----------------GR---FLYTPMLPVMM--AE----G-------S-------------------

PF06609

Q8NII4_FUSAU/1-598----------GL----FSTL---WTM--GQ---AVSILVM-GRL--TD----R-F-----G--RRP-FVIA-THIIGL--
Q9C1B3_FUSSP/1-598----------SL----FSTL---WTT--GQ---AVSILMM-GRL--TD----R-F-----G--RRP-FVIL-THILGL--

PF12832

A7SQQ8_NEMVE/55-132-----------------------------------------VFY----------F-------------------------
Q6FB61_ACIAD/6-82-----------------------------------------GFY----------F-------------------------
B7P8Y1_IXOSC/9-85-----------------------------------------AIT----------F-------------------------
Q17GA0_AEDAE/14-90-----------------------------------------IVL----------F-------------------------
A7RI07_NEMVE/54-130-----------------------------------------AFY----------F-------------------------
A4Y888_SHEPC/10-86-----------------------------------------ACY----------F-------------------------
A4BSZ3_9GAMM/7-83-----------------------------------------AFY----------F-------------------------
Q2BMQ1_9GAMM/3-79-----------------------------------------GFY----------F-------------------------
Q54SK7_DICDI/682-755-----------------------------------------FSL----------T-------------------------
A7EK42_SCLS1/450-504-----------------------------------------SIL----------V-------------------------
B2AA42_PODAN/619-697-----------------------------------------SVV----------V-------------------------
A1WY15_HALHL/14-90-----------------------------------------GFY----------L-------------------------
Q54G39_DICDI/12-88-----------------------------------------LLY----------F-------------------------
B3PHF3_CELJU/15-91-----------------------------------------GFY----------F-------------------------
Q07ZQ8_SHEFN/10-86-----------------------------------------ACY----------F-------------------------
D3SB25_THISK/3-79-----------------------------------------TVY----------F-------------------------
B0X8B9_CULQU/11-87-----------------------------------------CVL----------F-------------------------
YJBC_SCHPO/418-493-----------------------------------------WSL----------I-------------------------
Q16KC8_AEDAE/34-110-----------------------------------------VSL----------F-------------------------
Q21IX9_SACD2/5-81-----------------------------------------FFY----------F-------------------------
B4G7T5_DROPE/36-112-----------------------------------------ITL----------F-------------------------
C3YMP2_BRAFL/14-90-----------------------------------------AIF----------F-------------------------
Q0A9B1_ALHEH/6-82-----------------------------------------SFY----------F-------------------------
A3QFN3_SHELP/24-100-----------------------------------------ACY----------F-------------------------
Q55CH3_DICDI/11-87-----------------------------------------ILY----------F-------------------------
B8GQD4_THISH/5-81-----------------------------------------GFY----------F-------------------------
A1S7K7_SHEAM/12-88-----------------------------------------ACY----------F-------------------------
C5BL70_TERTT/2-78-----------------------------------------SVY----------F-------------------------
B1KKS0_SHEWM/10-86-----------------------------------------ACY----------F-------------------------
B0V728_ACIBY/7-83-----------------------------------------GFY----------F-------------------------
B0W437_CULQU/30-106-----------------------------------------MSL----------F-------------------------
A7UVG6_ANOGA/14-90-----------------------------------------IVL----------F-------------------------
Q2SJE3_HAHCH/5-81-----------------------------------------GFY----------F-------------------------
B7PL10_IXOSC/7-83-----------------------------------------GHY----------F-------------------------
A7C0B5_9GAMM/6-82-----------------------------------------AFY----------L-------------------------
A8PWD3_MALGO/544-619-----------------------------------------WLS----------L-------------------------
B6C555_9GAMM/9-85-----------------------------------------GFY----------L-------------------------
B6K1R3_SCHJY/414-489-----------------------------------------WSL----------I-------------------------
Q4PB45_USTMA/688-764-----------------------------------------WVS----------I-------------------------

PF01770

Q29L76_DROPS/2-397----------EQVYQNVYPF---GTY--SV---LAQLVIV-FLI--TD----L-V--------RYRPVIVL-SAVAGI--
Q294A5_DROPS/2-414----------EEINRSVYPV---GTY--SY---LALQIFV-FLI--TD----F-L--------RYKPVIIA-NALTGI--
Y2544_DICDI/95-457----------TIVYQEIYPY---WTY--SY---FVFLLIF-GIL--GE----I-I--------GYKVIIII-GMVAKI--
Q9EQN9_MOUSE/28-459----------RQVYNEIYPV---WTY--SY---LLLLFPV-FLA--TD----Y-L--------RYKPVILL-QGLSLI--
Q9VK64_DROME/2-395----------DQIYQDVYPF---GTY--SV---LAQLVIV-FLI--TD----L-V--------RYKPVIVL-SALAGI--
Q9BTX8_HUMAN/23-434----------EQVTNEITPV---LSY--SY---LAVLVPV-FLL--TD----Y-L--------RYTPVLLL-QGLSFV--
Q9VGV5_DROME/2-408----------QQLTHDVYPV---GTY--SY---LVQLVFV-FLI--TD----F-L--------RYKPLIIT-IGAAGV--
S19A3_HUMAN/10-441----------AEITNEIFPV---WTY--SY---LVLLLPV-FVL--TD----Y-V--------RYKPVIIL-QGISFI--
Q4T7Q4_TETNG/6-427----------EELNNQIFPM---STY--GN---LAAQIPI-FLL--TD----W-L--------RYKPVVIL-ECVALF--
Q6GN45_XENLA/68-474----------EQVTNEITPV---LSY--SY---MAVLVPV-FLL--TD----Y-L--------RYTPVLIL-QSLSHI--
Q17QC9_BOVIN/23-434----------TQVTNEITPV---LSY--SY---LAVLVPI-FLL--TD----Y-L--------CYKPVLLL-QGLSYV--
Q1LV16_DANRE/4-414----------EVVTNYLFPI---WTY--SY---LSLLCPV-FLL--TD----L-L--------RYKPLIVA-QGLFLV--
Q16JT2_AEDAE/2-405----------EQINQQVFPV---GTY--SY---GIQLVIT-FLI--TD----Y-F--------RYKPLIIL-SGVAGI--
Q6NRB3_XENLA/18-453----------RQVFNEIYPV---WTY--SY---LALLFPV-FLA--TD----Y-L--------RYKPVIVL-QGASLI--
Q9VGV6_DROME/2-411----------DEVNRSVYPV---GTY--SY---LALLIFV-FLI--TD----L-L--------RYKPVIIA-NATTGI--
FOLT2_CAEEL/2-394----------QTLNSQVYPI---WTY--SY---LITLIPA-FLL--TD----V-F--------LYKPLLVF-EAFSYF--
Q542F3_MOUSE/23-427----------EQVTNEIIPM---LPY--SH---LAVLVPV-FLL--TD----Y-L--------RYKPVLVL-QCLSFV--
Q28C92_XENTR/10-422----------EQVKNSVLPV---WTY--SY---IALLIPV-FLL--TD----Y-L--------RYKPIIVL-QALGLS--
Q6DIK7_XENTR/10-424----------EQVTAVVFPV---WTY--SY---LALLVPA-FLL--TD----Y-L--------RYKPVIIL-QGLAIT--
Q7Q5N2_ANOGA/2-422----------EQLNRDVYPI---GTY--SQ---VALLVFM-FLL--TD----V-L--------RYKSIIVF-SACLGI--
A8BIM9_GIAIC/39-447----------DQINQTVFPM---SGY--SN---FGFLLVL-SMA--SI----G-I--------SHHALLYF-GWVGYV--
A7SN54_NEMVE/6-420----------EQLENEIYPV---WTY--SY---LAALFFV-FVF--TD----F-L--------RYKPVIII-EGLAYL--
S19A3_MOUSE/11-435----------PEMTNEILPV---WTY--SY---LATLPP