Sequence alignment for CL0015

PF13000

C4R336_PICPG/74-584--------------------------------------------------------------------------------
G0WCJ0_NAUDC/17-577--------------------------------------------------------------------------------
G8BYR1_TETPH/85-660--------------------------------------------------------------------------------
Q75EB1_ASHGO/51-585--------------------------------------------------------------------------------
E7K9I5_YEASA/17-559--------------------------------------------------------------------------------
Q6CKM4_KLULA/10-515--------------------------------------------------------------------------------
G0VIX6_NAUCC/41-595--------------------------------------------------------------------------------
H2AY09_KAZAF/18-574--------------------------------------------------------------------------------
I2H5Y9_TETBL/23-594--------------------------------------------------------------------------------
G8JR10_ERECY/17-554--------------------------------------------------------------------------------
S6E3L5_ZYGB2/13-555--------------------------------------------------------------------------------
Q6FMM5_CANGA/15-566--------------------------------------------------------------------------------
C5E2P0_LACTC/16-543--------------------------------------------------------------------------------
B6ABL4_CRYMR/9-525--------------------------------------------------------------------------------
G8ZXV2_TORDC/17-551--------------------------------------------------------------------------------
J7RSN7_KAZNA/20-561--------------------------------------------------------------------------------

PF07672

Q8EUQ6_MYCPE/191-477--------------------------------------------------------------------------------
Y077_MYCPN/209-467--------------------------------------------------------------------------------
Q8EVP4_MYCPE/172-441--------------------------------------------------------------------------------
Y076_MYCPN/210-484--------------------------------------------------------------------------------
Q98PH4_MYCPU/154-430--------------------------------------------------------------------------------
Q7NAK7_MYCGA/200-455--------------------------------------------------------------------------------

PF03825

YEGT_ECOLI/1-405--------------------------------------------------------------------------------
Q9A7U2_CAUCR/1-395--------------------------------------------------------------------------------
XAPB_ECOLI/1-407--------------------------------------------------------------------------------
NUPG_ECOLI/1-406--------------------------------------------------------------------------------

PF00854

PTR7_ARATH/99-532--------------------------------------------------------------------------------
F7BBU0_ORNAN/81-472--------------------------------------------------------------------------------
PEPT3_CAEEL/82-453--------------------------------------------------------------------------------
PEPT1_CAEEL/113-509--------------------------------------------------------------------------------
PTR12_ARATH/99-524--------------------------------------------------------------------------------
S15A1_RABIT/81-472--------------------------------------------------------------------------------
PTR30_ARATH/96-518--------------------------------------------------------------------------------
PTR2_ARATH/113-544--------------------------------------------------------------------------------
DTPA_ECOLI/88-460--------------------------------------------------------------------------------
DTPD_ECOLI/76-458--------------------------------------------------------------------------------
YJDL_ECOLI/75-447--------------------------------------------------------------------------------
PTR2_SCHPO/158-542--------------------------------------------------------------------------------
S15A2_HUMAN/111-487--------------------------------------------------------------------------------
PTR2_YEAST/155-533--------------------------------------------------------------------------------
S15A1_RAT/81-474--------------------------------------------------------------------------------
PTR17_ARATH/124-550--------------------------------------------------------------------------------
S15A4_RAT/94-517--------------------------------------------------------------------------------
DTPT_LACLA/91-474--------------------------------------------------------------------------------
PEPT2_CAEEL/99-494--------------------------------------------------------------------------------
DTPB_ECOLI/81-457--------------------------------------------------------------------------------
YCLF_BACSU/95-469--------------------------------------------------------------------------------

PF06779

Q986E3_RHILO/34-394--------------------------------------------------------------------------------
Q89HQ1_BRADU/48-412--------------------------------------------------------------------------------
A9CI18_AGRT5/23-387--------------------------------------------------------------------------------
Q88ED9_PSEPK/14-373--------------------------------------------------------------------------------
Q8Y185_RALSO/36-399--------------------------------------------------------------------------------
Q9I3T2_PSEAE/20-380--------------------------------------------------------------------------------
Q89X18_BRADU/63-426--------------------------------------------------------------------------------
Q92UK2_RHIME/1-365--------------------------------------------------------------------------------
YJIJ_ECOLI/23-381--------------------------------------------------------------------------------
Q8ZJZ6_SALTY/23-379--------------------------------------------------------------------------------
Q9PGN0_XYLFA/26-385--------------------------------------------------------------------------------

PF01733

ENT1_ARATH/167-450--------------------------------------------------------------------------------
S29A1_RAT/144-455--------------------------------------------------------------------------------
S29A2_HUMAN/131-454--------------------------------------------------------------------------------
S29A1_HUMAN/144-454--------------------------------------------------------------------------------
FUN26_YEAST/180-510--------------------------------------------------------------------------------
Q19495_CAEEL/137-426--------------------------------------------------------------------------------
Q21145_CAEEL/434-723--------------------------------------------------------------------------------

PF03239

FTH1_YEAST/8-404--------------------------------------------------------------------------------
EFEU_BACSU/9-395--------------------------------------------------------------------------------
Q9Y8Z4_AERPE/4-268--------------------------------------------------------------------------------
Y964_SYNY3/6-291--------------------------------------------------------------------------------
FIP1_SCHPO/7-320--------------------------------------------------------------------------------
EFEU_ECOLI/1-276--------------------------------------------------------------------------------
O83937_TREPA/14-362--------------------------------------------------------------------------------
Q9ZC51_YERPE/156-557--------------------------------------------------------------------------------
Q9RKQ1_STRCO/1-274--------------------------------------------------------------------------------
Q9ZDD8_RICPR/1-278--------------------------------------------------------------------------------
FTR1_YEAST/7-321--------------------------------------------------------------------------------
Y154_ARCFU/4-266--------------------------------------------------------------------------------
Q9WYP8_THEMA/2-266--------------------------------------------------------------------------------

PF01770

S19A1_HUMAN/23-434--------------------------------------------------------------------------------
Q9EQN9_MOUSE/28-459--------------------------------------------------------------------------------
Q9VK64_DROME/2-395--------------------------------------------------------------------------------
Q29L76_DROPS/2-397--------------------------------------------------------------------------------
Q294A5_DROPS/2-414--------------------------------------------------------------------------------
Q9VGV5_DROME/2-408--------------------------------------------------------------------------------
Q16JT2_AEDAE/2-405--------------------------------------------------------------------------------
S19A3_HUMAN/10-441--------------------------------------------------------------------------------
Q1LV16_DANRE/4-414--------------------------------------------------------------------------------
Q9VGV6_DROME/2-411--------------------------------------------------------------------------------
FOLT2_CAEEL/2-394--------------------------------------------------------------------------------
Q28C92_XENTR/10-422--------------------------------------------------------------------------------
Q7Q5N2_ANOGA/2-422--------------------------------------------------------------------------------
A8BIM9_GIAIC/39-447--------------------------------------------------------------------------------
A7SN54_NEMVE/6-420--------------------------------------------------------------------------------
S19A3_MOUSE/11-435--------------------------------------------------------------------------------
F1N2M7_BOVIN/23-430--------------------------------------------------------------------------------
F1NVD6_CHICK/32-445--------------------------------------------------------------------------------
F7EDM0_XENTR/76-481--------------------------------------------------------------------------------
H3CDB6_TETNG/12-433--------------------------------------------------------------------------------
S19A1_MOUSE/23-426--------------------------------------------------------------------------------

PF03219

TLC2_ARATH/88-571--------------------------------------------------------------------------------
TLC1_CHLTR/2-492--------------------------------------------------------------------------------
Q6MEN4_PARUW/1-484--------------------------------------------------------------------------------
Q6MBI2_PARUW/1-474--------------------------------------------------------------------------------
Q6MEN5_PARUW/4-499--------------------------------------------------------------------------------
Q6MEM5_PARUW/2-491--------------------------------------------------------------------------------
A5CCG3_ORITB/1-504--------------------------------------------------------------------------------
Q1MSG2_LAWIP/9-504--------------------------------------------------------------------------------
C4YY86_9RICK/5-489--------------------------------------------------------------------------------
C4YYY2_9RICK/12-501--------------------------------------------------------------------------------
C4YZB1_9RICK/5-496--------------------------------------------------------------------------------
F8KVN2_PARAV/3-490--------------------------------------------------------------------------------
TLCE_RICPR/7-496--------------------------------------------------------------------------------
TLC2_CHLTR/2-500--------------------------------------------------------------------------------
TLCD_RICPR/14-503--------------------------------------------------------------------------------

PF06963

S40A2_ARATH/31-479--------------------------------------------------------------------------------
S40A1_ORYSJ/21-450--------------------------------------------------------------------------------
S40A1_ARATH/35-483--------------------------------------------------------------------------------
A2R421_ASPNC/42-466--------------------------------------------------------------------------------
Q5AXY5_EMENI/19-441--------------------------------------------------------------------------------
Q8IA95_CAEEL/5-448--------------------------------------------------------------------------------
S40A3_ARATH/146-569--------------------------------------------------------------------------------
Q0CWF0_ASPTN/44-463--------------------------------------------------------------------------------
Q4PD48_USTMA/82-563--------------------------------------------------------------------------------
S40A1_HUMAN/22-531--------------------------------------------------------------------------------
S40A1_DANRE/19-522--------------------------------------------------------------------------------
A8X2J9_CAEBR/13-461--------------------------------------------------------------------------------
A5BT51_VITVI/32-472--------------------------------------------------------------------------------
A1CBM9_ASPCL/39-469--------------------------------------------------------------------------------
S40A3_ORYSJ/147-569--------------------------------------------------------------------------------
H3DM67_TETNG/10-523--------------------------------------------------------------------------------

PF13347

D2VB35_NAEGR/31-486--------------------------------------------------------------------------------
B8B7S1_ORYSI/22-442--------------------------------------------------------------------------------
Q8I3H5_PLAF7/62-507--------------------------------------------------------------------------------
C5BVC3_BEUC1/22-453--------------------------------------------------------------------------------
A0A031WJE7_PEPDI/25-461--------------------------------------------------------------------------------
B3W8U5_LACCB/11-452--------------------------------------------------------------------------------
C3Z8Z9_BRAFL/15-394--------------------------------------------------------------------------------
B5X2T0_SALSA/38-502--------------------------------------------------------------------------------
NLS1_XENTR/37-494--------------------------------------------------------------------------------
D0KIC2_PECWW/9-445--------------------------------------------------------------------------------
B1S9F4_9BIFI/14-474--------------------------------------------------------------------------------
A4AJK9_9ACTN/13-439--------------------------------------------------------------------------------
E8WA27_STRFA/18-443--------------------------------------------------------------------------------
A1SNV8_NOCSJ/11-434--------------------------------------------------------------------------------
A3V2V1_9RHOB/6-408--------------------------------------------------------------------------------
Q28K27_JANSC/7-401--------------------------------------------------------------------------------
B9KP25_RHOSK/4-400--------------------------------------------------------------------------------
B6AV21_9RHOB/12-414--------------------------------------------------------------------------------
A6E455_9RHOB/14-411--------------------------------------------------------------------------------
A8TM36_9PROT/10-426--------------------------------------------------------------------------------
A7HQL5_PARL1/9-433--------------------------------------------------------------------------------
Q026U3_SOLUE/21-465--------------------------------------------------------------------------------
Q0AL93_MARMM/17-465--------------------------------------------------------------------------------
Q2G9N1_NOVAD/12-450--------------------------------------------------------------------------------
Q2N8H6_ERYLH/12-453--------------------------------------------------------------------------------
C0D597_9CLOT/17-465--------------------------------------------------------------------------------
A6NPU4_9FIRM/28-469--------------------------------------------------------------------------------
C6LHW9_9FIRM/41-483--------------------------------------------------------------------------------
Q5YU93_NOCFA/38-478--------------------------------------------------------------------------------
Q0F3N0_9PROT/19-595--------------------------------------------------------------------------------
D4LG93_9FIRM/21-452--------------------------------------------------------------------------------
A6TPY1_ALKMQ/9-433--------------------------------------------------------------------------------
A6TPY6_ALKMQ/10-436--------------------------------------------------------------------------------
C5EQ37_9FIRM/10-441--------------------------------------------------------------------------------
B7GTV4_BIFLS/22-444--------------------------------------------------------------------------------
B0NCA5_CLOSV/62-493--------------------------------------------------------------------------------
D4L2L1_9FIRM/9-431--------------------------------------------------------------------------------
C9BIA1_ENTFC/23-456--------------------------------------------------------------------------------
C3W9X3_FUSMR/14-452--------------------------------------------------------------------------------
D1PII8_9FIRM/14-445--------------------------------------------------------------------------------
C0BCF9_9FIRM/22-465--------------------------------------------------------------------------------
C4Z9B4_EUBR3/7-441--------------------------------------------------------------------------------
C9QHC7_VIBOR/7-438--------------------------------------------------------------------------------
B0NX91_9CLOT/12-438--------------------------------------------------------------------------------
C3WEF2_FUSMR/7-437--------------------------------------------------------------------------------
C0BFD6_9FIRM/20-452--------------------------------------------------------------------------------
C3WB69_FUSMR/6-433--------------------------------------------------------------------------------
M2C6H5_TREDN/4-434--------------------------------------------------------------------------------
C7XWC4_9LACO/6-449--------------------------------------------------------------------------------
B2GBT3_LACF3/22-466--------------------------------------------------------------------------------
E7FT79_9LACO/16-461--------------------------------------------------------------------------------
D0DS55_LACFE/13-457--------------------------------------------------------------------------------
C0WMV6_LACBU/20-464--------------------------------------------------------------------------------
Q6SCS3_STRTR/10-454--------------------------------------------------------------------------------
B1SH60_9STRE/18-462--------------------------------------------------------------------------------
C5RC37_WEIPA/6-451--------------------------------------------------------------------------------
C8P5V7_9LACO/3-447--------------------------------------------------------------------------------
Q03PA7_LACBA/4-451--------------------------------------------------------------------------------
A8RLH8_CLOBW/23-450--------------------------------------------------------------------------------
B0NC69_CLOSV/24-452--------------------------------------------------------------------------------
R7CNT8_9FIRM/14-438--------------------------------------------------------------------------------
B1BWZ1_CLOPF/8-434--------------------------------------------------------------------------------
A9MYD9_SALPB/15-438--------------------------------------------------------------------------------
A9QSF4_LACLK/37-463--------------------------------------------------------------------------------
C6PWS4_9CLOT/17-439--------------------------------------------------------------------------------
F0K7R1_CLOAE/8-431--------------------------------------------------------------------------------
D4F9L7_EDWTA/9-430--------------------------------------------------------------------------------
D4BGD4_9ENTR/26-444--------------------------------------------------------------------------------
A4WD81_ENT38/20-469--------------------------------------------------------------------------------
C8P9N3_9LACO/19-468--------------------------------------------------------------------------------
D1BWG8_XYLCX/30-459--------------------------------------------------------------------------------
C8P9N0_9LACO/19-447--------------------------------------------------------------------------------
J4NZS7_OENOE/11-431--------------------------------------------------------------------------------
A6DPD4_9BACT/8-427--------------------------------------------------------------------------------
B1ZS00_OPITP/13-436--------------------------------------------------------------------------------
B3HTC5_ECOLX/7-428--------------------------------------------------------------------------------
D2TGV7_CITRI/11-433--------------------------------------------------------------------------------
L0W055_SERPL/8-433--------------------------------------------------------------------------------
D0KF27_PECWW/10-433--------------------------------------------------------------------------------
D3RGD6_KLEVT/10-434--------------------------------------------------------------------------------
C1MDP3_9ENTR/24-449--------------------------------------------------------------------------------
A0A025G5J5_ECO57/10-432--------------------------------------------------------------------------------
D2ZB78_9ENTR/9-430--------------------------------------------------------------------------------
E6WJ95_PANSA/9-430--------------------------------------------------------------------------------
D4GIM8_PANAM/27-451--------------------------------------------------------------------------------
C9XVR9_CROTZ/33-456--------------------------------------------------------------------------------
A0A023UW17_SERPL/19-442--------------------------------------------------------------------------------
A6G4R1_9DELT/26-447--------------------------------------------------------------------------------
A4AAW4_9GAMM/14-442--------------------------------------------------------------------------------
A6DP62_9BACT/9-590--------------------------------------------------------------------------------

PF11700

A7K364_VIBSE/8-434--------------------------------------------------------------------------------
Q8DIR0_THEEB/14-463--------------------------------------------------------------------------------
Q4JAW8_SULAC/5-379--------------------------------------------------------------------------------
A0A059FXI1_9RHOB/25-469--------------------------------------------------------------------------------
A0A059FSZ2_9RHOB/23-495--------------------------------------------------------------------------------
Q0U0L9_PHANO/44-456--------------------------------------------------------------------------------
A1CD46_ASPCL/43-518--------------------------------------------------------------------------------
ATG22_CANAL/39-496--------------------------------------------------------------------------------
A3LP71_PICST/32-502--------------------------------------------------------------------------------
Q75EJ9_ASHGO/58-558--------------------------------------------------------------------------------
Q6CKN0_KLULA/64-544--------------------------------------------------------------------------------
A7EQB6_SCLS1/56-534--------------------------------------------------------------------------------
A5DD56_PICGU/47-524--------------------------------------------------------------------------------
Q4PA89_USTMA/59-561--------------------------------------------------------------------------------
F5HBL2_CRYNB/49-483--------------------------------------------------------------------------------
Q0TYS2_PHANO/43-505--------------------------------------------------------------------------------
Q0CF56_ASPTN/43-493--------------------------------------------------------------------------------
Q5B0Q4_EMENI/43-494--------------------------------------------------------------------------------
Q0CXZ2_ASPTN/50-478--------------------------------------------------------------------------------
A1DH52_NEOFI/48-512--------------------------------------------------------------------------------
ATG22_SCHPO/13-525--------------------------------------------------------------------------------
A9WGR7_CHLAA/9-439--------------------------------------------------------------------------------
A4X7E0_SALTO/18-457--------------------------------------------------------------------------------
A6E856_9SPHI/5-431--------------------------------------------------------------------------------
Q26DY7_FLABB/8-443--------------------------------------------------------------------------------
A6H0A9_FLAPJ/7-445--------------------------------------------------------------------------------
ATG22_CRYNJ/1-531--------------------------------------------------------------------------------
AT222_PHANO/72-634--------------------------------------------------------------------------------
ATG22_COCIM/35-567--------------------------------------------------------------------------------
AT221_PENCW/20-562--------------------------------------------------------------------------------
AT221_ASPFU/24-580--------------------------------------------------------------------------------
AT222_ASPCL/24-579--------------------------------------------------------------------------------
AT221_ASPNC/30-582--------------------------------------------------------------------------------
AT221_ASPOR/20-571--------------------------------------------------------------------------------
AT221_EMENI/24-564--------------------------------------------------------------------------------
AT222_ASPTN/24-571--------------------------------------------------------------------------------
AT222_SCLS1/72-619--------------------------------------------------------------------------------
L7I128_MAGOY/99-626--------------------------------------------------------------------------------
ATG22_NEUCR/155-689--------------------------------------------------------------------------------
AT221_BOTFB/21-562--------------------------------------------------------------------------------
AT222_PENCW/33-580--------------------------------------------------------------------------------
AT222_ASPOR/30-578--------------------------------------------------------------------------------
AT222_EMENI/31-576--------------------------------------------------------------------------------
ATG22_YARLI/6-582--------------------------------------------------------------------------------
ATG22_PICAN/27-551--------------------------------------------------------------------------------
M9N7N8_ASHG1/19-490--------------------------------------------------------------------------------
N1P7Z2_YEASC/20-514--------------------------------------------------------------------------------
ATG22_CANGA/31-527--------------------------------------------------------------------------------
ATG22_KLULA/17-487--------------------------------------------------------------------------------
ATG22_VANPO/27-511--------------------------------------------------------------------------------

PF03092

Q25272_LEIDO/59-606--------------------------------------------------------------------------------
B3GVG0_TRYBB/138-667--------------------------------------------------------------------------------
Q9UAB8_LEIDO/94-683--------------------------------------------------------------------------------
Q9UAB7_LEIDO/75-654--------------------------------------------------------------------------------
Q9UAC0_LEIDO/76-655--------------------------------------------------------------------------------
Q9UAC1_LEIDO/75-651--------------------------------------------------------------------------------
FBT8_ARATH/98-515--------------------------------------------------------------------------------
FBT7_ARATH/30-441--------------------------------------------------------------------------------
FBT3_ARATH/61-473--------------------------------------------------------------------------------
FBT1_ARATH/137-553--------------------------------------------------------------------------------
F7USN5_SYNYG/46-457--------------------------------------------------------------------------------
O68867_SYNE7/38-441--------------------------------------------------------------------------------

PF00083

GTR4_MOUSE/27-483--------------------------------------------------------------------------------
GTR1_MOUSE/14-467--------------------------------------------------------------------------------
QUTD_EMENI/24-490--------------------------------------------------------------------------------
ITR2_YEAST/112-569--------------------------------------------------------------------------------
SNF3_YEAST/100-556--------------------------------------------------------------------------------
GALP_ECOLI/18-451--------------------------------------------------------------------------------
HXT5_YEAST/89-549--------------------------------------------------------------------------------
GTR3_MOUSE/13-465--------------------------------------------------------------------------------
HXT9_YEAST/64-526--------------------------------------------------------------------------------
HXT8_YEAST/69-530--------------------------------------------------------------------------------
HXT6_YEAST/68-528--------------------------------------------------------------------------------
GTR3_CHICK/14-464--------------------------------------------------------------------------------
GTR5_HUMAN/20-475--------------------------------------------------------------------------------
HXT13_YEAST/60-521--------------------------------------------------------------------------------
YB91_YEAST/27-485--------------------------------------------------------------------------------
PROP_ECOLI/25-453--------------------------------------------------------------------------------
JEN1_YEAST/125-563--------------------------------------------------------------------------------
GIT1_YEAST/43-466--------------------------------------------------------------------------------
GTR2_MOUSE/13-498--------------------------------------------------------------------------------
HXT2_YEAST/59-519--------------------------------------------------------------------------------
XYLE_ECOLI/13-478--------------------------------------------------------------------------------
LACP_KLULA/75-529--------------------------------------------------------------------------------
STP1_ARATH/26-489--------------------------------------------------------------------------------
MAL31_YEAST/102-561--------------------------------------------------------------------------------
QAY_NEUCR/24-494--------------------------------------------------------------------------------
GLF_ZYMMO/13-469--------------------------------------------------------------------------------
STL1_YEAST/30-488--------------------------------------------------------------------------------
ARAE_ECOLI/25-461--------------------------------------------------------------------------------
GAL2_YEAST/74-534--------------------------------------------------------------------------------
A4I0Q6_LEIIN/5-442--------------------------------------------------------------------------------
A4I8N6_LEIIN/77-573--------------------------------------------------------------------------------
Q38AB8_TRYB2/39-501--------------------------------------------------------------------------------
Q38AB9_TRYB2/39-500--------------------------------------------------------------------------------

PF05977

Q92LE2_RHIME/11-531--------------------------------------------------------------------------------
Q98HB4_RHILO/11-532--------------------------------------------------------------------------------
Q92Y88_RHIME/8-530--------------------------------------------------------------------------------
A9CFW7_AGRT5/8-530--------------------------------------------------------------------------------
Q9HYE1_PSEAE/25-549--------------------------------------------------------------------------------
Q989L4_RHILO/31-551--------------------------------------------------------------------------------
Q92SW7_RHIME/14-535--------------------------------------------------------------------------------
Q989T8_RHILO/11-532--------------------------------------------------------------------------------
Q9I0E1_PSEAE/6-529--------------------------------------------------------------------------------

PF07690

O17785_CAEEL/33-439--------------------------------------------------------------------------------
A0A038FBG6_MYCTX/18-356--------------------------------------------------------------------------------
ANTR2_ARATH/137-500--------------------------------------------------------------------------------
Q19296_CAEEL/16-403--------------------------------------------------------------------------------
A9CFQ9_AGRT5/27-373--------------------------------------------------------------------------------
A0A028WC33_STAAU/10-348--------------------------------------------------------------------------------
I0ZIS1_HELPX/8-347--------------------------------------------------------------------------------
C3MP39_SULIL/20-385--------------------------------------------------------------------------------
D7GFS1_PROFC/22-419--------------------------------------------------------------------------------
O66589_AQUAE/21-406--------------------------------------------------------------------------------
A0A022P0M0_PSEAI/19-362--------------------------------------------------------------------------------
MFSD9_HUMAN/49-427--------------------------------------------------------------------------------
Q97CG2_THEVO/16-347--------------------------------------------------------------------------------
F2HKW9_LACLV/24-427--------------------------------------------------------------------------------
F6BV17_SINMB/23-360--------------------------------------------------------------------------------
D1EUE3_BRUML/8-339--------------------------------------------------------------------------------
N0C478_SALTI/17-369--------------------------------------------------------------------------------
I0LFL8_CORGK/19-414--------------------------------------------------------------------------------
Q9YG70_AERPE/18-417--------------------------------------------------------------------------------
Q9HLN0_THEAC/12-329--------------------------------------------------------------------------------
M4UM27_RALSL/30-433--------------------------------------------------------------------------------
A7WY21_STAA1/33-313--------------------------------------------------------------------------------
D6EGQ9_STRLI/61-422--------------------------------------------------------------------------------
Q8NNT7_CORGL/10-351--------------------------------------------------------------------------------
M4MIX3_SINM2/13-355--------------------------------------------------------------------------------
I6V0W9_9EURY/13-389--------------------------------------------------------------------------------
O58400_PYRHO/34-380--------------------------------------------------------------------------------
A1EPJ6_VIBCL/16-353--------------------------------------------------------------------------------
Q9KWU2_SPHSX/13-348--------------------------------------------------------------------------------
A0A008NSL7_STAAU/18-353--------------------------------------------------------------------------------
C8K874_LISMN/13-349--------------------------------------------------------------------------------
NART_STACT/13-344--------------------------------------------------------------------------------
Q9K646_BACHD/13-358--------------------------------------------------------------------------------
YLZ2_SCHPO/48-434--------------------------------------------------------------------------------
E8VD81_BACST/15-348--------------------------------------------------------------------------------
Q1K517_NEUCR/132-490--------------------------------------------------------------------------------
O54179_STRCO/33-428--------------------------------------------------------------------------------
Q98B83_RHILO/60-407--------------------------------------------------------------------------------
A0A017M9G1_ECOLX/39-413--------------------------------------------------------------------------------
Q9EYN6_SYNPW/18-450--------------------------------------------------------------------------------
Q9KBG2_BACHD/16-398--------------------------------------------------------------------------------
Q986N1_RHILO/24-356--------------------------------------------------------------------------------
Q93LX8_9ACTO/30-425--------------------------------------------------------------------------------
Q8KDQ3_CHLTE/9-374--------------------------------------------------------------------------------
Q9PCL3_XYLFA/32-422--------------------------------------------------------------------------------
Q9URI1_CANAX/123-512--------------------------------------------------------------------------------
A0A016X6J9_VIBCL/22-366--------------------------------------------------------------------------------
M4MHF4_SINM2/19-357--------------------------------------------------------------------------------
Q9RSF5_DEIRA/46-397--------------------------------------------------------------------------------
LIZ1_SCHPO/36-407--------------------------------------------------------------------------------
F0K3Z3_CLOAE/13-357--------------------------------------------------------------------------------
A0A030S566_PSEAI/29-430--------------------------------------------------------------------------------
A0A024SUQ9_PSEAI/12-346--------------------------------------------------------------------------------
Q9KYI2_STRCO/15-371--------------------------------------------------------------------------------
Q973W8_SULTO/12-335--------------------------------------------------------------------------------
Q18472_CAEEL/18-397--------------------------------------------------------------------------------
Q8ZXX0_PYRAE/10-352--------------------------------------------------------------------------------
Q9AA55_CAUCR/30-391--------------------------------------------------------------------------------
YN42_SCHPO/141-527--------------------------------------------------------------------------------
A0A008B8F0_STAAU/16-376--------------------------------------------------------------------------------
Q961H2_DROME/54-453--------------------------------------------------------------------------------
C3SM02_ECOLX/36-398--------------------------------------------------------------------------------
Q8KCE7_CHLTE/27-390--------------------------------------------------------------------------------
P95852_SULSF/9-333--------------------------------------------------------------------------------
O45678_CAEEL/27-403--------------------------------------------------------------------------------
A0A030YLG4_PSEAI/21-369--------------------------------------------------------------------------------
O30222_ARCFU/15-357--------------------------------------------------------------------------------
B0R8P5_HALS3/24-368--------------------------------------------------------------------------------
Q8TR38_METAC/18-398--------------------------------------------------------------------------------
Q986D7_RHILO/41-396--------------------------------------------------------------------------------
O69759_PSEFL/31-392--------------------------------------------------------------------------------
Q9HLR9_THEAC/6-377--------------------------------------------------------------------------------
H6NYS0_SALTI/13-352--------------------------------------------------------------------------------
O28944_ARCFU/4-328--------------------------------------------------------------------------------
A1EJD6_VIBCL/40-383--------------------------------------------------------------------------------
Q96XQ4_SULTO/9-336--------------------------------------------------------------------------------
A0A023BKQ7_LISMN/13-376--------------------------------------------------------------------------------
O62376_CAEEL/16-394--------------------------------------------------------------------------------
YCUD_SCHPO/89-473--------------------------------------------------------------------------------
A0A038KTQ1_MYCTX/25-423--------------------------------------------------------------------------------
Q9KG75_BACHD/5-341--------------------------------------------------------------------------------
Q7JZE2_DROME/46-458--------------------------------------------------------------------------------
A0A016X795_VIBCL/36-395--------------------------------------------------------------------------------
B0RRS7_XANCB/26-418--------------------------------------------------------------------------------
H1XFL1_9XANT/19-356--------------------------------------------------------------------------------
YQ92_SCHPO/20-407--------------------------------------------------------------------------------
O16697_CAEEL/36-432--------------------------------------------------------------------------------
A0A029SIS1_STRPY/10-353--------------------------------------------------------------------------------
Q1K880_NEUCR/87-498--------------------------------------------------------------------------------
H1CQV8_CLOPF/26-404--------------------------------------------------------------------------------
O58488_PYRHO/9-354--------------------------------------------------------------------------------
Q9K9F3_BACHD/14-368--------------------------------------------------------------------------------
O29880_ARCFU/11-360--------------------------------------------------------------------------------
Q97C48_THEVO/19-351--------------------------------------------------------------------------------
Q9Y7D4_ASPTE/35-449--------------------------------------------------------------------------------
F7ZPU5_CLOAT/23-413--------------------------------------------------------------------------------
Q8MPU6_CAEEL/90-445--------------------------------------------------------------------------------
Q96Y06_SULTO/9-344--------------------------------------------------------------------------------
A9CIR5_AGRT5/18-359--------------------------------------------------------------------------------
Q8ZWZ3_PYRAE/12-326--------------------------------------------------------------------------------
A0A025FMH0_ECO57/20-357--------------------------------------------------------------------------------
G4UU99_NEUT9/52-417--------------------------------------------------------------------------------
A0A038F9G3_MYCTX/16-365--------------------------------------------------------------------------------
Q19845_CAEEL/45-446--------------------------------------------------------------------------------
A0A028WR33_STAAU/12-354--------------------------------------------------------------------------------
L8ADD9_BACIU/19-353--------------------------------------------------------------------------------
Q8ZVF8_PYRAE/4-322--------------------------------------------------------------------------------
O58825_PYRHO/10-360--------------------------------------------------------------------------------
A0A017MXT2_ECOLX/8-341--------------------------------------------------------------------------------
Q9L8Q4_PSEST/17-351--------------------------------------------------------------------------------
Q9XXC1_CAEEL/44-436--------------------------------------------------------------------------------
Y4007_STRCO/39-376--------------------------------------------------------------------------------
Q8YQ15_NOSS1/8-358--------------------------------------------------------------------------------
O93992_CANAX/65-459--------------------------------------------------------------------------------
Q8YWH2_NOSS1/17-343--------------------------------------------------------------------------------
Q9RSM6_DEIRA/32-418--------------------------------------------------------------------------------
Q9VDS0_DROME/61-500--------------------------------------------------------------------------------
A0A030RLT0_PSEAI/28-357--------------------------------------------------------------------------------
M4MMB5_SINM2/19-421--------------------------------------------------------------------------------
I3XGH7_RHIFR/18-362--------------------------------------------------------------------------------
Q8XGP2_RALSO/41-431--------------------------------------------------------------------------------
J7JJU9_BACIU/15-364--------------------------------------------------------------------------------
E3YYX7_LISIO/14-347--------------------------------------------------------------------------------
F7UKI9_SYNYG/19-365--------------------------------------------------------------------------------
B8H5X3_CAUCN/31-388--------------------------------------------------------------------------------
D6EJD0_STRLI/29-361--------------------------------------------------------------------------------
Q97BG6_THEVO/17-357--------------------------------------------------------------------------------
Q9X4X9_9PSED/27-377--------------------------------------------------------------------------------
Q973J7_SULTO/8-320--------------------------------------------------------------------------------
O32859_MYCFO/12-364--------------------------------------------------------------------------------
Q9S243_STRCO/13-352--------------------------------------------------------------------------------
A0A034WYQ7_STREE/13-344--------------------------------------------------------------------------------
Q97CC5_THEVO/27-411--------------------------------------------------------------------------------
D5AX67_RICPP/10-405--------------------------------------------------------------------------------
Q9RD97_STRCO/46-435--------------------------------------------------------------------------------
Q8R8R3_THETN/20-398--------------------------------------------------------------------------------
O30210_ARCFU/17-354--------------------------------------------------------------------------------
Q8X120_EXODE/120-524--------------------------------------------------------------------------------
Q9EW91_9ACTO/13-358--------------------------------------------------------------------------------
Q8MMD6_DROME/21-407--------------------------------------------------------------------------------
Q8XVV0_RALSO/19-414--------------------------------------------------------------------------------
Q978I2_THEVO/17-358--------------------------------------------------------------------------------
S22AI_MOUSE/13-363--------------------------------------------------------------------------------
M4MJU5_SINM2/14-352--------------------------------------------------------------------------------
Q4UVJ5_XANC8/24-370--------------------------------------------------------------------------------
A0A030R0G5_PSEAI/34-397--------------------------------------------------------------------------------
A0A030YI13_PSEAI/26-388--------------------------------------------------------------------------------
Q9KG22_BACHD/29-373--------------------------------------------------------------------------------
Q9KYE9_STRCO/8-359--------------------------------------------------------------------------------
A0A029SJ89_STRPY/27-401--------------------------------------------------------------------------------
O31131_BRELN/13-405--------------------------------------------------------------------------------
M4U5Z3_9XANT/29-361--------------------------------------------------------------------------------
A4TJW7_YERPP/23-431--------------------------------------------------------------------------------
Q8U366_PYRFU/20-359--------------------------------------------------------------------------------
Q9C9R9_ARATH/11-379--------------------------------------------------------------------------------
Q20265_CAEEL/46-427--------------------------------------------------------------------------------
Q9PCQ0_XYLFA/73-403--------------------------------------------------------------------------------
A0A022NLX7_PSEAI/4-339--------------------------------------------------------------------------------
Q9VPX2_DROME/42-442--------------------------------------------------------------------------------
G2KCG1_LISMN/17-359--------------------------------------------------------------------------------
Q8VUK1_HALHD/23-380--------------------------------------------------------------------------------
B8FVY2_DESHD/13-347--------------------------------------------------------------------------------
A9CGF2_AGRT5/30-354--------------------------------------------------------------------------------
O66181_ARTSP/15-353--------------------------------------------------------------------------------
Q8KYU7_9PROT/15-359--------------------------------------------------------------------------------
YJ7D_SCHPO/81-445--------------------------------------------------------------------------------
H4S4N1_ECOLX/47-408--------------------------------------------------------------------------------
Q9VY22_DROME/66-470--------------------------------------------------------------------------------
I6V2R6_9EURY/8-345--------------------------------------------------------------------------------
J7JKV9_BACIU/12-351--------------------------------------------------------------------------------
O30679_RHORH/8-341--------------------------------------------------------------------------------
F0KEM5_CLOAE/16-408--------------------------------------------------------------------------------
A0A023ZK54_YEASX/86-451--------------------------------------------------------------------------------
B8H3N7_CAUCN/19-356--------------------------------------------------------------------------------
F0KEM1_CLOAE/19-357--------------------------------------------------------------------------------
A0A028WN84_STAAU/12-398--------------------------------------------------------------------------------
Q9VPD9_DROME/28-441--------------------------------------------------------------------------------
Q8PVU8_METMA/11-346--------------------------------------------------------------------------------
A0A032S8J6_STAAU/18-410--------------------------------------------------------------------------------
F0K465_CLOAE/17-361--------------------------------------------------------------------------------
Q8KR58_ESCFE/20-359--------------------------------------------------------------------------------
I0LNP6_CORGK/19-353--------------------------------------------------------------------------------
Q9LAA0_AERHY/27-362--------------------------------------------------------------------------------
O06742_BACIU/18-364--------------------------------------------------------------------------------
Q9FCG1_STRCO/24-364--------------------------------------------------------------------------------
O94019_CANAX/86-529--------------------------------------------------------------------------------
MOT14_MOUSE/42-459--------------------------------------------------------------------------------
F6C4D9_SINMB/8-347--------------------------------------------------------------------------------
Q9Y7E0_ASPTE/42-435--------------------------------------------------------------------------------
A0A022NSM6_PSEAI/11-401--------------------------------------------------------------------------------
O76837_CAEEL/25-400--------------------------------------------------------------------------------
Q96ZI2_SULTO/36-365--------------------------------------------------------------------------------
Q7BQD2_PSEST/7-367--------------------------------------------------------------------------------
Q94886_DROME/14-423--------------------------------------------------------------------------------

PF05978

Q19933_CAEEL/13-169--------------------------------------------------------------------------------
Q9XV34_CAEEL/12-166--------------------------------------------------------------------------------
MFS11_MOUSE/14-166--------------------------------------------------------------------------------
Q8MYL9_CAEEL/14-170--------------------------------------------------------------------------------
Q965T3_CAEEL/14-170--------------------------------------------------------------------------------
P91007_CAEEL/16-172--------------------------------------------------------------------------------
Q9XWR7_CAEEL/37-194--------------------------------------------------------------------------------
Q19932_CAEEL/14-169--------------------------------------------------------------------------------
Q21545_CAEEL/14-168--------------------------------------------------------------------------------
O61865_CAEEL/27-183--------------------------------------------------------------------------------
Q18251_CAEEL/11-167--------------------------------------------------------------------------------

PF03137

A0NEW4_ANOGA/55-618--------------------------------------------------------------------------------
A7S331_NEMVE/27-582--------------------------------------------------------------------------------
A7S539_NEMVE/32-576--------------------------------------------------------------------------------
A7S542_NEMVE/18-557--------------------------------------------------------------------------------
A7SHZ4_NEMVE/19-550--------------------------------------------------------------------------------
A7SQZ6_NEMVE/18-584--------------------------------------------------------------------------------
A7SWE4_NEMVE/55-622--------------------------------------------------------------------------------
A7SX54_NEMVE/31-599--------------------------------------------------------------------------------
A8P8W3_BRUMA/81-731--------------------------------------------------------------------------------
A8PR64_BRUMA/26-571--------------------------------------------------------------------------------
B0WEE2_CULQU/64-642--------------------------------------------------------------------------------
B0WEE5_CULQU/105-708--------------------------------------------------------------------------------
B0WGA7_CULQU/25-763--------------------------------------------------------------------------------
B3DJD4_DANRE/48-631--------------------------------------------------------------------------------
B3MGJ1_DROAN/65-620--------------------------------------------------------------------------------
B3MGJ2_DROAN/51-611--------------------------------------------------------------------------------
B3MNT7_DROAN/36-684--------------------------------------------------------------------------------
B3RLK5_TRIAD/8-577--------------------------------------------------------------------------------
B3RLK6_TRIAD/21-588--------------------------------------------------------------------------------
B3RLK7_TRIAD/29-614--------------------------------------------------------------------------------
B3RLK8_TRIAD/27-595--------------------------------------------------------------------------------
B3RLL2_TRIAD/176-721--------------------------------------------------------------------------------
B3S2R8_TRIAD/18-575--------------------------------------------------------------------------------
B3SCA6_TRIAD/44-614--------------------------------------------------------------------------------
B4J9Q1_DROGR/61-622--------------------------------------------------------------------------------
B4J9Q2_DROGR/50-610--------------------------------------------------------------------------------
B4J9Q3_DROGR/52-605--------------------------------------------------------------------------------
B4JCP9_DROGR/31-685--------------------------------------------------------------------------------
B4KJ36_DROMO/34-688--------------------------------------------------------------------------------
B4KS84_DROMO/70-629--------------------------------------------------------------------------------
B4KS85_DROMO/55-614--------------------------------------------------------------------------------
B4KS86_DROMO/50-605--------------------------------------------------------------------------------
B4KS87_DROMO/111-737--------------------------------------------------------------------------------
B4MDK1_DROVI/34-691--------------------------------------------------------------------------------
B4MFR1_DROVI/68-626--------------------------------------------------------------------------------
B4MFR2_DROVI/57-615--------------------------------------------------------------------------------
B4MJH9_DROWI/51-614--------------------------------------------------------------------------------
B4MJI0_DROWI/54-620--------------------------------------------------------------------------------
B4MWM1_DROWI/38-693--------------------------------------------------------------------------------
B4N051_DROWI/200-840--------------------------------------------------------------------------------
B5DE94_XENTR/28-595--------------------------------------------------------------------------------
B5DI87_DROPS/36-609--------------------------------------------------------------------------------
B5E0I0_DROPS/65-626--------------------------------------------------------------------------------
B7PPH4_IXOSC/20-614--------------------------------------------------------------------------------
B7QN84_IXOSC/6-567--------------------------------------------------------------------------------
C3Y4T6_BRAFL/2-565--------------------------------------------------------------------------------
C3Y4T7_BRAFL/83-626--------------------------------------------------------------------------------
C3YMS7_BRAFL/5-587--------------------------------------------------------------------------------
C3ZQA6_BRAFL/26-589--------------------------------------------------------------------------------
C3ZX58_BRAFL/40-591--------------------------------------------------------------------------------
D6W853_TRICA/116-732--------------------------------------------------------------------------------
D6W895_TRICA/53-625--------------------------------------------------------------------------------
E0VXM5_PEDHC/126-706--------------------------------------------------------------------------------
E0W488_PEDHC/204-804--------------------------------------------------------------------------------
E1C5S3_CHICK/28-603--------------------------------------------------------------------------------
E1FKB9_LOALO/26-596--------------------------------------------------------------------------------
E1FVI2_LOALO/58-633--------------------------------------------------------------------------------
E2A200_CAMFO/99-698--------------------------------------------------------------------------------
E2ABP4_CAMFO/74-684--------------------------------------------------------------------------------
E2BXT3_HARSA/74-652--------------------------------------------------------------------------------
E2RSD4_CANFA/44-638--------------------------------------------------------------------------------
E4X1Y1_OIKDI/36-601--------------------------------------------------------------------------------
E5S461_TRISP/81-717--------------------------------------------------------------------------------
E5SC63_TRISP/58-613--------------------------------------------------------------------------------
E7F5H8_DANRE/27-603--------------------------------------------------------------------------------
E9G6H1_DAPPU/44-620--------------------------------------------------------------------------------
E9GGR7_DAPPU/1-573--------------------------------------------------------------------------------
E9GTG7_DAPPU/37-616--------------------------------------------------------------------------------
E9INY6_SOLIN/50-616--------------------------------------------------------------------------------
F1MA40_RAT/144-702--------------------------------------------------------------------------------
F1NQ62_CHICK/86-676--------------------------------------------------------------------------------
F1Q3Z3_CANFA/92-650--------------------------------------------------------------------------------
F1Q9B1_DANRE/21-583--------------------------------------------------------------------------------
F1QBF7_DANRE/27-591--------------------------------------------------------------------------------
F1RU07_PIG/132-741--------------------------------------------------------------------------------
F1SQZ6_PIG/21-597--------------------------------------------------------------------------------
F2U1E1_SALR5/138-886--------------------------------------------------------------------------------
F4WH08_ACREC/51-617--------------------------------------------------------------------------------
F4X6X3_ACREC/89-670--------------------------------------------------------------------------------
F6RPB8_HORSE/50-647--------------------------------------------------------------------------------
F6SHC6_MONDO/129-692--------------------------------------------------------------------------------
F6SHD5_MONDO/83-645--------------------------------------------------------------------------------
F6SNL4_XENTR/97-651--------------------------------------------------------------------------------
F6TIF0_CIOIN/25-583--------------------------------------------------------------------------------
F6UFC7_MONDO/37-638--------------------------------------------------------------------------------
F6UHW9_MACMU/29-621--------------------------------------------------------------------------------
F6Z8W3_MONDO/36-628--------------------------------------------------------------------------------
F6ZVK8_CIOIN/40-603--------------------------------------------------------------------------------
F6ZXK1_MONDO/21-593--------------------------------------------------------------------------------
F7ACE2_CIOIN/22-602--------------------------------------------------------------------------------
F7B262_CIOIN/35-639--------------------------------------------------------------------------------
F7B8B6_XENTR/14-595--------------------------------------------------------------------------------
F7BQX3_MONDO/39-601--------------------------------------------------------------------------------
F7CCC4_MACMU/114-672--------------------------------------------------------------------------------
F7D880_XENTR/45-603--------------------------------------------------------------------------------
F7DID9_ORNAN/85-636--------------------------------------------------------------------------------
F7E5T7_MACMU/28-625--------------------------------------------------------------------------------
F7G693_MONDO/107-666--------------------------------------------------------------------------------
F7IM14_CALJA/33-639--------------------------------------------------------------------------------
G1KDM6_ANOCA/110-669--------------------------------------------------------------------------------
G1KJC8_ANOCA/62-624--------------------------------------------------------------------------------
G1KTZ7_ANOCA/42-626--------------------------------------------------------------------------------
G1KTZ8_ANOCA/2-594--------------------------------------------------------------------------------
G1KU16_ANOCA/44-637--------------------------------------------------------------------------------
G1LS58_AILME/38-599--------------------------------------------------------------------------------
G1MG68_AILME/111-671--------------------------------------------------------------------------------
G1NLJ6_MELGA/21-604--------------------------------------------------------------------------------
G1P1F0_MYOLU/56-614--------------------------------------------------------------------------------
G1PCN2_MYOLU/58-650--------------------------------------------------------------------------------
G1PGX5_MYOLU/20-594--------------------------------------------------------------------------------
G1QXW4_NOMLE/21-597--------------------------------------------------------------------------------
G1RKH9_NOMLE/129-734--------------------------------------------------------------------------------
G1SJM2_RABIT/94-653--------------------------------------------------------------------------------
G1T6Y7_RABIT/47-646--------------------------------------------------------------------------------
G1T960_RABIT/29-621--------------------------------------------------------------------------------
G3NAV0_GASAC/31-610--------------------------------------------------------------------------------
G3NHS2_GASAC/34-602--------------------------------------------------------------------------------
G3P9F5_GASAC/17-593--------------------------------------------------------------------------------
G3Q5Q6_GASAC/29-624--------------------------------------------------------------------------------
G3RFJ2_GORGO/108-666--------------------------------------------------------------------------------
G3RW09_GORGO/3-600--------------------------------------------------------------------------------
G3THK1_LOXAF/27-590--------------------------------------------------------------------------------
G3VZ81_SARHA/19-591--------------------------------------------------------------------------------
G3WV28_SARHA/37-630--------------------------------------------------------------------------------
G3WVX8_SARHA/40-630--------------------------------------------------------------------------------
G3WWQ7_SARHA/43-640--------------------------------------------------------------------------------
G4VAF3_SCHMA/62-701--------------------------------------------------------------------------------
G5BJ45_HETGA/1-591--------------------------------------------------------------------------------
G6D5X6_DANPL/120-675--------------------------------------------------------------------------------
G6DHQ3_DANPL/73-638--------------------------------------------------------------------------------
H0VSG6_CAVPO/50-647--------------------------------------------------------------------------------
H0VU31_CAVPO/105-653--------------------------------------------------------------------------------
H0W6D9_CAVPO/29-617--------------------------------------------------------------------------------
H0WRN3_OTOGA/1-607--------------------------------------------------------------------------------
H0X513_OTOGA/48-645--------------------------------------------------------------------------------
H0XUZ7_OTOGA/29-621--------------------------------------------------------------------------------
H0ZQ14_TAEGU/44-636--------------------------------------------------------------------------------
H2L5X8_ORYLA/7-609--------------------------------------------------------------------------------
H2LW99_ORYLA/3-593--------------------------------------------------------------------------------
H2LWK4_ORYLA/34-623--------------------------------------------------------------------------------
H2LXV9_ORYLA/4-606--------------------------------------------------------------------------------
H2ME20_ORYLA/33-598--------------------------------------------------------------------------------
H2NP86_PONAB/41-622--------------------------------------------------------------------------------
H2SCH0_TAKRU/44-642--------------------------------------------------------------------------------
H2SCH1_TAKRU/29-627--------------------------------------------------------------------------------
H2SCH5_TAKRU/21-605--------------------------------------------------------------------------------
H2SN38_TAKRU/26-590--------------------------------------------------------------------------------
H2T5W9_TAKRU/22-602--------------------------------------------------------------------------------
H2TWS2_TAKRU/7-592--------------------------------------------------------------------------------
H2UWX7_TAKRU/9-600--------------------------------------------------------------------------------
H2UZN6_TAKRU/20-610--------------------------------------------------------------------------------
H2V2U5_TAKRU/20-610--------------------------------------------------------------------------------
H2YEL4_CIOSA/27-585--------------------------------------------------------------------------------
H2YTS0_CIOSA/2-575--------------------------------------------------------------------------------
H2YZB0_CIOSA/24-616--------------------------------------------------------------------------------
H2Z037_CIOSA/5-589--------------------------------------------------------------------------------
H2Z5W5_CIOSA/21-582--------------------------------------------------------------------------------
H2ZCE8_CIOSA/9-615--------------------------------------------------------------------------------
H3ABP2_LATCH/6-582--------------------------------------------------------------------------------
H3AUF3_LATCH/60-624--------------------------------------------------------------------------------
H3AXL7_LATCH/47-642--------------------------------------------------------------------------------
H3B0P1_LATCH/42-638--------------------------------------------------------------------------------
H3BW91_TETNG/35-616--------------------------------------------------------------------------------
H3DMV0_TETNG/12-567--------------------------------------------------------------------------------
H3DSJ9_PRIPA/41-714--------------------------------------------------------------------------------
H3FQI4_PRIPA/22-588--------------------------------------------------------------------------------
H9GXA5_DANRE/22-598--------------------------------------------------------------------------------
H9GYB5_DANRE/9-610--------------------------------------------------------------------------------
H9J2D0_BOMMO/122-735--------------------------------------------------------------------------------
H9KAI9_APIME/72-668--------------------------------------------------------------------------------
H9KS62_APIME/23-630--------------------------------------------------------------------------------
I1FF21_AMPQE/83-628--------------------------------------------------------------------------------
I1FF22_AMPQE/53-616--------------------------------------------------------------------------------
I3J8K7_ORENI/27-592--------------------------------------------------------------------------------
I3JPB0_ORENI/4-598--------------------------------------------------------------------------------
I3JU44_ORENI/3-598--------------------------------------------------------------------------------
I3JU45_ORENI/36-628--------------------------------------------------------------------------------
I3KD69_ORENI/19-600--------------------------------------------------------------------------------
I3KT50_ORENI/9-572--------------------------------------------------------------------------------
I3MXD4_SPETR/104-661--------------------------------------------------------------------------------
I3MZY5_SPETR/101-669--------------------------------------------------------------------------------
J3QNA4_MOUSE/108-668--------------------------------------------------------------------------------
J9JWU7_ACYPI/65-667--------------------------------------------------------------------------------
J9K6L3_ACYPI/47-601--------------------------------------------------------------------------------
K1PJB3_CRAGI/119-693--------------------------------------------------------------------------------
K1Q6Z9_CRAGI/63-616--------------------------------------------------------------------------------
K1QB38_CRAGI/29-589--------------------------------------------------------------------------------
K1QD74_CRAGI/43-615--------------------------------------------------------------------------------
K7IWN1_NASVI/25-629--------------------------------------------------------------------------------
K7IWN2_NASVI/77-675--------------------------------------------------------------------------------
K7J562_NASVI/209-820--------------------------------------------------------------------------------
K7J8P8_NASVI/104-674--------------------------------------------------------------------------------
L5JNP4_PTEAL/43-638--------------------------------------------------------------------------------
L7N264_MOUSE/21-597--------------------------------------------------------------------------------
L9L9W1_TUPCH/47-739--------------------------------------------------------------------------------
M3WPK8_FELCA/38-596--------------------------------------------------------------------------------
M3XXF4_MUSPF/103-666--------------------------------------------------------------------------------
M3XXG5_MUSPF/93-653--------------------------------------------------------------------------------
M3YCV1_MUSPF/50-648--------------------------------------------------------------------------------
M3ZWM7_XIPMA/18-618--------------------------------------------------------------------------------
M3ZXE4_XIPMA/24-582--------------------------------------------------------------------------------
M4ABK2_XIPMA/34-613--------------------------------------------------------------------------------
SO1A3_RAT/21-597--------------------------------------------------------------------------------
SO2A1_RAT/33-602--------------------------------------------------------------------------------
Q16RK9_AEDAE/100-701--------------------------------------------------------------------------------
Q16RL0_AEDAE/55-631--------------------------------------------------------------------------------
Q171D5_AEDAE/25-762--------------------------------------------------------------------------------
Q28XS7_DROPS/47-608--------------------------------------------------------------------------------
Q5JAR4_HUMAN/29-621--------------------------------------------------------------------------------
SO4C1_RAT/102-664--------------------------------------------------------------------------------
Q7Q103_ANOGA/25-768--------------------------------------------------------------------------------
Q7Q551_ANOGA/114-716--------------------------------------------------------------------------------
SO2B1_MOUSE/42-636--------------------------------------------------------------------------------
Q8C0X7_MOUSE/95-654--------------------------------------------------------------------------------
SO1A5_MOUSE/21-597--------------------------------------------------------------------------------
Q93550_CAEEL/18-586--------------------------------------------------------------------------------
SO4A1_HUMAN/104-663--------------------------------------------------------------------------------
SO1A6_MOUSE/21-597--------------------------------------------------------------------------------
SO4A1_RAT/103-665--------------------------------------------------------------------------------
SO1C1_RAT/44-642--------------------------------------------------------------------------------
SO1B2_MOUSE/27-617--------------------------------------------------------------------------------
SO1B2_RAT/29-615--------------------------------------------------------------------------------
Q9VK84_DROME/36-684--------------------------------------------------------------------------------
Q9VVH9_DROME/175-754--------------------------------------------------------------------------------
Q9W269_DROME/112-731--------------------------------------------------------------------------------
Q9W270_DROME/95-661--------------------------------------------------------------------------------
Q9W271_DROME/67-626--------------------------------------------------------------------------------
Q9XWC5_CAEEL/49-620--------------------------------------------------------------------------------
R4GBU6_ANOCA/260-819--------------------------------------------------------------------------------
T1ER69_HELRO/33-610--------------------------------------------------------------------------------
T1G9I5_HELRO/71-663--------------------------------------------------------------------------------
T1HLF3_RHOPR/50-617--------------------------------------------------------------------------------
T1HLL5_RHOPR/20-673--------------------------------------------------------------------------------
T1HYS5_RHOPR/25-590--------------------------------------------------------------------------------
T1I8L4_RHOPR/19-568--------------------------------------------------------------------------------
T1IDL3_RHOPR/22-585--------------------------------------------------------------------------------
T1IV13_STRMM/34-600--------------------------------------------------------------------------------
T1J381_STRMM/107-721--------------------------------------------------------------------------------
T1J4Q6_STRMM/53-601--------------------------------------------------------------------------------
T1J9S9_STRMM/138-752--------------------------------------------------------------------------------
T1K555_TETUR/46-593--------------------------------------------------------------------------------
U1NEN2_ASCSU/27-606--------------------------------------------------------------------------------
U1NQ20_ASCSU/50-610--------------------------------------------------------------------------------
U3I6L4_ANAPL/103-660--------------------------------------------------------------------------------
U3I6Y8_ANAPL/7-588--------------------------------------------------------------------------------
U3K039_FICAL/40-624--------------------------------------------------------------------------------
U3K045_FICAL/38-630--------------------------------------------------------------------------------
U3KFS6_FICAL/31-593--------------------------------------------------------------------------------
V8NPM0_OPHHA/58-605--------------------------------------------------------------------------------
W4WD24_ATTCE/23-636--------------------------------------------------------------------------------
W4XLX7_STRPU/60-699--------------------------------------------------------------------------------
W4XQW5_STRPU/59-640--------------------------------------------------------------------------------
W4XVZ6_STRPU/91-689--------------------------------------------------------------------------------
W4Z5F6_STRPU/135-671--------------------------------------------------------------------------------
W4Z5F7_STRPU/78-634--------------------------------------------------------------------------------
W5J7I4_ANODA/56-623--------------------------------------------------------------------------------
W5JBI4_ANODA/130-794--------------------------------------------------------------------------------
W5JW33_ANODA/25-791--------------------------------------------------------------------------------
W5KDH2_ASTMX/31-629--------------------------------------------------------------------------------
W5KJ52_ASTMX/32-619--------------------------------------------------------------------------------
W5LQU9_ASTMX/27-591--------------------------------------------------------------------------------
W5MDQ5_LEPOC/17-593--------------------------------------------------------------------------------
W5MFK3_LEPOC/106-669--------------------------------------------------------------------------------
W5MRR1_LEPOC/26-603--------------------------------------------------------------------------------
W5MRT2_LEPOC/53-615--------------------------------------------------------------------------------
W5MY22_LEPOC/30-602--------------------------------------------------------------------------------
W5NE89_LEPOC/38-625--------------------------------------------------------------------------------
W5NE95_LEPOC/1-594--------------------------------------------------------------------------------
W5NE99_LEPOC/24-615--------------------------------------------------------------------------------
W5NEA9_LEPOC/1-598--------------------------------------------------------------------------------
W5PSU6_SHEEP/93-647--------------------------------------------------------------------------------
W5QAF5_SHEEP/107-670--------------------------------------------------------------------------------
W5QGQ1_SHEEP/21-597--------------------------------------------------------------------------------
X5LX59_CAEEL/46-677--------------------------------------------------------------------------------
X5M903_CAEEL/27-574--------------------------------------------------------------------------------

PF03209

P73827_SYNY3/40-466--------------------------------------------------------------------------------
PUCC_RHOS4/51-454--------------------------------------------------------------------------------
BCH2_RHOCB/28-417--------------------------------------------------------------------------------
D5AMI6_RHOCB/54-460--------------------------------------------------------------------------------
D5ANS1_RHOCB/51-456--------------------------------------------------------------------------------
G3XCS5_PROMA/1-413--------------------------------------------------------------------------------
I0HT76_RUBGI/55-465--------------------------------------------------------------------------------
Q3J171_RHOS4/51-459--------------------------------------------------------------------------------
Q3J183_RHOS4/28-414--------------------------------------------------------------------------------

PF05631

Q9N3A9_CAEEL/1-336-----------------------------------------------------------------------------MFV
Q9FWD6_ORYSJ/4-357-----------------------------------------------------------------------------FYY

PF12832

A7SQQ8_NEMVE/55-132--------------------------------------------------------------------------------
Q6FB61_ACIAD/6-82--------------------------------------------------------------------------------
B7P8Y1_IXOSC/9-85--------------------------------------------------------------------------------
Q17GA0_AEDAE/14-90--------------------------------------------------------------------------------
A7RI07_NEMVE/54-130--------------------------------------------------------------------------------
Q54SK7_DICDI/682-755--------------------------------------------------------------------------------
B2AA42_PODAN/619-697--------------------------------------------------------------------------------
A1WY15_HALHL/14-90--------------------------------------------------------------------------------
Q54G39_DICDI/12-88--------------------------------------------------------------------------------
B3PHF3_CELJU/15-91--------------------------------------------------------------------------------
Q07ZQ8_SHEFN/10-86--------------------------------------------------------------------------------
D3SB25_THISK/3-79--------------------------------------------------------------------------------
B0X8B9_CULQU/11-87--------------------------------------------------------------------------------
YJBC_SCHPO/418-493--------------------------------------------------------------------------------
Q16KC8_AEDAE/34-110--------------------------------------------------------------------------------
Q21IX9_SACD2/5-81--------------------------------------------------------------------------------
B4G7T5_DROPE/36-112--------------------------------------------------------------------------------
C3YMP2_BRAFL/14-90--------------------------------------------------------------------------------
A3QFN3_SHELP/24-100--------------------------------------------------------------------------------
Q55CH3_DICDI/11-87--------------------------------------------------------------------------------
B8GQD4_THISH/5-81--------------------------------------------------------------------------------
C5BL70_TERTT/2-78--------------------------------------------------------------------------------
A7UVG6_ANOGA/14-90--------------------------------------------------------------------------------
Q2SJE3_HAHCH/5-81--------------------------------------------------------------------------------
B7PL10_IXOSC/7-83--------------------------------------------------------------------------------
A8PWD3_MALGO/544-619--------------------------------------------------------------------------------
Q4PB45_USTMA/688-764--------------------------------------------------------------------------------
Q3J7E6_NITOC/9-84--------------------------------------------------------------------------------

PF01306

LACY_CITFR/1-412-----------------------------------------------------------------------------MYY
RAFB_ECOLX/4-415-----------------------------------------------------------------------------AST
A0A017JVR8_ECOLX/4-411-----------------------------------------------------------------------------NIP
LACY_KLEOX/6-416-----------------------------------------------------------------------------LAP

PF06609

Q8NII4_FUSAU/1-598MTATVHEKGVDLESQPDDRLRAQALATTADELPEGYYTSPRVIASFAGFSLNVCATYFVLQASASALPNILQDIGQSENQ
Q9C1B3_FUSSP/1-598MTVVVPEEGLDLESQPDDRMRAKALATSAAELPDGYYRSPRIVASFAAFSMNVVATYFVLQASASALPNILQDVGQSENS

PF06813

Q7XGH1_ORYSJ/34-288--------------------------------------------------------------------------------
Q9LUF8_ARATH/16-265--------------------------------------------------------------------------------
Q8H613_ORYSJ/14-261--------------------------------------------------------------------------------
Q94D97_ORYSJ/8-252--------------------------------------------------------------------------------
Q9M8M1_ARATH/13-260--------------------------------------------------------------------------------
Q9ZUV4_ARATH/17-262--------------------------------------------------------------------------------
O80960_ARATH/21-266--------------------------------------------------------------------------------
Q8H132_ARATH/7-253--------------------------------------------------------------------------------
Q9SLF1_ARATH/14-260--------------------------------------------------------------------------------
F4I9E1_ARATH/43-286--------------------------------------------------------------------------------
F4J4R8_ARATH/23-272--------------------------------------------------------------------------------
Q9S7R2_ARATH/16-263--------------------------------------------------------------------------------

PF13000

C4R336_PICPG/74-584----------------------------QFALL---------VMLYLI------------QG--VPI-------------
G0WCJ0_NAUDC/17-577----------------------------QFYLL---------VALYFV------------QG--IPV-------------
G8BYR1_TETPH/85-660----------------------------QFYLL---------VALYFI------------QG--IPI-------------
Q75EB1_ASHGO/51-585----------------------------QFYLL---------VALYFL------------QG--IPV-------------
E7K9I5_YEASA/17-559----------------------------QFYLL---------IMLYLA------------QG--IPV-------------
Q6CKM4_KLULA/10-515----------------------------QFYLL---------VVLYLL------------QG--IPV-------------
G0VIX6_NAUCC/41-595----------------------------QFFLL---------IALYFV------------QG--VPV-------------
H2AY09_KAZAF/18-574----------------------------QFYLL---------VILYFL------------QG--IPV-------------
I2H5Y9_TETBL/23-594----------------------------.FFLL---------VLLYFL------------QG--IPV-------------
G8JR10_ERECY/17-554----------------------------QFYLL---------VVLYFL------------QG--IPV-------------
S6E3L5_ZYGB2/13-555----------------------------QFYLL---------VVLYLL------------QG--IPV-------------
Q6FMM5_CANGA/15-566----------------------------QFYLL---------ICLYFL------------QG--IPV-------------
C5E2P0_LACTC/16-543----------------------------.FFLL---------VVLYFL------------QG--IPV-------------
B6ABL4_CRYMR/9-525----------------------------VIY.L---------ITLYTL------------QG--LPI-------------
G8ZXV2_TORDC/17-551----------------------------QFYLL---------VALYLL------------QG--IPV-------------
J7RSN7_KAZNA/20-561----------------------------QFYLL---------VALYFV------------QG--IPV-------------

PF07672

Q8EUQ6_MYCPE/191-477---------------------------KD.RPK---------FMTINQ------------FG--FNG-------------
Y077_MYCPN/209-467---------------------------NRKKSI---------LSNANF------------WG--FNV-------------
Q8EVP4_MYCPE/172-441---------------------------NK.KSK---------YIASNT------------FG--LNI-------------
Y076_MYCPN/210-484---------------------------QRRKSV---------LSNANL------------WG--FNS-------------
Q98PH4_MYCPU/154-430---------------------------AKTKGK---------ISIFTT------------WG--YPL-------------
Q7NAK7_MYCGA/200-455---------------------------MKTKTT---------LSVINS------------FG--FNI-------------

PF03825

YEGT_ECOLI/1-405-------------------------MKTTAKLS---------FMMFVE------------WF--IWG-------------
Q9A7U2_CAUCR/1-395-------------------------MGTSFRLF---------VMMVLQ------------LA--IWG-------------
XAPB_ECOLI/1-407-------------------------MSIAMRLK---------VMSFLQ------------YF--IWG-------------
NUPG_ECOLI/1-406-------------------------MNLKLQLK---------ILSFLQ------------FC--LWG-------------

PF00854

PTR7_ARATH/99-532---------------------------YLTIAI---------FAAIQA------------TG--VSI-------------
F7BBU0_ORNAN/81-472---------------------------FKTIIY---------LSIVYT------------IG--QAV-------------
PEPT3_CAEEL/82-453---------------------------FKVILY---------GSSIYV------------VG--HVL-------------
PEPT1_CAEEL/113-509---------------------------FWTIFS---------VSILYA------------IG--QVV-------------
PTR12_ARATH/99-524---------------------------FVIFLI---------SASIEF------------LG--LIL-------------
S15A1_RABIT/81-472---------------------------FKTIVW---------LSIVYT------------IG--QAV-------------
PTR30_ARATH/96-518---------------------------FWTFTA---------SSLIYV------------LG--MIL-------------
PTR2_ARATH/113-544---------------------------YWTIAC---------FSGIYF------------IG--MSA-------------
DTPA_ECOLI/88-460---------------------------KRVIML---------GAIVLA------------IG--YAL-------------
DTPD_ECOLI/76-458---------------------------RMAVML---------GALLMA------------IG--HVV-------------
YJDL_ECOLI/75-447---------------------------RTAVIA---------GALLMT------------LG--HVV-------------
PTR2_SCHPO/158-542---------------------------YNTIVC---------SAVIYF------------IG--ILI-------------
S15A2_HUMAN/111-487---------------------------FKTIIY---------LSLVYV------------LG--HVI-------------
PTR2_YEAST/155-533---------------------------YNTICC---------GTAIYI------------AG--IFI-------------
S15A1_RAT/81-474---------------------------FKTIVS---------LSIVYT------------IG--QAV-------------
PTR17_ARATH/124-550---------------------------YWTIAS---------FSAIYF------------IG--MAL-------------
S15A4_RAT/94-517---------------------------ARAILL---------SLALYL------------LG--MLA-------------
DTPT_LACLA/91-474---------------------------.RTIFL---------GGILIT------------LG--HIA-------------
PEPT2_CAEEL/99-494---------------------------FWTIFF---------ISIFYA------------CG--QIL-------------
DTPB_ECOLI/81-457---------------------------KRTIVL---------GALVLA------------IG--YFM-------------
YCLF_BACSU/95-469---------------------------ANTVFY---------GGIFIM------------FG--HIA-------------

PF06779

Q986E3_RHILO/34-394--------------------------------------------MAVA------------MG--IGR-------------
Q89HQ1_BRADU/48-412--------------------------------------------SLVG------------LG--LAR-------------
A9CI18_AGRT5/23-387--------------------------------------------MASA------------MG--FGR-------------
Q88ED9_PSEPK/14-373--------------------------------------------LMMA------------MG--IGR-------------
Q8Y185_RALSO/36-399--------------------------------------------LSVA------------MG--IGR-------------
Q9I3T2_PSEAE/20-380--------------------------------------------LVVA------------MG--VGR-------------
Q89X18_BRADU/63-426--------------------------------------------ATVG------------LG--IGR-------------
Q92UK2_RHIME/1-365--------------------------------------------MAVA------------MG--FGR-------------
YJIJ_ECOLI/23-381--------------------------------------------LTLG------------MG--LGR-------------
Q8ZJZ6_SALTY/23-379--------------------------------------------LTLG------------MG--VGR-------------
Q9PGN0_XYLFA/26-385--------------------------------------------LSLG------------IG--IGR-------------

PF01733

ENT1_ARATH/167-450------------------------------SAA---------V-ALSG------------L.GDALM-------------
S29A1_RAT/144-455------------------------------MIK---------I-VLIN------------S.FGAIL-------------
S29A2_HUMAN/131-454------------------------------MAS---------V-CFIN------------S.FSAVL-------------
S29A1_HUMAN/144-454------------------------------MIK---------I-VLIN------------S.FGAIL-------------
FUN26_YEAST/180-510------------------------------IMM---------L-VVIS------------SMGTAMT-------------
Q19495_CAEEL/137-426------------------------------LGM---------A-TSIN------------F.SNGLY-------------
Q21145_CAEEL/434-723------------------------------LGT---------I-VVLN------------A.ANGLF-------------

PF03239

FTH1_YEAST/8-404------------------------------SFQ---------I-FFIF------------L-RESLE-------------
EFEU_BACSU/9-395------------------------------LFS---------L-LMVF------------G-SAAHA-------------
Q9Y8Z4_AERPE/4-268------------------------------ALA---------T-GLVA------------F-REAFE-------------
Y964_SYNY3/6-291------------------------------GLP---------I-FIVT------------L-REALE-------------
FIP1_SCHPO/7-320------------------------------SVA---------I-FFIV------------L-RETLE-------------
EFEU_ECOLI/1-276------------------------------MFV---------P-FLIM------------L-REGLE-------------
O83937_TREPA/14-362------------------------------VYG---------M-GCTM------------V-APGMP-------------
Q9ZC51_YERPE/156-557------------------------------LLA---------Q-AISE------------Y-QDGKY-------------
Q9RKQ1_STRCO/1-274------------------------------MFS---------N-YLIG------------L-REGLE-------------
Q9ZDD8_RICPR/1-278------------------------------MFK---------I-ALVV------------F-RECLE-------------
FTR1_YEAST/7-321------------------------------NVA---------V-FFVV------------F-RECLE-------------
Y154_ARCFU/4-266------------------------------MMG---------Q-MVIT------------L-REGFE-------------
Q9WYP8_THEMA/2-266------------------------------HLG---------A-LLIT------------F-REALE-------------

PF01770

S19A1_HUMAN/23-434------------------------RSWRHLVCY---------L-CFYG------------FMAQIRP-------------
Q9EQN9_MOUSE/28-459------------------------ECWFLPTAL---------L-CAYG------------FFANLRP-------------
Q9VK64_DROME/2-395------------------------KSWLKISLL---------L-CTFG------------FFREFRP-------------
Q29L76_DROPS/2-397------------------------EYWLKISLL---------L-CTFG------------FLRELRP-------------
Q294A5_DROPS/2-414------------------------ESWLKISWV---------L-CIFG------------FLREIRP-------------
Q9VGV5_DROME/2-408------------------------KEWLKISCL---------L-CVFG------------CIREIRP-------------
Q16JT2_AEDAE/2-405------------------------EQWGKIAIV---------L-TLFG------------FLKDFRP-------------
S19A3_HUMAN/10-441------------------------SSWIYPTVI---------L-CLFG------------FFSMMRP-------------
Q1LV16_DANRE/4-414------------------------SDWVFPTVL---------L-SLYG------------FFANCRP-------------
Q9VGV6_DROME/2-411------------------------ESWLKISCL---------L-CIFG------------FLRELRP-------------
FOLT2_CAEEL/2-394------------------------EQW.KVMVL---------I-CMYG------------AVKEFRP-------------
Q28C92_XENTR/10-422------------------------SGWKYPTIL---------L-CLFG------------FFADMRA-------------
Q7Q5N2_ANOGA/2-422------------------------QPWLRVSLL---------L-CVFG------------FFRELRV-------------
A8BIM9_GIAIC/39-447------------------------GSFNALLFL---------Q-VLLG------------ILCAFKP-------------
A7SN54_NEMVE/6-420------------------------EFWQKATLL---------L-CLYG------------FFKEMKP-------------
S19A3_MOUSE/11-435------------------------NSWVYPTVI---------L-CLFG------------FFSMFRP-------------
F1N2M7_BOVIN/23-430------------------------QSWWCLVFF---------L-CFYG------------FMAQMRP-------------
F1NVD6_CHICK/32-445------------------------QRWKLQVFY---------L-CFYG------------FMTQIRP-------------
F7EDM0_XENTR/76-481------------------------.QWKFLLFY---------L-CIYG------------FMTQLRP-------------
H3CDB6_TETNG/12-433------------------------ENWKYPTFI---------L-CIYG------------FFSTVRP-------------
S19A1_MOUSE/23-426------------------------KSWRCLVFY---------L-CFFG------------FMAQLRP-------------

PF03219

TLC2_ARATH/88-571-----------------------------FDEG---------D-TAAM------------AV--SPK-------------
TLC1_CHLTR/2-492-----------------------------TQTA---------E-KPFG------------KL--RSF-------------
Q6MEN4_PARUW/1-484-----------------------------MSQQ---------E-SEFG------------KL--RAF-------------
Q6MBI2_PARUW/1-474-----------------------------MKNQ---------Q-NSVS------------S.--...-------------
Q6MEN5_PARUW/4-499-----------------------------TPTG---------S-REFS------------PW--RSN-------------
Q6MEM5_PARUW/2-491-----------------------------SQDA---------K-QDFG------------KW--RAF-------------
A5CCG3_ORITB/1-504-----------------------------MQKT---------N-I.LK------------KF--TKA-------------
Q1MSG2_LAWIP/9-504-----------------------------GSMP---------E-EDFT------------GW--RAI-------------
C4YY86_9RICK/5-489-----------------------------..KS---------D-NYLS------------EL--RKV-------------
C4YYY2_9RICK/12-501-----------------------------...N---------K-ARNS------------KF--RHI-------------
C4YZB1_9RICK/5-496-----------------------------....---------K-IFFE------------KV--KEI-------------
F8KVN2_PARAV/3-490-----------------------------.NES---------K-PEFG------------PL--RSF-------------
TLCE_RICPR/7-496-----------------------------...S---------R-SFKN------------KF--RAA-------------
TLC2_CHLTR/2-500-----------------------------.SSE---------V-KSFS------------KF--RGY-------------
TLCD_RICPR/14-503-----------------------------..KI---------N-SHFS------------KL--TDY-------------

PF06963

S40A2_ARATH/31-479-----------------------------RSMV---------I-SLYL------------GY--FLA-------------
S40A1_ORYSJ/21-450-----------------------------AALL---------R-RLYV------------GH--FLA-------------
S40A1_ARATH/35-483-----------------------------RRFV---------I-YLYV------------GY--FLA-------------
A2R421_ASPNC/42-466-----------------------------TRIL---------F-RLYI------------SH--FLS-------------
Q5AXY5_EMENI/19-441-----------------------------NRVL---------L-RLYT------------SH--FLS-------------
Q8IA95_CAEEL/5-448-----------------------------SGKE---------L-QLNS------------AF--LLT-------------
S40A3_ARATH/146-569-----------------------------PEGL---------Y-VLYA------------SC--LVG-------------
Q0CWF0_ASPTN/44-463-----------------------------KHVL---------F-RLYV------------SH--TLS-------------
Q4PD48_USTMA/82-563-----------------------------ARGT---------L-LLAV------------QH--ATL-------------
S40A1_HUMAN/22-531-----------------------------TSAK---------F-LLYL------------GH--SLS-------------
S40A1_DANRE/19-522-----------------------------KSAK---------F-LIYV------------GH--ALS-------------
A8X2J9_CAEBR/13-461-----------------------------SKAS---------I-FLYC------------AY--IST-------------
A5BT51_VITVI/32-472-----------------------------SSLI---------I-YLYV------------GH--FLA-------------
A1CBM9_ASPCL/39-469-----------------------------KHVL---------A-RLYV------------SH--FLS-------------
S40A3_ORYSJ/147-569-----------------------------..AM---------N-ALYA------------AC--LAG-------------
H3DM67_TETNG/10-523-----------------------------..PK---------F-LIYV------------SG--ALS-------------

PF13347

D2VB35_NAEGR/31-486-----------------------------AILP.........T-FLTS------------IL..DVY-------------
B8B7S1_ORYSI/22-442-----------------------------PILS.........Y-GSGH------------ML..NDI-------------
Q8I3H5_PLAF7/62-507-----------------------------EKIRKLKLCTILSF-SCPM------------IG..VGG-------------
C5BVC3_BEUC1/22-453-----------------------------EKVL.........I-AMPL------------PA..AMM-------------
A0A031WJE7_PEPDI/25-461-----------------------------KRAI.........Y-TYSS------------SI...NL-------------
B3W8U5_LACCB/11-452-----------------------------DRQTL........F-GINT------------MGLMSTT-------------
C3Z8Z9_BRAFL/15-394-----------------------------AKLC.........Y-GIGG------------AG..IEI-------------
B5X2T0_SALSA/38-502-----------------------------RKIS.........Y-AVGG------------MP..YQM-------------
NLS1_XENTR/37-494-----------------------------SKIC.........F-AIGG------------AP..YQI-------------
D0KIC2_PECWW/9-445-----------------------------HTFC.........Y-GSAN------------LL..GSG-------------
B1S9F4_9BIFI/14-474-----------------------------SAIG.........Y-GMGD------------LY..GGG-------------
A4AJK9_9ACTN/13-439-----------------------------TIAT.........Y-AIGS------------LG..TGG-------------
E8WA27_STRFA/18-443-----------------------------VRIG.........Y-GLGS------------LC..TGT-------------
A1SNV8_NOCSJ/11-434-----------------------------VRVG.........Y-GSGS------------VA..TGA-------------
A3V2V1_9RHOB/6-408-----------------------------DRLPA........F-SLFA------------AV..LSG-------------
Q28K27_JANSC/7-401-----------------------------SLPG.........Y-AVFA------------AM..LAS-------------
B9KP25_RHOSK/4-400-----------------------------RLLP.........W-SLLA------------GL..IAA-------------
B6AV21_9RHOB/12-414-----------------------------SALGG........Y-AVFA------------AL..LSA-------------
A6E455_9RHOB/14-411-----------------------------PRLPG........Y-ALFG------------AL..LAA-------------
A8TM36_9PROT/10-426-----------------------------VLMA.........Y-GIPG------------LP..AAA-------------
A7HQL5_PARL1/9-433-----------------------------SIYM.........H-GSIG------------LP..IAM-------------
Q026U3_SOLUE/21-465-----------------------------VKIM.........Y-GVGE------------IA..NAV-------------
Q0AL93_MARMM/17-465-----------------------------TKLL.........Y-GVGS------------MA..YGV-------------
Q2G9N1_NOVAD/12-450-----------------------------LALF.........N-GLGS------------VA..YGI-------------
Q2N8H6_ERYLH/12-453-----------------------------IKLI.........N-GSGA------------VA..FGV-------------
C0D597_9CLOT/17-465-----------------------------WQIGF........F-SLNN------------CA..TNI-------------
A6NPU4_9FIRM/28-469-----------------------------MLLG.........Y-FIGP------------FG..ALL-------------
C6LHW9_9FIRM/41-483-----------------------------MWLG.........Y-FAGP------------CL.LYMV-------------
Q5YU93_NOCFA/38-478-----------------------------AWLG.........Y-LLGP------------SG..ALL-------------
Q0F3N0_9PROT/19-595-----------------------------QKLA.........W-GVGG------------FG..ENI-------------
D4LG93_9FIRM/21-452-----------------------------LKYF.........F-GVGD------------AG..FVL-------------
A6TPY1_ALKMQ/9-433-----------------------------IINA.........Y-GFGE------------LG..FII-------------
A6TPY6_ALKMQ/10-436-----------------------------VVYG.........Y-GVPD------------LT..CNL-------------
C5EQ37_9FIRM/10-441-----------------------------EILG.........Y-TVGS------------IG..DST-------------
B7GTV4_BIFLS/22-444-----------------------------EYVA.........Y-FCYG------------FG..QCF-------------
B0NCA5_CLOSV/62-493-----------------------------NKVG.........Y-GSGD------------IA..GNV-------------
D4L2L1_9FIRM/9-431-----------------------------EKIS.........Y-GLYF------------MG..QNV-------------
C9BIA1_ENTFC/23-456-----------------------------DKLG.........Y-MFGD------------LG..NCF-------------
C3W9X3_FUSMR/14-452-----------------------------DKIG.........Y-LFGD------------FG..NDV-------------
D1PII8_9FIRM/14-445-----------------------------DKVG.........Y-LFGD------------FG..NDF-------------
C0BCF9_9FIRM/22-465-----------------------------EKFA.........Y-GIGA------------VG..KDM-------------
C4Z9B4_EUBR3/7-441-----------------------------QKCA.........F-GFGA------------FG..KDI-------------
C9QHC7_VIBOR/7-438-----------------------------TKLS.........Y-GFGA------------FG..KDF-------------
B0NX91_9CLOT/12-438-----------------------------VKYT.........F-AFGA------------LG..KDL-------------
C3WEF2_FUSMR/7-437-----------------------------EKYS.........F-GIGA------------FG..KDI-------------
C0BFD6_9FIRM/20-452-----------------------------EKLC.........F-GIGA------------IG..KDA-------------
C3WB69_FUSMR/6-433-----------------------------MKLS.........Y-GIGA------------LG..KDY-------------
M2C6H5_TREDN/4-434-----------------------------NRWT.........F-GLGT------------IG..RDM-------------
C7XWC4_9LACO/6-449-----------------------------NIIC.........Y-GLGA------------FG..HDS-------------
B2GBT3_LACF3/22-466-----------------------------ERIS.........F-CFGN------------LG..HSA-------------
E7FT79_9LACO/16-461-----------------------------SKFA.........F-AMGN------------MG..HAA-------------
D0DS55_LACFE/13-457-----------------------------SRIA.........Y-SFGA------------FG..HDM-------------
C0WMV6_LACBU/20-464-----------------------------SRLS.........Y-SFGA------------FG..HDM-------------
Q6SCS3_STRTR/10-454-----------------------------SRLS.........Y-AAGA------------FG..NDV-------------
B1SH60_9STRE/18-462-----------------------------SRIS.........Y-AFGA------------FG..HDI-------------
C5RC37_WEIPA/6-451-----------------------------QYLS.........Y-AAGA------------FG..HDA-------------
C8P5V7_9LACO/3-447-----------------------------KYFA.........Y-ALGT------------FG..HDA-------------
Q03PA7_LACBA/4-451-----------------------------QYLS.........Y-AAGA------------LG..HDA-------------
A8RLH8_CLOBW/23-450-----------------------------KRMY.........Y-ALGD------------FG..YNF-------------
B0NC69_CLOSV/24-452-----------------------------RKLA.........F-GSGE------------IV..HNV-------------
R7CNT8_9FIRM/14-438-----------------------------SKIA.........Y-GFGD------------VG..CNF-------------
B1BWZ1_CLOPF/8-434-----------------------------DKIG.........Y-TLGD------------LG..CCC-------------
A9MYD9_SALPB/15-438-----------------------------EKLA.........Y-GAGD------------IG..SNL-------------
A9QSF4_LACLK/37-463-----------------------------QQLL.........Y-GFGD------------FG..NGF-------------
C6PWS4_9CLOT/17-439-----------------------------EKIS.........Y-GFGD------------FG..NGF-------------
F0K7R1_CLOAE/8-431-----------------------------EKIS.........Y-GLGD------------FG..NGF-------------
D4F9L7_EDWTA/9-430-----------------------------AVIG.........Y-GCGD------------MA..NNF-------------
D4BGD4_9ENTR/26-444-----------------------------SLAS.........Y-VLGG------------IG..DNV-------------
A4WD81_ENT38/20-469-----------------------------ERIG.........Y-GMGD------------FA..QNL-------------
C8P9N3_9LACO/19-468-----------------------------ERIC.........Y-GAGD------------LA..QNL-------------
D1BWG8_XYLCX/30-459-----------------------------QRIG.........F-GSGD------------LA..QNL-------------
C8P9N0_9LACO/19-447-----------------------------QKFG.........W-ATGD------------FA..QNL-------------
J4NZS7_OENOE/11-431-----------------------------ERIS.........Y-GLSD------------AA..DNL-------------
A6DPD4_9BACT/8-427-----------------------------NIFA.........Y-SLGD------------LG..MNL-------------
B1ZS00_OPITP/13-436-----------------------------EKIG.........F-GAGD------------AA..VNV-------------
B3HTC5_ECOLX/7-428-----------------------------EKIG.........F-GAGD------------MA..IAI-------------
D2TGV7_CITRI/11-433-----------------------------DKIG.........Y-GLGD------------MA..SAL-------------
L0W055_SERPL/8-433-----------------------------EKIG.........Y-GLGD------------GA..SNI-------------
D0KF27_PECWW/10-433-----------------------------EKIG.........Y-GLGD------------TA..CNL-------------
D3RGD6_KLEVT/10-434-----------------------------EKFS.........Y-GLGD------------TG..CNL-------------
C1MDP3_9ENTR/24-449-----------------------------EKIG.........Y-GLGD------------AG..GTV-------------
A0A025G5J5_ECO57/10-432-----------------------------EKIG.........Y-GMGD------------AA..SHI-------------
D2ZB78_9ENTR/9-430-----------------------------EKIS.........Y-GLGD------------MA..SHI-------------
E6WJ95_PANSA/9-430-----------------------------EKIS.........Y-GLGD------------MA..SHI-------------
D4GIM8_PANAM/27-451-----------------------------EKAG.........F-GAGD------------AA..CNM-------------
C9XVR9_CROTZ/33-456-----------------------------EKIG.........Y-GMGD------------AG..CNI-------------
A0A023UW17_SERPL/19-442-----------------------------EKVG.........Y-GMGD------------AG..SCM-------------
A6G4R1_9DELT/26-447-----------------------------EKLG.........Y-GFGD------------LG..FNL-------------
A4AAW4_9GAMM/14-442-----------------------------EKVG.........Y-GLGD------------MA..SNF-------------
A6DP62_9BACT/9-590-----------------------------EKFG.........Y-GLGD------------LA..SNL-------------

PF11700

A7K364_VIBSE/8-434-------------------------LTNKELMS---------Y-FGYG------------.V--GQC-------------
Q8DIR0_THEEB/14-463-------------------------GAPPSLSL---------W-TKLA------------FG--AGD-------------
Q4JAW8_SULAC/5-379-------------------------IRKDNLIS---------Y-FLLL------------FV--NSA-------------
A0A059FXI1_9RHOB/25-469-------------------------KLDRSAWS---------W-ATYQ------------AG--RDP-------------
A0A059FSZ2_9RHOB/23-495-------------------------ALGKTGFA---------W-AWFE------------AA--RNP-------------
Q0U0L9_PHANO/44-456-------------------------ATKRALIA---------W-LVLC------------FS--TGP-------------
A1CD46_ASPCL/43-518-------------------------NSKRALWG---------Y-LVLC------------FS--TGP-------------
ATG22_CANAL/39-496-------------------------NKKSIFHT---------W-LLLC------------YS--TGP-------------
A3LP71_PICST/32-502-------------------------AKKSIYRA---------W-LLLC------------YS--TGP-------------
Q75EJ9_ASHGO/58-558-------------------------RGRWVFPA---------W-LLVC------------FS--TGP-------------
Q6CKN0_KLULA/64-544-------------------------DTRKTYLV---------W-LLIC------------FS--TGP-------------
A7EQB6_SCLS1/56-534-------------------------ATRKELWS---------Y-YAYY------------AG--NNG-------------
A5DD56_PICGU/47-524-------------------------TTKWEVLM---------Y-ALYY------------FG--NNA-------------
Q4PA89_USTMA/59-561-------------------------TGRYELWS---------F-YIYY------------IG--NCG-------------
F5HBL2_CRYNB/49-483-------------------------TTRKEVWS---------W-YIYY------------VG--NSG-------------
Q0TYS2_PHANO/43-505-------------------------TTRKEIWS---------Y-YSYY------------VG--DNG-------------
Q0CF56_ASPTN/43-493-------------------------ATKWEIWA---------Y-YSF.------------..--...-------------
Q5B0Q4_EMENI/43-494-------------------------TARLEIWA---------Y-YAYY------------IG--NNG-------------
Q0CXZ2_ASPTN/50-478-------------------------TTKWEIWA---------Y-..YA------------WV--NNH-------------
A1DH52_NEOFI/48-512-------------------------TTKWEIWA---------Y-YAYY------------IG--NNG-------------
ATG22_SCHPO/13-525-------------------------TTVWHVLS---------W-ILYA------------VG--AGP-------------
A9WGR7_CHLAA/9-439-------------------------DNRREQVG---------W-YFYD------------WA--NSA-------------
A4X7E0_SALTO/18-457-------------------------SSRRERTG---------W-YVYD------------WA--NSA-------------
A6E856_9SPHI/5-431-------------------------NDKKVIRS---------W-AFFD------------WA--NSA-------------
Q26DY7_FLABB/8-443-------------------------GHKKLLHA---------W-AFYD------------WA--NSV-------------
A6H0A9_FLAPJ/7-445-------------------------GDKKLLNA---------W-AFYD------------WA--NSV-------------
ATG22_CRYNJ/1-531-------------------------MPPPHVRA---------W-YSYA------------FA--AEV-------------
AT222_PHANO/72-634-------------------------TSNKELSG---------F-YMYG------------WA--AEV-------------
ATG22_COCIM/35-567-------------------------TSKKELAG---------W-YSYG------------WA--AEV-------------
AT221_PENCW/20-562-------------------------TSKRELAG---------W-YCYG------------WA--AEV-------------
AT221_ASPFU/24-580-------------------------TSKKELAG---------W-YSYG------------WA--AEV-------------
AT222_ASPCL/24-579-------------------------TSKKELAG---------W-YSYG------------WA--AEV-------------
AT221_ASPNC/30-582-------------------------TSKKELAG---------W-YSYG------------WA--AEV-------------
AT221_ASPOR/20-571-------------------------TSRKELAG---------W-YSYS------------WA--AEV-------------
AT221_EMENI/24-564-------------------------TNKKELLG---------W-YSYG------------WA--AEV-------------
AT222_ASPTN/24-571-------------------------TSKKELVG---------W-YSYG------------WA--AEV-------------
AT222_SCLS1/72-619-------------------------TSRKELSG---------W-YAYG------------FA--AEV-------------
L7I128_MAGOY/99-626-------------------------TSEKELAG---------W-YMYS------------FA--AET-------------
ATG22_NEUCR/155-689-------------------------TSQKELAG---------W-YAYA------------FA--AEV-------------
AT221_BOTFB/21-562-------------------------TTDRELRG---------F-FCYG------------LA--AEV-------------
AT222_PENCW/33-580-------------------------TSRREILG---------W-YSYG------------IA--AEV-------------
AT222_ASPOR/30-578-------------------------TSKREIWG---------W-YAYG------------IA--AEV-------------
AT222_EMENI/31-576-------------------------TGRREIWG---------W-YAYG------------VA--AEV-------------
ATG22_YARLI/6-582-------------------------TTQKELYG---------W-YAYA------------WA--AEP-------------
ATG22_PICAN/27-551-------------------------TTGAEVFG---------W-CLYS------------WA--AEP-------------
M9N7N8_ASHG1/19-490-------------------------ATNRNVFG---------W-YLYA------------FS--SEP-------------
N1P7Z2_YEASC/20-514-------------------------KAQNNIKG---------W-YAYS------------FS--SEP-------------
ATG22_CANGA/31-527-------------------------AARDNIKG---------W-YLYS------------FS--SEP-------------
ATG22_KLULA/17-487-------------------------QAKRNIKG---------W-YFYC------------FS--SEP-------------
ATG22_VANPO/27-511-------------------------RTKQNIVG---------W-YFYS------------FS--SEP-------------

PF03092

Q25272_LEIDO/59-606-------------------------KGLANGLM---------R-LSMQ------------P-------------------
B3GVG0_TRYBB/138-667-------------------------KGIAHDMI---------R-TTLF------------P-------------------
Q9UAB8_LEIDO/94-683-------------------------KGIADQLI---------S-YSRQ------------P-------------------
Q9UAB7_LEIDO/75-654-------------------------RGVADRIL---------T-GQTY------------A-------------------
Q9UAC0_LEIDO/76-655-------------------------KGVADQIL---------Y-GQTY------------A-------------------
Q9UAC1_LEIDO/75-651-------------------------RGVADRIL---------T-GQTY------------A-------------------
FBT8_ARATH/98-515-------------------------QGS.RCFP---------W-LALN------------F-------------------
FBT7_ARATH/30-441-------------------------QGF.RGFP---------W-LGAN------------F-------------------
FBT3_ARATH/61-473-------------------------QGLGKGLS---------K-VSTQ------------Y-------------------
FBT1_ARATH/137-553-------------------------QGV.LGLA---------R-LAVS------------F-------------------
F7USN5_SYNYG/46-457-------------------------QGV.LGLS---------R-LAVS------------F-------------------
O68867_SYNE7/38-441-------------------------QGI.LGLS---------R-LAVS------------F-------------------

PF00083

GTR4_MOUSE/27-483-------------------------AVFSAVLG---------S.LQFG------------YN--IGV-------------
GTR1_MOUSE/14-467-------------------------LAVGGAVL---------GSLQFG------------YN--TGV-------------
QUTD_EMENI/24-490-------------------------LAAVASFT---------S.CMIG------------YD--SAF-------------
ITR2_YEAST/112-569-------------------------LTFVASIS---------G.FMFG------------YD--TGY-------------
SNF3_YEAST/100-556-------------------------VGVFVAVG---------G.FLFG------------YD--TGL-------------
GALP_ECOLI/18-451-------------------------VCFLAALA---------G.LLFG------------LD--IGV-------------
HXT5_YEAST/89-549-------------------------CCLMVAFG---------G.FVFG------------WD--TGT-------------
GTR3_MOUSE/13-465-------------------------AVTVATIG---------S.FQFG------------YN--TGV-------------
HXT9_YEAST/64-526-------------------------LCLMIAFG---------G.FIFG------------WD--TGT-------------
HXT8_YEAST/69-530-------------------------MCLCMAFG---------G.FMSG------------WD--TGT-------------
HXT6_YEAST/68-528-------------------------MCIMIAFG---------G.FVFG------------WD--TGT-------------
GTR3_CHICK/14-464-------------------------AVSVAAIG---------S.LQFG------------YN--TGV-------------
GTR5_HUMAN/20-475-------------------------ATLIAAFG---------SSFQYG------------YN--VAA-------------
HXT13_YEAST/60-521-------------------------LCYPISFG---------G.FLPG------------WD--SGI-------------
YB91_YEAST/27-485-------------------------GTIVACLG---------S.IQYG------------YH--IAE-------------
PROP_ECOLI/25-453-------------------------KAITAASL---------GNAMEW------------FD--FGV-------------
JEN1_YEAST/125-563-------------------------VNPIPELR---------KMTWQN------------WN--YFF-------------
GIT1_YEAST/43-466-------------------------KNIVTIIA---------SGFALI------------SD--GYV-------------
GTR2_MOUSE/13-498-------------------------TVFTAVLS---------S.FQFG------------YD--IGV-------------
HXT2_YEAST/59-519-------------------------LCLMIAFG---------G.FVFG------------WD--TGT-------------
XYLE_ECOLI/13-478-------------------------ITLVATLG---------G.LLFG------------YD--TAV-------------
LACP_KLULA/75-529-------------------------LCFITYLC---------A.TMQG------------YD--GAL-------------
STP1_ARATH/26-489-------------------------TCVVAAMG---------G.LIFG------------YD--IGI-------------
MAL31_YEAST/102-561-------------------------WSLLVSTT---------L.IQEG------------YD--TAI-------------
QAY_NEUCR/24-494-------------------------CAAIASFA---------S.CMIG------------YD--SAF-------------
GLF_ZYMMO/13-469-------------------------LALIAAIG---------G.LLFG------------YD--SAV-------------
STL1_YEAST/30-488-------------------------FITIASMT---------GFSLFG------------YD--QGL-------------
ARAE_ECOLI/25-461-------------------------VSVAAAVA---------G.LLFG------------LD--IGV-------------
GAL2_YEAST/74-534-------------------------LCLCVAFG---------G.FMFG------------WD--TGT-------------
A4I0Q6_LEIIN/5-442-------------------------VMLCAALG---------G.FLFG------------YD--TGV-------------
A4I8N6_LEIIN/77-573-------------------------VATPIILT---------P.LLYG------------YN--LGF-------------
Q38AB8_TRYB2/39-501-------------------------VAQVQVVG---------G.TLNG------------FS--IGF-------------
Q38AB9_TRYB2/39-500-------------------------VAQVQVVG---------G.TLNG------------YV--IGY-------------

PF05977

Q92LE2_RHIME/11-531--------------------STALAPLRNGVFR---------S-IWTA------------SQ--ISS-------------
Q98HB4_RHILO/11-532--------------------VSALAPFRHGIFR---------A-VWSA------------SL--VSN-------------
Q92Y88_RHIME/8-530--------------------TSGFAPLRQKVFA---------V-LWIA------------TI--VGN-------------
A9CFW7_AGRT5/8-530--------------------ASSFAPLAQPVFA---------V-LWAA------------TV--LGN-------------
Q9HYE1_PSEAE/25-549--------------------TGTWAPFSIQAFR---------I-IWIC------------NL--FAN-------------
Q989L4_RHILO/31-551--------------------SATFPPLENSTFR---------P-IWIA------------TQ--VSS-------------
Q92SW7_RHIME/14-535--------------------ISPLAPFRHDIFR---------T-IWIA------------SL--ASN-------------
Q989T8_RHILO/11-532--------------------PAAFAPLRNSTFR---------S-IWLA------------IQ--VAN-------------
Q9I0E1_PSEAE/6-529--------------------ASPWSPLRQTTFR---------W-LWLA------------SI--ASN-------------

PF07690

O17785_CAEEL/33-439-----------------------------VICT---------L-CLSI------------AQ--SDT.............
A0A038FBG6_MYCTX/18-356-----------------------------SLGV---------T-ASSF------------LF--ING.............
ANTR2_ARATH/137-500-----------------------------LCFS---------S-FLLC------------NM--DRV.............
Q19296_CAEEL/16-403-----------------------------LIPA---------L-ICNM------------LA--FTS.............
A9CFQ9_AGRT5/27-373-----------------------------AVGT---------Q-TAGS------------FV--SQG.............
A0A028WC33_STAAU/10-348-----------------------------LVIG---------M-ALNI------------TG--SSF.............
I0ZIS1_HELPX/8-347-----------------------------LALV---------S-SLRF------------LG--LFI.............
C3MP39_SULIL/20-385-----------------------------LMFA---------S-LAIG------------YF--MWG.............
D7GFS1_PROFC/22-419-----------------------------LVVG---------G-ITAI------------MD--TTI.............
O66589_AQUAE/21-406-----------------------------ASFI---------Y-FDHS------------FS--IWL.............
A0A022P0M0_PSEAI/19-362-----------------------------VAIM---------L-GPTG------------IL--LNT.............
MFSD9_HUMAN/49-427-----------------------------LYLV---------G-FLDL------------FG--VSM.............
Q97CG2_THEVO/16-347-----------------------------VAVI---------E-VLRM------------FG--IFL.............
F2HKW9_LACLV/24-427-----------------------------LLVA---------I-FAFQ------------LN--ASM.............
F6BV17_SINMB/23-360-----------------------------VSFC---------H-MLND------------IM--QSL.............
D1EUE3_BRUML/8-339-----------------------------AAIA---------T-ISAV------------GA--AIG.............
N0C478_SALTI/17-369-----------------------------LLIL---------G-FASG------------LP--LAL.............
I0LFL8_CORGK/19-414-----------------------------SVLT---------F-WLFA------------QS--TLN.............
Q9YG70_AERPE/18-417-----------------------------LALT---------A-FLVM------------YV--EAV.............
Q9HLN0_THEAC/12-329-----------------------------VMSM---------N-SLYQ------------YS--WNV.............
M4UM27_RALSL/30-433-----------------------------ALAI---------H-LCIG------------MA--YGF.............
A7WY21_STAA1/33-313-----------------------------IFIG---------Y-AGYY------------LL--RKN.............
D6EGQ9_STRLI/61-422-----------------------------PWIG---------M-MGIS------------SA--EYA.............
Q8NNT7_CORGL/10-351-----------------------------VLVA---------V-AAAF------------GS--WSL.............
M4MIX3_SINM2/13-355-----------------------------AGGL---------L-GCIA------------IG--AMF.............
I6V0W9_9EURY/13-389-----------------------------LGFG---------F-FGIS------------II--WSL.............
O58400_PYRHO/34-380-----------------------------FAIG---------M-FFAN------------LA--WGI.............
A1EPJ6_VIBCL/16-353-----------------------------LAFG---------S-FLVF------------CN--LYL.............
Q9KWU2_SPHSX/13-348-----------------------------MSLM---------A-HVTM------------SG--GRV.............
A0A008NSL7_STAAU/18-353-----------------------------MLII---------L-FLME------------FA--RGM.............
C8K874_LISMN/13-349-----------------------------ITLI---------N-FVVY------------LV--YYL.............
NART_STACT/13-344-----------------------------QTLS---------L-VAGF------------MV--WSI.............
Q9K646_BACHD/13-358-----------------------------LWIA---------Q-SVSA------------LG--GTF.............
YLZ2_SCHPO/48-434-----------------------------ISSM---------T-FLNQ------------YG--DSV.............
E8VD81_BACST/15-348-----------------------------VLLV---------N-LFVF------------VF--FYT.............
Q1K517_NEUCR/132-490-----------------------------MCLI---------S-LSNG------------MS--DSA.............
O54179_STRCO/33-428-----------------------------LLVA---------Q-FMLA------------VD--FSI.............
Q98B83_RHILO/60-407-----------------------------GLLL---------F-FCAG------------FA--DGA.............
A0A017M9G1_ECOLX/39-413-----------------------------FLFV---------L-FIFS------------FL--DRI.............
Q9EYN6_SYNPW/18-450-----------------------------TWFA---------F-FLTF------------VV--WFN.............
Q9KBG2_BACHD/16-398-----------------------------VMCT---------L-ALSA------------MS--VLI.............
Q986N1_RHILO/24-356-----------------------------LLTG---------C-IAVI------------GS--NSL............V
Q93LX8_9ACTO/30-425-----------------------------LAAN---------M-LIDA------------LE--VSV.............
Q8KDQ3_CHLTE/9-374-----------------------------LFLT---------V-LLDL------------IG--FGI.............
Q9PCL3_XYLFA/32-422-----------------------------VLLG---------F-FVIT------------LD--AVV.............
Q9URI1_CANAX/123-512-----------------------------ISFL---------T-TSVY------------MG--SAV.............
A0A016X6J9_VIBCL/22-366-----------------------------LGAL---------G-ALTP------------LA--IDM.............
M4MHF4_SINM2/19-357-----------------------------VVGA---------G-VVSA------------FQ--VGK.............
Q9RSF5_DEIRA/46-397-----------------------------LFLT---------I-FIAM------------LG--LSV.............
LIZ1_SCHPO/36-407-----------------------------CCVS---------Y-FINY------------LD--RSS.............
F0K3Z3_CLOAE/13-357-----------------------------YLIG---------I-FISG------------IG--TKL.............
A0A030S566_PSEAI/29-430-----------------------------GLLG---------V-LLAS------------LT--AGLN...........G
A0A024SUQ9_PSEAI/12-346-----------------------------LFLC---------G-CAAF------------LN--LYT.............
Q9KYI2_STRCO/15-371-----------------------------IFSS---------V-FIDT------------FG--WGL.............
Q973W8_SULTO/12-335-----------------------------ISFS---------A-FFAD------------LG--YQA.............
Q18472_CAEEL/18-397-----------------------------GFLC---------L-ASVC------------SN--YII.............
Q8ZXX0_PYRAE/10-352-----------------------------ILIA---------R-IGSG------------AS--AFL.............
Q9AA55_CAUCR/30-391-----------------------------LFGV---------S-VATA------------LG--NTG.............
YN42_SCHPO/141-527-----------------------------LAYV---------A-LCSS------------FA--SSV.............
A0A008B8F0_STAAU/16-376-----------------------------FFFI---------G-VIAY------------MD--RAN.............
Q961H2_DROME/54-453-----------------------------LEPA---------V-FLIF------------FA--RNL.............
C3SM02_ECOLX/36-398-----------------------------IWLG---------Y-ALFY------------FT--RKS.............
Q8KCE7_CHLTE/27-390-----------------------------FLFA---------S-FFSI------------GM--VTF.............
P95852_SULSF/9-333-----------------------------FTIL---------V-FFTG------------LY--LGT.............
O45678_CAEEL/27-403-----------------------------TMFS---------G-TCVL------------YA--SRA.............
A0A030YLG4_PSEAI/21-369-----------------------------ATFA---------Q-ACAC------------FF--VQG.............
O30222_ARCFU/15-357-----------------------------GAML---------A-FTVR------------WL--HYL.............
B0R8P5_HALS3/24-368-----------------------------LVFA---------T-GLTI------------GS--ERT.............
Q8TR38_METAC/18-398-----------------------------LYTI---------T-FIGT------------LG--FGI.............
Q986D7_RHILO/41-396-----------------------------VAAN---------A-SFSA------------TF--SGI.............
O69759_PSEFL/31-392-----------------------------VTFC---------Y-LFYY------------TG--RQT.............
Q9HLR9_THEAC/6-377-----------------------------WFAS---------Y-LMSS------------MA--SGI.............
H6NYS0_SALTI/13-352-----------------------------AHVC---------I-NFVL------------GG--VYA.............
O28944_ARCFU/4-328-----------------------------LILS---------G-FFAY------------AS--LSC.............
A1EJD6_VIBCL/40-383-----------------------------VLIG---------T-LFAR------------TS--FFM.............
Q96XQ4_SULTO/9-336-----------------------------VFIS---------S-LSFF------------LS--YFSR...........I
A0A023BKQ7_LISMN/13-376-----------------------------RLFG---------E-ALLD------------IS--FWM.............
O62376_CAEEL/16-394-----------------------------TFVS---------Y-GLYH------------AS--RKAL..........SG
YCUD_SCHPO/89-473-----------------------------LFVA---------T-VYTF------------LE--VYV.............
A0A038KTQ1_MYCTX/25-423-----------------------------LAGG---------V-ALYA------------TN--EFL.............
Q9KG75_BACHD/5-341-----------------------------IYII---------L-VVAF------------ID--TFI.............
Q7JZE2_DROME/46-458-----------------------------AFLA---------T-CLHA------------AM--RNM.............
A0A016X795_VIBCL/36-395-----------------------------LIFG---------Y-AMFY------------VV--RMA.............
B0RRS7_XANCB/26-418-----------------------------LACA---------I-FMEQ------------MD--ATV.............
H1XFL1_9XANT/19-356-----------------------------MAAA---------T-GLAV------------AS--NYY.............
YQ92_SCHPO/20-407-----------------------------IAIA---------L-FTDL------------FL--YGI.............
O16697_CAEEL/36-432-----------------------------CIFL---------Q-FIVG------------VQ--ISV.............
A0A029SIS1_STRPY/10-353-----------------------------AWLG---------N-FFTG------------AS--FSL.............
Q1K880_NEUCR/87-498-----------------------------LMSN---------V-FLYG------------FD--GTI.............
H1CQV8_CLOPF/26-404-----------------------------LMIF---------A-LVID------------NS--FKI.............
O58488_PYRHO/9-354-----------------------------LDTI---------L-MTAG------------FG--TLT.............
Q9K9F3_BACHD/14-368-----------------------------VTFL---------T-FLAV------------QG--VRL.............
O29880_ARCFU/11-360-----------------------------GFLL---------N-LMLG------------IV--YAW.............
Q97C48_THEVO/19-351-----------------------------VSTA---------A-AVRS------------IG--YGA.............
Q9Y7D4_ASPTE/35-449-----------------------------VTLV---------A-FLML------------LD--MSI.............
F7ZPU5_CLOAT/23-413-----------------------------LLLA---------G-FLSL------------FN--ETV.............
Q8MPU6_CAEEL/90-445-----------------------------LSLA---------N-LCST------------IA--FSC.............
Q96Y06_SULTO/9-344-----------------------------TSIS---------H-FIND------------GN--TWV.............
A9CIR5_AGRT5/18-359-----------------------------LVVI---------A-GVAA------------LC--MNL.............
Q8ZWZ3_PYRAE/12-326-----------------------------VLFS---------R-GVYS------------LM--WFF.............
A0A025FMH0_ECO57/20-357-----------------------------FLIV---------A-FLTG------------IA--GAL.............
G4UU99_NEUT9/52-417-----------------------------VTLL---------Y-MLCF------------LD--RVN.............
A0A038F9G3_MYCTX/16-365-----------------------------LDLL---------N-FSLA------------DV--RDG.............
Q19845_CAEEL/45-446-----------------------------AGSC---------A-FIQA------------TQ--FAI.............
A0A028WR33_STAAU/12-354-----------------------------LYIL---------T-LMFF------------SA--NAI.............
L8ADD9_BACIU/19-353-----------------------------RFFG---------E-LLTS------------LT--GAM.............
Q8ZVF8_PYRAE/4-322-----------------------------VNLA---------T-LLFF------------TA--NGI.............
O58825_PYRHO/10-360-----------------------------FSVG---------R-WIST------------AG--WTI.............
A0A017MXT2_ECOLX/8-341-----------------------------LALG---------T-FGLG------------MA--EFG.............
Q9L8Q4_PSEST/17-351-----------------------------LLLI---------A-MGMP------------MM--IFY.............
Q9XXC1_CAEEL/44-436-----------------------------FLLS---------S-IICY------------NA--CYV.............
Y4007_STRCO/39-376-----------------------------IALC---------T-AVTA------------AN--IYL.............
Q8YQ15_NOSS1/8-358-----------------------------LATL---------Y-ISQF------------IP--TTF.............
O93992_CANAX/65-459-----------------------------ISIG---------S-VCVT------------CI--SSS.............
Q8YWH2_NOSS1/17-343-----------------------------LYIV---------A-FLSG------------IS--LGL.............
Q9RSM6_DEIRA/32-418-----------------------------LLIV---------I-LVVA------------FE--SAA.............
Q9VDS0_DROME/61-500-----------------------------IFLC---------K-IPAA------------WF--MAC.............
A0A030RLT0_PSEAI/28-357-----------------------------IFCL---------G-INLR------------PI--LTG.............
M4MMB5_SINM2/19-421-----------------------------LVAG---------I-VLAT------------LT--EAI.............
I3XGH7_RHIFR/18-362-----------------------------LFGL---------Q-FISM------------GA--MEM.............
Q8XGP2_RALSO/41-431-----------------------------LMTA---------A-ILAA------------LD--TTI.............
J7JJU9_BACIU/15-364-----------------------------LLAS---------Q-TISS------------LG--DWL.............
E3YYX7_LISIO/14-347-----------------------------TAAA---------S-LLAF------------MG--IGV.............
F7UKI9_SYNYG/19-365-----------------------------LYLA---------Q-AISL------------LG--DAL.............
B8H5X3_CAUCN/31-388-----------------------------LFLA---------M-VINY------------VD--RQT.............
D6EJD0_STRLI/29-361-----------------------------VMLG---------I-FSII------------TT--EIL.............
Q97BG6_THEVO/17-357-----------------------------LALS---------R-LIRA------------SG--RVS.............
Q9X4X9_9PSED/27-377-----------------------------AGVA---------I-SINA------------AL--LYG.............
Q973J7_SULTO/8-320-----------------------------LILS---------S-SLNG------------II--WGA.............
O32859_MYCFO/12-364-----------------------------ILFA---------A-LTAG------------AG--NGI.............
Q9S243_STRCO/13-352-----------------------------LVIA---------F-GFAQ------------AA--VSM.............
A0A034WYQ7_STREE/13-344-----------------------------LSLV---------L-ITSF------------SI--SSA.............
Q97CC5_THEVO/27-411-----------------------------LFIA---------I-LFNY------------AD--RE..............
D5AX67_RICPP/10-405-----------------------------IWLF---------G-FISG------------FN--VMI.............
Q9RD97_STRCO/46-435-----------------------------TSAA---------T-AVAL------------MA--FTA.............
Q8R8R3_THETN/20-398-----------------------------FLML---------F-SVRF------------LR--KEINMTTL...KKVAY
O30210_ARCFU/17-354-----------------------------LFGT---------L-FLFW------------YD--MGT.............
Q8X120_EXODE/120-524-----------------------------TVIS---------A-AQLL------------TQ--AAL.............
Q9EW91_9ACTO/13-358-----------------------------YLIG---------Q-LTSN------------IG--TWM.............
Q8MMD6_DROME/21-407-----------------------------LFLS---------I-VVNY------------MA--KFN.............
Q8XVV0_RALSO/19-414-----------------------------GTLG---------A-MMAT------------LD--ISI.............
Q978I2_THEVO/17-358-----------------------------LVSS---------V-WFSH------------TA--FSA.............
S22AI_MOUSE/13-363-----------------------------TYVL---------A-ALEL------------TC--LFM.............
M4MJU5_SINM2/14-352-----------------------------ISFG---------T-VLGI------------AG--TDL.............
Q4UVJ5_XANC8/24-370-----------------------------ILLY---------R-VSAM------------LS--YQI.............
A0A030R0G5_PSEAI/34-397-----------------------------VFAL---------T-VINL------------VD--RVS.............
A0A030YI13_PSEAI/26-388-----------------------------TWLA---------Y-AAFY------------FT--RKA.............
Q9KG22_BACHD/29-373-----------------------------LWVA---------S-IFSG------------LS--FSI.............
Q9KYE9_STRCO/8-359-----------------------------IHVG---------N-ALSA------------FG--LGF.............
A0A029SJ89_STRPY/27-401-----------------------------AFFG---------Y-VCAY------------LV--RNN.............
O31131_BRELN/13-405-----------------------------ILLG---------G-VLLP------------LA--MSG.............
M4U5Z3_9XANT/29-361-----------------------------MSLC---------V-ALLI------------AS--EFM.............
A4TJW7_YERPP/23-431-----------------------------IALA---------Q-ILMS------------FN--VAS.............
Q8U366_PYRFU/20-359-----------------------------LGLV---------S-FLND------------MS--SEM.............
Q9C9R9_ARATH/11-379-----------------------------VNLA---------G-IMER------------AD--ESL.............
Q20265_CAEEL/46-427-----------------------------TLVQ---------A-NVHV------------YN--FTV.............
Q9PCQ0_XYLFA/73-403-----------------------------LAMT---------G-FIAI------------VT--ETL.............
A0A022NLX7_PSEAI/4-339-----------------------------IFSG---------Y-FAAE------------GL--IYP.............
Q9VPX2_DROME/42-442-----------------------------VAMV---------A-MVNH------------TA--IKAHGDGGGHGGHGSV
G2KCG1_LISMN/17-359-----------------------------LFIG---------Y-TSVY------------VD--KYT.............
Q8VUK1_HALHD/23-380-----------------------------LSPL---------V-FALV------------FA--SWT.............
B8FVY2_DESHD/13-347-----------------------------AISS---------V-SLLV------------MT--YSS.............
A9CGF2_AGRT5/30-354-----------------------------MAPI---------G-IVAM------------LS--QTH.............
O66181_ARTSP/15-353-----------------------------TIAT---------I-TAVG------------FG--RMA.............
Q8KYU7_9PROT/15-359-----------------------------GALL---------T-LISS------------FG--QTY.............
YJ7D_SCHPO/81-445-----------------------------MCIT---------Y-MIQY------------LD--KTA.............
H4S4N1_ECOLX/47-408-----------------------------LFFA---------A-VINY------------LD--RSS.............
Q9VY22_DROME/66-470-----------------------------VANN---------V-TVEP------------IL--AAY.............
I6V2R6_9EURY/8-345-----------------------------LNFS---------T-LFFF------------LG--VSI.............
J7JKV9_BACIU/12-351-----------------------------MYIN---------Y-FFLG------------MV--NII.............
O30679_RHORH/8-341-----------------------------LGLA---------V-FAQG------------TS--EFM.............
F0KEM5_CLOAE/16-408-----------------------------IFLG---------S-FLVS------------LG--TST.............
A0A023ZK54_YEASX/86-451-----------------------------LCCT---------Y-LLMF------------LD--KAL.............
B8H3N7_CAUCN/19-356-----------------------------TYLM---------F-MMFA------------MT--TDS.............
F0KEM1_CLOAE/19-357-----------------------------LGLA---------G-FVSA------------AD--NWF.............
A0A028WN84_STAAU/12-398-----------------------------LILI---------M-FMSA------------IE--SSI.............
Q9VPD9_DROME/28-441-----------------------------AVIV---------T-FMHY------------FS--WGL.............
Q8PVU8_METMA/11-346-----------------------------LCIT---------A-CFAM------------AG--GSL.............
A0A032S8J6_STAAU/18-410-----------------------------MLIS---------A-FVAI------------LN--QTL.............
F0K465_CLOAE/17-361-----------------------------LFLV---------Q-VINR------------LG--DFV.............
Q8KR58_ESCFE/20-359-----------------------------LALC---------A-GLLG------------IG--QNG.............
I0LNP6_CORGK/19-353-----------------------------MSFA---------A-FVYV------------TF--EMF.............
Q9LAA0_AERHY/27-362-----------------------------AAFI---------Q-LVSA------------LD--FMM.............
O06742_BACIU/18-364-----------------------------IGSI---------P-LILT------------LG--NSM.............
Q9FCG1_STRCO/24-364-----------------------------LWTS---------T-LVNR------------LG--AFV............A
O94019_CANAX/86-529-----------------------------FFIV---------I-FITA------------FT--AAT............S
MOT14_MOUSE/42-459-----------------------------SFFV---------H-ILIM------------GS--QMA.............
F6C4D9_SINMB/8-347-----------------------------LAVG---------S-FTMS------------TV--GFV.............
Q9Y7E0_ASPTE/42-435-----------------------------VSWM---------T-LVVT------------FS--STC.............
A0A022NSM6_PSEAI/11-401-----------------------------YLLG---------F-ALDL------------VN--IFI.............
O76837_CAEEL/25-400-----------------------------LIIG---------L-CCIC------------CT--NAN.............
Q96ZI2_SULTO/36-365-----------------------------IIPL---------T-IAIR------------AS--NNM.............
Q7BQD2_PSEST/7-367-----------------------------VGLQ---------L-LFGW------------MN--LVLAV.........PS
Q94886_DROME/14-423-----------------------------TFIG---------F-IVNY------------MI--RIN.............

PF05978

Q19933_CAEEL/13-169-----------------------------LSIS---------I-VILF------------SA--VLA-------------
Q9XV34_CAEEL/12-166-----------------------------LAFG---------F-FVNF------------VA--FNT-------------
MFS11_MOUSE/14-166-----------------------------LGVA---------F-MFMF------------TA--FQT-------------
Q8MYL9_CAEEL/14-170-----------------------------LGLG---------Q-LCIM------------VG--YDS-------------
Q965T3_CAEEL/14-170-----------------------------VSTS---------F-LILF------------SA--VLS-------------
P91007_CAEEL/16-172-----------------------------LGFA---------Q-LCMN------------TA--FDA-------------
Q9XWR7_CAEEL/37-194-----------------------------LGIG---------T-LFLY------------TG--YSL-------------
Q19932_CAEEL/14-169-----------------------------LSVS---------F-MLLF------------FA--YMS-------------
Q21545_CAEEL/14-168-----------------------------LGFG---------F-FATF------------FA--FNS-------------
O61865_CAEEL/27-183-----------------------------LGFG---------H-LCIM------------TG--CDS-------------
Q18251_CAEEL/11-167-----------------------------LGAS---------F-AFIF------------SA--FNS-------------

PF03137

A0NEW4_ANOGA/55-618----LYV----------------------LLFG---------L-MGCI------------L.--NST-------------
A7S331_NEMVE/27-582----WFL----------------------FFIC---------S-YFFT------------QS--IVV-------------
A7S539_NEMVE/32-576----WFL----------------------FFLV---------M-YFFT------------QS--IVV-------------
A7S542_NEMVE/18-557----WFL----------------------FFLV---------M-YFFT------------QS--IVV-------------
A7SHZ4_NEMVE/19-550----WFL----------------------VFQC---------W-LVLA------------QG--LIV-------------
A7SQZ6_NEMVE/18-584----WFT----------------------VFLC---------M-FILT------------QG--ILI-------------
A7SWE4_NEMVE/55-622----GFM----------------------VFLC---------I-FGLV------------QG--MAI-------------
A7SX54_NEMVE/31-599----WFL----------------------VFLT---------I-YSFM------------QG--MTA-------------
A8P8W3_BRUMA/81-731----WML----------------------LWLC---------W-FCTV------------QG--LLV-------------
A8PR64_BRUMA/26-571----CFL----------------------VTML---------F-VIAV------------Q.--GTY-------------
B0WEE2_CULQU/64-642----LYV----------------------FLFG---------F-VGCL------------F.--GST-------------
B0WEE5_CULQU/105-708----AYV----------------------FLYG---------V-VGCV------------F.--SAT-------------
B0WGA7_CULQU/25-763----SFI----------------------MVYG---------F-LGTT------------Q.--AMA-------------
B3DJD4_DANRE/48-631----MFL----------------------VALS---------F-AYFS------------K.--ALS-------------
B3MGJ1_DROAN/65-620----MYV----------------------VLYG---------F-AGCV------------L.--VMT-------------
B3MGJ2_DROAN/51-611----TFV----------------------IVYG---------I-ASCF------------M.--AMA-------------
B3MNT7_DROAN/36-684----MFM----------------------GVYG---------L-LGTI------------Q.--AMS-------------
B3RLK5_TRIAD/8-577----WLL----------------------AFTS---------L-YVII------------SG--MMI-------------
B3RLK6_TRIAD/21-588----WLL----------------------VFTS---------S-YIII------------AS--MLI-------------
B3RLK7_TRIAD/29-614----WLL----------------------FFIC---------S-FIVI------------AG--MQA-------------
B3RLK8_TRIAD/27-595----WLL----------------------LILC---------F-YSVT------------MS--MQI-------------
B3RLL2_TRIAD/176-721----YFL----------------------FFLC---------T-TILL------------AH--MQA-------------
B3S2R8_TRIAD/18-575----WLM----------------------AFIG---------I-YIFI------------SG--IQT-------------
B3SCA6_TRIAD/44-614----CLI----------------------LIVC---------L-QVFV------------SG--MMI-------------
B4J9Q1_DROGR/61-622----MYV----------------------TIYG---------V-SGCF------------M.--AMC-------------
B4J9Q2_DROGR/50-610----AYV----------------------LIYG---------L-GGCL------------M.--SMS-------------
B4J9Q3_DROGR/52-605----VYV----------------------VVYG---------I-AGCF------------I.--AMA-------------
B4JCP9_DROGR/31-685----YFM----------------------GVYG---------L-LGTI------------Q.--AMS-------------
B4KJ36_DROMO/34-688----AFM----------------------GVYG---------L-LGTI------------Q.--AIS-------------
B4KS84_DROMO/70-629----MYV----------------------TIYG---------I-AGCF------------M.--AMC-------------
B4KS85_DROMO/55-614----SFV----------------------LIYG---------I-GGCL------------L.--SMS-------------
B4KS86_DROMO/50-605----MFM----------------------VLFG---------I-AGCF------------I.--GMA-------------
B4KS87_DROMO/111-737----AYV----------------------LLYG---------I-VGCI------------F.--SMT-------------
B4MDK1_DROVI/34-691----WFM----------------------GVYG---------L-LGTI------------Q.--AMS-------------
B4MFR1_DROVI/68-626----MYV----------------------TIYG---------I-AGCF------------M.--AMC-------------
B4MFR2_DROVI/57-615----LFV----------------------VIYG---------I-GGCF------------L.--SMS-------------
B4MJH9_DROWI/51-614----MFM----------------------VLYG---------I-AGCF------------L.--AMA-------------
B4MJI0_DROWI/54-620----MYV----------------------TLYG---------I-AGCT------------I.--AMT-------------
B4MWM1_DROWI/38-693----TFM----------------------GVYG---------L-LGTI------------Q.--AMS-------------
B4N051_DROWI/200-840----IFV----------------------LLLS---------L-LVMM------------QQ--ALS-------------
B5DE94_XENTR/28-595----VFV----------------------VCHA---------L-LQLS------------Q.--LLY-------------
B5DI87_DROPS/36-609----MFM----------------------GVYG---------L-LGTI------------Q.--AMS-------------
B5E0I0_DROPS/65-626----MYV----------------------ILYG---------L-AGCV------------M.--TMT-------------
B7PPH4_IXOSC/20-614----WFL----------------------LVFC---------V-LGVL------------Q.--GAY-------------
B7QN84_IXOSC/6-567----AFL----------------------AVFC---------L-TSVL------------Q.--GMY-------------
C3Y4T6_BRAFL/2-565----SFI----------------------LFLC---------L-LILS------------QG--ILV-------------
C3Y4T7_BRAFL/83-626----AIL----------------------FFLS---------W-LAFT------------QG--MVV-------------
C3YMS7_BRAFL/5-587----CVV----------------------IAIS---------L-LTLV------------QS--MLV-------------
C3ZQA6_BRAFL/26-589----GMM----------------------VLLV---------I-CTVA------------EN--MTH-------------
C3ZX58_BRAFL/40-591----CLV----------------------AMIC---------V-FNFL------------TS--SIH-------------
D6W853_TRICA/116-732----CFV----------------------FLLS---------F-LVTL------------QQ--ALS-------------
D6W895_TRICA/53-625----AYV----------------------FLYG---------L-LGCV------------F.--SAA-------------
E0VXM5_PEDHC/126-706----VYV----------------------LLYG---------L-LGCF------------N.--SAT-------------
E0W488_PEDHC/204-804----VFV----------------------MLLS---------F-LVNL------------QQ--ALS-------------
E1C5S3_CHICK/28-603----FFV----------------------FCHG---------L-LQLS------------Q.--LLV-------------
E1FKB9_LOALO/26-596----CFL----------------------VTML---------F-VIAI------------Q.--GTY-------------
E1FVI2_LOALO/58-633----WLL----------------------VMLG---------I-CAFV------------QS--FVV-------------
E2A200_CAMFO/99-698----AFL----------------------VTFC---------L-TWVL------------Q.--GMY-------------
E2ABP4_CAMFO/74-684----AYV----------------------FLYG---------V-LGCI------------F.--SAS-------------
E2BXT3_HARSA/74-652----AYV----------------------FLYG---------V-LGCI------------F.--SAS-------------
E2RSD4_CANFA/44-638----VFL----------------------GALS---------F-VYFA------------K.--ALA-------------
E4X1Y1_OIKDI/36-601----GFL----------------------VCFS---------C-YIFF------------QS--MVS-------------
E5S461_TRISP/81-717----WML----------------------FWIC---------W-YCTV------------QG--MVV-------------
E5SC63_TRISP/58-613----FLL----------------------IILC---------I-SATS------------QS--MAI-------------
E7F5H8_DANRE/27-603----IFL----------------------ISEC---------A-LMLA------------QG--TVG-------------
E9G6H1_DAPPU/44-620----SFL----------------------FWIC---------W-AGGF------------QS--FLI-------------
E9GGR7_DAPPU/1-573----MFL----------------------AVFC---------L-ACVL------------Q.--GMF-------------
E9GTG7_DAPPU/37-616----SYL----------------------LTYS---------F-LGLF------------Q.--AMF-------------
E9INY6_SOLIN/50-616----LYV----------------------GLIC---------W-IGVV------------Q.--AAS-------------
F1MA40_RAT/144-702----FFL----------------------ISFC---------I-LTLA------------Q.--GIV-------------
F1NQ62_CHICK/86-676----VFL----------------------AALS---------F-SYFS------------K.--ALS-------------
F1Q3Z3_CANFA/92-650----CFM----------------------IFYC---------L-LVTS------------Q.--GIV-------------
F1Q9B1_DANRE/21-583----IFV----------------------LCHG---------L-LQLT------------Q.--LLY-------------
F1QBF7_DANRE/27-591----FFV----------------------LCHG---------M-LQLS------------Q.--LLV-------------
F1RU07_PIG/132-741----CFL----------------------VCMC---------F-LTFI------------QA--LMV-------------
F1SQZ6_PIG/21-597----MFL----------------------LAIT---------C-AYVA------------K.--TQS-------------
F2U1E1_SALR5/138-886----WYL----------------------VFLS---------M-FAFG------------QS--MII-------------
F4WH08_ACREC/51-617----LFV----------------------GLIC---------W-IGVV------------Q.--AAS-------------
F4X6X3_ACREC/89-670----WAL----------------------FWLC---------W-AGAM------------QG--MVV-------------
F6RPB8_HORSE/50-647----VFV----------------------LCHS---------L-LQLA------------Q.--LMI-------------
F6SHC6_MONDO/129-692----GYL----------------------FYYC---------L-LALT------------QG--IVV-------------
F6SHD5_MONDO/83-645----GFL----------------------FHYC---------L-LALI------------QG--IVV-------------
F6SNL4_XENTR/97-651----GVL----------------------VFLC---------A-ASFL------------QG--MTV-------------
F6TIF0_CIOIN/25-583----GFL----------------------VGYS---------F-FVIV------------QG--MLV-------------
F6UFC7_MONDO/37-638----FFV----------------------FCHS---------L-LQLA------------Q.--LMI-------------
F6UHW9_MACMU/29-621----MFL----------------------AALA---------L-SFIA------------K.--ALG-------------
F6Z8W3_MONDO/36-628----IFV----------------------VALT---------F-SFVC------------K.--TLA-------------
F6ZVK8_CIOIN/40-603----AFV----------------------AFVG---------I-ALCG------------Q.--SAL-------------
F6ZXK1_MONDO/21-593----IFL----------------------LALL---------C-AFVS------------K.--TLS-------------
F7ACE2_CIOIN/22-602----WYL----------------------VVHC---------L-LAIA------------ST--VVS-------------
F7B262_CIOIN/35-639----TFV----------------------AFLS---------L-LQLV------------Q.--VMG-------------
F7B8B6_XENTR/14-595----MFL----------------------VALC---------F-SYFA------------K.--AFS-------------
F7BQX3_MONDO/39-601----VFV----------------------LCHG---------L-LQLC------------Q.--LLY-------------
F7CCC4_MACMU/114-672----CFM----------------------VFYC---------I-LVLC------------Q.--GVV-------------
F7D880_XENTR/45-603----GYL----------------------VMYS---------L-LAVM------------QG--TAV-------------
F7DID9_ORNAN/85-636----GIL----------------------FFLC---------L-ASFL------------QG--MTV-------------
F7E5T7_MACMU/28-625----LFV----------------------LCHS---------L-LQLA------------Q.--LMI-------------
F7G693_MONDO/107-666----GIL----------------------FFLC---------M-ASFL------------QG--MTV-------------
F7IM14_CALJA/33-639----VFV----------------------LCQG---------L-LQLC------------Q.--LLY-------------
G1KDM6_ANOCA/110-669----GVL----------------------FFLC---------V-ASFL------------QG--MTV-------------
G1KJC8_ANOCA/62-624----LFV----------------------LCHG---------L-LQLA------------Q.--LLY-------------
G1KTZ7_ANOCA/42-626----IFL----------------------VALA---------F-AYLT------------K.--TMS-------------
G1KTZ8_ANOCA/2-594----MFL----------------------IALA---------F-SYFA------------K.--GFS-------------
G1KU16_ANOCA/44-637----IFL----------------------CALS---------F-VYFA------------K.--ALS-------------
G1LS58_AILME/38-599----CFL----------------------FFYS---------L-LITS------------Q.--GIV-------------
G1MG68_AILME/111-671----GFL----------------------VFLC---------A-AAFL------------QG--MTV-------------
G1NLJ6_MELGA/21-604----LFL----------------------LALS---------L-AFIG------------K.--TMT-------------
G1P1F0_MYOLU/56-614----CFL----------------------IFFY---------T-LVVS------------Q.--GMV-------------
G1PCN2_MYOLU/58-650----FFV----------------------LCHS---------L-LQLA------------Q.--LMI-------------
G1PGX5_MYOLU/20-594----MFL----------------------LAIT---------C-AFIS------------K.--TLS-------------
G1QXW4_NOMLE/21-597----MFL----------------------LAIT---------C-AFVS------------K.--TLS-------------
G1RKH9_NOMLE/129-734----CFL----------------------VCMC---------L-LTFI------------QA--LMV-------------
G1SJM2_RABIT/94-653----CFM----------------------VIYF---------I-LASS------------Q.--GIV-------------
G1T6Y7_RABIT/47-646----FFV----------------------LCHS---------L-LQLT------------Q.--LMV-------------
G1T960_RABIT/29-621----MFL----------------------VALA---------L-SYIC------------K.--ALG-------------
G3NAV0_GASAC/31-610----FFV----------------------FCHS---------L-LQLA------------Q.--LLV-------------
G3NHS2_GASAC/34-602----LFV----------------------LCHG---------L-LQLS------------Q.--LLY-------------
G3P9F5_GASAC/17-593----IFL----------------------ISEC---------A-LMLA------------QG--TVG-------------
G3Q5Q6_GASAC/29-624----LFL----------------------VSLA---------F-VYFS------------K.--AFG-------------
G3RFJ2_GORGO/108-666----CFM----------------------IFYC---------I-LLIC------------Q.--GVV-------------
G3RW09_GORGO/3-600----IFL----------------------TLLS---------F-SYVA------------K.--ALA-------------
G3THK1_LOXAF/27-590----FFM----------------------IFYC---------I-LLIS------------Q.--GMI-------------
G3VZ81_SARHA/19-591----GFL----------------------FHYC---------L-LALI------------QG--IVV-------------
G3WV28_SARHA/37-630----MFM----------------------IALS---------F-SYIC------------K.--SLA-------------
G3WVX8_SARHA/40-630----LFM----------------------IALI---------C-CLFC------------K.--ALM-------------
G3WWQ7_SARHA/43-640----VFL----------------------CALS---------F-VYFA------------K.--ALS-------------
G4VAF3_SCHMA/62-701----AFL----------------------AAAC---------F-ISCL------------Q.--ASF-------------
G5BJ45_HETGA/1-591----MFL----------------------AALS---------F-SYIC------------K.--IIG-------------
G6D5X6_DANPL/120-675----VFV----------------------FFLS---------F-LVTL------------QQ--ALS-------------
G6DHQ3_DANPL/73-638----MFM----------------------LVFL---------S-GWVL------------Q.--GMF-------------
H0VSG6_CAVPO/50-647----FFV----------------------LCHS---------L-LQLA------------Q.--LMI-------------
H0VU31_CAVPO/105-653----GFL----------------------LFLC---------T-ASFL------------QG--MTV-------------
H0W6D9_CAVPO/29-617----MFL----------------------AALS---------F-SVFC------------R.--LIS-------------
H0WRN3_OTOGA/1-607----VFV----------------------LCQG---------I-LQLC------------Q.--LLY-------------
H0X513_OTOGA/48-645----LFV----------------------LCHS---------L-LQLA------------Q.--LMI-------------
H0XUZ7_OTOGA/29-621----MFF----------------------SALS---------Y-SFIA------------K.--ALA-------------
H0ZQ14_TAEGU/44-636----IFL----------------------GALS---------F-VYFA------------K.--ALS-------------
H2L5X8_ORYLA/7-609----LFV----------------------LCHG---------L-LQLS------------Q.--LLY-------------
H2LW99_ORYLA/3-593----IFL----------------------VALS---------F-AYFA------------K.--ALS-------------
H2LWK4_ORYLA/34-623----IFL----------------------IAEC---------A-LMLA------------QG--TVG-------------
H2LXV9_ORYLA/4-606----LFI----------------------VALS---------F-SYFS------------K.--ALT-------------
H2ME20_ORYLA/33-598----VFV----------------------LCHS---------L-LQLA------------Q.--LLV-------------
H2NP86_PONAB/41-622----IFL----------------------VSEC---------A-LMLA------------QG--TVG-------------
H2SCH0_TAKRU/44-642----LFL----------------------VSLA---------F-AFFA------------K.--AFS-------------
H2SCH1_TAKRU/29-627----LFL----------------------VSLA---------F-AFFA------------K.--AFS-------------
H2SCH5_TAKRU/21-605----IFI----------------------LVLS---------F-ACFS------------R.--SLT-------------
H2SN38_TAKRU/26-590----FFV----------------------LCHS---------L-LQLS------------Q.--LLV-------------
H2T5W9_TAKRU/22-602----IFL----------------------ISEC---------A-LMLA------------QG--TVG-------------
H2TWS2_TAKRU/7-592----CFL----------------------FCMC---------Y-LTFI------------QS--LMV-------------
H2UWX7_TAKRU/9-600----MFL----------------------VALS---------F-AYFA------------K.--ALS-------------
H2UZN6_TAKRU/20-610----LFV----------------------LCHG---------L-LQLS------------Q.--LLC-------------
H2V2U5_TAKRU/20-610----IFI----------------------AALS---------Y-AYFA------------K.--ALS-------------
H2YEL4_CIOSA/27-585----GFL----------------------VAYS---------F-FVVV------------QG--MFV-------------
H2YTS0_CIOSA/2-575----MFL----------------------FFLT---------C-FQLI------------N.--LLT-------------
H2YZB0_CIOSA/24-616----QYL----------------------LVHC---------V-FAVA------------AT--LVS-------------
H2Z037_CIOSA/5-589----CFL----------------------VVYS---------L-FSMV------------AG--TMI-------------
H2Z5W5_CIOSA/21-582----AFL----------------------VLLT---------L-ANIM------------QG--VII-------------
H2ZCE8_CIOSA/9-615----TFV----------------------VFLS---------L-LQLV------------Q.--VMG-------------
H3ABP2_LATCH/6-582----FFV----------------------VCHG---------V-LQLS------------Q.--LLV-------------
H3AUF3_LATCH/60-624----GYL----------------------FFYS---------V-LAIV------------QG--TVV-------------
H3AXL7_LATCH/47-642----VFL----------------------AALS---------F-AYFA------------K.--ALS-------------
H3B0P1_LATCH/42-638----VFL----------------------VAIS---------F-AYFA------------R.--GAS-------------
H3BW91_TETNG/35-616----FFV----------------------LCHS---------L-LQLA------------Q.--LLV-------------
H3DMV0_TETNG/12-567----LFV----------------------LCHG---------L-LQLS------------Q.--LLY-------------
H3DSJ9_PRIPA/41-714----GFL----------------------TLFV---------I-VYLM------------E.--AMG-------------
H3FQI4_PRIPA/22-588----VFI----------------------GLML---------L-VVAI------------Q.--GCY-------------
H9GXA5_DANRE/22-598----IFI----------------------AALA---------F-CYFS------------K.--SMT-------------
H9GYB5_DANRE/9-610----MFL----------------------AAMC---------F-VFFA------------K.--AFQ-------------
H9J2D0_BOMMO/122-735----VFV----------------------FFLS---------F-LVTL------------QQ--ALS-------------
H9KAI9_APIME/72-668----AYV----------------------FLYG---------V-LGCI------------F.--SAS-------------
H9KS62_APIME/23-630----NFI----------------------AVYG---------L-LGTV------------Q.--AMA-------------
I1FF21_AMPQE/83-628----MFT----------------------FLLC---------C-YAFL------------QG--AIV-------------
I1FF22_AMPQE/53-616----AFT----------------------VFLC---------L-FAVI------------EG--AIV-------------
I3J8K7_ORENI/27-592----FFV----------------------FCHS---------L-LQLA------------Q.--LLV-------------
I3JPB0_ORENI/4-598----MFL----------------------AALS---------F-AYFA------------K.--ALS-------------
I3JU44_ORENI/3-598----LFL----------------------ASLA---------F-VYFA------------K.--AFA-------------
I3JU45_ORENI/36-628----LFI----------------------VALS---------F-AYFS------------K.--ALT-------------
I3KD69_ORENI/19-600----IFL----------------------ISEC---------A-LMLA------------QG--TVG-------------
I3KT50_ORENI/9-572----LFV----------------------LCHG---------L-LQLS------------Q.--LLY-------------
I3MXD4_SPETR/104-661----GLL----------------------FFLC---------A-ASFL------------QG--MTV-------------
I3MZY5_SPETR/101-669----GFL----------------------IHYC---------L-LALT------------QG--VVV-------------
J3QNA4_MOUSE/108-668----YFL----------------------ISFC---------I-LSLS------------Q.--GTI-------------
J9JWU7_ACYPI/65-667----VFL----------------------ATFC---------F-SWVL------------Q.--GMF-------------
J9K6L3_ACYPI/47-601----VYV----------------------LVYG---------L-LGLN------------Q.--FML-------------
K1PJB3_CRAGI/119-693----AFV----------------------VCMS---------V-LLAV------------SG--TLS-------------
K1Q6Z9_CRAGI/63-616----LFV----------------------VWVF---------I-LCFL------------EG--FAV-------------
K1QB38_CRAGI/29-589----ALL----------------------FFLS---------C-FCML------------QG--FVV-------------
K1QD74_CRAGI/43-615----WFV----------------------LWLC---------I-FGFV------------EG--AAV-------------
K7IWN1_NASVI/25-629----SFI----------------------AVYG---------L-LGTV------------Q.--SMA-------------
K7IWN2_NASVI/77-675----AYV----------------------FLYG---------V-LGCI------------F.--SAS-------------
K7J562_NASVI/209-820----VFV----------------------FLLS---------F-LVTL------------QQ--ALS-------------
K7J8P8_NASVI/104-674----MFL----------------------FTFC---------I-TWVL------------Q.--GMY-------------
L5JNP4_PTEAL/43-638----FFL----------------------LCHS---------L-LQLV------------Q.--LMI-------------
L7N264_MOUSE/21-597----VFL----------------------LALT---------G-ACVS------------K.--SLT-------------
L9L9W1_TUPCH/47-739----SFV----------------------LCHS---------L-LQLA------------Q.--LMI-------------
M3WPK8_FELCA/38-596----CFL----------------------VFFC---------I-LVAS------------Q.--GIV-------------
M3XXF4_MUSPF/103-666----GFL----------------------LYYC---------L-LALT------------QG--IIV-------------
M3XXG5_MUSPF/93-653----CFV----------------------VFFC---------L-LITS------------Q.--GIV-------------
M3YCV1_MUSPF/50-648----FFV----------------------LCHS---------L-LQLA------------Q.--LMI-------------
M3ZWM7_XIPMA/18-618----LFL----------------------VSLA---------F-MYFA------------K.--AFA-------------
M3ZXE4_XIPMA/24-582----VFV----------------------LCHS---------L-LQLA------------Q.--LLV-------------
M4ABK2_XIPMA/34-613----IFL----------------------VAEC---------A-LMLA------------QG--TVG-------------
SO1A3_RAT/21-597----VFL----------------------MALT---------C-AYVS------------K.--SLS-------------
SO2A1_RAT/33-602----VFV----------------------LCHG---------L-LQLC------------Q.--LLY-------------
Q16RK9_AEDAE/100-701----AYV----------------------FLYG---------V-VGCI------------F.--SAT-------------
Q16RL0_AEDAE/55-631----LYV----------------------FLFG---------I-VGCL------------F.--GST-------------
Q171D5_AEDAE/25-762----SFI----------------------MVYG---------F-LGTT------------Q.--AMA-------------
Q28XS7_DROPS/47-608----LYM----------------------VIYG---------I-AGCF------------L.--AIA-------------
Q5JAR4_HUMAN/29-621----MFL----------------------AALS---------F-SYIA------------K.--ALG-------------
SO4C1_RAT/102-664----GFL----------------------LHYC---------L-LALT------------QG--IVV-------------
Q7Q103_ANOGA/25-768----SFI----------------------MVYG---------F-LGTV------------Q.--AMA-------------
Q7Q551_ANOGA/114-716----VYV----------------------FMYG---------V-VGCI------------F.--SAT-------------
SO2B1_MOUSE/42-636----FFV----------------------LCHS---------L-LQLT------------Q.--LMI-------------
Q8C0X7_MOUSE/95-654----GFM----------------------TLYV---------A-AVLI------------H.--GAL-------------
SO1A5_MOUSE/21-597----MFL----------------------LALT---------C-AYVS------------K.--SLS-------------
Q93550_CAEEL/18-586----IFV----------------------LLMV---------L-VIAV------------Q.--GTY-------------
SO4A1_HUMAN/104-663----GIL----------------------FFLC---------A-AAFL------------QG--MTV-------------
SO1A6_MOUSE/21-597----VFL----------------------LALI---------W-AYIS------------K.--ILS-------------
SO4A1_RAT/103-665----GFL----------------------FFLC---------A-ASFL------------QG--MTV-------------
SO1C1_RAT/44-642----VFL----------------------GALS---------F-VYFA------------K.--ALT-------------
SO1B2_MOUSE/27-617----IFL----------------------AALS---------F-SYIC------------K.--ALG-------------
SO1B2_RAT/29-615----LFL----------------------AALS---------F-SYIC------------K.--ALG-------------
Q9VK84_DROME/36-684----MFM----------------------GVYG---------L-LGTI------------Q.--AMS-------------
Q9VVH9_DROME/175-754----VFM----------------------VVFL---------L-AYIL------------Q.--GMY-------------
Q9W269_DROME/112-731----AYV----------------------LLYG---------I-VGCI------------F.--SMT-------------
Q9W270_DROME/95-661----MFV----------------------IVYG---------I-ASCF------------L.--AMA-------------
Q9W271_DROME/67-626----MYV----------------------ILYG---------L-AGCV------------M.--TMT-------------
Q9XWC5_CAEEL/49-620----CLL----------------------VVLG---------I-CAFI------------QS--FVV-------------
R4GBU6_ANOCA/260-819----GYL----------------------VFYS---------L-LSVF------------QG--IVV-------------
T1ER69_HELRO/33-610----TFI----------------------VLYF---------I-FSFS------------H.--GVQ-------------
T1G9I5_HELRO/71-663----TFL----------------------CVAC---------C-FVAL------------QG--MVV-------------
T1HLF3_RHOPR/50-617----AYV----------------------FLYG---------L-LGCI------------F.--SAA-------------
T1HLL5_RHOPR/20-673----TFM----------------------VVYG---------L-LGTI------------Q.--AMS-------------
T1HYS5_RHOPR/25-590----AFL----------------------VTFC---------I-TWVL------------Q.--GMY-------------
T1I8L4_RHOPR/19-568----IYV----------------------LIYG---------L-LGVY------------E.--TVL-------------
T1IDL3_RHOPR/22-585----SYV----------------------IIYG---------L-LGLN------------V.--AAL-------------
T1IV13_STRMM/34-600----VFT----------------------LCYG---------F-LSVV------------Q.--GMS-------------
T1J381_STRMM/107-721----VFL----------------------GVFC---------L-ASVL------------Q.--GMY-------------
T1J4Q6_STRMM/53-601----VYM----------------------ISYC---------I-LNMC------------Q.--GMF-------------
T1J9S9_STRMM/138-752----VFV----------------------FLSC---------I-LVAL------------QQ--TLS-------------
T1K555_TETUR/46-593----IFV----------------------AIFS---------L-IATM------------R.--SAY-------------
U1NEN2_ASCSU/27-606----IFL----------------------VVML---------A-VIGV------------Q.--GTY-------------
U1NQ20_ASCSU/50-610----VLL----------------------ASLC---------I-CAIC------------QG--SIV-------------
U3I6L4_ANAPL/103-660----GVL----------------------FFLC---------V-ASFL------------QG--MTV-------------
U3I6Y8_ANAPL/7-588----FFV----------------------FCHG---------L-LQLS------------Q.--LLV-------------
U3K039_FICAL/40-624----VFL----------------------LALS---------L-AFIG------------K.--TMS-------------
U3K045_FICAL/38-630----IFL----------------------GALA---------F-SFFA------------K.--GFS-------------
U3KFS6_FICAL/31-593----VFV----------------------LCHG---------L-LQLS------------Q.--LLY-------------
V8NPM0_OPHHA/58-605----GYL----------------------VFYS---------L-LSVF------------QG--IIV-------------
W4WD24_ATTCE/23-636----TFI----------------------VVYG---------L-LGTV------------Q.--AMA-------------
W4XLX7_STRPU/60-699----VYV----------------------TMTC---------I-ANVV------------YI--SSI-------------
W4XQW5_STRPU/59-640----FFC----------------------VLLC---------M-VVAS------------D.--AFN-------------
W4XVZ6_STRPU/91-689----GYL----------------------LALS---------L-TGLF------------HY--LVP-------------
W4Z5F6_STRPU/135-671----AYL----------------------VIYS---------L-IGIV------------QV--MTS-------------
W4Z5F7_STRPU/78-634----GFL----------------------VWLC---------L-FALT------------QS--YVT-------------
W5J7I4_ANODA/56-623----LYV----------------------LLFG---------L-IGCI------------L.--NST-------------
W5JBI4_ANODA/130-794----VFV----------------------LLLS---------I-LVTL------------QQ--ALS-------------
W5JW33_ANODA/25-791----SFI----------------------MVYG---------F-LGTV------------Q.--AMA-------------
W5KDH2_ASTMX/31-629----LFL----------------------FAMS---------F-IYFA------------K.--AFQ-------------
W5KJ52_ASTMX/32-619----IFL----------------------VAEC---------A-LMLA------------QG--TVG-------------
W5LQU9_ASTMX/27-591----FFV----------------------LCHG---------M-LQLA------------L.--LLV-------------
W5MDQ5_LEPOC/17-593----FFV----------------------LCHG---------S-MQLT------------Q.--LLY-------------
W5MFK3_LEPOC/106-669----WVL----------------------FFLC---------V-ASFL------------QG--MIV-------------
W5MRR1_LEPOC/26-603----AFV----------------------ATLC---------.-LILS------------AN--SIG-------------
W5MRT2_LEPOC/53-615----GFL----------------------VFYC---------L-LAVV------------QG--FLV-------------
W5MY22_LEPOC/30-602----VFV----------------------FCHG---------L-LQLA------------Q.--LLV-------------
W5NE89_LEPOC/38-625----MFL----------------------AALA---------L-SYFC------------K.--SLS-------------
W5NE95_LEPOC/1-594----MFL----------------------VSLS---------F-VYFA------------K.--AFQ-------------
W5NE99_LEPOC/24-615----MFL----------------------VSLS---------F-VYFA------------K.--AFQ-------------
W5NEA9_LEPOC/1-598----MFL----------------------FALS---------F-AYFA------------K.--ALS-------------
W5PSU6_SHEEP/93-647----GFL----------------------LFLC---------V-ASFL------------QG--MTV-------------
W5QAF5_SHEEP/107-670----CFL----------------------IFFC---------I-LVMA------------Q.--CIV-------------
W5QGQ1_SHEEP/21-597----MFL----------------------LAIT---------C-AFVS------------K.--TLS-------------
X5LX59_CAEEL/46-677----PMI----------------------VLLC---------V-YCSI------------QG--LIV-------------
X5M903_CAEEL/27-574----PFM----------------------SILS---------A-NAML------------QG--AIV-------------

PF03209

P73827_SYNY3/40-466------------------------------VLN---------R-VLID------------E---LAV-------------
PUCC_RHOS4/51-454------------------------------TLN---------R-VMIV------------E---LKV-------------
BCH2_RHOCB/28-417------------------------------TLN---------R-LMVV------------E---LAL-------------
D5AMI6_RHOCB/54-460------------------------------TLN---------R-VMIV------------E---LAV-------------
D5ANS1_RHOCB/51-456------------------------------TLN---------R-VMIL------------E---LGV-------------
G3XCS5_PROMA/1-413------------------------------MLN---------R-IMIT------------E---LAF-------------
I0HT76_RUBGI/55-465------------------------------TLN---------R-VMIV------------E---LGV-------------
Q3J171_RHOS4/51-459------------------------------TLN---------R-VMIV------------E---LAV-------------
Q3J183_RHOS4/28-414------------------------------TLN---------R-LMVV------------E---LAL-------------

PF05631

Q9N3A9_CAEEL/1-336GVFYGLA----------------------AVCG---------L-LYFYTRSATESNDDPKFK--S-F-------------
Q9FWD6_ORYSJ/4-357LVFGGLA----------------------AVVA---------G-LELGKSGKDRVATTPAFN--A-F-------------

PF12832

A7SQQ8_NEMVE/55-132----ALL----------------------IYKV---------F-YFFY------------FA--A-I-------------
Q6FB61_ACIAD/6-82----ITT----------------------KLGG---------F-YFFY------------YA--I-V-------------
B7P8Y1_IXOSC/9-85----KLL----------------------PLMA---------I-TFFF------------FS--A-I-------------
Q17GA0_AEDAE/14-90----NLI----------------------SLKI---------V-LFLF------------YA--A-L-------------
A7RI07_NEMVE/54-130----KLL----------------------SYKA---------F-YFLF------------FG--G-F-------------
Q54SK7_DICDI/682-755----GFA----------------------YIVF---------S-LTIY------------YG--P-N-------------
B2AA42_PODAN/619-697----MLA----------------------FLGS---------V-VVLH------------FG--A-N-------------
A1WY15_HALHL/14-90----PYW----------------------RLSG---------F-YLFF------------FA--A-L-------------
Q54G39_DICDI/12-88----KHT----------------------NIKL---------L-YFFL------------FS--S-L-------------
B3PHF3_CELJU/15-91----PYW----------------------RLSG---------F-YFFY------------FA--V-V-------------
Q07ZQ8_SHEFN/10-86----DLR----------------------WLSA---------C-YFFF------------FS--I-L-------------
D3SB25_THISK/3-79----PSA----------------------RLST---------V-YFFY------------FA--S-L-------------
B0X8B9_CULQU/11-87----HCL----------------------SLKC---------V-LFLF------------YG--G-L-------------
YJBC_SCHPO/418-493----MLS----------------------FLGW---------S-LILH------------FG--S-N-------------
Q16KC8_AEDAE/34-110----HLV----------------------LMKV---------S-LFLI------------FG--A-T-------------
Q21IX9_SACD2/5-81----PYW----------------------RLAF---------F-YFVY------------FA--V-I-------------
B4G7T5_DROPE/36-112----NLI----------------------MLKI---------T-LFVM------------YG--A-T-------------
C3YMP2_BRAFL/14-90----DLL----------------------VVKA---------I-FFLF------------YS--G-T-------------
A3QFN3_SHELP/24-100----QLH----------------------WISA---------C-YFFF------------FA--I-L-------------
Q55CH3_DICDI/11-87----RHT----------------------NLKI---------L-YFFQ------------SA--S-I-------------
B8GQD4_THISH/5-81----PYW----------------------KLSG---------F-YFFY------------FA--S-I-------------
C5BL70_TERTT/2-78----PYW----------------------RLSS---------V-YFFY------------FA--V-V-------------
A7UVG6_ANOGA/14-90----NLI----------------------SLKI---------V-LFLF------------YG--A-L-------------
Q2SJE3_HAHCH/5-81----PIW----------------------KLAG---------F-YFFY------------FA--L-V-------------
B7PL10_IXOSC/7-83----KEL----------------------PMKG---------H-YFFY------------YS--A-L-------------
A8PWD3_MALGO/544-619----MLA----------------------FLGW---------L-SLLH------------FG--I-N-------------
Q4PB45_USTMA/688-764----MLA----------------------FLGW---------V-SILH------------FG--S-N-------------
Q3J7E6_NITOC/9-84----PYW----------------------RLSG---------F-YLFY------------FA--T-L-------------

PF01306

LACY_CITFR/1-412LKNTNFW----------------------MFGF---------F-FFFY------------FF--I.M-------------
RAFB_ECOLX/4-415HKNTDFW----------------------IFGL---------F-FFLY------------FF--I.M-------------
A0A017JVR8_ECOLX/4-411FRN.AYY----------------------RFAS---------S-YSFL------------FF--ISW-------------
LACY_KLEOX/6-416RERHNFI----------------------YFML---------F-FFFY------------YF--I.M-------------

PF06609

Q8NII4_FUSAU/1-598GLFSTLWTMGQAVSILVMGRLTDRFGRRPFVIA---------T-HIIGLVGAIVGCTANKFN--TLL-------------
Q9C1B3_FUSSP/1-598SLFSTLWTTGQAVSILMMGRLTDRFGRRPFVIL---------T-HILGLVGAIVGCTATKFN--TLL-------------

PF06813

Q7XGH1_ORYSJ/34-288----RWF----------------------MMLA---------C-MVIM------------SA--SGG-------------
Q9LUF8_ARATH/16-265----RWL----------------------VFVC---------A-MWVQ------------SV--AGV-------------
Q8H613_ORYSJ/14-261----PWV----------------------GLGA---------A-VWVQ------------VA--GGA-------------
Q94D97_ORYSJ/8-252----HWL----------------------SLVG---------S-IWLQ------------TI--NGP-------------
Q9M8M1_ARATH/13-260----PWV----------------------GLAA---------A-AWVQ------------VS--AGS-------------
Q9ZUV4_ARATH/17-262----RWF----------------------MVFA---------S-FLIM------------AC--AGA-------------
O80960_ARATH/21-266----RWF----------------------MFFG---------S-LLIM------------ST--AGA-------------
Q8H132_ARATH/7-253----KWM----------------------ILVA---------T-IWIQ------------AF--TGT-------------
Q9SLF1_ARATH/14-260----KWL----------------------GFVT---------A-VWVQ------------SI--SGN-------------
F4I9E1_ARATH/43-286----KWT----------------------VLVA---------A-IWIQ------------AS--TGT-------------
F4J4R8_ARATH/23-272----RWT----------------------VLVA---------A-IWIQ------------AF--TGT-------------
Q9S7R2_ARATH/16-263----RWL----------------------VFVA---------A-MWIQ------------SC--AGI-------------

PF13000

C4R336_PICPG/74-584GLA-----------F-----------------------------------------------------GTIPF-------
G0WCJ0_NAUDC/17-577GLA-----------F-----------------------------------------------------GTIPF-------
G8BYR1_TETPH/85-660GLS-----------F-----------------------------------------------------GTVPF-------
Q75EB1_ASHGO/51-585GLA-----------F-----------------------------------------------------GTVPF-------
E7K9I5_YEASA/17-559GLA-----------F-----------------------------------------------------GTVPF-------
Q6CKM4_KLULA/10-515GLT-----------F-----------------------------------------------------GTIPF-------
G0VIX6_NAUCC/41-595GLA-----------F-----------------------------------------------------GTIPF-------
H2AY09_KAZAF/18-574GLA-----------F-----------------------------------------------------GTVPF-------
I2H5Y9_TETBL/23-594GLT-----------F-----------------------------------------------------GTIPF-------
G8JR10_ERECY/17-554GLA-----------F-----------------------------------------------------GTVPF-------
S6E3L5_ZYGB2/13-555GLA-----------F-----------------------------------------------------GTVPF-------
Q6FMM5_CANGA/15-566GLA-----------F-----------------------------------------------------GTVPF-------
C5E2P0_LACTC/16-543GLA-----------F-----------------------------------------------------GTVPF-------
B6ABL4_CRYMR/9-525GLS-----------.-----------------------------------------------------SSIPF-------
G8ZXV2_TORDC/17-551GLA-----------F-----------------------------------------------------GTIPF-------
J7RSN7_KAZNA/20-561GLA-----------F-----------------------------------------------------GAIPF-------

PF07672

Q8EUQ6_MYCPE/191-477GAF-----------F-----------------------------------------------------ANIFF-------
Y077_MYCPN/209-467GLV-----------I-----------------------------------------------------VAAPF-------
Q8EVP4_MYCPE/172-441GAI-----------L-----------------------------------------------------ANVFF-------
Y076_MYCPN/210-484GIV-----------V-----------------------------------------------------AFVPF-------
Q98PH4_MYCPU/154-430GTI-----------I-----------------------------------------------------TLAPF-------
Q7NAK7_MYCGA/200-455GAA-----------F-----------------------------------------------------SLGLF-------

PF03825

YEGT_ECOLI/1-405AWF-----------V-----------------------------------------------------PLWLW-------
Q9A7U2_CAUCR/1-395AWA-----------P-----------------------------------------------------KIFPY-------
XAPB_ECOLI/1-407SWL-----------V-----------------------------------------------------TLGSY-------
NUPG_ECOLI/1-406SWL-----------T-----------------------------------------------------TLGSY-------

PF00854

PTR7_ARATH/99-532LTL...........S-----------------------------------------------------TIIPG-------
F7BBU0_ORNAN/81-472TAI...........S-----------------------------------------------------S.IND-------
PEPT3_CAEEL/82-453LSL...........G-----------------------------------------------------A.VPF-------
PEPT1_CAEEL/113-509LAL...........A-----------------------------------------------------S.TKN-------
PTR12_ARATH/99-524LTI...........Q-----------------------------------------------------ARRPS-------
S15A1_RABIT/81-472TSL...........S-----------------------------------------------------S.VNE-------
PTR30_ARATH/96-518LTM...........A-----------------------------------------------------VTVKS-------
PTR2_ARATH/113-544LTL...........S-----------------------------------------------------ASVPA-------
DTPA_ECOLI/88-460VAW...........S-----------------------------------------------------G.HDA-------
DTPD_ECOLI/76-458LGA...........S-----------------------------------------------------EIHPS-------
YJDL_ECOLI/75-447LGI...........D-----------------------------------------------------T.NST-------
PTR2_SCHPO/158-542LTC...........T-----------------------------------------------------A.IPS-------
S15A2_HUMAN/111-487KSL...........G-----------------------------------------------------A.LPI-------
PTR2_YEAST/155-533LFI...........T-----------------------------------------------------S.IPS-------
S15A1_RAT/81-474ISV...........S-----------------------------------------------------S.IND-------
PTR17_ARATH/124-550LTL...........S-----------------------------------------------------ASLPV-------
S15A4_RAT/94-517FPLLAAPRSRSFLCG-----------------------------------------------------DPHPE-------
DTPT_LACLA/91-474LA.............-----------------------------------------------------..TPF-------
PEPT2_CAEEL/99-494LAF...........S-----------------------------------------------------S.IAP-------
DTPB_ECOLI/81-457TGM...........S-----------------------------------------------------LLKPD-------
YCLF_BACSU/95-469LAY...........P-----------------------------------------------------G.SSI-------

PF06779

Q986E3_RHILO/34-394FVY-----------T-----------------------------------------------------PILPG-------
Q89HQ1_BRADU/48-412FSY-----------T-----------------------------------------------------PLIPA-------
A9CI18_AGRT5/23-387FSF-----------T-----------------------------------------------------PILPG-------
Q88ED9_PSEPK/14-373FAL-----------T-----------------------------------------------------PQLPQ-------
Q8Y185_RALSO/36-399FAF-----------T-----------------------------------------------------PILPM-------
Q9I3T2_PSEAE/20-380FSL-----------T-----------------------------------------------------PQLPH-------
Q89X18_BRADU/63-426FAY-----------A-----------------------------------------------------LVLPD-------
Q92UK2_RHIME/1-365FSY-----------T-----------------------------------------------------PILPA-------
YJIJ_ECOLI/23-381FLY-----------T-----------------------------------------------------PMLPV-------
Q8ZJZ6_SALTY/23-379FLY-----------T-----------------------------------------------------PMLPV-------
Q9PGN0_XYLFA/26-385FLH-----------T-----------------------------------------------------PILPV-------

PF01733

ENT1_ARATH/167-450QGG-----------L---------------------------------------------I-------GVAGE-------
S29A1_RAT/144-455QAS-----------L---------------------------------------------F-------GLAGV-------
S29A2_HUMAN/131-454QGS-----------L---------------------------------------------F-------GQLGT-------
S29A1_HUMAN/144-454QGS-----------L---------------------------------------------F-------GLAGL-------
FUN26_YEAST/180-510QNG-----------I---------------------------------------------M-------AIANV-------
Q19495_CAEEL/137-426ENS-----------V---------------------------------------------Y-------GVFAD-------
Q21145_CAEEL/434-723QNS-----------M---------------------------------------------F-------GLASP-------

PF03239

FTH1_YEAST/8-404IVV-----------I---------------------------------------------V-------SILLT-------
EFEU_BACSU/9-395EDD-----------P---------------------------------------------I-------AALIQ-------
Q9Y8Z4_AERPE/4-268AIL-----------L---------------------------------------------S-------TIIIM-------
Y964_SYNY3/6-291ASL-----------V---------------------------------------------V-------GIVLA-------
FIP1_SCHPO/7-320ASI-----------I---------------------------------------------V-------SVLMS-------
EFEU_ECOLI/1-276AAL-----------I---------------------------------------------V-------SLIAS-------
O83937_TREPA/14-362AAF-----------A---------------------------------------------R-------SVVRA-------
Q9ZC51_YERPE/156-557AEA-----------S---------------------------------------------K-------SVQQA-------
Q9RKQ1_STRCO/1-274ASL-----------V---------------------------------------------V-------CILIA-------
Q9ZDD8_RICPR/1-278ISL-----------L---------------------------------------------L-------SVILA-------
FTR1_YEAST/7-321AVI-----------V---------------------------------------------I-------SVLLS-------
Y154_ARCFU/4-266AAL-----------L---------------------------------------------V-------AVLVA-------
Q9WYP8_THEMA/2-266ASV-----------I---------------------------------------------I-------AVILA-------

PF01770

S19A1_HUMAN/23-434GES-----------F---------------------------------------------I-------TPYLL-------
Q9EQN9_MOUSE/28-459SEP-----------F---------------------------------------------L-------TPYLL-------
Q9VK64_DROME/2-395SEP-----------Y---------------------------------------------V-------TEYLA-------
Q29L76_DROPS/2-397SEP-----------Y---------------------------------------------V-------TEYLA-------
Q294A5_DROPS/2-414SEP-----------Y---------------------------------------------H-------AEILM-------
Q9VGV5_DROME/2-408SEP-----------Y---------------------------------------------V-------TEYLL-------
Q16JT2_AEDAE/2-405SDP-----------F---------------------------------------------V-------VQFLN-------
S19A3_HUMAN/10-441SEP-----------F---------------------------------------------L-------IPYLS-------
Q1LV16_DANRE/4-414AEP-----------F---------------------------------------------L-------TPYLV-------
Q9VGV6_DROME/2-411SEP-----------Y---------------------------------------------H-------AEILM-------
FOLT2_CAEEL/2-394TEP-----------Y---------------------------------------------M-------YEYQH-------
Q28C92_XENTR/10-422VDP-----------F---------------------------------------------T-------AQYFT-------
Q7Q5N2_ANOGA/2-422SEP-----------F---------------------------------------------V-------TEFLS-------
A8BIM9_GIAIC/39-447AEP-----------F---------------------------------------------V-------VPYYI-------
A7SN54_NEMVE/6-420SEP-----------F---------------------------------------------L-------TPYLR-------
S19A3_MOUSE/11-435SEA-----------F---------------------------------------------L-------IPFLS-------
F1N2M7_BOVIN/23-430GES-----------F---------------------------------------------I-------TPYLL-------
F1NVD6_CHICK/32-445GES-----------F---------------------------------------------I-------TPYLL-------
F7EDM0_XENTR/76-481GES-----------F---------------------------------------------I-------TPYLL-------
H3CDB6_TETNG/12-433IEP-----------F---------------------------------------------L-------FAYLT-------
S19A1_MOUSE/23-426GES-----------F---------------------------------------------I-------TPFLL-------

PF03219

TLC2_ARATH/88-571IFG-----------V---------------------------------------------EVTTLK--KIVPL-------
TLC1_CHLTR/2-492LWP-----------I---------------------------------------------HMHELK--KVLPM-------
Q6MEN4_PARUW/1-484FWP-----------I---------------------------------------------HGHEVK--KVLPM-------
Q6MBI2_PARUW/1-474...-----------.---------------------------------------------TLLILK--KRSLI-------
Q6MEN5_PARUW/4-499LWP-----------V---------------------------------------------HRYELK--KLIPM-------
Q6MEM5_PARUW/2-491FWP-----------V---------------------------------------------HGYELK--KLLPM-------
A5CCG3_ORITB/1-504LWP-----------I---------------------------------------------ELHEMK--LFMPM-------
Q1MSG2_LAWIP/9-504LWP-----------V---------------------------------------------YNFELK--KFLPM-------
C4YY86_9RICK/5-489IWP-----------I---------------------------------------------ERYENK--KFLPM-------
C4YYY2_9RICK/12-501VWP-----------I---------------------------------------------RSYELT--KFIPM-------
C4YZB1_9RICK/5-496IWP-----------I---------------------------------------------ERKELK--LFIPM-------
F8KVN2_PARAV/3-490FWP-----------V---------------------------------------------HNYELR--KLLPM-------
TLCE_RICPR/7-496FWP-----------V---------------------------------------------HNYELG--KFIPI-------
TLC2_CHLTR/2-500FFP-----------I---------------------------------------------YRSEFS--KFIPL-------
TLCD_RICPR/14-503IWP-----------I---------------------------------------------KRHEIS--KFLFI-------

PF06963

S40A2_ARATH/31-479RWG-----------A---------------------------------------------RTWEFS--VALYM-------
S40A1_ORYSJ/21-450RWG-----------A---------------------------------------------RMWEFS--VGLYM-------
S40A1_ARATH/35-483RWS-----------A---------------------------------------------RTWEFS--VALYM-------
A2R421_ASPNC/42-466TWN-----------S---------------------------------------------RMFEFG--AVLFL-------
Q5AXY5_EMENI/19-441TWN-----------S---------------------------------------------RMFEFG--AVVFL-------
Q8IA95_CAEEL/5-448TLG-----------D---------------------------------------------RMWAFV--IGLFM-------
S40A3_ARATH/146-569NLV-----------E---------------------------------------------QLWNFA--WPSAI-------
Q0CWF0_ASPTN/44-463TWN-----------S---------------------------------------------RMFEFG--SVLFL-------
Q4PD48_USTMA/82-563SWG-----------Y---------------------------------------------RSAEFA--YPLMM-------
S40A1_HUMAN/22-531TWG-----------D---------------------------------------------RMWHFA--VSVFL-------
S40A1_DANRE/19-522TWG-----------D---------------------------------------------RMWNFA--VAVFL-------
A8X2J9_CAEBR/13-461CLE-----------D---------------------------------------------RAWSFC--VSLCM-------
A5BT51_VITVI/32-472RWG-----------A---------------------------------------------RMWEFS--VGLYM-------
A1CBM9_ASPCL/39-469TWN-----------S---------------------------------------------RMFEFG--AILFL-------
S40A3_ORYSJ/147-569NAT-----------E---------------------------------------------QLWNFT--WPAAV-------
H3DM67_TETNG/10-523MWG-----------D---------------------------------------------RMWHFA--ISVFL-------

PF13347

D2VB35_NAEGR/31-486IDM-----------H---------------------------------------------LTKYYMEDICKYY-------
B8B7S1_ORYSI/22-442TSS-----------C---------------------------------------------WFTYLL....VFL-------
Q8I3H5_PLAF7/62-507MNL-----------I---------------------------------------------STIYTS....YFY-------
C5BVC3_BEUC1/22-453SSV-----------L---------------------------------------------IHNVYV....KFY-------
A0A031WJE7_PEPDI/25-461AYN-----------F---------------------------------------------IGYFVSTVTNIFL-------
B3W8U5_LACCB/11-452AYY-----------L---------------------------------------------YTAVLM....MFI-------
C3Z8Z9_BRAFL/15-394TWT-----------V---------------------------------------------LGAYTS....TFL-------
B5X2T0_SALSA/38-502TAN-----------A---------------------------------------------KGFFLQ....IFL-------
NLS1_XENTR/37-494TGC-----------A---------------------------------------------LGFFLQ....IFL-------
D0KIC2_PECWW/9-445ALA-----------I---------------------------------------------SGAWLM....YFY-------
B1S9F4_9BIFI/14-474QGA-----------L---------------------------------------------VATYLA....LFW-------
A4AJK9_9ACTN/13-439FGA-----------L---------------------------------------------PGLVLV....YFL-------
E8WA27_STRFA/18-443FAT-----------V---------------------------------------------PGLILL....YYL-------
A1SNV8_NOCSJ/11-434FGT-----------V---------------------------------------------PGLMLL....PYL-------
A3V2V1_9RHOB/6-408AGL-----------P---------------------------------------------IYIYAP....KYY-------
Q28K27_JANSC/7-401AGL-----------P---------------------------------------------IYIHAP....KFY-------
B9KP25_RHOSK/4-400AGL-----------P---------------------------------------------IYIHAP....KVY-------
B6AV21_9RHOB/12-414AGL-----------P---------------------------------------------IYIHAP....KFY-------
A6E455_9RHOB/14-411AGL-----------P---------------------------------------------LYIHAP....KFY-------
A8TM36_9PROT/10-426LGV-----------P---------------------------------------------LYIFLP....TFY-------
A7HQL5_PARL1/9-433FGY-----------P---------------------------------------------VAVWLP....PFY-------
Q026U3_SOLUE/21-465KTV-----------T---------------------------------------------FALYGL....FFA-------
Q0AL93_MARMM/17-465KDV-----------A---------------------------------------------FRAYLL....WYY-------
Q2G9N1_NOVAD/12-450KDN-----------G---------------------------------------------FATFLL....LFY-------
Q2N8H6_ERYLH/12-453KDL-----------G---------------------------------------------FSFFLL....PYY-------
C0D597_9CLOT/17-465AMF-----------L---------------------------------------------MMQY.S....YFT-------
A6NPU4_9FIRM/28-469SSG-----------I---------------------------------------------FTSFLN....KYF-------
C6LHW9_9FIRM/41-483YYS-----------V---------------------------------------------AGTYLT....QFY-------
Q5YU93_NOCFA/38-478LNA-----------V---------------------------------------------LATYLN....VYY-------
Q0F3N0_9PROT/19-595ANA-----------A---------------------------------------------ILSLVY....PIF-------
D4LG93_9FIRM/21-452MSN-----------I---------------------------------------------ETFYFM....TFL-------
A6TPY1_ALKMQ/9-433MMT-----------L---------------------------------------------ATTYYS....YFL-------
A6TPY6_ALKMQ/10-436MMM-----------G---------------------------------------------AVTYYA....YFL-------
C5EQ37_9FIRM/10-441CYN-----------F---------------------------------------------VLSFFS....FFM-------
B7GTV4_BIFLS/22-444SYG-----------I---------------------------------------------IGSFIL....IYY-------
B0NCA5_CLOSV/62-493VYA-----------F---------------------------------------------LSAFVM....IYL-------
D4L2L1_9FIRM/9-431FYG-----------L---------------------------------------------VG.YMT....TYF-------
C9BIA1_ENTFC/23-456ILG-----------L---------------------------------------------VNSFLM....IYY-------
C3W9X3_FUSMR/14-452MLI-----------F---------------------------------------------VSQFLM....VFY-------
D1PII8_9FIRM/14-445TFI-----------F---------------------------------------------STMMLM....KFY-------
C0BCF9_9FIRM/22-465VYM-----------L---------------------------------------------SASYVL....YYY-------
C4Z9B4_EUBR3/7-441VYM-----------L---------------------------------------------ISSYLL....YYY-------
C9QHC7_VIBOR/7-438AIT-----------I---------------------------------------------VYMYLM....FYY-------
B0NX91_9CLOT/12-438IYG-----------M---------------------------------------------MATFAM....IYF-------
C3WEF2_FUSMR/7-437ILA-----------Y---------------------------------------------VGVFLM....IYF-------
C0BFD6_9FIRM/20-452ICN-----------L---------------------------------------------VGAFLM....LYF-------
C3WB69_FUSMR/6-433ACA-----------I---------------------------------------------IYIFLM....YYL-------
M2C6H5_TREDN/4-434VYS-----------L---------------------------------------------ISMYLI....FYM-------
C7XWC4_9LACO/6-449FYG-----------I---------------------------------------------LNTYML....MFI-------
B2GBT3_LACF3/22-466FYG-----------A---------------------------------------------LSTYFI....VYV-------
E7FT79_9LACO/16-461FYA-----------A---------------------------------------------LSNYFI....IFV-------
D0DS55_LACFE/13-457FYG-----------M---------------------------------------------LSTYFM....MFV-------
C0WMV6_LACBU/20-464FYA-----------T---------------------------------------------LSTYFM....IFI-------
Q6SCS3_STRTR/10-454FYA-----------T---------------------------------------------LSTYFI....MFV-------
B1SH60_9STRE/18-462FYA-----------T---------------------------------------------LSTYFI....TFI-------
C5RC37_WEIPA/6-451FYA-----------T---------------------------------------------LSTYFM....MFV-------
C8P5V7_9LACO/3-447FYN-----------T---------------------------------------------LSIYFM....MFI-------
Q03PA7_LACBA/4-451FYA-----------T---------------------------------------------LSTYFA....MFV-------
A8RLH8_CLOBW/23-450MYY-----------W---------------------------------------------LSTYLM....IYY-------
B0NC69_CLOSV/24-452PWM-----------L---------------------------------------------VSAYLA....FYM-------
R7CNT8_9FIRM/14-438SWM-----------F---------------------------------------------VSNFLM....IFY-------
B1BWZ1_CLOPF/8-434TEQ-----------F---------------------------------------------RAMFLT....VFY-------
A9MYD9_SALPB/15-438MLS-----------I---------------------------------------------GTLYFL....KFY-------
A9QSF4_LACLK/37-463MFD-----------L---------------------------------------------GQAYLT....KFW-------
C6PWS4_9CLOT/17-439MFD-----------L---------------------------------------------GQAYLS....KFF-------
F0K7R1_CLOAE/8-431MFD-----------L---------------------------------------------GQSYLL....KFY-------
D4F9L7_EDWTA/9-430AFA-----------M---------------------------------------------GALFLL....SYY-------
D4BGD4_9ENTR/26-444ICT-----------M---------------------------------------------IVTFLM....LYY-------
A4WD81_ENT38/20-469VFG-----------T---------------------------------------------IGGFLA....LHM-------
C8P9N3_9LACO/19-468IFG-----------T---------------------------------------------IGSMLL....FYL-------
D1BWG8_XYLCX/30-459IYN-----------T---------------------------------------------VSTYLL....FFY-------
C8P9N0_9LACO/19-447IYT-----------T---------------------------------------------ISTYLL....FFY-------
J4NZS7_OENOE/11-431VFQ-----------M---------------------------------------------LTTYLL....FFY-------
A6DPD4_9BACT/8-427NFQ-----------L---------------------------------------------IGFYLA....YFY-------
B1ZS00_OPITP/13-436VWS-----------A---------------------------------------------LAIIIT....FFY-------
B3HTC5_ECOLX/7-428VMM-----------S---------------------------------------------LAMIIT....YFY-------
D2TGV7_CITRI/11-433VWQ-----------T---------------------------------------------ATLFLA....FFY-------
L0W055_SERPL/8-433IWQ-----------T---------------------------------------------IMLFMA....YFY-------
D0KF27_PECWW/10-433VWQ-----------T---------------------------------------------VMLFMA....YFY-------
D3RGD6_KLEVT/10-434VWQ-----------T---------------------------------------------VMLFMA....WFY-------
C1MDP3_9ENTR/24-449ITC-----------L---------------------------------------------IMNFLT....FFY-------
A0A025G5J5_ECO57/10-432IFD-----------N---------------------------------------------VMLYMM....FFY-------
D2ZB78_9ENTR/9-430GLD-----------N---------------------------------------------VIIFLT....FYY-------
E6WJ95_PANSA/9-430AID-----------N---------------------------------------------VIIFLT....FYY-------
D4GIM8_PANAM/27-451LFN-----------P---------------------------------------------ITMFLS....FFY-------
C9XVR9_CROTZ/33-456IFG-----------A---------------------------------------------IMLFVN....YFY-------
A0A023UW17_SERPL/19-442IWS-----------V---------------------------------------------LALYLT....WFY-------
A6G4R1_9DELT/26-447YWT-----------T---------------------------------------------IASFLA....AFY-------
A4AAW4_9GAMM/14-442YMG-----------F---------------------------------------------FGLFLL....YYY-------
A6DP62_9BACT/9-590FWM-----------Q---------------------------------------------FIWYLN....YFY-------

PF11700

A7K364_VIBSE/8-434FSF-----------G---------------------------------------------L-------VGSFILYFYTDI
Q8DIR0_THEEB/14-463LGA-----------A---------------------------------------------I-------TANLQVFFLMVF
Q4JAW8_SULAC/5-379SAQ-----------Y---------------------------------------------.-------..FYLPVYFE..
A0A059FXI1_9RHOB/25-469YIG-----------L---------------------------------------------V-------NGFLFAPYFATL
A0A059FSZ2_9RHOB/23-495YYI-----------L---------------------------------------------I-------VIYVFAPYFARD
Q0U0L9_PHANO/44-456TAG-----------M---------------------------------------------A-------F.RYVPAVLQSA
A1CD46_ASPCL/43-518TSS-----------M---------------------------------------------.-------VNNYVTAAILSA
ATG22_CANAL/39-496VAS-----------M---------------------------------------------.-------SRTYIPASIQSI
A3LP71_PICST/32-502VAS-----------M---------------------------------------------.-------SRTYVPAVIQSI
Q75EJ9_ASHGO/58-558TYV-----------M---------------------------------------------.-------MRSFVPASLQTI
Q6CKN0_KLULA/64-544TAA-----------M---------------------------------------------.-------MRSYVPATIQTT
A7EQB6_SCLS1/56-534IGS-----------F---------------------------------------------.-------..QYSSLLFQNL
A5DD56_PICGU/47-524TGP-----------Y---------------------------------------------.-------..TFTPTQYQNL
Q4PA89_USTMA/59-561LGP-----------F---------------------------------------------.-------..NFAPSQFQNL
F5HBL2_CRYNB/49-483LGP-----------F---------------------------------------------.-------..NFAISAWQNL
Q0TYS2_PHANO/43-505LTL-----------F---------------------------------------------.-------..NFGPTAFQNL
Q0CF56_ASPTN/43-493FYL-----------L---------------------------------------------T-------DIDFAPTAFQNL
Q5B0Q4_EMENI/43-494LSL-----------F---------------------------------------------.-------..NFAPTAFQNL
Q0CXZ2_ASPTN/50-478FG.-----------.---------------------------------------------.-------.....PTAFQNL
A1DH52_NEOFI/48-512LSL-----------F---------------------------------------------.-------..NFAPTAFQNL
ATG22_SCHPO/13-525TAI-----------I---------------------------------------------S-------MGVYVPLIVMKN
A9WGR7_CHLAA/9-439FST-----------T---------------------------------------------V-------VTVFLGPYLTSI
A4X7E0_SALTO/18-457FQT-----------T---------------------------------------------V-------ITVFLGPFLTTV
A6E856_9SPHI/5-431YNL-----------V---------------------------------------------I-------TSTIFPAYYTII
Q26DY7_FLABB/8-443YSL-----------V---------------------------------------------I-------TSAIFPIFYSVV
A6H0A9_FLAPJ/7-445YSL-----------V---------------------------------------------I-------ASAIFPIFYEMI
ATG22_CRYNJ/1-531FSS-----------Y---------------------------------------------.-------............
AT222_PHANO/72-634FVV-----------C---------------------------------------------G-------IGSFIPVTLEQL
ATG22_COCIM/35-567FAV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT221_PENCW/20-562FVV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT221_ASPFU/24-580FTV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT222_ASPCL/24-579FTV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT221_ASPNC/30-582FTV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT221_ASPOR/20-571FTV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT221_EMENI/24-564FTV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT222_ASPTN/24-571FTV-----------C---------------------------------------------A-------MGSFLPITLEQM
AT222_SCLS1/72-619FVI-----------C---------------------------------------------G-------IGSFIPITLEQL
L7I128_MAGOY/99-626YVI-----------C---------------------------------------------A-------ISSFIPILLESL
ATG22_NEUCR/155-689YVI-----------C---------------------------------------------G-------IGSFIPILLESL
AT221_BOTFB/21-562FAV-----------C---------------------------------------------A-------VGSFLPVTLEQL
AT222_PENCW/33-580FAV-----------C---------------------------------------------G-------VGSFLPLTLEQL
AT222_ASPOR/30-578FAV-----------C---------------------------------------------G-------VGSFLPLTLEQL
AT222_EMENI/31-576FAV-----------C---------------------------------------------G-------VGSFLPLTLEQL
ATG22_YARLI/6-582FMV-----------V---------------------------------------------A-------VATYIPQLLQSY
ATG22_PICAN/27-551FIV-----------S---------------------------------------------V-------VGTYVPLLLEQI
M9N7N8_ASHG1/19-490FIV-----------S---------------------------------------------A-------MSTYFPLLLEEF
N1P7Z2_YEASC/20-514FVV-----------S---------------------------------------------A-------VSTYIPLLLQQF
ATG22_CANGA/31-527FVV-----------S---------------------------------------------A-------VATYVPLLLEQF
ATG22_KLULA/17-487FIV-----------S---------------------------------------------A-------VSTYVPLLLEQF
ATG22_VANPO/27-511FVV-----------S---------------------------------------------A-------IATYIPLLLEQF

PF03092

Q25272_LEIDO/59-606---------------------------------------------------------------------------MLTGR
B3GVG0_TRYBB/138-667---------------------------------------------------------------------------MFTYT
Q9UAB8_LEIDO/94-683---------------------------------------------------------------------------MFMSR
Q9UAB7_LEIDO/75-654---------------------------------------------------------------------------MMIDR
Q9UAC0_LEIDO/76-655---------------------------------------------------------------------------MMIDR
Q9UAC1_LEIDO/75-651---------------------------------------------------------------------------MMIDR
FBT8_ARATH/98-515---------------------------------------------------------------------------HMVHS
FBT7_ARATH/30-441---------------------------------------------------------------------------FLTEQ
FBT3_ARATH/61-473---------------------------------------------------------------------------YFKDE
FBT1_ARATH/137-553---------------------------------------------------------------------------YLKDD
F7USN5_SYNYG/46-457---------------------------------------------------------------------------FLKDE
O68867_SYNE7/38-441---------------------------------------------------------------------------FLKDD

PF00083

GTR4_MOUSE/27-483INA-----------P---------------------------------------------Q-------KVIEQSYNAT.W
GTR1_MOUSE/14-467INA-----------P---------------------------------------------Q-------KVIEEFYNQT.W
QUTD_EMENI/24-490IGT-----------T---------------------------------------------L-------SLQSFQNEFN.W
ITR2_YEAST/112-569ISS-----------A---------------------------------------------L-------ISINRDLDNK.V
SNF3_YEAST/100-556INS-----------I---------------------------------------------T-------SMNY.VKSHV.A
GALP_ECOLI/18-451IAG-----------A---------------------------------------------L-------PFIA...DEF.Q
HXT5_YEAST/89-549ISG-----------F---------------------------------------------V-------RQTDFIRRFG.S
GTR3_MOUSE/13-465INA-----------P---------------------------------------------E-------TILKDFLNYT.L
HXT9_YEAST/64-526ISG-----------F---------------------------------------------V-------NLSDFIRRFG.Q
HXT8_YEAST/69-530ISG-----------F---------------------------------------------V-------NQTDFLRRFGNY
HXT6_YEAST/68-528ISG-----------F---------------------------------------------I-------NQTDFIRRFG.M
GTR3_CHICK/14-464INA-----------P---------------------------------------------E-------KIIQAFYNRT.L
GTR5_HUMAN/20-475VNS-----------P---------------------------------------------A-------LLMQQFYNET.Y
HXT13_YEAST/60-521TAG-----------F---------------------------------------------I-------NMDNFKMNFG.S
YB91_YEAST/27-485LNA-----------P---------------------------------------------Q-------EFLSCSRFEA.P
PROP_ECOLI/25-453YGF-----------V---------------------------------------------A-------YALGKVFFPG.A
JEN1_YEAST/125-563MGY-----------F---------------------------------------------A-------WLSAAWAFFC.V
GIT1_YEAST/43-466NGS-----------M---------------------------------------------S-------MLNKVFVMEY.G
GTR2_MOUSE/13-498INA-----------P---------------------------------------------Q-------EVIISHYRHV.L
HXT2_YEAST/59-519ISG-----------F---------------------------------------------V-------NQTDFKRRFG.Q
XYLE_ECOLI/13-478ISG-----------T---------------------------------------------V-------ESLNTVFVAP.Q
LACP_KLULA/75-529MGS-----------I---------------------------------------------Y-------TEDAYLKYYH.L
STP1_ARATH/26-489SGG-----------V---------------------------------------------T-------SMPSFLKRFF.P
MAL31_YEAST/102-561LGA-----------F---------------------------------------------Y-------ALPVFQKKYG.S
QAY_NEUCR/24-494IGT-----------T---------------------------------------------L-------ALPSFTKEFD.F
GLF_ZYMMO/13-469IAA-----------I---------------------------------------------G-------TPVD..IHFI.A
STL1_YEAST/30-488MAS-----------L---------------------------------------------I-------TGKQFNYEFP.A
ARAE_ECOLI/25-461IAG-----------A---------------------------------------------L-------PFIT...DHF.V
GAL2_YEAST/74-534ISG-----------F---------------------------------------------V-------VQTDFLRRFG.M
A4I0Q6_LEIIN/5-442INA-----------A---------------------------------------------L-------FQMK..DHFG.F
A4I8N6_LEIIN/77-573VGP-----------Y---------------------------------------------S-------TMYGYASNCQ.L
Q38AB8_TRYB2/39-501VAV-----------Y---------------------------------------------I-------LLYEVATNCS.L
Q38AB9_TRYB2/39-500VAV-----------Y---------------------------------------------L-------LLYLTATECK.F

PF05977

Q92LE2_RHIME/11-531LGW-----------L---------------------------------------------V-------QTVAISWLMASI
Q98HB4_RHILO/11-532FGG-----------L---------------------------------------------I-------QGVGAAWMMTTI
Q92Y88_RHIME/8-530TGS-----------F---------------------------------------------I-------RDVASSWLVTDL
A9CFW7_AGRT5/8-530TGS-----------F---------------------------------------------M-------RDVASSWLMTDL
Q9HYE1_PSEAE/25-549LGT-----------W---------------------------------------------A-------QSVAAAWVVTDA
Q989L4_RHILO/31-551LGW-----------L---------------------------------------------I-------QMVAISWLMATI
Q92SW7_RHIME/14-535FGG-----------L---------------------------------------------I-------QAVGAAWLMTSI
Q989T8_RHILO/11-532LGW-----------L---------------------------------------------M-------QAVAISWLMATI
Q9I0E1_PSEAE/6-529IGT-----------W---------------------------------------------M-------HEVGAGWLMTSL

PF07690

O17785_CAEEL/33-439LTL-----------N---------------------------------------------F.......TIICM.......
A0A038FBG6_MYCTX/18-356VAF-----------L---------------------------------------------I.......P..RL.......
ANTR2_ARATH/137-500NMS-----------I---------------------------------------------A.......IL.PM.......
Q19296_CAEEL/16-403ILP-----------L---------------------------------------------F.......PT.IL.......
A9CFQ9_AGRT5/27-373IYI-----------L---------------------------------------------V.......P..FW.......
A0A028WC33_STAAU/10-348LWP-----------L---------------------------------------------N.......TI.YM.......
I0ZIS1_HELPX/8-347VLP-----------V---------------------------------------------I.......S..LY.......
C3MP39_SULIL/20-385VIA-----------S---------------------------------------------I...................
D7GFS1_PROFC/22-419VAI-----------G---------------------------------------------M.......H..TL.......
O66589_AQUAE/21-406LLG-----------A---------------------------------------------L.......GP.FI.......
A0A022P0M0_PSEAI/19-362FSL-----------F---------------------------------------------I.......AP..M.......
MFSD9_HUMAN/49-427VVP-----------L---------------------------------------------L.......SL.HV.......
Q97CG2_THEVO/16-347VVP-----------V---------------------------------------------F.......T..LY.......
F2HKW9_LACLV/24-427LSP-----------A---------------------------------------------L.......V..TM.......
F6BV17_SINMB/23-360LTA-----------L---------------------------------------------Y.......P..LL.......
D1EUE3_BRUML/8-339LGI-----------P---------------------------------------------L.......LS.VL.......
N0C478_SALTI/17-369TSG-----------T---------------------------------------------L.......QA.WM.......
I0LFL8_CORGK/19-414IGP-----------D---------------------------------------------M...................
Q9YG70_AERPE/18-417LYT-----------S---------------------------------------------V.......P..AI.......
Q9HLN0_THEAC/12-329LEP-----------M---------------------------------------------I.......SIDLH.......
M4UM27_RALSL/30-433SVF-----------W---------------------------------------------L.......PL..........
A7WY21_STAA1/33-313FSL-----------A---------------------------------------------M.......PA..........
D6EGQ9_STRLI/61-422FAS-----------A---------------------------------------------E.......DTLHE.......
Q8NNT7_CORGL/10-351LLP-----------V---------------------------------------------V.......PLAVL.......
M4MIX3_SINM2/13-355SLP-----------V---------------------------------------------F.......LV.PI.......
I6V0W9_9EURY/13-389YNA-----------Y---------------------------------------------I.......PI.FL.......
O58400_PYRHO/34-380GYP-----------Y---------------------------------------------L.......T..VY.......
A1EPJ6_VIBCL/16-353FQP-----------M---------------------------------------------L.......P..YL.......
Q9KWU2_SPHSX/13-348SAS-----------L---------------------------------------------F.......ALQHN.......
A0A008NSL7_STAAU/18-353YIL-----------S---------------------------------------------Y.......IN.FL.......
C8K874_LISMN/13-349LMV-----------I---------------------------------------------I.......AV.IA.......
NART_STACT/13-344IAP-----------L---------------------------------------------M.......P..MI.......
Q9K646_BACHD/13-358TTF-----------T---------------------------------------------V.......SW.LM.......
YLZ2_SCHPO/48-434FAP-----------S---------------------------------------------I.......S..NI.......
E8VD81_BACST/15-348FLT-----------V---------------------------------------------L.......PI.YT.......
Q1K517_NEUCR/132-490PGA-----------L---------------------------------------------I.......P..SI.......
O54179_STRCO/33-428LNV-----------A---------------------------------------------L.......P..AI.......
Q98B83_RHILO/60-407LMP-----------F---------------------------------------------F.......PL.WA.......
A0A017M9G1_ECOLX/39-413NIG-----------F---------------------------------------------A.......GL.TM.......
Q9EYN6_SYNPW/18-450LAP-----------L---------------------------------------------A.......T..TV.......
Q9KBG2_BACHD/16-398FNF-----------V---------------------------------------------L.......A..DI.......
Q986N1_RHILO/24-356LGP-----------I---------------------------------------------A.......P..AV.......
Q93LX8_9ACTO/30-425ALV-----------A---------------------------------------------L.......P..AI.......
Q8KDQ3_CHLTE/9-374VLP-----------L---------------------------------------------L.......P..TY.......
Q9PCL3_XYLFA/32-422VNV-----------A---------------------------------------------L.......P..TL.......
Q9URI1_CANAX/123-512YTP-----------G---------------------------------------------I.......E..EL.......
A0A016X6J9_VIBCL/22-366YLP-----------A---------------------------------------------M.......P..TI.......
M4MHF4_SINM2/19-357APA-----------A---------------------------------------------L.......A..AV.......
Q9RSF5_DEIRA/46-397LFP-----------I---------------------------------------------I.......GP..L.......
LIZ1_SCHPO/36-407INN-----------A---------------------------------------------Y.......LS.GM.......
F0K3Z3_CLOAE/13-357TTI-----------A---------------------------------------------L.......ANKVIG......
A0A030S566_PSEAI/29-430HVT-----------E---------------------------------------------I.......AMTDV.......
A0A024SUQ9_PSEAI/12-346TQG-----------I---------------------------------------------F.......D..EL.......
Q9KYI2_STRCO/15-371FAP-----------L---------------------------------------------A.......FL.YF.......
Q973W8_SULTO/12-335AVA-----------S---------------------------------------------F.......PIIFV.......
Q18472_CAEEL/18-397INF-----------T---------------------------------------------F.......I..CM.......
Q8ZXX0_PYRAE/10-352...-----------.---------------------------------------------...........VV.......
Q9AA55_CAUCR/30-391MLS-----------V---------------------------------------------L.......PA..........
YN42_SCHPO/141-527..F-----------A---------------------------------------------V.......PAEAI.......
A0A008B8F0_STAAU/16-376ISY-----------I---------------------------------------------A.......KQ.MM.......
Q961H2_DROME/54-453IGA-----------V---------------------------------------------Y.......QNQILYQT....
C3SM02_ECOLX/36-398FNA-----------A---------------------------------------------V.......PE.IL.......
Q8KCE7_CHLTE/27-390VSI-----------G---------------------------------------------Q.......AY.IL.......
P95852_SULSF/9-333LRI-----------I---------------------------------------------I.......P..VF.......
O45678_CAEEL/27-403SLP-----------I---------------------------------------------S.......AA.AV.......
A0A030YLG4_PSEAI/21-369IGA-----------I---------------------------------------------A.......V..FV.......
O30222_ARCFU/15-357YSF-----------T---------------------------------------------A.......P..QI.......
B0R8P5_HALS3/24-368VVP-----------V---------------------------------------------L.......GEDVL.......
Q8TR38_METAC/18-398ILT-----------F---------------------------------------------L.......V..FL.......
Q986D7_RHILO/41-396PAT-----------A---------------------------------------------V..........VL.......
O69759_PSEFL/31-392LGF-----------A---------------------------------------------I.......P..GI.......
Q9HLR9_THEAC/6-377TNP-----------M---------------------------------------------I.......PL.FV.......
H6NYS0_SALTI/13-352FSY-----------F---------------------------------------------K.......TP.LM.......
O28944_ARCFU/4-328VIP-----------I---------------------------------------------I.......P..SY.......
A1EJD6_VIBCL/40-383AWP-----------F---------------------------------------------L.......VV.FL.......
Q96XQ4_SULTO/9-336AWS-----------I---------------------------------------------V..........SV.......
A0A023BKQ7_LISMN/13-376VFP-----------F---------------------------------------------L.......TI.YF.......
O62376_CAEEL/16-394VKS-----------S---------------------------------------------I.......KADWL.......
YCUD_SCHPO/89-473IWS-----------S---------------------------------------------T.......ACINF.......
A0A038KTQ1_MYCTX/25-423TIS-----------L---------------------------------------------L.......PS.TI.......
Q9KG75_BACHD/5-341QLP-----------I---------------------------------------------I.......TPYAL.......
Q7JZE2_DROME/46-458LGM-----------I---------------------------------------------ILKMVMPRPEDALVVPAGLS
A0A016X795_VIBCL/36-395LGV-----------V---------------------------------------------K.......KPMLD.......
B0RRS7_XANCB/26-418LAT-----------A---------------------------------------------L.......P..TL.......
H1XFL1_9XANT/19-356AQP-----------L---------------------------------------------L.......E..TL.......
YQ92_SCHPO/20-407ITP-----------I---------------------------------------------L.......PF.SL.......
O16697_CAEEL/36-432YYM-----------S---------------------------------------------M.......WPYLS.......
A0A029SIS1_STRPY/10-353VMP-----------F---------------------------------------------M.......A..LY.......
Q1K880_NEUCR/87-498TAA-----------V---------------------------------------------Y.......S..II.......
H1CQV8_CLOPF/26-404ISP-----------D---------------------------------------------L...................
O58488_PYRHO/9-354FMG-----------V---------------------------------------------A.......KP.DI.......
Q9K9F3_BACHD/14-368SFG-----------A---------------------------------------------F.......VQ.PW.......
O29880_ARCFU/11-360SVF-----------V---------------------------------------------N.......PL..........
Q97C48_THEVO/19-351TWP-----------F---------------------------------------------M.......AV.YF.......
Q9Y7D4_ASPTE/35-449IVT-----------A---------------------------------------------I.......P..HI.......
F7ZPU5_CLOAT/23-413LNV-----------A---------------------------------------------F.......P..TL.......
Q8MPU6_CAEEL/90-445IAP-----------F---------------------------------------------Y.......PAEAK.......
Q96Y06_SULTO/9-344LPT-----------V---------------------------------------------Y.......G..FM.......
A9CIR5_AGRT5/18-359FLP-----------S---------------------------------------------L.......SAMAL.......
Q8ZWZ3_PYRAE/12-326LAP-----------V---------------------------------------------L.......P..AI.......
A0A025FMH0_ECO57/20-357QTP-----------T---------------------------------------------L.......SI.FL.......
G4UU99_NEUT9/52-417IGN-----------A---------------------------------------------R.......IQ.GL.......
A0A038F9G3_MYCTX/16-365LGP-----------Y---------------------------------------------L.......SI.YL.......
Q19845_CAEEL/45-446FFT-----------S---------------------------------------------M.......YPYIL.......
A0A028WR33_STAAU/12-354LNV-----------F---------------------------------------------I.......P..LR.......
L8ADD9_BACIU/19-353MGP-----------F---------------------------------------------M.......VL.YL.......
Q8ZVF8_PYRAE/4-322AII-----------A---------------------------------------------I.......PP.YL.......
O58825_PYRHO/10-360QDV-----------A---------------------------------------------V.......PL.YV.......
A0A017MXT2_ECOLX/8-341IMG-----------V---------------------------------------------L.......T..EL.......
Q9L8Q4_PSEST/17-351AIG-----------I---------------------------------------------L.......GP.HL.......
Q9XXC1_CAEEL/44-436SMV-----------N---------------------------------------------P.......QSSPY.......
Y4007_STRCO/39-376AAP-----------L---------------------------------------------L.......P..LI.......
Q8YQ15_NOSS1/8-358FIQ-----------A---------------------------------------------L.......PV.FM.......
O93992_CANAX/65-459VAL-----------A---------------------------------------------T.......P..QI.......
Q8YWH2_NOSS1/17-343FNP-----------F---------------------------------------------I.......STLMK.......
Q9RSM6_DEIRA/32-418VGT-----------M---------------------------------------------M.......P..RV.......
Q9VDS0_DROME/61-500IIF-----------T---------------------------------------------G.......PELYP.......
A0A030RLT0_PSEAI/28-357IGP-----------L---------------------------------------------L.......EEITA.......
M4MMB5_SINM2/19-421AST-----------V---------------------------------------------L.......SL.GR.......
I3XGH7_RHIFR/18-362NGP-----------F---------------------------------------------W.......P..IQ.......
Q8XGP2_RALSO/41-431ANT-----------A---------------------------------------------L.......P..EI.......
J7JJU9_BACIU/15-364HIL-----------A---------------------------------------------V.......LT.LA.......
E3YYX7_LISIO/14-347VDP-----------L---------------------------------------------L.......P..SI.......
F7UKI9_SYNYG/19-365TWV-----------G---------------------------------------------L.......A..LL.......
B8H5X3_CAUCN/31-388IGF-----------L---------------------------------------------K.......H..DL.......
D6EJD0_STRLI/29-361PIG-----------L---------------------------------------------L.......T..SI.......
Q97BG6_THEVO/17-357SFI-----------F---------------------------------------------L.......PL.IF.......
Q9X4X9_9PSED/27-377FGT-----------L---------------------------------------------V.......V..PL.......
Q973J7_SULTO/8-320NII-----------I---------------------------------------------I.......AL.YF.......
O32859_MYCFO/12-364TIV-----------A---------------------------------------------F.......PW.LV.......
Q9S243_STRCO/13-352ARP-----------A---------------------------------------------V.......S..YR.......
A0A034WYQ7_STREE/13-344LPA-----------M---------------------------------------------F.......D..YY.......
Q97CC5_THEVO/27-411IWI-----------V---------------------------------------------S.......EP.AF.......
D5AX67_RICPP/10-405TGN-----------T---------------------------------------------L.......NYWFA.......
Q9RD97_STRCO/46-435PMV-----------T---------------------------------------------L.......P..ET.......
Q8R8R3_THETN/20-398SFG-----------N---------------------------------------------F.......PIGIM.......
O30210_ARCFU/17-354LAP-----------V---------------------------------------------L...................
Q8X120_EXODE/120-524AMS-----------I---------------------------------------------A.......PLHII.......
Q9EW91_9ACTO/13-358QRA-----------A---------------------------------------------Q.......DL.LV.......
Q8MMD6_DROME/21-407AGV-----------A---------------------------------------------V.......VAMTN.......
Q8XVV0_RALSO/19-414VNS-----------A---------------------------------------------L.......P..TI.......
Q978I2_THEVO/17-358YNL-----------I---------------------------------------------V.......IWVVL.......
S22AI_MOUSE/13-363QFS-----------I---------------------------------------------L.......P..YL.......
M4MJU5_SINM2/14-352VLP-----------A---------------------------------------------I.......P..AM.......
Q4UVJ5_XANC8/24-370VAV-----------T---------------------------------------------V.......GW.HI.......
A0A030R0G5_PSEAI/34-397LSI-----------A---------------------------------------------M.......P..TI.......
A0A030YI13_PSEAI/26-388FSV-----------A---------------------------------------------K.......LGIAE.......
Q9KG22_BACHD/29-373YFL-----------T---------------------------------------------K.......SW.YV.......
Q9KYE9_STRCO/8-359TVP-----------Y---------------------------------------------L.......YV.YV.......
A0A029SJ89_STRPY/27-401FKL-----------M---------------------------------------------S.......NT.IM.......
O31131_BRELN/13-405ASV-----------A---------------------------------------------V.......P..AI.......
M4U5Z3_9XANT/29-361PVS-----------L---------------------------------------------L.......TP..I.......
A4TJW7_YERPP/23-431LPV-----------A---------------------------------------------L.......G..GM.......
Q8U366_PYRFU/20-359IAP-----------I---------------------------------------------V.......PT.YL.......
Q9C9R9_ARATH/11-379LPG-----------V---------------------------------------------Y.......KEVGL.......
Q20265_CAEEL/46-427LCM-----------Q---------------------------------------------E.......EQEKANNESLSR
Q9PCQ0_XYLFA/73-403PAG-----------L---------------------------------------------L.......P..QI.......
A0A022NLX7_PSEAI/4-339FWP-----------T---------------------------------------------W...................
Q9VPX2_DROME/42-442ILS-----------N---------------------------------------------A.......SQVSL.......
G2KCG1_LISMN/17-359IGI-----------S---------------------------------------------L.......V..TV.......
Q8VUK1_HALHD/23-380IFA-----------V---------------------------------------------L.......GL.EL.......
B8FVY2_DESHD/13-347ISV-----------I---------------------------------------------M.......AD.LI.......
A9CGF2_AGRT5/30-354...-----------.---------------------------------------------....................
O66181_ARTSP/15-353YGI-----------L---------------------------------------------M.......P..FM.......
Q8KYU7_9PROT/15-359FIS-----------I---------------------------------------------F.......AG.EI.......
YJ7D_SCHPO/81-445LSY-----------A---------------------------------------------A.......LY.GM.......
H4S4N1_ECOLX/47-408LSV-----------A---------------------------------------------N.......L..TI.......
Q9VY22_DROME/66-470IMP-----------S---------------------------------------------V.......LSNLA.......
I6V2R6_9EURY/8-345LNP-----------L---------------------------------------------V.......SPYAI.......
J7JKV9_BACIU/12-351LAS-----------N---------------------------------------------M.......S..SL.......
O30679_RHORH/8-341LSG-----------L---------------------------------------------I.......P..DM.......
F0KEM5_CLOAE/16-408INL-----------A---------------------------------------------L.......P..FL.......
A0A023ZK54_YEASX/86-451LNY-----------A---------------------------------------------A.......SM.GI.......
B8H3N7_CAUCN/19-356VGV-----------I---------------------------------------------I.......P..HV.......
F0KEM1_CLOAE/19-357VSP-----------A---------------------------------------------L.......Q..PI.......
A0A028WN84_STAAU/12-398ISL-----------A---------------------------------------------L.......P..TI.......
Q9VPD9_DROME/28-441LTV-----------P---------------------------------------------F.......IE.KL.......
Q8PVU8_METMA/11-346LTP-----------V---------------------------------------------L.......P..DM.......
A0A032S8J6_STAAU/18-410LNT-----------A---------------------------------------------L.......P..SI.......
F0K465_CLOAE/17-361.FP-----------F---------------------------------------------L.......SL.LL.......
Q8KR58_ESCFE/20-359LLV-----------M---------------------------------------------L.......PQLVT.......
I0LNP6_CORGK/19-353AVG-----------L---------------------------------------------I.......K..PM.......
Q9LAA0_AERHY/27-362IMP-----------L---------------------------------------------G.......P..DL.......
O06742_BACIU/18-364LIP-----------I---------------------------------------------L.......P..KM.......
Q9FCG1_STRCO/24-364TFM-----------A---------------------------------------------L..........YL.......
O94019_CANAX/86-529NDA-----------G---------------------------------------------S.......IQDSL.......
MOT14_MOUSE/42-459LGV-----------L---------------------------------------------N.......VE.WL.......
F6C4D9_SINMB/8-347FSS-----------L---------------------------------------------L.......PS.IA.......
Q9Y7E0_ASPTE/42-435LLP-----------A---------------------------------------------A.......P..EI.......
A0A022NSM6_PSEAI/11-401ASV-----------A---------------------------------------------Y.......P..DI.......
O76837_CAEEL/25-400YNA-----------I---------------------------------------------N.......FSVIC.......
Q96ZI2_SULTO/36-365LMT-----------T---------------------------------------------I.......PL.VT.......
Q7BQD2_PSEST/7-367IYL-----------M---------------------------------------------L.......GMPLV.......
Q94886_DROME/14-423LNI-----------T---------------------------------------------I.......VD.MIAGKGAIT

PF05978

Q19933_CAEEL/13-169HEF-----------I---------------------------------------------M-------EP-LI-------
Q9XV34_CAEEL/12-166QGM-----------I---------------------------------------------E-------ES-VV-------
MFS11_MOUSE/14-166CGN-----------V---------------------------------------------A-------QT-VI-------
Q8MYL9_CAEEL/14-170ESF-----------I---------------------------------------------L-------ES-VI-------
Q965T3_CAEEL/14-170HEF-----------I---------------------------------------------A-------EP-LF-------
P91007_CAEEL/16-172EAF-----------I---------------------------------------------L-------ES-VI-------
Q9XWR7_CAEEL/37-194QQF-----------I---------------------------------------------G-------ES-VI-------
Q19932_CAEEL/14-169QEF-----------I---------------------------------------------Q-------EP-LI-------
Q21545_CAEEL/14-168QGF-----------I---------------------------------------------E-------EA-VI-------
O61865_CAEEL/27-183QAF-----------I---------------------------------------------L-------ES-VI-------
Q18251_CAEEL/11-167QGL-----------I---------------------------------------------E-------VA-VL-------

PF03137

A0NEW4_ANOGA/55-618TSY-----------F-------------------------------------------Y-G-------TLTTV-------
A7S331_NEMVE/27-582NGV-----------Y-------------------------------------------S-V-------SITTI-------
A7S539_NEMVE/32-576NGV-----------Y-------------------------------------------S-V-------SISTI-------
A7S542_NEMVE/18-557NGV-----------Y-------------------------------------------S-V-------SISTI-------
A7SHZ4_NEMVE/19-550SGM-----------T-------------------------------------------G-V-------VISSL-------
A7SQZ6_NEMVE/18-584NGV-----------T-------------------------------------------S-L-------VITTI-------
A7SWE4_NEMVE/55-622NTF-----------V-------------------------------------------N-Q-------ALPTL-------
A7SX54_NEMVE/31-599NGF-----------T-------------------------------------------A-A-------GLTAL-------
A8P8W3_BRUMA/81-731NGL-----------V-------------------------------------------P-S-------AITSI-------
A8PR64_BRUMA/26-571LAY-----------V-------------------------------------------V-G-------ILTNL-------
B0WEE2_CULQU/64-642SAY-----------F-------------------------------------------Y-G-------TLSTV-------
B0WEE5_CULQU/105-708YAY-----------F-------------------------------------------N-G-------TITTL-------
B0WGA7_CULQU/25-763YIY-----------F-------------------------------------------V-I-------TLTTL-------
B3DJD4_DANRE/48-631GSY-----------M-------------------------------------------K-S-------TITQL-------
B3MGJ1_DROAN/65-620FSY-----------F-------------------------------------------N-G-------TITTM-------
B3MGJ2_DROAN/51-611FTY-----------F-------------------------------------------T-G-------TITTL-------
B3MNT7_DROAN/36-684YMY-----------F-------------------------------------------I-V-------TLTTL-------
B3RLK5_TRIAD/8-577SGF-----------T-------------------------------------------A-V-------AITSL-------
B3RLK6_TRIAD/21-588SGF-----------T-------------------------------------------A-V-------AITSL-------
B3RLK7_TRIAD/29-614TGF-----------T-------------------------------------------G-V-------IITSL-------
B3RLK8_TRIAD/27-595IGF-----------R-------------------------------------------G-V-------VIPQV-------
B3RLL2_TRIAD/176-721HGI-----------K-------------------------------------------A-T-------IVPSL-------
B3S2R8_TRIAD/18-575TGL-----------G-------------------------------------------G-V-------VITSL-------
B3SCA6_TRIAD/44-614SAF-----------V-------------------------------------------G-V-------TVSSI-------
B4J9Q1_DROGR/61-622FAY-----------F-------------------------------------------S-G-------TITTL-------
B4J9Q2_DROGR/50-610IAY-----------F-------------------------------------------T-G-------TLTTL-------
B4J9Q3_DROGR/52-605FSY-----------F-------------------------------------------N-G-------TITTL-------
B4JCP9_DROGR/31-685YMY-----------F-------------------------------------------I-V-------TLTTL-------
B4KJ36_DROMO/34-688YMY-----------F-------------------------------------------I-V-------TLTTL-------
B4KS84_DROMO/70-629FAY-----------F-------------------------------------------N-G-------TITTL-------
B4KS85_DROMO/55-614LAY-----------F-------------------------------------------N-A-------IVTTL-------
B4KS86_DROMO/50-605FSY-----------F-------------------------------------------N-G-------TITTL-------
B4KS87_DROMO/111-737YAY-----------F-------------------------------------------N-G-------TITTI-------
B4MDK1_DROVI/34-691YMY-----------F-------------------------------------------I-V-------TLTTL-------
B4MFR1_DROVI/68-626FAY-----------F-------------------------------------------N-G-------TITTL-------
B4MFR2_DROVI/57-615LAY-----------F-------------------------------------------N-G-------TITTL-------
B4MJH9_DROWI/51-614FSY-----------S-------------------------------------------N-G-------TITTL-------
B4MJI0_DROWI/54-620FAY-----------F-------------------------------------------N-G-------TITTL-------
B4MWM1_DROWI/38-693YMY-----------F-------------------------------------------I-V-------TLTTL-------
B4N051_DROWI/200-840SGY-----------I-------------------------------------------N-S-------VITTI-------
B5DE94_XENTR/28-595SAY-----------F-------------------------------------------K-S-------CLTTI-------
B5DI87_DROPS/36-609YMY-----------F-------------------------------------------I-V-------TLTTL-------
B5E0I0_DROPS/65-626FAY-----------F-------------------------------------------N-G-------TITTL-------
B7PPH4_IXOSC/20-614RTY-----------F-------------------------------------------I-G-------IQSTL-------
B7QN84_IXOSC/6-567YTY-----------F-------------------------------------------V-S-------VLTTI-------
C3Y4T6_BRAFL/2-565SGY-----------I-------------------------------------------N-S-------VVTTI-------
C3Y4T7_BRAFL/83-626NGF-----------V-------------------------------------------N-V-------VITTI-------
C3YMS7_BRAFL/5-587SGY-----------L-------------------------------------------S-S-------VITTI-------
C3ZQA6_BRAFL/26-589GGM-----------I-------------------------------------------G-A-------TISTI-------
C3ZX58_BRAFL/40-591FGY-----------L-------------------------------------------N-G-------VLTTI-------
D6W853_TRICA/116-732SGY-----------I-------------------------------------------N-S-------VITTI-------
D6W895_TRICA/53-625YAY-----------F-------------------------------------------N-G-------TITTL-------
E0VXM5_PEDHC/126-706YAY-----------F-------------------------------------------N-G-------TITSL-------
E0W488_PEDHC/204-804SGY-----------I-------------------------------------------N-S-------VITTI-------
E1C5S3_CHICK/28-603SSY-----------L-------------------------------------------K-S-------SISTI-------
E1FKB9_LOALO/26-596LAY-----------V-------------------------------------------V-G-------ILTNL-------
E1FVI2_LOALO/58-633NSI-----------F-------------------------------------------P-V-------GLSTL-------
E2A200_CAMFO/99-698YTY-----------F-------------------------------------------V-S-------VITTI-------
E2ABP4_CAMFO/74-684YAY-----------F-------------------------------------------N-G-------TITTI-------
E2BXT3_HARSA/74-652YAY-----------F-------------------------------------------N-G-------TITTI-------
E2RSD4_CANFA/44-638EGY-----------L-------------------------------------------K-S-------TITQI-------
E4X1Y1_OIKDI/36-601SGY-----------T-------------------------------------------A-G-------VSSSI-------
E5S461_TRISP/81-717SGL-----------V-------------------------------------------P-S-------VLSTL-------
E5SC63_TRISP/58-613NGF-----------V-------------------------------------------P-N-------SITTL-------
E7F5H8_DANRE/27-603.AY-----------L-------------------------------------------V-S-------VLTTL-------
E9G6H1_DAPPU/44-620NGL-----------L-------------------------------------------N-V-------CVSTI-------
E9GGR7_DAPPU/1-573YTY-----------F-------------------------------------------V-S-------VLTTI-------
E9GTG7_DAPPU/37-616FSY-----------S-------------------------------------------I-A-------TLTTL-------
E9INY6_SOLIN/50-616YTY-----------F-------------------------------------------H-V-------TGSTI-------
F1MA40_RAT/144-702FGL-----------T-------------------------------------------D-L-------SIGNF-------
F1NQ62_CHICK/86-676GVI-----------M-------------------------------------------K-S-------SITQI-------
F1Q3Z3_CANFA/92-650FGL-----------I-------------------------------------------D-L-------SIDTF-------
F1Q9B1_DANRE/21-583SSY-----------F-------------------------------------------K-S-------TITTI-------
F1QBF7_DANRE/27-591SGY-----------L-------------------------------------------K-A-------SITTI-------
F1RU07_PIG/132-741SGY-----------L-------------------------------------------S-S-------VITTI-------
F1SQZ6_PIG/21-597GSY-----------M-------------------------------------------N-S-------MLTQI-------
F2U1E1_SALR5/138-886SGV-----------F-------------------------------------------P-I-------SITSI-------
F4WH08_ACREC/51-617YAY-----------F-------------------------------------------H-V-------TGSTI-------
F4X6X3_ACREC/89-670NGF-----------V-------------------------------------------N-V-------VITTI-------
F6RPB8_HORSE/50-647SGY-----------L-------------------------------------------K-G-------SISTV-------
F6SHC6_MONDO/129-692NGL-----------V-------------------------------------------N-I-------SISTI-------
F6SHD5_MONDO/83-645NGL-----------V-------------------------------------------N-I-------SISTI-------
F6SNL4_XENTR/97-651NGF-----------L-------------------------------------------N-T-------VITTI-------
F6TIF0_CIOIN/25-583NGF-----------V-------------------------------------------N-V-------SITTL-------
F6UFC7_MONDO/37-638SGY-----------L-------------------------------------------K-S-------SISTI-------
F6UHW9_MACMU/29-621AVV-----------M-------------------------------------------K-S-------SIIHI-------
F6Z8W3_MONDO/36-628GIV-----------M-------------------------------------------K-S-------SITQI-------
F6ZVK8_CIOIN/40-603ATY-----------N-------------------------------------------K-S-------VLTSI-------
F6ZXK1_MONDO/21-593GSF-----------I-------------------------------------------N-S-------ILTQL-------
F7ACE2_CIOIN/22-602AGI-----------T-------------------------------------------N-I-------NVSTL-------
F7B262_CIOIN/35-639SGY-----------N-------------------------------------------K-S-------ALTSI-------
F7B8B6_XENTR/14-595GSY-----------M-------------------------------------------K-S-------SITQI-------
F7BQX3_MONDO/39-601SAY-----------F-------------------------------------------K-S-------SLTTI-------
F7CCC4_MACMU/114-672FGL-----------T-------------------------------------------D-V-------SIGNV-------
F7D880_XENTR/45-603NGL-----------V-------------------------------------------N-V-------VISTI-------
F7DID9_ORNAN/85-636NGL-----------I-------------------------------------------N-T-------VITSL-------
F7E5T7_MACMU/28-625SGY-----------L-------------------------------------------K-S-------SISTV-------
F7G693_MONDO/107-666NGF-----------I-------------------------------------------N-T-------VITSI-------
F7IM14_CALJA/33-639SAY-----------F-------------------------------------------K-S-------SLTTI-------
G1KDM6_ANOCA/110-669NGF-----------I-------------------------------------------N-T-------VITSI-------
G1KJC8_ANOCA/62-624SAY-----------F-------------------------------------------K-S-------SLSTI-------
G1KTZ7_ANOCA/42-626GAY-----------V-------------------------------------------N-S-------MLTQI-------
G1KTZ8_ANOCA/2-594GSY-----------M-------------------------------------------K-S-------MMTQI-------
G1KU16_ANOCA/44-637GSY-----------L-------------------------------------------K-S-------TITQI-------
G1LS58_AILME/38-599FGL-----------V-------------------------------------------D-L-------SIDTF-------
G1MG68_AILME/111-671NGF-----------I-------------------------------------------N-T-------VITSI-------
G1NLJ6_MELGA/21-604GAY-----------L-------------------------------------------N-S-------MYTQI-------
G1P1F0_MYOLU/56-614IGL-----------I-------------------------------------------D-V-------SLNTF-------
G1PCN2_MYOLU/58-650SGY-----------L-------------------------------------------K-S-------SISTV-------
G1PGX5_MYOLU/20-594GSY-----------M-------------------------------------------N-S-------MLTQI-------
G1QXW4_NOMLE/21-597GSY-----------M-------------------------------------------N-S-------MLTQI-------
G1RKH9_NOMLE/129-734SGY-----------L-------------------------------------------S-S-------VITTI-------
G1SJM2_RABIT/94-653FGL-----------V-------------------------------------------D-L-------SISNF-------
G1T6Y7_RABIT/47-646SGY-----------L-------------------------------------------K-S-------SISTV-------
G1T960_RABIT/29-621GII-----------M-------------------------------------------K-S-------SITQI-------
G3NAV0_GASAC/31-610SGY-----------M-------------------------------------------K-S-------SISTI-------
G3NHS2_GASAC/34-602SAY-----------F-------------------------------------------K-S-------TISTI-------
G3P9F5_GASAC/17-593.AY-----------L-------------------------------------------V-S-------VLTTL-------
G3Q5Q6_GASAC/29-624GSY-----------M-------------------------------------------K-S-------SITQI-------
G3RFJ2_GORGO/108-666FGL-----------I-------------------------------------------D-V-------SIGDF-------
G3RW09_GORGO/3-600GIF-----------M-------------------------------------------K-I-------SSTQI-------
G3THK1_LOXAF/27-590FGL-----------V-------------------------------------------D-L-------SIDHF-------
G3VZ81_SARHA/19-591NGL-----------V-------------------------------------------N-I-------SISTI-------
G3WV28_SARHA/37-630GTV-----------M-------------------------------------------K-S-------SITHI-------
G3WVX8_SARHA/40-630ATF-----------L-------------------------------------------K-S-------SITHI-------
G3WWQ7_SARHA/43-640EGY-----------L-------------------------------------------K-S-------TITQI-------
G4VAF3_SCHMA/62-701SGY-----------T-------------------------------------------S-S-------QVTTL-------
G5BJ45_HETGA/1-591GIT-----------M-------------------------------------------K-T-------AITQI-------
G6D5X6_DANPL/120-675SGY-----------I-------------------------------------------N-S-------VITTI-------
G6DHQ3_DANPL/73-638LTY-----------F-------------------------------------------V-S-------VTTTV-------
H0VSG6_CAVPO/50-647SGY-----------L-------------------------------------------K-S-------SISTV-------
H0VU31_CAVPO/105-653NGF-----------I-------------------------------------------N-T-------VITSI-------
H0W6D9_CAVPO/29-617GIS-----------M-------------------------------------------K-T-------AITHI-------
H0WRN3_OTOGA/1-607SAC-----------F-------------------------------------------K-S-------SLTTI-------
H0X513_OTOGA/48-645SGY-----------L-------------------------------------------K-S-------SISTV-------
H0XUZ7_OTOGA/29-621GTV-----------M-------------------------------------------K-S-------SITQI-------
H0ZQ14_TAEGU/44-636GSY-----------L-------------------------------------------K-S-------TITQI-------
H2L5X8_ORYLA/7-609TTY-----------F-------------------------------------------K-S-------IISTI-------
H2LW99_ORYLA/3-593GSY-----------M-------------------------------------------K-S-------TITQL-------
H2LWK4_ORYLA/34-623.AY-----------L-------------------------------------------V-S-------VLTTL-------
H2LXV9_ORYLA/4-606GTY-----------M-------------------------------------------K-S-------SITQI-------
H2ME20_ORYLA/33-598SGY-----------M-------------------------------------------K-S-------SITTI-------
H2NP86_PONAB/41-622.AY-----------L-------------------------------------------V-S-------VLTTL-------
H2SCH0_TAKRU/44-642GAY-----------L-------------------------------------------K-S-------SITQI-------
H2SCH1_TAKRU/29-627GAY-----------L-------------------------------------------K-S-------SITQI-------
H2SCH5_TAKRU/21-605ATH-----------M-------------------------------------------K-S-------SITQI-------
H2SN38_TAKRU/26-590SGY-----------M-------------------------------------------K-S-------SISTI-------
H2T5W9_TAKRU/22-602.AY-----------L-------------------------------------------V-S-------VLTTL-------
H2TWS2_TAKRU/7-592SGY-----------L-------------------------------------------S-S-------VITTI-------
H2UWX7_TAKRU/9-600GSY-----------M-------------------------------------------K-S-------TITQL-------
H2UZN6_TAKRU/20-610SAY-----------F-------------------------------------------K-S-------IITTI-------
H2V2U5_TAKRU/20-610GSY-----------M-------------------------------------------K-S-------TITQL-------
H2YEL4_CIOSA/27-585NGF-----------I-------------------------------------------N-V-------SITTL-------
H2YTS0_CIOSA/2-575LTY-----------T-------------------------------------------D-S-------VLNYI-------
H2YZB0_CIOSA/24-616AGI-----------V-------------------------------------------N-I-------NVSTL-------
H2Z037_CIOSA/5-589GGL-----------T-------------------------------------------N-T-------NISTL-------
H2Z5W5_CIOSA/21-582NGL-----------L-------------------------------------------K-I-------SITSI-------
H2ZCE8_CIOSA/9-615SGY-----------N-------------------------------------------K-S-------ALTSI-------
H3ABP2_LATCH/6-582SGY-----------L-------------------------------------------K-S-------SVSTI-------
H3AUF3_LATCH/60-624NGL-----------I-------------------------------------------N-I-------SISTI-------
H3AXL7_LATCH/47-642GSY-----------M-------------------------------------------K-S-------SITQI-------
H3B0P1_LATCH/42-638GSY-----------M-------------------------------------------K-S-------SITQI-------
H3BW91_TETNG/35-616SGY-----------M-------------------------------------------K-S-------SISTI-------
H3DMV0_TETNG/12-567SAY-----------F-------------------------------------------K-S-------IITTI-------
H3DSJ9_PRIPA/41-714GMY-----------I-------------------------------------------V-S-------AIQNI-------
H3FQI4_PRIPA/22-588LGY-----------V-------------------------------------------V-G-------MLTTL-------
H9GXA5_DANRE/22-598ASY-----------T-------------------------------------------K-S-------TITQI-------
H9GYB5_DANRE/9-610GSY-----------M-------------------------------------------K-S-------SVTQI-------
H9J2D0_BOMMO/122-735SGY-----------I-------------------------------------------N-S-------VITTI-------
H9KAI9_APIME/72-668YAY-----------F-------------------------------------------N-G-------TITTI-------
H9KS62_APIME/23-630FIY-----------I-------------------------------------------V-V-------TLTTL-------
I1FF21_AMPQE/83-628SGF-----------T-------------------------------------------S-V-------VLSTI-------
I1FF22_AMPQE/53-616IGL-----------T-------------------------------------------S-V-------NLSSI-------
I3J8K7_ORENI/27-592SGY-----------M-------------------------------------------K-S-------SISTI-------
I3JPB0_ORENI/4-598GSY-----------M-------------------------------------------K-S-------TITQL-------
I3JU44_ORENI/3-598GAY-----------M-------------------------------------------K-S-------SITQI-------
I3JU45_ORENI/36-628GTY-----------M-------------------------------------------K-S-------SITQI-------
I3KD69_ORENI/19-600.AY-----------L-------------------------------------------V-S-------VLTTL-------
I3KT50_ORENI/9-572SAY-----------F-------------------------------------------K-S-------TISTI-------
I3MXD4_SPETR/104-661NGF-----------I-------------------------------------------N-T-------VITSI-------
I3MZY5_SPETR/101-669NGL-----------V-------------------------------------------N-I-------SISTI-------
J3QNA4_MOUSE/108-668SGL-----------T-------------------------------------------R-V-------STGNF-------
J9JWU7_ACYPI/65-667STY-----------F-------------------------------------------V-S-------VITTL-------
J9K6L3_ACYPI/47-601SSY-----------F-------------------------------------------N-G-------TLTTM-------
K1PJB3_CRAGI/119-693TGY-----------L-------------------------------------------N-S-------VLTTI-------
K1Q6Z9_CRAGI/63-616NGI-----------S-------------------------------------------N-A-------GLPAI-------
K1QB38_CRAGI/29-589NGI-----------N-------------------------------------------N-V-------NTTSV-------
K1QD74_CRAGI/43-615NGV-----------V-------------------------------------------N-I-------ALTTL-------
K7IWN1_NASVI/25-629FIY-----------I-------------------------------------------V-V-------SLTTL-------
K7IWN2_NASVI/77-675YAY-----------F-------------------------------------------N-G-------TITTI-------
K7J562_NASVI/209-820SGY-----------I-------------------------------------------N-S-------VITTI-------
K7J8P8_NASVI/104-674YTY-----------F-------------------------------------------V-S-------VITTI-------
L5JNP4_PTEAL/43-638SGY-----------L-------------------------------------------K-S-------SISTV-------
L7N264_MOUSE/21-597GSH-----------M-------------------------------------------K-S-------MLLQI-------
L9L9W1_TUPCH/47-739SGY-----------L-------------------------------------------K-S-------SISTV-------
M3WPK8_FELCA/38-596FGL-----------V-------------------------------------------D-L-------SIDTF-------
M3XXF4_MUSPF/103-666NGL-----------V-------------------------------------------N-I-------SISTI-------
M3XXG5_MUSPF/93-653FGL-----------K-------------------------------------------E-L-------SMETF-------
M3YCV1_MUSPF/50-648SGY-----------L-------------------------------------------K-S-------SISTV-------
M3ZWM7_XIPMA/18-618GAY-----------M-------------------------------------------K-S-------SITQI-------
M3ZXE4_XIPMA/24-582SGY-----------M-------------------------------------------K-S-------SISTI-------
M4ABK2_XIPMA/34-613.AY-----------L-------------------------------------------V-S-------VLTTL-------
SO1A3_RAT/21-597GTF-----------M-------------------------------------------S-S-------MLTQI-------
SO2A1_RAT/33-602SAY-----------F-------------------------------------------K-S-------SLTTI-------
Q16RK9_AEDAE/100-701YAY-----------F-------------------------------------------N-G-------TITTL-------
Q16RL0_AEDAE/55-631TAY-----------F-------------------------------------------Y-G-------TLTTV-------
Q171D5_AEDAE/25-762YIY-----------F-------------------------------------------V-I-------TLTTL-------
Q28XS7_DROPS/47-608FSY-----------F-------------------------------------------N-G-------TLTTL-------
Q5JAR4_HUMAN/29-621GII-----------M-------------------------------------------K-I-------SITQI-------
SO4C1_RAT/102-664NGL-----------V-------------------------------------------N-I-------SISTI-------
Q7Q103_ANOGA/25-768YIY-----------F-------------------------------------------V-I-------TLTTL-------
Q7Q551_ANOGA/114-716YAY-----------F-------------------------------------------N-G-------TITTL-------
SO2B1_MOUSE/42-636SGY-----------L-------------------------------------------K-S-------SISTV-------
Q8C0X7_MOUSE/95-654FAV-----------V-------------------------------------------D-M-------TLNIY-------
SO1A5_MOUSE/21-597GIY-----------M-------------------------------------------N-S-------MLTQI-------
Q93550_CAEEL/18-586LGY-----------V-------------------------------------------V-G-------MLTTL-------
SO4A1_HUMAN/104-663NGF-----------I-------------------------------------------N-T-------VITSL-------
SO1A6_MOUSE/21-597GVY-----------M-------------------------------------------S-T-------MLTQL-------
SO4A1_RAT/103-665NGF-----------I-------------------------------------------N-T-------VITSI-------
SO1C1_RAT/44-642EGY-----------L-------------------------------------------K-S-------TITQI-------
SO1B2_MOUSE/27-617GVI-----------M-------------------------------------------K-S-------SITQI-------
SO1B2_RAT/29-615GVV-----------M-------------------------------------------K-S-------SITQI-------
Q9VK84_DROME/36-684YMY-----------F-------------------------------------------I-V-------TLTTL-------
Q9VVH9_DROME/175-754MTY-----------F-------------------------------------------V-S-------VITTI-------
Q9W269_DROME/112-731YAY-----------F-------------------------------------------N-G-------TITTI-------
Q9W270_DROME/95-661FTY-----------F-------------------------------------------T-G-------TITTM-------
Q9W271_DROME/67-626FAY-----------F-------------------------------------------N-G-------TITTL-------
Q9XWC5_CAEEL/49-620NAI-----------F-------------------------------------------P-V-------GLSTL-------
R4GBU6_ANOCA/260-819NGL-----------I-------------------------------------------N-V-------SISTI-------
T1ER69_HELRO/33-610GTY-----------T-------------------------------------------S-T-------ILATL-------
T1G9I5_HELRO/71-663SGF-----------V-------------------------------------------S-V-------CLSTL-------
T1HLF3_RHOPR/50-617YSY-----------F-------------------------------------------N-G-------IITTL-------
T1HLL5_RHOPR/20-673YVY-----------I-------------------------------------------I-S-------TLTTI-------
T1HYS5_RHOPR/25-590YTY-----------F-------------------------------------------V-S-------VITTI-------
T1I8L4_RHOPR/19-568ESY-----------F-------------------------------------------I-G-------TISTL-------
T1IDL3_RHOPR/22-585SAY-----------F-------------------------------------------I-G-------TISTI-------
T1IV13_STRMM/34-600FMF-----------I-------------------------------------------V-A-------TLTTI-------
T1J381_STRMM/107-721YTY-----------F-------------------------------------------V-S-------VLTTI-------
T1J4Q6_STRMM/53-601YTY-----------M-------------------------------------------I-S-------ILSTV-------
T1J9S9_STRMM/138-752SGY-----------L-------------------------------------------N-S-------VITTI-------
T1K555_TETUR/46-593FVY-----------M-------------------------------------------I-G-------VMSTL-------
U1NEN2_ASCSU/27-606LGY-----------T-------------------------------------------V-G-------ILTNL-------
U1NQ20_ASCSU/50-610NGF-----------I-------------------------------------------S-T-------SISSL-------
U3I6L4_ANAPL/103-660NGF-----------I-------------------------------------------N-T-------VITSI-------
U3I6Y8_ANAPL/7-588SGY-----------L-------------------------------------------K-S-------SISTI-------
U3K039_FICAL/40-624GAY-----------M-------------------------------------------N-S-------MYTQI-------
U3K045_FICAL/38-630GSY-----------M-------------------------------------------K-S-------MSSQI-------
U3KFS6_FICAL/31-593SAN-----------F-------------------------------------------K-S-------SLTTI-------
V8NPM0_OPHHA/58-605NGL-----------I-------------------------------------------N-V-------SISTI-------
W4WD24_ATTCE/23-636FIY-----------I-------------------------------------------I-V-------TLTTL-------
W4XLX7_STRPU/60-699GGY-----------V-------------------------------------------S-A-------SLSTI-------
W4XQW5_STRPU/59-640SGT-----------F-------------------------------------------G-S-------AVTSL-------
W4XVZ6_STRPU/91-689FGL-----------F-------------------------------------------F-A-------VLTTL-------
W4Z5F6_STRPU/135-671YGM-----------V-------------------------------------------S-I-------AVTTI-------
W4Z5F7_STRPU/78-634SGI-----------V-------------------------------------------F-T-------VTTTL-------
W5J7I4_ANODA/56-623TSY-----------F-------------------------------------------Y-G-------TLTTV-------
W5JBI4_ANODA/130-794SGY-----------I-------------------------------------------N-S-------VITTI-------
W5JW33_ANODA/25-791YIY-----------F-------------------------------------------V-I-------TLTTL-------
W5KDH2_ASTMX/31-629GSY-----------M-------------------------------------------K-S-------SVVQI-------
W5KJ52_ASTMX/32-619.AY-----------L-------------------------------------------V-S-------VLTTL-------
W5LQU9_ASTMX/27-591SGY-----------L-------------------------------------------K-G-------SISTI-------
W5MDQ5_LEPOC/17-593SAY-----------V-------------------------------------------K-S-------TVTTI-------
W5MFK3_LEPOC/106-669NGF-----------I-------------------------------------------N-T-------VITSI-------
W5MRR1_LEPOC/26-603NAY-----------L-------------------------------------------I-S-------MLSTL-------
W5MRT2_LEPOC/53-615NGL-----------V-------------------------------------------N-I-------SISTI-------
W5MY22_LEPOC/30-602SGY-----------L-------------------------------------------K-S-------SISTI-------
W5NE89_LEPOC/38-625ASY-----------T-------------------------------------------K-S-------TITQI-------
W5NE95_LEPOC/1-594GSY-----------M-------------------------------------------K-S-------SITQI-------
W5NE99_LEPOC/24-615GSY-----------M-------------------------------------------K-S-------SITQI-------
W5NEA9_LEPOC/1-598GSY-----------M-------------------------------------------K-S-------TITQL-------
W5PSU6_SHEEP/93-647NGF-----------I-------------------------------------------N-T-------VITSI-------
W5QAF5_SHEEP/107-670FGL-----------V-------------------------------------------D-L-------STNSF-------
W5QGQ1_SHEEP/21-597GSY-----------M-------------------------------------------N-S-------MLTQI-------
X5LX59_CAEEL/46-677NGL-----------V-------------------------------------------P-S-------AISSI-------
X5M903_CAEEL/27-574NGL-----------V-------------------------------------------S-V-------SISSI-------

PF03209

P73827_SYNY3/40-466LPW-----------V-------------------------------------------A-A-------TAIAM-------
PUCC_RHOS4/51-454PAS-----------V-------------------------------------------V-G-------IMISL-------
BCH2_RHOCB/28-417PAV-----------L-------------------------------------------P-G-------ALVAL-------
D5AMI6_RHOCB/54-460PAS-----------L-------------------------------------------V-S-------VMLAM-------
D5ANS1_RHOCB/51-456PAL-----------V-------------------------------------------V-A-------AMISI-------
G3XCS5_PROMA/1-413PAI-----------L-------------------------------------------V-G-------GGLAF-------
I0HT76_RUBGI/55-465PAS-----------I-------------------------------------------V-A-------VMVAL-------
Q3J171_RHOS4/51-459PAT-----------V-------------------------------------------V-A-------LMIAL-------
Q3J183_RHOS4/28-414PAV-----------L-------------------------------------------S-G-------LLVAL-------

PF05631

Q9N3A9_CAEEL/1-336QRT-----------YLIVYMMAVAGDWL----------------------------QGP-H-------VYALY-------
Q9FWD6_ORYSJ/4-357KNN-----------YILVYSLMMSGDWL----------------------------QGP-Y-------VYYLY-------

PF12832

A7SQQ8_NEMVE/55-132GSL-----------Q-------------------------------------------P-Y-------FGLYL-------
Q6FB61_ACIAD/6-82GTF-----------M-------------------------------------------P-Y-------WSLYL-------
B7P8Y1_IXOSC/9-85GCL-----------T-------------------------------------------P-F-------LSLHL-------
Q17GA0_AEDAE/14-90GCL-----------H-------------------------------------------P-Y-------LQKHM-------
A7RI07_NEMVE/54-130GSS-----------F-------------------------------------------P-Y-------MSLYF-------
Q54SK7_DICDI/682-755QEY-----------Y-------------------------------------------P-T-------IKSLS-------
B2AA42_PODAN/619-697KDV-----------Y-------------------------------------------P-Y-------FSFDG-------
A1WY15_HALHL/14-90GAL-----------M-------------------------------------------P-Y-------WGPYL-------
Q54G39_DICDI/12-88STF-----------Y-------------------------------------------P-F-------ITIYL-------
B3PHF3_CELJU/15-91GAL-----------V-------------------------------------------P-Y-------WGIYL-------
Q07ZQ8_SHEFN/10-86GIM-----------V-------------------------------------------P-Y-------LGVFF-------
D3SB25_THISK/3-79GAF-----------M-------------------------------------------P-F-------WGPYL-------
B0X8B9_CULQU/11-87GCI-----------Y-------------------------------------------P-F-------LQSNM-------
YJBC_SCHPO/418-493APL-----------Y-------------------------------------------P-Y-------FSFSK-------
Q16KC8_AEDAE/34-110SSL-----------V-------------------------------------------P-Y-------LTVHM-------
Q21IX9_SACD2/5-81GGL-----------S-------------------------------------------P-Y-------WGLYL-------
B4G7T5_DROPE/36-112SSL-----------L-------------------------------------------P-Y-------LTIHM-------
C3YMP2_BRAFL/14-90SCI-----------Y-------------------------------------------P-Y-------LTVYM-------
A3QFN3_SHELP/24-100GVL-----------V-------------------------------------------P-Y-------LGVFF-------
Q55CH3_DICDI/11-87ACF-----------Q-------------------------------------------P-F-------ISIYL-------
B8GQD4_THISH/5-81GAF-----------V-------------------------------------------P-Y-------WGLYL-------
C5BL70_TERTT/2-78GAI-----------S-------------------------------------------P-F-------WGLYL-------
A7UVG6_ANOGA/14-90GCL-----------H-------------------------------------------P-Y-------IQKHM-------
Q2SJE3_HAHCH/5-81GGI-----------S-------------------------------------------P-Y-------FPVYL-------
B7PL10_IXOSC/7-83SGF-----------L-------------------------------------------P-F-------IGVLL-------
A8PWD3_MALGO/544-619QPL-----------Y-------------------------------------------P-F-------FAFDD-------
Q4PB45_USTMA/688-764QSL-----------Y-------------------------------------------P-F-------FAYDN-------
Q3J7E6_NITOC/9-84GAL-----------L-------------------------------------------P-Y-------WGLYL-------

PF01306

LACY_CITFR/1-412GAY-----------F-------------------------------------------P-F-------FPIWL-------
RAFB_ECOLX/4-415ATC-----------F-------------------------------------------P-F-------LPVWL-------
A0A017JVR8_ECOLX/4-411SLW-----------W-------------------------------------------S-L-------YAIWL-------
LACY_KLEOX/6-416SAY-----------F-------------------------------------------P-F-------FPVWL-------

PF06609

Q8NII4_FUSAU/1-598AAM-----------TLLGVAAGPAGSSPLFVGELMSNKTKFLGLLTVSIPTIVMS.AGP-Y-------FGQRL-------
Q9C1B3_FUSSP/1-598AAM-----------TMLGVAAGPAGASPLFIGELMSNKTKFLGLLIVSAPVVATNGLSP-Y-------LGQRL-------

PF06813

Q7XGH1_ORYSJ/34-288TNI-----------F-------------------------------------------S.I-------YSGAL-------
Q9LUF8_ARATH/16-265GYL-----------F-------------------------------------------GGS-------MSPAI-------
Q8H613_ORYSJ/14-261SST-----------F-------------------------------------------A.L-------YSHAL-------
Q94D97_ORYSJ/8-252NSD-----------F-------------------------------------------P.V-------YSSQL-------
Q9M8M1_ARATH/13-260GST-----------F-------------------------------------------P.L-------YSSAL-------
Q9ZUV4_ARATH/17-262TYL-----------F-------------------------------------------G.T-------YSKDI-------
O80960_ARATH/21-266TYM-----------F-------------------------------------------G.I-------YSGDI-------
Q8H132_ARATH/7-253NFD-----------F-------------------------------------------S.A-------YSSDL-------
Q9SLF1_ARATH/14-260NYT-----------F-------------------------------------------S.N-------YSGAL-------
F4I9E1_ARATH/43-286NFD-----------F-------------------------------------------S.A-------YSSHL-------
F4J4R8_ARATH/23-272NFD-----------F-------------------------------------------S.A-------YSSDM-------
Q9S7R2_ARATH/16-263GYL-----------F-------------------------------------------G.S-------ISPVI-------

PF13000

C4R336_PICPG/74-584-----------------------------------------------------L-----LKG..SNLSFSQVGVFSLASY
G0WCJ0_NAUDC/17-577-----------------------------------------------------L-----LKSMVKETSFTSLGVFSIATY
G8BYR1_TETPH/85-660-----------------------------------------------------L-----LKSIIKETTFTQLGFFSISTY
Q75EB1_ASHGO/51-585-----------------------------------------------------L-----LKSIAKDTSFTKLGLFGIATY
E7K9I5_YEASA/17-559-----------------------------------------------------L-----LKSLAKETSFTSLGIFSMATY
Q6CKM4_KLULA/10-515-----------------------------------------------------I-----LKSSQRQTSFVTIGLFSMATY
G0VIX6_NAUCC/41-595-----------------------------------------------------L-----LKSMAKETSFASLGVFSIATY
H2AY09_KAZAF/18-574-----------------------------------------------------L-----LKSLVKETSFTSLGLFSMATY
I2H5Y9_TETBL/23-594-----------------------------------------------------L-----LKSIAKETSFASLGFFSIATY
G8JR10_ERECY/17-554-----------------------------------------------------L-----LKSVAKDTSFTKLGVFSMATY
S6E3L5_ZYGB2/13-555-----------------------------------------------------L-----LKSMAKETSFTTLGIFSIATY
Q6FMM5_CANGA/15-566-----------------------------------------------------L-----LKSMAKETTFTQLGIFSMATY
C5E2P0_LACTC/16-543-----------------------------------------------------L-----LKSGARETTFTQLGVFALATY
B6ABL4_CRYMR/9-525-----------------------------------------------------I-----LQG...RISYKEQSIFSMVTL
G8ZXV2_TORDC/17-551-----------------------------------------------------L-----LKSMAKDTSFTTLGLFSIATY
J7RSN7_KAZNA/20-561-----------------------------------------------------L-----LKSMAKQTSFTSLGVFSVATY

PF07672

Q8EUQ6_MYCPE/191-477-----------------------------------------------------C-----FGISQVINGTDA.--------
Y077_MYCPN/209-467-----------------------------------------------------L-----IP.GVGRFATAN.--------
Q8EVP4_MYCPE/172-441-----------------------------------------------------I-----IP.EVRSAVTNNY--------
Y076_MYCPN/210-484-----------------------------------------------------L-----FQ.SVQQAGTKY.--------
Q98PH4_MYCPU/154-430-----------------------------------------------------L-----VSKDTTEALVRN.--------
Q7NAK7_MYCGA/200-455-----------------------------------------------------T-----YSMTIKMEAVKS.--------

PF03825

YEGT_ECOLI/1-405-----------------------------------------------------LSKSG.FSAGEIGWSYACTAIAAI---
Q9A7U2_CAUCR/1-395-----------------------------------------------------MGMLG.FAPWQQSLVGSAWGVAAL---
XAPB_ECOLI/1-407-----------------------------------------------------MINTLHFTGANVGMVYSSKGIAAI---
NUPG_ECOLI/1-406-----------------------------------------------------MFVTLKFDGASIGAVYSSLGIAAV---

PF00854

PTR7_ARATH/99-532-----------------------------------------------------L-----RPPRCN..PTTS---------
F7BBU0_ORNAN/81-472-----------------------------------------------------L-----TDSDHD..G...---------
PEPT3_CAEEL/82-453-----------------------------------------------------L-----SYP.........---------
PEPT1_CAEEL/113-509-----------------------------------------------------F-----QSS.........---------
PTR12_ARATH/99-524-----------------------------------------------------L-----MPPPCK..SSAA---------
S15A1_RABIT/81-472-----------------------------------------------------L-----TDNNHD..G...---------
PTR30_ARATH/96-518-----------------------------------------------------L-----RPTCEN..G...---------
PTR2_ARATH/113-544-----------------------------------------------------L-----KPAECI..G...---------
DTPA_ECOLI/88-460-----------------------------------------------------G-----............---------
DTPD_ECOLI/76-458-----------------------------------------------------.-----............---------
YJDL_ECOLI/75-447-----------------------------------------------------F-----............---------
PTR2_SCHPO/158-542-----------------------------------------------------V-----IDAGKSMGG...---------
S15A2_HUMAN/111-487-----------------------------------------------------L-----GGQ.........---------
PTR2_YEAST/155-533-----------------------------------------------------V-----GNRDSAIGG...---------
S15A1_RAT/81-474-----------------------------------------------------L-----TDHDHD..G...---------
PTR17_ARATH/124-550-----------------------------------------------------L-----KPAACA..GVAA---------
S15A4_RAT/94-517-----------------------------------------------------L-----VRNCSAPFPNGT---------
DTPT_LACLA/91-474-----------------------------------------------------G-----LS..........---------
PEPT2_CAEEL/99-494-----------------------------------------------------S-----GSS.........---------
DTPB_ECOLI/81-457-----------------------------------------------------.-----............---------
YCLF_BACSU/95-469-----------------------------------------------------.-----............---------

PF06779

Q986E3_RHILO/34-394-----------------------------------------------------M--------------------------
Q89HQ1_BRADU/48-412-----------------------------------------------------L--------------------------
A9CI18_AGRT5/23-387-----------------------------------------------------M--------------------------
Q88ED9_PSEPK/14-373-----------------------------------------------------L--------------------------
Q8Y185_RALSO/36-399-----------------------------------------------------M--------------------------
Q9I3T2_PSEAE/20-380-----------------------------------------------------L--------------------------
Q89X18_BRADU/63-426-----------------------------------------------------M--------------------------
Q92UK2_RHIME/1-365-----------------------------------------------------M--------------------------
YJIJ_ECOLI/23-381-----------------------------------------------------M--------------------------
Q8ZJZ6_SALTY/23-379-----------------------------------------------------M--------------------------
Q9PGN0_XYLFA/26-385-----------------------------------------------------M--------------------------

PF01733

ENT1_ARATH/167-450-------MPER---------------------------------------------------------------------
S29A1_RAT/144-455-------LPAN---------------------------------------------------------------------
S29A2_HUMAN/131-454-------MPST---------------------------------------------------------------------
S29A1_HUMAN/144-454-------LPAS---------------------------------------------------------------------
FUN26_YEAST/180-510-------FGSE---------------------------------------------------------------------
Q19495_CAEEL/137-426-------FPHT---------------------------------------------------------------------
Q21145_CAEEL/434-723-------FPFK---------------------------------------------------------------------

PF03239

FTH1_YEAST/8-404-------IVKQGLSVEDDSPFEGSSSSAGLPSPNTNTNADSTTAFLQAGPSDGNA-------------------------
EFEU_BACSU/9-395-------LNKQMIKSVKDGDMDSAQQTFDTFKAKWKKEEPSI..........KKE-------------------------
Q9Y8Z4_AERPE/4-268-------LLKK............................................-------------------------
Y964_SYNY3/6-291-------CLAR............................................-------------------------
FIP1_SCHPO/7-320-------FISQ............................................-------------------------
EFEU_ECOLI/1-276-------YLKR............................................-------------------------
O83937_TREPA/14-362-------SAWVGVALMC......................................-------------------------
Q9ZC51_YERPE/156-557-------HYQGFKNSEMEMSVRGNRSAQQAAEINQQFTALIDL.......ARQPD-------------------------
Q9RKQ1_STRCO/1-274-------YLVK............................................-------------------------
Q9ZDD8_RICPR/1-278-------VTKQ............................................-------------------------
FTR1_YEAST/7-321-------FLKQ............................................-------------------------
Y154_ARCFU/4-266-------YLKR............................................-------------------------
Q9WYP8_THEMA/2-266-------YLKR............................................-------------------------

PF01770

S19A1_HUMAN/23-434-------GPDK---------------------------------------------------------------------
Q9EQN9_MOUSE/28-459-------GPDK---------------------------------------------------------------------
Q9VK64_DROME/2-395-------SDYG---------------------------------------------------------------------
Q29L76_DROPS/2-397-------GDYG---------------------------------------------------------------------
Q294A5_DROPS/2-414-------SDWY---------------------------------------------------------------------
Q9VGV5_DROME/2-408-------GPWR---------------------------------------------------------------------
Q16JT2_AEDAE/2-405-------GSWH---------------------------------------------------------------------
S19A3_HUMAN/10-441-------GPDK---------------------------------------------------------------------
Q1LV16_DANRE/4-414-------GP.K---------------------------------------------------------------------
Q9VGV6_DROME/2-411-------GEWY---------------------------------------------------------------------
FOLT2_CAEEL/2-394-------TV.L---------------------------------------------------------------------
Q28C92_XENTR/10-422-------GSYH---------------------------------------------------------------------
Q7Q5N2_ANOGA/2-422-------GEWR---------------------------------------------------------------------
A8BIM9_GIAIC/39-447-------D..N---------------------------------------------------------------------
A7SN54_NEMVE/6-420-------APPK---------------------------------------------------------------------
S19A3_MOUSE/11-435-------EPSK---------------------------------------------------------------------
F1N2M7_BOVIN/23-430-------GPDK---------------------------------------------------------------------
F1NVD6_CHICK/32-445-------GHDK---------------------------------------------------------------------
F7EDM0_XENTR/76-481-------SPER---------------------------------------------------------------------
H3CDB6_TETNG/12-433-------GPDK---------------------------------------------------------------------
S19A1_MOUSE/23-426-------E..R---------------------------------------------------------------------

PF03219

TLC2_ARATH/88-571-------G-LM------------------------------------------FF-------------------------
TLC1_CHLTR/2-492-------F-LM------------------------------------------FF-------------------------
Q6MEN4_PARUW/1-484-------M-LM------------------------------------------LF-------------------------
Q6MBI2_PARUW/1-474-------L-FQ------------------------------------------FF-------------------------
Q6MEN5_PARUW/4-499-------L-LI------------------------------------------FF-------------------------
Q6MEM5_PARUW/2-491-------F-FM------------------------------------------FF-------------------------
A5CCG3_ORITB/1-504-------A-LI------------------------------------------IF-------------------------
Q1MSG2_LAWIP/9-504-------G-LM------------------------------------------ML-------------------------
C4YY86_9RICK/5-489-------A-FM------------------------------------------MF-------------------------
C4YYY2_9RICK/12-501-------A-LL------------------------------------------MF-------------------------
C4YZB1_9RICK/5-496-------A-LM------------------------------------------MS-------------------------
F8KVN2_PARAV/3-490-------F-LM------------------------------------------FF-------------------------
TLCE_RICPR/7-496-------S-AL------------------------------------------MF-------------------------
TLC2_CHLTR/2-500-------F-FL------------------------------------------AF-------------------------
TLCD_RICPR/14-503-------T-LL------------------------------------------MF-------------------------

PF06963

S40A2_ARATH/31-479-------I-YL------------------------------------------WP-------------------------
S40A1_ORYSJ/21-450-------I-RI------------------------------------------WP-------------------------
S40A1_ARATH/35-483-------I-HL------------------------------------------WP-------------------------
A2R421_ASPNC/42-466-------A-TI------------------------------------------FP-------------------------
Q5AXY5_EMENI/19-441-------A-SI------------------------------------------FP-------------------------
Q8IA95_CAEEL/5-448-------H-QL------------------------------------------..-------------------------
S40A3_ARATH/146-569-------A-ML------------------------------------------YP-------------------------
Q0CWF0_ASPTN/44-463-------A-SI------------------------------------------FP-------------------------
Q4PD48_USTMA/82-563-------V-QL------------------------------------------FT-------------------------
S40A1_HUMAN/22-531-------V-EL------------------------------------------YG-------------------------
S40A1_DANRE/19-522-------V-EL------------------------------------------YG-------------------------
A8X2J9_CAEBR/13-461-------D-LL------------------------------------------..-------------------------
A5BT51_VITVI/32-472-------I-NI------------------------------------------WP-------------------------
A1CBM9_ASPCL/39-469-------A-SI------------------------------------------FQ-------------------------
S40A3_ORYSJ/147-569-------A-VL------------------------------------------HP-------------------------
H3DM67_TETNG/10-523-------I-EL------------------------------------------YG-------------------------

PF13347

D2VB35_NAEGR/31-486-------S-DK------------------------------------------SC-------------------------
B8B7S1_ORYSI/22-442-------T-DI------------------------------------------.G-------------------------
Q8I3H5_PLAF7/62-507-------T-NI------------------------------------------VG-------------------------
C5BVC3_BEUC1/22-453-------T-DV------------------------------------------IG-------------------------
A0A031WJE7_PEPDI/25-461-------T-DV------------------------------------------AK-------------------------
B3W8U5_LACCB/11-452-------T-DY------------------------------------------SG-------------------------
C3Z8Z9_BRAFL/15-394-------V-QV------------------------------------------AQ-------------------------
B5X2T0_SALSA/38-502-------L-DV------------------------------------------VQ-------------------------
NLS1_XENTR/37-494-------L-DI------------------------------------------AQ-------------------------
D0KIC2_PECWW/9-445-------T-TF------------------------------------------CG-------------------------
B1S9F4_9BIFI/14-474-------N-RF------------------------------------------CG-------------------------
A4AJK9_9ACTN/13-439-------T-DT------------------------------------------LG-------------------------
E8WA27_STRFA/18-443-------T-DV------------------------------------------LA-------------------------
A1SNV8_NOCSJ/11-434-------T-DS------------------------------------------LG-------------------------
A3V2V1_9RHOB/6-408-------A-DT------------------------------------------YG-------------------------
Q28K27_JANSC/7-401-------V-DT------------------------------------------YG-------------------------
B9KP25_RHOSK/4-400-------V-DE------------------------------------------YG-------------------------
B6AV21_9RHOB/12-414-------V-DE------------------------------------------FG-------------------------
A6E455_9RHOB/14-411-------V-DE------------------------------------------YG-------------------------
A8TM36_9PROT/10-426-------T-AG------------------------------------------LG-------------------------
A7HQL5_PARL1/9-433-------A-GE------------------------------------------LG-------------------------
Q026U3_SOLUE/21-465-------T-VV------------------------------------------KG-------------------------
Q0AL93_MARMM/17-465-------N-YV------------------------------------------IG-------------------------
Q2G9N1_NOVAD/12-450-------N-QV------------------------------------------LG-------------------------
Q2N8H6_ERYLH/12-453-------N-LV------------------------------------------LG-------------------------
C0D597_9CLOT/17-465-------Q-NV------------------------------------------LG-------------------------
A6NPU4_9FIRM/28-469-------T-DV------------------------------------------LA-------------------------
C6LHW9_9FIRM/41-483-------T-DV------------------------------------------LG-------------------------
Q5YU93_NOCFA/38-478-------T-DV------------------------------------------LG-------------------------
Q0F3N0_9PROT/19-595-------N-VA------------------------------------------LG-------------------------
D4LG93_9FIRM/21-452-------T-DL------------------------------------------AG-------------------------
A6TPY1_ALKMQ/9-433-------T-DV------------------------------------------AY-------------------------
A6TPY6_ALKMQ/10-436-------T-DI------------------------------------------IR-------------------------
C5EQ37_9FIRM/10-441-------I-TV------------------------------------------AG-------------------------
B7GTV4_BIFLS/22-444-------T-DV------------------------------------------VG-------------------------
B0NCA5_CLOSV/62-493-------T-NT------------------------------------------VG-------------------------
D4L2L1_9FIRM/9-431-------T-DI------------------------------------------.G-------------------------
C9BIA1_ENTFC/23-456-------T-NV------------------------------------------LG-------------------------
C3W9X3_FUSMR/14-452-------T-QV------------------------------------------WG-------------------------
D1PII8_9FIRM/14-445-------T-DV------------------------------------------MG-------------------------
C0BCF9_9FIRM/22-465-------Q-DI------------------------------------------MG-------------------------
C4Z9B4_EUBR3/7-441-------N-VV------------------------------------------LG-------------------------
C9QHC7_VIBOR/7-438-------T-DV------------------------------------------VG-------------------------
B0NX91_9CLOT/12-438-------T-DV------------------------------------------LK-------------------------
C3WEF2_FUSMR/7-437-------T-DV------------------------------------------LY-------------------------
C0BFD6_9FIRM/20-452-------T-DT------------------------------------------LY-------------------------
C3WB69_FUSMR/6-433-------T-DV------------------------------------------VG-------------------------
M2C6H5_TREDN/4-434-------T-DV------------------------------------------IY-------------------------
C7XWC4_9LACO/6-449-------T-SL------------------------------------------MF-------------------------
B2GBT3_LACF3/22-466-------T-SG------------------------------------------MF-------------------------
E7FT79_9LACO/16-461-------T-SG------------------------------------------LF-------------------------
D0DS55_LACFE/13-457-------T-GH------------------------------------------LF-------------------------
C0WMV6_LACBU/20-464-------T-SH------------------------------------------LF-------------------------
Q6SCS3_STRTR/10-454-------T-TH------------------------------------------LF-------------------------
B1SH60_9STRE/18-462-------T-SH------------------------------------------LF-------------------------
C5RC37_WEIPA/6-451-------T-SQ------------------------------------------LF-------------------------
C8P5V7_9LACO/3-447-------T-SQ------------------------------------------LF-------------------------
Q03PA7_LACBA/4-451-------T-SV------------------------------------------LF-------------------------
A8RLH8_CLOBW/23-450-------T-DT------------------------------------------IG-------------------------
B0NC69_CLOSV/24-452-------T-DI------------------------------------------AM-------------------------
R7CNT8_9FIRM/14-438-------T-DV------------------------------------------FG-------------------------
B1BWZ1_CLOPF/8-434-------T-LV------------------------------------------LK-------------------------
A9MYD9_SALPB/15-438-------T-DE------------------------------------------LG-------------------------
A9QSF4_LACLK/37-463-------I-DV------------------------------------------VG-------------------------
C6PWS4_9CLOT/17-439-------T-DV------------------------------------------CG-------------------------
F0K7R1_CLOAE/8-431-------T-DV------------------------------------------VG-------------------------
D4F9L7_EDWTA/9-430-------T-DV------------------------------------------AG-------------------------
D4BGD4_9ENTR/26-444-------T-DY------------------------------------------VG-------------------------
A4WD81_ENT38/20-469-------L-TV------------------------------------------NT-------------------------
C8P9N3_9LACO/19-468-------T-TV------------------------------------------FG-------------------------
D1BWG8_XYLCX/30-459-------T-EV------------------------------------------FG-------------------------
C8P9N0_9LACO/19-447-------T-NV------------------------------------------YG-------------------------
J4NZS7_OENOE/11-431-------T-DV------------------------------------------YG-------------------------
A6DPD4_9BACT/8-427-------T-DV------------------------------------------FG-------------------------
B1ZS00_OPITP/13-436-------T-DV------------------------------------------YR-------------------------
B3HTC5_ECOLX/7-428-------T-DV------------------------------------------FG-------------------------
D2TGV7_CITRI/11-433-------T-DV------------------------------------------FG-------------------------
L0W055_SERPL/8-433-------T-DI------------------------------------------YG-------------------------
D0KF27_PECWW/10-433-------T-DV------------------------------------------FG-------------------------
D3RGD6_KLEVT/10-434-------T-DV------------------------------------------FG-------------------------
C1MDP3_9ENTR/24-449-------T-DV------------------------------------------FG-------------------------
A0A025G5J5_ECO57/10-432-------T-DN------------------------------------------FG-------------------------
D2ZB78_9ENTR/9-430-------T-DV------------------------------------------VG-------------------------
E6WJ95_PANSA/9-430-------T-DV------------------------------------------VG-------------------------
D4GIM8_PANAM/27-451-------T-DI------------------------------------------FG-------------------------
C9XVR9_CROTZ/33-456-------T-DI------------------------------------------FG-------------------------
A0A023UW17_SERPL/19-442-------T-DV------------------------------------------YG-------------------------
A6G4R1_9DELT/26-447-------T-DY------------------------------------------FG-------------------------
A4AAW4_9GAMM/14-442-------T-DV------------------------------------------FG-------------------------
A6DP62_9BACT/9-590-------T-DV------------------------------------------FG-------------------------

PF11700

A7K364_VIBSE/8-434LG......-.......................................................................
Q8DIR0_THEEB/14-463LT......-.......................................................................
Q4JAW8_SULAC/5-379........-.......................................................................
A0A059FXI1_9RHOB/25-469VV...GDG-V..KG..................................................................
A0A059FSZ2_9RHOB/23-495IV...GAD-I..LASGRLEGLSPDEA......................................................
Q0U0L9_PHANO/44-456AN...VLG-H...IPGTNKPCAKRGVI.....................................................
A1CD46_ASPCL/43-518AN...LLG-H...EEGSNKPCPRRGTNI....................................................
ATG22_CANAL/39-496AK...NVG-K....TKMNQPCGTQGN......................................................
A3LP71_PICST/32-502AT...EVG-....RNSKGGRCERRGN......................................................
Q75EJ9_ASHGO/58-558AH...ELG-H..PKGHPAAHCRPRGD......................................................
Q6CKN0_KLULA/64-544AH...ALG-H...PKGSSGPCLATGD......................................................
A7EQB6_SCLS1/56-534IYQAGFNP-N..ILPLGSAPCGDDT.......................................................
A5DD56_PICGU/47-524LS...QSG-W..IKGKRNVSCSDDPNG.....................................................
Q4PA89_USTMA/59-561LS...QQA-T..NL..GAGQCGQDGQN.....................................................
F5HBL2_CRYNB/49-483LY...LAG-WDPAYPTGTVPCGDG........................................................
Q0TYS2_PHANO/43-505MYQ..AAG-D......................................................................
Q0CF56_ASPTN/43-493LYQ..AAG-D......................................................................
Q5B0Q4_EMENI/43-494LS...QA.-.....TDENG.............................................................
Q0CXZ2_ASPTN/50-478LSQAAGSG-G......................................................................
A1DH52_NEOFI/48-512LYQ..AAG-D......................................................................
ATG22_SCHPO/13-525AH...DHG-F..LRTDHTIPCSLYPEE.....................................................
A9WGR7_CHLAA/9-439TR......-...NAADA...............................................................
A4X7E0_SALTO/18-457AE......-.......QAAGCELGAD......................................................
A6E856_9SPHI/5-431TTTA.EHG-D......................................................................
Q26DY7_FLABB/8-443SKTAYEEG-N......................................................................
A6H0A9_FLAPJ/7-445FK...KRG-N......................................................................
ATG22_CRYNJ/1-531.....PSG-N..IPANHFGTCDGKA.......................................................
AT222_PHANO/72-634AR...ENG-V..LLSDRTTPCKAPRPITPSFSASSFEA........LLR..........................PNPEK
ATG22_COCIM/35-567TR...DQG-V..LLSDKKTPCSASWPTAPTAYAAADATA....................................SPRVG
AT221_PENCW/20-562AR...DRG-V..LLSDKTTPCSATWRPP........LPPPGSDAPVYLP..........................QVSDG
AT221_ASPFU/24-580AR...DRG-V..LFSDKVTPCSATLNGPSRMSIQARWTLSSRYDA..............................GRPTV
AT222_ASPCL/24-579AR...DRG-V..LLSDKVTPCSASWNGTETTARTHGISPPW.....YGI..........................NATPG
AT221_ASPNC/30-582AR...ERG-V..LLSDKKTPCSATWSSLESTSPSGTWNTIFDATAFTKP..........................GSPRT
AT221_ASPOR/20-571AR...DRG-V..LLSDKVTPCQATWKAPKQLSPHETLSQTLINALRYGR..........................DVPGA
AT221_EMENI/24-564AR...ERG-V..LLSDKTTPCTAIWKTPESSNTS............WQN..........................SSPAA
AT222_ASPTN/24-571AR...DSG-V..LLADKTTPCSATWKTPQGTSPTLSADTTGL....WSS..........................QAPRT
AT222_SCLS1/72-619AR...ENG-V..LLSDPTQPCGSSSTHLPPG...............LHP..........................GSAKD
L7I128_MAGOY/99-626AR...ENG-V..LLKDRTSPCKASYDKTPD.............................................GGNDD
ATG22_NEUCR/155-689AR...ENG-V..LLSDRSKPCGSSSDKHTTSAEG..............................................
AT221_BOTFB/21-562AR...EQG-V..LFTDKITPCTAKNATAIANATVNALM........SRA..........................EGPDT
AT222_PENCW/33-580AR...ERG-T...LQTSRLPCVGPSAGNSTNATEHG............................................
AT222_ASPOR/30-578AR...EQG-T..FKSSHL.PCVGPGSPSTSVNGTAPAM........LRR..........................DEAEN
AT222_EMENI/31-576AR...EQG-F..LSSSH.LPCVGPDAPPAAGNGTAPANE.........................................
ATG22_YARLI/6-582AR...QNA-V..LADDHSQPCDSPPVPFPGDPGVPTDPGIPPNNSLSSSVPWFLRANEIQLLESPDTVHTMKDHKAKPTQ
ATG22_PICAN/27-551AR...DNG-V..KLIDKITPCNQPHDPTIPIPSPPKDGDFPNSTLTYAS.............................QN
M9N7N8_ASHG1/19-490AR...NNG-V..QVDDHTVACGAEDK......................................................
N1P7Z2_YEASC/20-514AS...ING-V..KVHDHSIPCLSETGSDSD..................................................
ATG22_CANGA/31-527AR...ING-V..QLDDHNAPCSTSSSD.....................................................
ATG22_KLULA/17-487GR...ING-V..KLDDHSLRCEVNDD......................................................
ATG22_VANPO/27-511AR...HNG-V..TLEDHSVHCTADHD......................................................

PF03092

Q25272_LEIDO/59-606YG------------------------------------------------------------------------------
B3GVG0_TRYBB/138-667FG------------------------------------------------------------------------------
Q9UAB8_LEIDO/94-683YG------------------------------------------------------------------------------
Q9UAB7_LEIDO/75-654YG------------------------------------------------------------------------------
Q9UAC0_LEIDO/76-655YG------------------------------------------------------------------------------
Q9UAC1_LEIDO/75-651YG------------------------------------------------------------------------------
FBT8_ARATH/98-515LA------------------------------------------------------------------------------
FBT7_ARATH/30-441LR------------------------------------------------------------------------------
FBT3_ARATH/61-473QK------------------------------------------------------------------------------
FBT1_ARATH/137-553LH------------------------------------------------------------------------------
F7USN5_SYNYG/46-457LG------------------------------------------------------------------------------
O68867_SYNE7/38-441LG------------------------------------------------------------------------------

PF00083

GTR4_MOUSE/27-483LGRQGPGG-PDSI........................................................-----------
GTR1_MOUSE/14-467NHRYGEPI-PS..........................................................-----------
QUTD_EMENI/24-490ESLNTDLI-S...........................................................-----------
ITR2_YEAST/112-569LTYGE.KE-............................................................-----------
SNF3_YEAST/100-556PNHDSFTA-Q...........................................................-----------
GALP_ECOLI/18-451ITSHT.QE-............................................................-----------
HXT5_YEAST/89-549TRANGTTY-L...........................................................-----------
GTR3_MOUSE/13-465EERLEDLP-SE..........................................................-----------
HXT9_YEAST/64-526KNDKGTYY-L...........................................................-----------
HXT8_YEAST/69-530SHSKNTYY-L...........................................................-----------
HXT6_YEAST/68-528KHKDGTNY-L...........................................................-----------
GTR3_CHICK/14-464SQRSGETI-SP..........................................................-----------
GTR5_HUMAN/20-475YGRTGEFM-ED..........................................................-----------
HXT13_YEAST/60-521YKHSTGEY-Y...........................................................-----------
YB91_YEAST/27-485DENISYDD-TWVGQHG..................................................LKQ-----------
PROP_ECOLI/25-453DPSVQMVA-A...........................................................-----------
JEN1_YEAST/125-563SVSVAPLA-ELY.........................................................-----------
GIT1_YEAST/43-466KKNYSSKV-S...........................................................-----------
GTR2_MOUSE/13-498GVPLDDRK-AAINYDVNGTDTPLTVTPA...........................YTTPAPWDEEETEG-----------
HXT2_YEAST/59-519MKSDGTYY-L...........................................................-----------
XYLE_ECOLI/13-478NLSESAAN-S...........................................................-----------
LACP_KLULA/75-529DINSSSG.-............................................................-----------
STP1_ARATH/26-489SVYRKQQE-DASTN......................................................Q-----------
MAL31_YEAST/102-561LNSNTGDY-E...........................................................-----------
QAY_NEUCR/24-494ASYT..PG-A...........................................................-----------
GLF_ZYMMO/13-469PRHLSATA-............................................................-----------
STL1_YEAST/30-488TKENGDHD-R...........................................................-----------
ARAE_ECOLI/25-461LTSR..LQ-E...........................................................-----------
GAL2_YEAST/74-534KHKDGTHY-L...........................................................-----------
A4I0Q6_LEIIN/5-442SEHSWQYA-............................................................-----------
A4I8N6_LEIIN/77-573YNAKKSCE-TLTAAKCRWFNASTYVSNTTYGEVCGWADRTTCFLKYSDEAGCLSDSACKWSYSANTCGN-----------
Q38AB8_TRYB2/39-501FKTTEACK-AVGSYGCEWKDTEVCSWKK...........................ECDSDSDGVNPCES-----------
Q38AB9_TRYB2/39-500TTEVA.CG-GAKIYGCKWSGTTCKFENP...........................KCSEGSDPSDSCKN-----------

PF05977

Q92LE2_RHIME/11-531SA------------------------------------------------------------------------------
Q98HB4_RHILO/11-532AT------------------------------------------------------------------------------
Q92Y88_RHIME/8-530SA------------------------------------------------------------------------------
A9CFW7_AGRT5/8-530SA------------------------------------------------------------------------------
Q9HYE1_PSEAE/25-549HA------------------------------------------------------------------------------
Q989L4_RHILO/31-551ST------------------------------------------------------------------------------
Q92SW7_RHIME/14-535SQ------------------------------------------------------------------------------
Q989T8_RHILO/11-532ST------------------------------------------------------------------------------
Q9I0E1_PSEAE/6-529SA------------------------------------------------------------------------------

PF07690

O17785_CAEEL/33-439.......S-GDGAPVSNRSALTNLENMEMTLVNASGSLTDNVENMEHKIADGRYN.........................
A0A038FBG6_MYCTX/18-356.......E-NA..........................................RG.........................
ANTR2_ARATH/137-500.......S-QE..........................................YN.........................
Q19296_CAEEL/16-403.......N-YYSKEG.................................HRDWLYDISVKGLQS.................
A9CFQ9_AGRT5/27-373.......R-EA..........................................FG.........................
A0A028WC33_STAAU/10-348.......K-QE..........................................LG.........................
I0ZIS1_HELPX/8-347.......A-DS..........................................FH.........................
C3MP39_SULIL/20-385.......A-PL.....................................................................
D7GFS1_PROFC/22-419.......T-EA..........................................LH.........................
O66589_AQUAE/21-406.......A-ES..........................................FG.........................
A0A022P0M0_PSEAI/19-362.......S-AE..........................................YA.........................
MFSD9_HUMAN/49-427........-KS..........................................LG.........................
Q97CG2_THEVO/16-347.......G-KL..........................................FS.........................
F2HKW9_LACLV/24-427.......Q-TQ..........................................LH.........................
F6BV17_SINMB/23-360.......K-EN..........................................YA.........................
D1EUE3_BRUML/8-339.......L-ES..........................................RG.........................
N0C478_SALTI/17-369.......T-VE..........................................NI.........................
I0LFL8_CORGK/19-414.......A-TD..........................................LG.........................
Q9YG70_AERPE/18-417.......Q-AE..........................................LG.........................
Q9HLN0_THEAC/12-329.......T-ST..........................................VY.........................
M4UM27_RALSL/30-433.......S-RA..........................................LGITQSHTCGADV..............
A7WY21_STAA1/33-313.......L-QE..........................................QG.........................
D6EGQ9_STRLI/61-422.......A-QH.....................................................................
Q8NNT7_CORGL/10-351.......N-NG.....................................................................
M4MIX3_SINM2/13-355.......S-RD..........................................TG.........................
I6V0W9_9EURY/13-389.......Q-ET..........................................FK.........................
O58400_PYRHO/34-380.......M-KI..........................................IG.........................
A1EPJ6_VIBCL/16-353.......A-NH..........................................FA.........................
Q9KWU2_SPHSX/13-348.......D-SN..........................................FM.........................
A0A008NSL7_STAAU/18-353.......P-TV..........................................TS.........................
C8K874_LISMN/13-349.......Q-EE..........................................LN.........................
NART_STACT/13-344.......S-QD..........................................IK.........................
Q9K646_BACHD/13-358........-............................................YQ.........................
YLZ2_SCHPO/48-434.......A-EQ..........................................FH.........................
E8VD81_BACST/15-348.......L-QE..........................................LG.........................
Q1K517_NEUCR/132-490.......E-KY..........................................YN.........................
O54179_STRCO/33-428.......G-DG..........................................LG.........................
Q98B83_RHILO/60-407.......S-SE..........................................AG.........................
A0A017M9G1_ECOLX/39-413.......G-RD..........................................LG.........................
Q9EYN6_SYNPW/18-450.......K-AD..........................................LG.........................
Q9KBG2_BACHD/16-398.......Q-DT..........................................FQ.........................
Q986N1_RHILO/24-356.......A-SS..........................................FA.........................
Q93LX8_9ACTO/30-425.......G-DD..........................................LG.........................
Q8KDQ3_CHLTE/9-374.......A-KE..........................................LG.........................
Q9PCL3_XYLFA/32-422.......A-HD..........................................LG.........................
Q9URI1_CANAX/123-512.......M-HD..........................................FG.........................
A0A016X6J9_VIBCL/22-366.......A-RD..........................................FG.........................
M4MHF4_SINM2/19-357.......Q-GD..........................................LA.........................
Q9RSF5_DEIRA/46-397.......G-RQ..........................................LG.........................
LIZ1_SCHPO/36-407.......Q-ED..........................................LK.........................
F0K3Z3_CLOAE/13-357.....FSG-GD..........................................FN.........................
A0A030S566_PSEAI/29-430.......R-GA..........................................LA.........................
A0A024SUQ9_PSEAI/12-346.......A-AS..........................................FH.........................
Q9KYI2_STRCO/15-371.......S-YN..........................................TG.........................
Q973W8_SULTO/12-335.......F-Y...........................................FH.........................
Q18472_CAEEL/18-397.......K-ED..........................................NSEMHLVN...................
Q8ZXX0_PYRAE/10-352.......K-LA..........................................SG.........................
Q9AA55_CAUCR/30-391........-............................................IG.........................
YN42_SCHPO/141-527.......T-TV..........................................FH.........................
A0A008B8F0_STAAU/16-376........-DD..........................................LG.........................
Q961H2_DROME/54-453....CITI-EKFNAT.................................QCEPLLGIDRGS....................
C3SM02_ECOLX/36-398.......A-NG..........................................VL.........................
Q8KCE7_CHLTE/27-390.......N-EH..........................................LG.........................
P95852_SULSF/9-333.......E-KQ..........................................IN.........................
O45678_CAEEL/27-403.......A-KE..........................................FA.........................
A0A030YLG4_PSEAI/21-369.......Q-ND..........................................LQ.........................
O30222_ARCFU/15-357.......M-DE..........................................FG.........................
B0R8P5_HALS3/24-368.......G-VE.....................................................................
Q8TR38_METAC/18-398.......V-TK..........................................YG.........................
Q986D7_RHILO/41-396.......R-QG..........................................YH.........................
O69759_PSEFL/31-392.......Q-HD..........................................YC.........................
Q9HLR9_THEAC/6-377.......V-VY..........................................LH.........................
H6NYS0_SALTI/13-352........-............................................AQ.........................
O28944_ARCFU/4-328.......A-SS..........................................LG.........................
A1EJD6_VIBCL/40-383.......Y-QD..........................................YH.........................
Q96XQ4_SULTO/9-336.......Y-SS..........................................LK.........................
A0A023BKQ7_LISMN/13-376.......S-ES..........................................IG.........................
O62376_CAEEL/16-394.......S-NS..........................................SGHAPL.....................
YCUD_SCHPO/89-473.......F-DI..........................................YQ.........................
A0A038KTQ1_MYCTX/25-423........-AD..........................................IG.........................
Q9KG75_BACHD/5-341........-.S..........................................LG.........................
Q7JZE2_DROME/46-458RLTEGNVT-STGRCG.................................SPRVVFN.........................
A0A016X795_VIBCL/36-395.......A-GI.....................................................................
B0RRS7_XANCB/26-418.......A-RD..........................................FG.........................
H1XFL1_9XANT/19-356.......A-QA..........................................FG.........................
YQ92_SCHPO/20-407.......V-DR..........................................VG.........................
O16697_CAEEL/36-432.......G-LD..........................................KT.........................
A0A029SIS1_STRPY/10-353.......V-EN..........................................LG.........................
Q1K880_NEUCR/87-498.......S-AE..........................................FG.........................
H1CQV8_CLOPF/26-404.......A-KA..........................................FN.........................
O58488_PYRHO/9-354.......I-HH..........................................FG.........................
Q9K9F3_BACHD/14-368.......E-TE..........................................FS.........................
O29880_ARCFU/11-360.......M-NT..........................................FG.........................
Q97C48_THEVO/19-351.......N-EY..........................................LH.........................
Q9Y7D4_ASPTE/35-449.......T-AQ..........................................FH.........................
F7ZPU5_CLOAT/23-413.......M-KE..........................................MN.........................
Q8MPU6_CAEEL/90-445.......L-KN.....................................................................
Q96Y06_SULTO/9-344.......V-KY..........................................LG.........................
A9CIR5_AGRT5/18-359.......Y-FE..........................................ID.........................
Q8ZWZ3_PYRAE/12-326.......L-RE..........................................FR.........................
A0A025FMH0_ECO57/20-357.......T-DE..........................................VH.........................
G4UU99_NEUT9/52-417.......A-TD..........................................LH.........................
A0A038F9G3_MYCTX/16-365.......L-LI..........................................HD.........................
Q19845_CAEEL/45-446.......T-LE..........................................HN.........................
A0A028WR33_STAAU/12-354.......G-HD..........................................LG.........................
L8ADD9_BACIU/19-353.......H-EQ..........................................LN.........................
Q8ZVF8_PYRAE/4-322........-RD..........................................LG.........................
O58825_PYRHO/10-360.......L-DK..........................................TG.........................
A0A017MXT2_ECOLX/8-341.......A-HN..........................................VG.........................
Q9L8Q4_PSEST/17-351.......V-AD..........................................LG.........................
Q9XXC1_CAEEL/44-436.......W-ED..........................................FVNSNKSLDEINWN.............
Y4007_STRCO/39-376.......A-HD..........................................MG.........................
Q8YQ15_NOSS1/8-358.......R-QQ..........................................KM.........................
O93992_CANAX/65-459.......M-EH..........................................LD.........................
Q8YWH2_NOSS1/17-343.......Q-NN.....................................................................
Q9RSM6_DEIRA/32-418.......A-TE..........................................LR.........................
Q9VDS0_DROME/61-500.......G-SE..........................................FTCDTSYLTSSSNSSFSISDNQCYVLD
A0A030RLT0_PSEAI/28-357.......G-TG..........................................LG.........................
M4MMB5_SINM2/19-421.......G-DI..........................................IGD........................
I3XGH7_RHIFR/18-362.......I-KA..........................................LS.........................
Q8XGP2_RALSO/41-431.......A-VD..........................................LH.........................
J7JJU9_BACIU/15-364.......A-FQ..........................................LH.........................
E3YYX7_LISIO/14-347.......A-ES..........................................IG.........................
F7UKI9_SYNYG/19-365.......A-FE.....................................................................
B8H5X3_CAUCN/31-388.......S-VE..........................................FG.........................
D6EJD0_STRLI/29-361.......G-SS..........................................FT.........................
Q97BG6_THEVO/17-357.......I-EI..........................................YS.........................
Q9X4X9_9PSED/27-377.......N-QA..........................................FG.........................
Q973J7_SULTO/8-320........-KS..........................................LG.........................
O32859_MYCFO/12-364.......L-QH..........................................NG.........................
Q9S243_STRCO/13-352.......A-LA..........................................LG.........................
A0A034WYQ7_STREE/13-344........-............................................QG.........................
Q97CC5_THEVO/27-411.......A-YS..........................................FGWSYSP....................
D5AX67_RICPP/10-405.......K-KD.....................................................................
Q9RD97_STRCO/46-435.......A-AD..........................................LH.........................
Q8R8R3_THETN/20-398.......L-EA..........................................FGTYVMFF...................
O30210_ARCFU/17-354.......M-ET..........................................YG.........................
Q8X120_EXODE/120-524.......G-NT..........................................FH.........................
Q9EW91_9ACTO/13-358.......L-HL..........................................TG.........................
Q8MMD6_DROME/21-407.......A-EN..........................................TN.........................
Q8XVV0_RALSO/19-414.......Q-GE..........................................IG.........................
Q978I2_THEVO/17-358.......F-IT.....................................................................
S22AI_MOUSE/13-363.......S-RT..........................................LG.........................
M4MJU5_SINM2/14-352.......P-TA..........................................LG.........................
Q4UVJ5_XANC8/24-370.......Y-EI..........................................TR.........................
A0A030R0G5_PSEAI/34-397.......A-GE..........................................FQ.........................
A0A030YI13_PSEAI/26-388.......D-PS..........................................FE.........................
Q9KG22_BACHD/29-373.......V-DE..........................................LG.........................
Q9KYE9_STRCO/8-359.......A-QV..........................................RG.........................
A0A029SJ89_STRPY/27-401........-............................................VQ.........................
O31131_BRELN/13-405.......G-DD..........................................LE.........................
M4U5Z3_9XANT/29-361.......A-SD..........................................LH.........................
A4TJW7_YERPP/23-431.......V-KS..........................................FN.........................
Q8U366_PYRFU/20-359.......T-DV..........................................LH.........................
Q9C9R9_ARATH/11-379.......A-LH.....................................................................
Q20265_CAEEL/46-427NETILPSS-LN..........................................FN.........................
Q9PCQ0_XYLFA/73-403.......A-QD..........................................LA.........................
A0A022NLX7_PSEAI/4-339.......L-AS..........................................LG.........................
Q9VPX2_DROME/42-442.......V-EECNPP.................................GGASNVTAKVE.....................
G2KCG1_LISMN/17-359.......S-QD..........................................LG.........................
Q8VUK1_HALHD/23-380.......R-EP..........................................LG.........................
B8FVY2_DESHD/13-347.......K-AF..........................................PH.........................
A9CGF2_AGRT5/30-354.......G-EY..........................................WL.........................
O66181_ARTSP/15-353.......K-ES..........................................LS.........................
Q8KYU7_9PROT/15-359.......R-AA..........................................FN.........................
YJ7D_SCHPO/81-445.......K-TD..........................................TH.........................
H4S4N1_ECOLX/47-408.......R-EE..........................................LG.........................
Q9VY22_DROME/66-470.......T-QN..........................................LNLEKACRVNMAYGDEV.........C
I6V2R6_9EURY/8-345........-.T..........................................LG.........................
J7JKV9_BACIU/12-351.......T-KQ..........................................WN.........................
O30679_RHORH/8-341.......A-RD..........................................LG.........................
F0KEM5_CLOAE/16-408.......M-KS..........................................FS.........................
A0A023ZK54_YEASX/86-451.......K-DH..........................................LK.........................
B8H3N7_CAUCN/19-356.......I-KT..........................................FD.........................
F0KEM1_CLOAE/19-357.......A-SE..........................................LS.........................
A0A028WN84_STAAU/12-398.......K-QD..........................................LN.........................
Q9VPD9_DROME/28-441.......S-GS..........................................FG.........................
Q8PVU8_METMA/11-346.......V-EP..........................................LK.........................
A0A032S8J6_STAAU/18-410.......M-RE..........................................LN.........................
F0K465_CLOAE/17-361.......T-QK..........................................LK.........................
Q8KR58_ESCFE/20-359.......L-TG..........................................LS.........................
I0LNP6_CORGK/19-353.......A-SD..........................................LG.........................
Q9LAA0_AERHY/27-362.......S-RA..........................................LD.........................
O06742_BACIU/18-364.......K-SE..........................................LH.........................
Q9FCG1_STRCO/24-364.......T-ID..........................................RG.........................
O94019_CANAX/86-529.......N-EK..........................................YG.........................
MOT14_MOUSE/42-459........-EE..........................................FH.........................
F6C4D9_SINMB/8-347.......A-DT..........................................HT.........................
Q9Y7E0_ASPTE/42-435.......A-NE..........................................FD.........................
A0A022NSM6_PSEAI/11-401.......G-RS..........................................LG.........................
O76837_CAEEL/25-400.......M-QD.....................................................................
Q96ZI2_SULTO/36-365.......K-YI..........................................FN.........................
Q7BQD2_PSEST/7-367.......M-RQ..........................................HG.........................
Q94886_DROME/14-423SNETHENS-TD..........................................LAALAEMNER.................

PF05978

Q19933_CAEEL/13-169-------A-AL------------------------------------------AT-------------------------
Q9XV34_CAEEL/12-166-------E-SV------------------------------------------SL-------------------------
MFS11_MOUSE/14-166-------R-SL------------------------------------------NS-------------------------
Q8MYL9_CAEEL/14-170-------H-SI------------------------------------------HE-------------------------
Q965T3_CAEEL/14-170-------H-GL------------------------------------------SE-------------------------
P91007_CAEEL/16-172-------H-SV------------------------------------------HE-------------------------
Q9XWR7_CAEEL/37-194-------H-SI------------------------------------------HE-------------------------
Q19932_CAEEL/14-169-------E-EE------------------------------------------HR-------------------------
Q21545_CAEEL/14-168-------D-SA------------------------------------------AD-------------------------
O61865_CAEEL/27-183-------N-SI------------------------------------------HE-------------------------
Q18251_CAEEL/11-167-------R-KK------------------------------------------AE-------------------------

PF03137

A0NEW4_ANOGA/55-618-------E-KS------------------------------------------IQ-------------------------
A7S331_NEMVE/27-582-------E-TR------------------------------------------FG-------------------------
A7S539_NEMVE/32-576-------E-KR------------------------------------------YG-------------------------
A7S542_NEMVE/18-557-------E-KR------------------------------------------YG-------------------------
A7SHZ4_NEMVE/19-550-------E-KR------------------------------------------FY-------------------------
A7SQZ6_NEMVE/18-584-------E-KR------------------------------------------FS-------------------------
A7SWE4_NEMVE/55-622-------E-RR------------------------------------------FG-------------------------
A7SX54_NEMVE/31-599-------E-KR------------------------------------------FK-------------------------
A8P8W3_BRUMA/81-731-------E-RR------------------------------------------FQ-------------------------
A8PR64_BRUMA/26-571-------E-RR------------------------------------------FG-------------------------
B0WEE2_CULQU/64-642-------E-KS------------------------------------------IQ-------------------------
B0WEE5_CULQU/105-708-------E-KR------------------------------------------YK-------------------------
B0WGA7_CULQU/25-763-------E-KR------------------------------------------FK-------------------------
B3DJD4_DANRE/48-631-------E-RR------------------------------------------FD-------------------------
B3MGJ1_DROAN/65-620-------E-KR------------------------------------------YK-------------------------
B3MGJ2_DROAN/51-611-------E-KR------------------------------------------FN-------------------------
B3MNT7_DROAN/36-684-------E-KR------------------------------------------FK-------------------------
B3RLK5_TRIAD/8-577-------E-TR------------------------------------------FE-------------------------
B3RLK6_TRIAD/21-588-------E-TR------------------------------------------FE-------------------------
B3RLK7_TRIAD/29-614-------E-KR------------------------------------------YE-------------------------
B3RLK8_TRIAD/27-595-------E-KR------------------------------------------FN-------------------------
B3RLL2_TRIAD/176-721-------E-KR------------------------------------------YN-------------------------
B3S2R8_TRIAD/18-575-------E-TR------------------------------------------YE-------------------------
B3SCA6_TRIAD/44-614-------E-KR------------------------------------------FH-------------------------
B4J9Q1_DROGR/61-622-------E-KR------------------------------------------YK-------------------------
B4J9Q2_DROGR/50-610-------E-KR------------------------------------------YK-------------------------
B4J9Q3_DROGR/52-605-------E-KR------------------------------------------YG-------------------------
B4JCP9_DROGR/31-685-------E-KR------------------------------------------FK-------------------------
B4KJ36_DROMO/34-688-------E-KR------------------------------------------FK-------------------------
B4KS84_DROMO/70-629-------E-KR------------------------------------------YK-------------------------
B4KS85_DROMO/55-614-------E-KR------------------------------------------YK-------------------------
B4KS86_DROMO/50-605-------E-KR------------------------------------------YK-------------------------
B4KS87_DROMO/111-737-------E-KR------------------------------------------FK-------------------------
B4MDK1_DROVI/34-691-------E-KR------------------------------------------FK-------------------------
B4MFR1_DROVI/68-626-------E-KR------------------------------------------YK-------------------------
B4MFR2_DROVI/57-615-------E-KR------------------------------------------YK-------------------------
B4MJH9_DROWI/51-614-------E-KR------------------------------------------FK-------------------------
B4MJI0_DROWI/54-620-------E-KR------------------------------------------YK-------------------------
B4MWM1_DROWI/38-693-------E-KR------------------------------------------FK-------------------------
B4N051_DROWI/200-840-------E-KR------------------------------------------FE-------------------------
B5DE94_XENTR/28-595-------E-KR------------------------------------------FG-------------------------
B5DI87_DROPS/36-609-------E-KR------------------------------------------FK-------------------------
B5E0I0_DROPS/65-626-------E-KR------------------------------------------YK-------------------------
B7PPH4_IXOSC/20-614-------E-RR------------------------------------------FA-------------------------
B7QN84_IXOSC/6-567-------E-KL------------------------------------------YQ-------------------------
C3Y4T6_BRAFL/2-565-------E-KR------------------------------------------FE-------------------------
C3Y4T7_BRAFL/83-626-------E-KR------------------------------------------FS-------------------------
C3YMS7_BRAFL/5-587-------E-KR------------------------------------------FE-------------------------
C3ZQA6_BRAFL/26-589-------E-KR------------------------------------------YQ-------------------------
C3ZX58_BRAFL/40-591-------E-RQ------------------------------------------FG-------------------------
D6W853_TRICA/116-732-------E-KR------------------------------------------FE-------------------------
D6W895_TRICA/53-625-------E-KR------------------------------------------FK-------------------------
E0VXM5_PEDHC/126-706-------E-KR------------------------------------------FR-------------------------
E0W488_PEDHC/204-804-------E-KR------------------------------------------FE-------------------------
E1C5S3_CHICK/28-603-------E-KR------------------------------------------YG-------------------------
E1FKB9_LOALO/26-596-------E-RR------------------------------------------FG-------------------------
E1FVI2_LOALO/58-633-------E-KR------------------------------------------FH-------------------------
E2A200_CAMFO/99-698-------E-KL------------------------------------------FQ-------------------------
E2ABP4_CAMFO/74-684-------E-KR------------------------------------------FK-------------------------
E2BXT3_HARSA/74-652-------E-KR------------------------------------------FK-------------------------
E2RSD4_CANFA/44-638-------E-RR------------------------------------------FD-------------------------
E4X1Y1_OIKDI/36-601-------E-QR------------------------------------------YS-------------------------
E5S461_TRISP/81-717-------E-RR------------------------------------------FN-------------------------
E5SC63_TRISP/58-613-------E-SR------------------------------------------FQ-------------------------
E7F5H8_DANRE/27-603-------E-RR------------------------------------------FN-------------------------
E9G6H1_DAPPU/44-620-------E-RR------------------------------------------YD-------------------------
E9GGR7_DAPPU/1-573-------E-KL------------------------------------------FQ-------------------------
E9GTG7_DAPPU/37-616-------E-KQ------------------------------------------FK-------------------------
E9INY6_SOLIN/50-616-------A-RR------------------------------------------FQ-------------------------
F1MA40_RAT/144-702-------E-RD------------------------------------------FY-------------------------
F1NQ62_CHICK/86-676-------E-RR------------------------------------------FD-------------------------
F1Q3Z3_CANFA/92-650-------Q-KA------------------------------------------YH-------------------------
F1Q9B1_DANRE/21-583-------E-RR------------------------------------------YG-------------------------
F1QBF7_DANRE/27-591-------E-KR------------------------------------------