Sequence alignment for CL0026

PF00127

AZUP_METEA/30-118VKMLNSG-------------------------------------------------------------------------
AZUR1_METJ/22-149AGCSVDV-------------------------------------------------------------------------
AZUP_ALCFA/28-116VHMLNKG-------------------------------------------------------------------------
AMCY_METEA/31-119PAGSTEV-------------------------------------------------------------------------
PLAS2_POPNI/70-168VDVLLGA-------------------------------------------------------------------------
AZUR_ALCFA/1-127.ACDVSI-------------------------------------------------------------------------
PLAS_CHLFU/2-98VTVKLGA-------------------------------------------------------------------------
PLAS_SILPR/67-165AEVLLGS-------------------------------------------------------------------------
AZUP_PARPN/27-115VHMLNKG-------------------------------------------------------------------------
PLAS_NOSS1/37-138YTVKLGS-------------------------------------------------------------------------
PLAS_CUCSA/1-99IEILLGG-------------------------------------------------------------------------
AMCY_PARDE/43-131ADGAIVV-------------------------------------------------------------------------
PLAS2_ARATH/69-167IEVLLGG-------------------------------------------------------------------------
AZUP_ACHCY/33-121VHMLNKG-------------------------------------------------------------------------
PLAS_SYNY3/31-126ATVKMGS-------------------------------------------------------------------------
AZUR_PSEFB/1-128AECKTTI-------------------------------------------------------------------------
PLAS_DAUCA/1-97AEVKLGA-------------------------------------------------------------------------
PLAS_CHLRE/49-145ATVKLGA-------------------------------------------------------------------------
AZUR_BORPE/22-149AECSVDI-------------------------------------------------------------------------
PLAS_VICFA/1-99VEVLLGA-------------------------------------------------------------------------
AZUR_PSEAE/21-148AECSVDI-------------------------------------------------------------------------
HCY_NATPH/73-163VVVVTGA-------------------------------------------------------------------------
AZUR_ALCSP/1-128AECSVDI-------------------------------------------------------------------------
AZUR_PSECL/1-128AECKVDV-------------------------------------------------------------------------
AZUR_ALCDE/21-148AQCEATI-------------------------------------------------------------------------
H81_NEIGO/57-182GNCAATV-------------------------------------------------------------------------
PLAS_ULVPR/2-98AIVKLGG-------------------------------------------------------------------------
AZUR2_METJ/1-128ASCETTV-------------------------------------------------------------------------
AMCY_PARVE/44-132PADAVVV-------------------------------------------------------------------------
PLAS_SOLLC/72-170LEVLLGG-------------------------------------------------------------------------
PLAS_HORVU/59-155QDVLLGA-------------------------------------------------------------------------

PF13473

B3CV67_ORITI/16-120GIYLLLV..LL.TLAS-----------------------------------.....WRS.......--------------
B5WRG9_9BURK/6-109KIAMLAA..TF.CLAA-----------------------------------.....TAH.......--------------
Q4ULV7_RICFE/15-124GLIFLAV..II.YIST-----------------------------------.....NKS.......--------------
A9VLT2_BACWK/13-122SLAMIVV..MT.TLGS-----------------------------------.....LHV.......--------------
Y394_RICPR/15-123CLMFLAI..MV.YIYK-----------------------------------.....SNGP......--------------
A8GXF3_RICB8/19-125LLIAGIS..LF.ISAN-----------------------------------.....KNS.......--------------
B2JD79_BURP8/6-110KIAALAM..AA.SLIG-----------------------------------.....LAH.......--------------
A3P8U3_BURP0/8-112SSLALAL..AF.AVSA-----------------------------------.....PHA.......--------------
C7JG61_ACEP3/11-115AAIPLLA..GA.WICF-----------------------------------.....PQQ.......--------------
D0P677_BRUSS/22-123G...GVV..LL.AVAS-----------------------------------.....SVA.......--------------
B1FN56_9BURK/5-109AIGFALA..LL.GASA-----------------------------------.....TSA.......--------------
B3Z7I0_BACCE/13-128FLVMLVV..IT.TLNS-----------------------------------.....LNVFAPVNTL--------------
Q210L9_RHOPB/21-125LAAAMLL..PL.IGAS-----------------------------------.....GAR.......--------------
Q7NZX4_CHRVO/5-110RLMAAAL..LAGLLSS-----------------------------------.....PAF.......--------------
B4EUB3_PROMH/7-110Q.YTLLL..LL.MIAS-----------------------------------.....STL.......--------------
D8JYC6_HYPDA/23-127GMFAASA..LQ.LVAF-----------------------------------.....SAH.......--------------
B6XG39_9ENTR/6-110SFLLVFI..CA.LFSQ-----------------------------------.....SAL.......--------------
Q1YSM9_9GAMM/7-113KRILFYFGLLL.AIAV-----------------------------------.....SPI.......--------------
A0YB47_9GAMM/4-108SRTLLIT..FF.LSAQ-----------------------------------.....TIA.......--------------
B2IE20_BEII9/7-115GCHLLAL..IM.MVAS-----------------------------------.....NSAGF.....--------------
Q11MW3_MESSB/9-113PIATGAA..LL.SMSV-----------------------------------.....PTS.......--------------
Q480M3_COLP3/12-116KRVISYM..LL.VMTS-----------------------------------.....YSA.......--------------
D8JSD6_HYPDA/6-111RLMSLAF..LA.LFSG-----------------------------------.....AAA.......--------------
Q2C9M1_9GAMM/6-110TFIILLL..FL.TLPL-----------------------------------.....SAF.......--------------
E3I4P1_RHOVT/6-110KVVFAAL..SL.AGAP-----------------------------------.....QLA.......--------------
B5ZI01_GLUDA/5-109PSLILPL..CL.FVCL-----------------------------------.....ARP.......--------------
A5E8V2_BRASB/12-114VAGSLGV..ML.AMTQ-----------------------------------.....AQA.......--------------
Q2L118_BORA1/3-106GLLALLL..AL.MLWM-----------------------------------.....PAH.......--------------
C0ZL71_BREBN/21-137PIIALAV..TL.TLLW-----------------------------------.....THHSHRL..P--------------
Q089I9_SHEFN/11-115LIALIVW..WF.WLYK-----------------------------------.....PKA.......--------------
Q1QPM6_NITHX/9-114LVTASVAFGIA.ASLP-----------------------------------.....IAH.......--------------
A3WJP7_9GAMM/11-116LIALIVW..WF.WLYK-----------------------------------.....PQQ.......--------------
Q15U28_PSEA6/11-116LIAAIVW..WF.WLYT-----------------------------------.....PKR.......--------------
C7RBS9_KANKD/11-116LIALIMW..WF.WLYK-----------------------------------.....PKE.......--------------
Q3IJ88_PSEHT/11-116LIIAIVY..WF.WLFK-----------------------------------.....PKQ.......--------------
D1RR85_SEROD/12-118HAALLAI.PAF.ALSI-----------------------------------.....DAL.......--------------
A4Y220_SHEPC/12-115GF..IIW..WF.WLYK-----------------------------------.....PAN.......--------------
C4T4D8_YERIN/12-116H.AALLA..LP.VVAS-----------------------------------.....NVH.......--------------
A4W945_ENT38/11-115Q.VGVAA..LF.AYAF-----------------------------------.....SAQ.......--------------
D4HVX9_ERWAC/11-115NVTMLAV..L..TSST-----------------------------------.....AAL.......--------------
B4WYZ8_9GAMM/12-118LMALVVW..WF.WLSH-----------------------------------R...KSTA.......--------------
A3Y901_9GAMM/11-116LIAFIVW..WF.WLYQ-----------------------------------.....PKP.......--------------
C6D115_PAESJ/19-132MICALFF..VF.FSSS-----------------------------------.....NSKTKAEVPA--------------
A6X5Q9_OCHA4/30-135GAAFYYA..SR.VSDK-----------------------------------.....ARH.......--------------
B8G648_CHLAD/16-123TVVLVGG..LL.LLSA-----------------------------------.....CGE.......--------------
B8IQ01_METNO/8-113RLAPLAA..LL.ALSG-----------------------------------.....SAL.......--------------
B8ELX4_METSB/25-132LVLVAGV..AF.YLAS-----------------------------------.....KKA.......--------------
C4VLJ4_9LACO/14-121GFIIW....WF.FIRK-----------------------------------.....VNDIEA....--------------
A9G130_SORC5/13-119GITSVAS..AL.GCSQ-----------------------------------.....PAS.......--------------
D7V688_9LACO/12-124GIILIGF..II.WWFF-----------------------------------.....GKHKEAT.GT--------------
C2HKM0_LACAI/12-124AILLIGF..IL.WWFF-----------------------------------.....GKHEESV.EN--------------
D2ENS3_9STRE/12-122A.LIVFI..LF.WFFK-----------------------------------.....KPEKSEQ..K--------------
C2EV15_9LACO/12-122ALIAGIV..WW.FFGK-----------------------------------.....HEQSSE...Q--------------
D0RSM9_9STRE/13-122VVAFIAW..WF.FAEH-----------------------------------.......EKVSG..H--------------
B2GF85_LACF3/12-122VLIALIV..WW.FFGK-----------------------------------.....HQAQAG....--------------
A1B2T7_PARDP/18-125LAVAGGA..AF.WYAT-----------------------------------.....QRN.......--------------
C0XM16_LACHI/13-122LIAFIVW..WF.FGKH-----------------------------------EGSVADAQ.......--------------
D3PXY6_STANL/11-120AALALTA..TA.ACAE-----------------------------------.....KAK.......--------------
Q46BR6_METBF/35-147IFALLIV..AL.LITS-----------------------------------.....TGF.......--------------
Q04BF3_LACDB/16-123GLIIWWF..FG.NFQK-----------------------------------.....SSQQA.....--------------
A8UZZ4_9AQUI/6-124LLLVSFF..IV.FSCT-----------------------------------.....KTD.......--------------
A7NN78_ROSCS/15-116LICALFA..TN.WSLA-----------------------------------.....ASP.......--------------

PF00116

COX2_NEUCR/114-238MSVLAEGHQWY-WSYQ-----------------------------------YPDFLDSNDEFIEFD--------------
COX2_ALBTU/95-214IVLKAIGHQWY-WSYE-----------------------------------MPSMNV.....SSID--------------
COX2_CHLAE/95-214FTIKSIGHQWY-WTYE-----------------------------------YTDYGG.....LIFN--------------
COX2_BREAN/107-231MTIKAMGLQWY-WKYE-----------------------------------YSDFMDDKGETMEFE--------------
COX2_ACHDO/95-213ITMKTIGHQWY-WSYE-----------------------------------YMDFKN....IIEFD--------------
COX2_EMEND/114-237LVVYAEGHQWY-WSYQ-----------------------------------YPDFTNEDNEFIEFD--------------
COX2_BETVU/116-240ITIKAIGHQWY-RSYE-----------------------------------YSDYNSSDEQSLTFD--------------
COX2_ASCSU/98-217LTVKVTGHQWY-WSYE-----------------------------------FSDIPG.....LEFD--------------
COX2_PARLI/95-214LTIKAIGHQWY-WSYE-----------------------------------YTDYND.....LEFD--------------
COX2_EXERO/95-212MTIKSIGHQWY-WSYE-----------------------------------YSDFKN.....IDFN--------------
COX2_PNECA/107-231ITIKAIGHQWY-WSYE-----------------------------------YSDYTDKEGQSIEFD--------------
COX2_ADABI/95-214VTLKTIGHQWY-WTYE-----------------------------------YSDFKK.....LEFD--------------
COX2_ONCFA/95-214MTLKVIGHQWY-WSYE-----------------------------------YSDFKN.....IEFD--------------
Q8ZXC2_PYRAE/67-155VTVVGR..MWQ-W...-----------------------------------...............--------------
Q9XDX2_MAGMG/93-178VYMMAR..LWE-W...-----------------------------------...............--------------
Q9YB77_AERPE/72-160VYIVGR..QFV-W...-----------------------------------...............--------------
COX2_PARDE/141-263LVIKAIGHQWY-WSYE-----------------------------------YPNDG......VAFD--------------
COX2_FORLA/95-214LTIKAMGHQWY-WSYE-----------------------------------YTDYEN.....LSFD--------------
Q8XPI7_RALSO/39-125IRVHAR..KFT-F...-----------------------------------...............--------------
COX2_APILI/95-212FSIKSIGHQWY-WSYE-----------------------------------YPEFNN.....IEFD--------------
COX2_CANGA/115-239MTIKAIGYQWY-WKYE-----------------------------------YSDFINDNGETIEFE--------------
COX2_SCHPO/111-235MTVKAIGRQWF-WTYE-----------------------------------LNDFVTNENEPVSFD--------------
COX2_SYMST/95-214ITLKTIGHQWY-WSYE-----------------------------------YSDFKH.....IEFD--------------
COX2_SITGR/95-214LLIKIIGHQWY-WSYE-----------------------------------YSDYKN.....IEFD--------------
COX2_LASSP/94-213ITIKSVGHQWY-WSYE-----------------------------------YSDFLN.....IEFD--------------
COX2_BALMU/95-214LTVKTMGHQWY-WSYE-----------------------------------YTDYED.....LSFD--------------
COX2_CTEFE/95-214ISLKAIGHQWY-WSYE-----------------------------------YTDFNN.....ISFD--------------
O08448_NATPH/70-159VHVIAV..QYA-Y...-----------------------------------...............--------------
COX2_PERAM/95-214VTLKTIGHQWY-WSYE-----------------------------------YSDFAK.....VEFD--------------
COX2_LOCMI/95-214ITIKTIGRQWY-WSYE-----------------------------------YSDFIN.....VEFD--------------
COX2_CHICK/94-213LTLKAIGHQWY-WTYE-----------------------------------YTDFKD.....LSFD--------------
Q8L1B7_9PSED/541-631VYMTSMAPTYG-M...-----------------------------------...............--------------

PF06525

A4YDJ8_METS5/12-195VVAFIVAVVVLSAAII............................SIYQFHTLSSPSTTNTTSSG................
A4YEZ9_METS5/6-222IGLVIIIIALIGISLFVISRHTTQTLTPSNMSVKVSNTFTNTTKMQNTTNMVNNTSTKQITNNTTNETKQ........VL
SOXE_SULAC/11-198VVGILVVIIAVAVGVY............................VYNQYVMLSSPSASSSTGTSTG..............
Q97UN1_SULSO/11-196IVGVLVAIVAVGVSVY............................AYYEYQVLSAPTSTATSTSTST..............
Q4J829_SULAC/7-202IAIIVVIIVVLGVVVY.....................LATRIGGTSSGTSQSSSSLSSSSSSISSS.............L
Q97VW6_SULSO/21-249IAVIVILIIVVGIVAYLTLVHHPATISSTTSSVETTSTSFTLTSTSTTISTSSTSTSSTTTTSSSTTSSTTITTTQSVTL

PF02298

O82081_ARATH/34-115------------WTVG----------------------------------------------------------------
O82761_ARATH/37-119------------WTIM----------------------------------------------------------------
NO16_MEDTR/36-121------------WKVP----------------------------------------------------------------
O81500_ARATH/32-115------------WTTI----------------------------------------------------------------
Q39040_ARATH/37-119------------WNPN----------------------------------------------------------------
NO552_SOYBN/38-124------------WKFP----------------------------------------------------------------
BCP_PEA/35-116------------WVIG----------------------------------------------------------------
O82083_ARATH/38-140------------WFDI----------------------------------------------------------------
O48787_ARATH/37-119------------WTMI----------------------------------------------------------------
STEL_TOXVR/11-97------------WKVP----------------------------------------------------------------
Q9ZNX8_TOBAC/35-119------------WAVP----------------------------------------------------------------
BABL_CUCSA/11-89------------WTFN----------------------------------------------------------------
NO20_MEDTR/36-121------------WKFP----------------------------------------------------------------
Q9ZRV5_CICAR/37-115------------WTFN----------------------------------------------------------------
BCB2_ARATH/36-118------------WTTG----------------------------------------------------------------
O82080_SPIOL/37-114------------WSFN----------------------------------------------------------------
MAVI_CUCPE/12-95------------WTTL----------------------------------------------------------------
CPC_CUCSA/13-99------------WSVP----------------------------------------------------------------
BABL_ARATH/44-122------------WTFN----------------------------------------------------------------
MPAA3_AMBEL/14-92------------WKLQ----------------------------------------------------------------
BCB1_ARATH/33-117------------WTRP----------------------------------------------------------------
O04596_ARATH/250-336------------WSVP----------------------------------------------------------------
Q9ZTU7_WHEAT/34-115------------WTLN----------------------------------------------------------------
Q96316_ARATH/32-112------------WTSN----------------------------------------------------------------
LAML_ARATH/37-119------------WNPN----------------------------------------------------------------
O82227_ARATH/36-122------------WKVP----------------------------------------------------------------

PF00812

EFNB1_XENLA/20-159ALGKNLE--PVTWNSQ----------------------------------------------------------------
EFNB2_MOUSE/28-169SRSIVLE--PIYWNSS----------------------------------------------------------------
EFNA5_CHICK/26-164KAVADRY--AVYWNST----------------------------------------------------------------
O93431_DANRE/17-155YASAERH--SVYWNST----------------------------------------------------------------
EFNA3_HUMAN/27-171GALGNRH--AVYWNSS----------------------------------------------------------------
EFNA1_XENLA/25-163EAQGERH--IVFWNSS----------------------------------------------------------------
EFNA1_HUMAN/15-153LAAADRH--TVFWNSS----------------------------------------------------------------
EFNA4_MOUSE/22-160GCSSLRH--PIYWNSS----------------------------------------------------------------
EFNB1_RAT/27-166PLAKNLE--PVSWSSL----------------------------------------------------------------
EFNB2_DANRE/22-163SRALILD--SIYWNTT----------------------------------------------------------------
EFNA2_CHICK/25-163KVISDRY--AVYWNRS----------------------------------------------------------------
EFNB3_HUMAN/25-169VSGLSLE--PVYWNSA----------------------------------------------------------------
EFN4_CAEEL/17-180LAAADEH--IVYWNST----------------------------------------------------------------
EFNA2_DANRE/21-159RIISDRH--AVYWNSS----------------------------------------------------------------

PF07732

Q9P8C3_9HYPO/104-220KHFSEQVFPDLG-----------------------------------------------------------------P..
Q9P861_BLAAD/25-143HVNWTTANPDGL-----------------------------------------------------------------Y..
Q9UVW1_ASPFM/25-141DLTWETGSPNGV-----------------------------------------------------------------S..
Q9UVV2_ASPFM/26-143NITWVWAAPDGF-----------------------------------------------------------------G..
Q19687_CAEEL/100-218ANRMEDVLVVDG-----------------------------------------------------------------L..
MCO_STAES/58-173QEGKTEFYKNNF-----------------------------------------------------------------S..
LAC1_EMENI/28-145ELTWEYGSPNGG-----------------------------------------------------------------T..
LAC4_ORYSJ/36-152NVQMANATRLCN-----------------------------------------------------------------T..
Q7S4C0_NEUCR/80-197SVEEGDCAPDGY-----------------------------------------------------------------A..
LAC10_ARATH/30-146NVVTKQVTRICS-----------------------------------------------------------------T..
Q7RX46_NEUCR/32-148KEFKSQVYPDRG-----------------------------------------------------------------P..
Q7S6W1_NEUCR/62-171VLEQGDIIGPDG-----------------------------------------------------------------V.F
Q7PNZ9_ANOGA/51-163KSTEQPITVSYY-----------------------------------------------------------------T..
Q8RMC6_9ACTO/88-204VTQTTAEIIPGV-----------------------------------------------------------------R..
BLRO_MYRVE/82-198KPFTHQVYPDLG-----------------------------------------------------------------S..
Q38757_ACEPS/31-147VVKESNFSRLCS-----------------------------------------------------------------T..
Q7VPL4_HAEDU/53-170DLRPAQTQFEAG-----------------------------------------------------------------K..
Q7NRY4_CHRVO/82-200AAAVSLPLLPGK-----------------------------------------------------------------P..
LAC2_ARATH/35-151DIQLKNITRLCK-----------------------------------------------------------------T..
O23170_ARATH/36-152TVTYGTRSPLG.-----------------------------------------------------------------V..
Q9LX04_ORYSJ/32-148DVSFITASPLG.-----------------------------------------------------------------L..
Q9AUI1_PINTA/41-156NVRLKNVTRLCH-----------------------------------------------------------------S..
Q8RQE2_9LACT/61-172KIADKKERHYQY-----------------------------------------------------------------T..
Q9SMW3_ARATH/31-147NVTYGTASPLG.-----------------------------------------------------------------V..
Q8LFM3_ARATH/42-158TVTYGIISPLG.-----------------------------------------------------------------V..
Q98FW8_RHILO/79-198TAGSATARFAKG-----------------------------------------------------------------L..
FTSP_PASMU/54-168SVQ...YPLEMG-----------------------------------------------------------------K..
Q8TFE2_9PEZI/64-183VTEVDNYVGGDG-----------------------------------------------------------------L.V
Q8TFD9_GAEGR/75-195ELTDSVKLAPDG-----------------------------------------------------------------V..
Q00292_ASPTE/65-183TVTQVTISPDGY-----------------------------------------------------------------E..
Q84ZL7_ORYSJ/38-154EVGYMTVAPLG.-----------------------------------------------------------------V..
Q7W3D4_BORPA/52-166EIGRTPANFTGA-----------------------------------------------------------------A..
FTSP_HAEIN/51-168TMQETNYPLDGS-----------------------------------------------------------------H..
Q9CJQ6_PASMU/79-197KAEPIKIRLADN-----------------------------------------------------------------K..
Q8TFE1_GAEGR/83-200SVEEGICNNDGY-----------------------------------------------------------------K..
FTSP_PHOLL/52-169TLQKAHWTFDGQ-----------------------------------------------------------------Y..
Q94ID0_TOXVR/9-125VLQEKNFTKWCS-----------------------------------------------------------------T..
Q9AUI6_PINTA/39-155HVRMKNVTRLCH-----------------------------------------------------------------T..
Q7SDL8_NEUCR/27-146TNGRGVIAPDGY-----------------------------------------------------------------Q..
Q8H6A0_LOLPR/37-153NVQMANVTRLCA-----------------------------------------------------------------T..
Q9SUD0_ARATH/33-149RVTYGKIALDT.-----------------------------------------------------------------L..
CUEO_YERPE/53-168QTGSVVWLPSTA-----------------------------------------------------------------T..
Q9ZQW3_POPTR/30-146RVVLTNTTKLCS-----------------------------------------------------------------S..
Q875H3_PHACH/52-169VVEEMLGAPDGV-----------------------------------------------------------------T..
Q9VX11_DROME/122-239LAANDDCKYADG-----------------------------------------------------------------L..
O24042_LIRTU/42-158DIRLQNVTRLCH-----------------------------------------------------------------T..
Q8L3Q4_ORYSJ/49-161QAKLASIILLG.-----------------------------------------------------------------...
Q9VBK7_DROME/139-256ACASEHCIYGDG-----------------------------------------------------------------V..
O04947_ARATH/22-139EVEYKYWSPDCK-----------------------------------------------------------------E..
Q8YCF0_BRUME/28-145KVQKGRHSFAKG-----------------------------------------------------------------S..
Q7S9Z8_NEUCR/154-264EVSEQPIAPDGT-----------------------------------------------------------------T..
LAC5_ARATH/34-150IIQATKVKRLCE-----------------------------------------------------------------T..
Q9SFF1_ARATH/34-150HVTYGNISPLG.-----------------------------------------------------------------V..
Q82JK0_STRAW/63-180EAKTGTSEVLSG-----------------------------------------------------------------V..
O04870_SOLLC/10-126NVTYGTIYPLG.-----------------------------------------------------------------V..
O24041_LIRTU/32-148DVQLKSVKRLCN-----------------------------------------------------------------R..
Q8I8Y1_MANSE/186-304DCSRPDCIPADG-----------------------------------------------------------------M..
LAC1_CRYPA/73-193LTQAENWLGPDG-----------------------------------------------------------------V.V
Q9A9L6_CAUCR/56-170TVGHTMAKIDGK-----------------------------------------------------------------A..
Q7XSQ1_ORYSJ/36-152EVTTGNINPLG.-----------------------------------------------------------------V..
LAC9_ARATH/33-149HVKDVVVTPLCK-----------------------------------------------------------------E..
Q8W0V4_LOLPR/45-161QVQSMRINQLCN-----------------------------------------------------------------S..
FET3_CANGA/25-144TTGWGNRNVDGI-----------------------------------------------------------------K..
LAC4_ARATH/32-148NVVMKNVTRLCS-----------------------------------------------------------------S..
Q9R9E7_PSESX/50-164SIGEMPVNITGK-----------------------------------------------------------------P..
Q9X3V2_PSEPU/46-162AAPLDVELVPGF-----------------------------------------------------------------K..
COPA_PSESM/50-164TIGETQVNITGN-----------------------------------------------------------------A..
Q9AUI4_PINTA/36-152HIRLNNITRLCH-----------------------------------------------------------------T..
Q7S1M8_NEUCR/27-114SISTRT......-----------------------------------------------------------------...
Q9L914_9GAMM/58-175GSRRSRCHFTGS-----------------------------------------------------------------T..
A9CFX2_AGRT5/76-193VAEPVEREMAEG-----------------------------------------------------------------M..
Q9AUI0_PINTA/32-148DIKFKNVTRLCH-----------------------------------------------------------------T..
LAC6_ARATH/37-153KVQTIRLTRLCQ-----------------------------------------------------------------T..
Q87F38_XYLFT/61-176RIGQSSVNFTGR-----------------------------------------------------------------M..
Q7N890_PHOLL/51-168EIKAGKSSFKAG-----------------------------------------------------------------V..
Q8RNQ3_LEGPN/119-233VVAYKTVNFAGK-----------------------------------------------------------------P..
O42702_9ASCO/36-154RVSSRNISIACT-----------------------------------------------------------------S..
FTSP_ECOLI/51-168TVQRAHWSFTPG-----------------------------------------------------------------T..
LAC2_PODAS/85-205LTEVDNWLGPDG-----------------------------------------------------------------V.V
O24093_MEDTR/31-148DVEYIYKKPDCK-----------------------------------------------------------------E..
Q8L4Y3_SOYBN/42-158VVEATPVKRLCK-----------------------------------------------------------------T..
ASOL_TOBAC/31-147NVTYGTIAPLG.-----------------------------------------------------------------V..
Q8L8N6_ARATH/32-148VVSYSQRFILG.-----------------------------------------------------------------G..
O65449_ARATH/31-147KITYGDIYPLG.-----------------------------------------------------------------V..
Q82XJ1_NITEU/53-167TIARTPFRIDDH-----------------------------------------------------------------I..
Q942J6_ORYSJ/33-149KVTYGTRTIMD.-----------------------------------------------------------------V..
Q9VLC3_DROME/283-401DCSRPHCVMGDG-----------------------------------------------------------------L..
Q8S2A8_ORYSJ/35-151DVKTTNVTRLCS-----------------------------------------------------------------S..
SKU5_ARATH/30-146EVSYITASPLG.-----------------------------------------------------------------V..
CUEO_SALTI/53-167K..AGQSTFAGK-----------------------------------------------------------------N..
Q9LV68_ARATH/34-150TVSYLSASPLG.-----------------------------------------------------------------T..
LAC1_NEUCR/91-211LTETDNWIGPDG-----------------------------------------------------------------V.I
Q9ZQW2_POPTR/41-157NITHKNFTRLCH-----------------------------------------------------------------T..
FIO1_SCHPO/30-151NVTDVYDVDPDG-----------------------------------------------------------------SGN
Q8W0V5_LOLPR/30-146LVSEVTLRHLCR-----------------------------------------------------------------D..
LAC17_ARATH/30-146EIKMQNVTRLCH-----------------------------------------------------------------T..
LAC11_ARATH/31-147DVQVKNISRICN-----------------------------------------------------------------A..
LAC7_ARATH/31-147NVQNLTVSRLCK-----------------------------------------------------------------R..
LAC3_ORYSJ/32-148IVQETPVKRLCK-----------------------------------------------------------------T..
LAC3_ARATH/33-149VITPTPVKRLCR-----------------------------------------------------------------T..
Q93M03_STRAU/64-181RMQEAQVEIVKG-----------------------------------------------------------------L..
CUEO_ECOLI/51-167TIGAGQSTFGGK-----------------------------------------------------------------T..
LAC14_ARATH/41-157KIKSKAYTRLCN-----------------------------------------------------------------T..
Q8X010_NEUCS/27-145NVSWITANPDGL-----------------------------------------------------------------A..
PCOA_ECOLX/50-164TIGETAVNITGS-----------------------------------------------------------------E..
Q9C497_GLOLA/74-192TITNVTDFAADG-----------------------------------------------------------------I..
LAC2_ORYSJ/34-150DIVMSNVSRLCH-----------------------------------------------------------------E..
Q9SDV9_BRAJU/30-147EVEYKLGWPDCK-----------------------------------------------------------------E..
LAC15_ARATH/27-143TVREVPYTKLCS-----------------------------------------------------------------T..
Q96VT5_EMEND/39-149NLTWSDISLWDS-----------------------------------------------------------------R..
Q8ZWA8_PYRAE/48-158EATYIEATASGY-----------------------------------------------------------------M..
Q8PCX4_XANCP/56-171QIGRMPVNLTGR-----------------------------------------------------------------A..
Q9M5B5_CUCME/45-162EVEYMFRSPDCK-----------------------------------------------------------------E..
Q8XS25_RALSO/63-177VIDETPVNFTGK-----------------------------------------------------------------P..
Q7MGM1_VIBVY/42-159TAEPATAEVVPG-----------------------------------------------------------------F..
SKS1_ARATH/34-150RVSYLTASPLG.-----------------------------------------------------------------V..
Q8NK87_CANAX/29-147KTGWVNANPDGV-----------------------------------------------------------------Y..
Q989B7_RHILO/43-161QTAKIQARLMDI-----------------------------------------------------------------G.P
Q7XIF0_ORYSJ/35-152NVTYGSINPLGS-----------------------------------------------------------------T..
Q9AUI3_PINTA/36-152VLQSTSVKRLCG-----------------------------------------------------------------T..
LAC2_BOTFU/74-191SVENSTITPDGY-----------------------------------------------------------------T..

PF07731

Q9P861_BLAAD/361-500YTAPKVPTLMTAL...----------------------------------------.....................SAG
Q9UVV2_ASPFM/370-504YVDPEEPTLYTALA..----------------------------------------.....................ASP
Q9UVW1_ASPFM/438-575AALPPAILSPQA....----------------------------------------........................
Q93F47_9PSED/243-350LADPNQAGPAQYWQ..----------------------------------------.....................ING
Q96UP8_GIBIN/312-437WLDFSNPTITLL....----------------------------------------........................
Q9P8C3_9HYPO/398-542DVPFPSSTSTTIDHSF----------------------------------------RFARTAG....QWSINGVTFSDVE
Q96V70_GIBIN/302-411RTNYNSPTLLLS....----------------------------------------........................
Q7S065_NEUCR/364-497FISQKVPSLYTAAT..----------------------------------------.....................VG.
Q7S4C0_NEUCR/422-556LIDWNNPTLKQV....----------------------------------------........................
Q7S6W1_NEUCR/414-557NVSWEQPLLEYI....----------------------------------------........................
LAC15_ARATH/408-547RFPEFPPLIFNFT...----------------------------------------......................AE
Q7RX46_NEUCR/320-463PAVLRSVPFPKTKTQV----------------------------------------DQHFKFERSNGEWKINGVSFADVA
Q9C1Z1_PICPA/365-505YVAPKVPVLGTVFS..----------------------------------------.....................AG.
LAC1_ARATH/429-565DFPEKPPNRFDFT...----------------------------------------......................GV
PHSA_STRAT/471-624DVQVPAEGVIQVTGAD----------------------------------------GRT.............KTYRRTA.
FIO1_SCHPO/364-501YVFPKVPSIMIANST.----------------------------------------....................NVD.
Q8TFD9_GAEGR/415-543ELDWSNPTVSQL....----------------------------------------........................
Q7SDL8_NEUCR/387-512RVDYNHPALDMV....----------------------------------------........................
Q8VYB3_ARATH/384-525DTPLKLADYFKIKGVF----------------------------------------..................KMGSIP
Q8NID5_9APHY/368-496YTSPSVPVLLQI....----------------------------------------.......................L
Q7XIF0_ORYSJ/383-523DTPLKLVDNYNIANVI----------------------------------------..................GWDSVP
Q8CXJ7_OCEIH/350-508HLTHIPSLKQNSINTI----------------------------------------RNLKLVGSEDKFGRPLLLLNNQLW
Q8I8Y1_MANSE/570-726HISMKMPTSPLLITRP----------------------------------------SPENFC......NASSIDEGCKE.
Q8NK87_CANAX/361-501YTTPKVPTLLTVLS..----------------------------------------.....................AG.
Q00292_ASPTE/424-564YVDWQTPSLGKL....----------------------------------------.......................T
LAC6_ARATH/417-553DFPTTPEKAYDFVN..----------------------------------------.....................GAP
Q7NRY4_CHRVO/360-497ERLRRIDPLLKASVTR----------------------------------------RVVFSEDMANPAAMFLINGKTFDM
LAC1_AGABI/371-491YISPTVPVLLQI....----------------------------------------.......................L
Q9ZQW5_POPTR/254-388DFPAKPPHVFNYT...----------------------------------------......................G.
Q804X3_CHICK/941-1065RRNCRPPCRIQLDNPD----------------------------------------..................FRRNHS
O65449_ARATH/375-516DTPLKLADYFKIPGVF----------------------------------------..................NLGSIP
Q9LQT5_ARATH/347-487ETPLKLVDHFQLNDTI----------------------------------------..................IPGMFP
Q90ZT2_DANRE/489-613KTHVKNPPKALTEDQQ----------------------------------------..................FIESNK
BLRO_MYRVE/371-515PANLRDVPFPSPTTNT----------------------------------------PRQFRFGRTGPTWTINGVAFADVQ
LAC3_ARATH/419-554DFPPVPPVQFDYT...----------------------------------------......................G.
SKS1_ARATH/397-536STPVRLADRNKVKGAY----------------------------------------...................KLDFP
Q82JK0_STRAW/341-480PSSLNTITRYDTTDFA----------------------------------------ARTITLGQSGASMLINGSAGTTMA
Q7MGM1_VIBVY/340-461PIDKSGQALPTFWL..----------------------------------------.....................VNK
Q9SFF1_ARATH/376-516DTPLKLVDYFKIDGVY----------------------------------------..................KPGSIS
Q8XX19_RALSO/116-246TPDPDSVPPNQIDGHV----------------------------------------DPR............PIMDIGVM.
LAC7_ARATH/412-551DFPDQPPVKFDYTN..----------------------------------------....................PNVT
Q9ZVV3_ARATH/388-531ETPLKLAEYFQMSEKV----------------------------------------FK...............YNVIKDE
Q9UVT5_LENED/376-499YIPPTVPVLLQI....----------------------------------------.......................L
Q7S2V2_NEUCR/516-661FANFSTPSLLDF....----------------------------------------........................
SKU5_ARATH/394-533STPIRLADKLKVKDVY----------------------------------------...................KLDFP
Q7RYF6_NEUCR/414-556DVQWDKPTLEYV....----------------------------------------........................
Q8J0L7_CLAPU/359-497YKSPKVPTLYSVLS..----------------------------------------.....................AG.
Q8RNQ3_LEGPN/688-807NKPVDGIIKMELFGYM----------------------------------------DR..............YIWFING.
LAC2_ORYSJ/411-546DFPDRPPARFNYT...----------------------------------------......................G.
LAC1_THACU/419-544YESPKIPTLLKIL...----------------------------------------......................TD
FET3_CANAX/362-502YKAPKVPTLLTVLS..----------------------------------------.....................AG.
O24041_LIRTU/420-554TFPNNPLFPFNYT...----------------------------------------......................G.
O68054_RHOCA/369-490PRPATAQPMVMLTGSM----------------------------------------LP..............YQWTIDG.
Q9VX11_DROME/473-628SFSMPKMSLLQTRNLG----------------------------------------VGQFFCNR...SQQADLGFNCRQ.
Q9FSC9_POPTR/404-539DFPAKPPISFNYT...----------------------------------------......................G.
LAC2_BOTFU/413-547LLDWSSPTTLKI....----------------------------------------........................
Q93HV5_STRGR/170-308RKGLYGPVVVRRKGDI----------------------------------------LPDQTC......TVVFNDMMINN.
Q8GB87_STRLA/454-610QVELPADGVIQLMSSE----------------------------------------GAL.............KTYRRTS.
E9ACP0_LEIMA/403-552PITEPYYVLGQGPNCQ----------------------------------------SLQNSSTCHYEFFQGEIGRRIEGY
LAC4_TRAVI/366-494FVSPTVPVLLQI....----------------------------------------.......................L
Q9P8G4_9APHY/369-494FIPPDIPVLLQI....----------------------------------------.......................L
Q87F38_XYLFT/490-609GREPGREIELHLTGNM----------------------------------------EK..............FAWSFDG.
FTSP_PHOLL/334-472TDNLPSRLIDDVTPVS----------------------------------------SVIRNREIYLDDNTPGINGALWDM
Q8WZH9_LENED/381-493YIPPTVPVLLQI....----------------------------------------.......................L
Q9CJQ6_PASMU/378-515HTNMPMMNHGTHHATT----------------------------------------TPTDNPIPPMMNGMFLINGQTFDM
O53858_MYCTU/384-503RPEPTHDLPVTLGGTM----------------------------------------AK..............YDWTING.
LAC9_ARATH/411-552DFPDQPPLKFDFTKF.----------------------------------------...................EQHPT
Q96VT5_EMEND/456-583FYPQTASKNFTA....----------------------------------------........................
COPA_PSEUB/489-608GREPSRTIELHLTGHM----------------------------------------EK..............FAWSFDG.
O23170_ARATH/380-520TTPLKLADWYNISGVF----------------------------------------..................DFKTII
Q8GP36_CORDP/379-493EGTPDREVSIDLGGQM----------------------------------------M................PYEWRI.
Q942J6_ORYSJ/381-524QTPLKLAEYFNASSGV----------------------------------------FE...............YNLIGDV
FET3_YEAST/362-504YTAPKVPTLMTVLS..----------------------------------------.....................SG.
FET5_YEAST/367-517YVTPKVPTLTTLLT..----------------------------------------.....................SG.
Q89KF9_BRAJA/312-434QLDLKGALRFDVALG.----------------------------------------...................APDTG
Q9LV68_ARATH/382-521ATPLKLAQQYNISGVY----------------------------------------...................KLDFP
O60199_PLEOS/365-491FVPPTVPVLLQI....----------------------------------------.......................L
Q7X4G1_XANEU/217-341EPGAATPKVAEMTDFN----------------------------------------L.................WTWNS.
Q7Z8S2_PLESA/371-496WVSPTSPVLLQI....----------------------------------------.......................I
O13420_9APHY/364-493FTPPTVPVLLQI....----------------------------------------.......................L
O67206_AQUAE/387-526PINTDGAQVQRITLGM----------------------------------------RRMVFTINGETWEDGYANPQDINN
Q96TR4_PLEOS/372-492YLSPSVPVLLQM....----------------------------------------.......................L
Q8I8Y0_MANSE/577-738YMSPPAPLLSQYDDIN----------------------------------------P................EQFCNGD
Q9VBK7_DROME/508-666YNSPGISLLQGRHLYQ----------------------------------------DDRYFCNK...SSLAAEGRNCER.
Q84ZL7_ORYSJ/403-540ETPLRLADLHNLTGVY----------------------------------------...................KTDFP
O74171_SCHCO/363-488FIPPSLPVLLQV....----------------------------------------.......................M
LAC2_PODAS/426-569NVDWDKPIVDYV....----------------------------------------........................
O59944_CERSU/368-493FVPPSVPVLTQI....----------------------------------------.......................L
Q94ID0_TOXVR/389-516DFPTV...........----------------------------------------.......................Q
Q8XS25_RALSO/486-605RRGPQREIEMHLTGNM----------------------------------------ER..............YTWSIDG.
Q7S9Z8_NEUCR/523-687RINFSDPTLLSL....----------------------------------------........................
Q8X010_NEUCS/358-513YVPPRVPTLYTVLSSP----------------------------------------N................SSSSQDM
Q7N890_PHOLL/374-513EQAMAGMGMHHGNMSH----------------------------------------GDMHHGGELNFHHANTINGQAFSI
Q84SA8_ASTTR/257-395DFPDQPPVVFDYTN..----------------------------------------.....................VNN
Q8X1W2_LENED/396-521FESPTVPVLLQI....----------------------------------------.......................L
FET3_CANGA/362-504YTTPKVPTLLTVLS..----------------------------------------.....................AG.
ASOL_TOBAC/383-524ETPLKLVEYFGATNKA----------------------------------------FK...............YDLMADE
Q9C497_GLOLA/416-556DVQWDKPTLQYI....----------------------------------------........................
Q8YQ92_NOSS1/200-332PRPPADEIVLVMAGYD----------------------------------------VD...............DNSHNDF
Q7NG83_GLOVI/190-322GRPPADEIALVMGGFD----------------------------------------LN...............DDGRNDI
LAC2_ARATH/423-557DFPTAPIIPFNYT...----------------------------------------......................G.
Q9A9L6_CAUCR/444-566SRAPGRTIEIHLTGNM----------------------------------------ERF.............MWAFDGE.
Q9AUI3_PINTA/418-554DFPDNPPVQFDYT...----------------------------------------......................AQ
Q9FKY9_ARATH/382-522ETPLKLADHFGISGVF----------------------------------------..................STNAIQ
CUEO_YERPE/393-532GNRPDMSQGKMKGMDH----------------------------------------GTMNGAPAFNFSHANRINGKAFSM
Q8TFE2_9PEZI/409-548NITWDEPTLEYL....----------------------------------------........................
Q7S1M8_NEUCR/347-488RVNWQEPTLRYV....----------------------------------------........................
Q8YCF0_BRUME/358-494SMAGMDHDMHGSRSAA----------------------------------------DAGPALDALTSGVQMAIADKPFDM
FTSP_SALTI/333-470TDNLPMRLLPTEIMSG----------------------------------------APVRSRDIS.LGDDPGINGQLWDV
Q9AUI1_PINTA/428-562NFPDNPPFPFNYT...----------------------------------------......................G.
LAC4_THACU/380-502YEAPSLPTLLKI....----------------------------------------......................LA
LAC14_ARATH/420-553DFPRNPPTKFNY....----------------------------------------........................
LAC3_ORYSJ/415-551DFPAYPPVQFDYT...----------------------------------------......................AQ
O04870_SOLLC/354-493DTPLKLLDYFKIGGFR----------------------------------------...................VGSIP
Q9X8C0_STRCO/91-236PPRMPRLPVARRRTLV----------------------------------------FSGDISGKHGLGVRFLIDGKLYDV
Q9LX04_ORYSJ/396-535DTPMRLADLYDKKGVY----------------------------------------...................TLDFP
Q9Y781_COPCI/368-493FHQPPVPVLLQI....----------------------------------------.......................M
COTA_BACSU/354-512YLASYPSVQHERIQNI----------------------------------------RTLKLAGTQDEYGRPVLLLNNKRW
Q82XJ1_NITEU/485-608QREPERELEIHLTGHM----------------------------------------ERF.............IWSFDGE.
Q8W0V5_LOLPR/411-556EMSARPPLEFDYTDPV----------------------------------------L................INFFNRS
A9CFX2_AGRT5/212-336NPGASVPKIMTMTDFN----------------------------------------L.................WAWNS.
Q89T40_BRAJA/212-336DPGSYLPRVNEMTDFN----------------------------------------M.................WTWNS.
Q7W3D4_BORPA/466-585NRAPTREIELHLTGNM----------------------------------------DR..............YMWSFNG.
LAC1_NEUCR/427-569NINWNKPVLEYV....----------------------------------------........................
Q875H3_PHACH/405-542DPLPKTNILLEIQRAY----------------------------------------...................NAGRA
Q875H1_COPCO/371-497FHEPNEPILLQT....----------------------------------------.......................L
Q8FQU9_COREF/414-557TPAIPGVLDPAARQDP----------------------------------------DVIDAPERSFVLNTFSINDQMMDM

PF00394

Q9UVV2_ASPFM/150-308E.FTLTLTDHY.HEQM----------------------------------------SVLLQQYEADSVGAQAGV...NEP
LAC4_ORYSJ/162-316KEVPVIFGEWW.NADT----------------------------------------EEVVNQAVQTGGG.........PN
NIR_RHOS5/206-358TVYYIGESDHYIPKDE----------------------------------------DGTYMRFSDPSEGYEDMVAVMDTL
LAC1_NEUCR/219-366G..PFPLTDYY.YDTA----------------------------------------DRLVL.LTQHAGP.........PP
LAC1_BOTFU/191-337DLGMLFLNDWN.HVPV----------------------------------------QSLWD.KAKTGA..........PP
LAC1_CRYPA/201-349G..PLVLSDYY.YKTA----------------------------------------DELVVYTQSNA...........PP
O68601_ALCXX/192-344RAYTIGEFDLYIPKGP----------------------------------------DGKYKDYATLAESYGDTVQVMRTL
LAC1_PHLRA/163-307DSTVITLADWY.HTAA----------------------------------------RL...........GSPF.....P.
LAC5_ARATH/160-312RNVPLLLGEWW.DANP----------------------------------------VDVLRESIRTGGA.........PN
O64838_ARATH/161-298ADFTLLVSDWY.KMGH----------------------------------------KELQRRLDSSRAL.........PP
Q9Y781_COPCI/165-306EATIITLADWY.HVPA----------------------------------------PS...........AGLV.....P.
ASO_TOBAC/163-329EFNLL.LSDWW.HKGS----------------------------------------HEQEV.DLSS..NPLRW.....IG
Q9UVT5_LENED/175-316ETTVLTIADC....TE----------------------------------------LI...........AAAV.....AP
O53858_MYCTU/190-352E.WIIILDDWT.DGIG----------------------------------------KSPQQ.LYGELT.....DP.NKPT
Q9SDV9_BRAJU/154-321EFNLL.LSDWW.HQSS----------------------------------------HAQEL.YLSS..RPMRW.....IG
FET3_CANAX/155-302E.VVLTLSDHY.HKYS----------------------------------------GDIGP.AFLTRFNPTGA.....EP
LAC5_TRAVE/165-309DTTVITLADWY.HTAA----------------------------------------KL...........GPAF.....PA
O74171_SCHCO/158-299DNTVITLADWY.HALA----------------------------------------PT...........IIGV.....G.
Q00292_ASPTE/189-347DLGPWTLTDWY.HEDA----------------------------------------FTLNWISLAGQL..........AP
O13422_9APHY/167-309EDTVITLADWY.HVAA----------------------------------------KL...........GPAF.....PP
LAC4_ARATH/158-308NEKVIVLGEWW.KSDT----------------------------------------ENIINEALKSGLA.........PN
FIO1_SCHPO/158-306E.YIISMTDWY.YTPF----------------------------------------NILVPDEFKTWKNPTGA.....EP
Q9ZQW3_POPTR/156-306KEKIIILSEWW.KADV----------------------------------------EAVVNQATMTGLP.........PN
LAC7_ARATH/157-310KEVPILFGEWW.NTDV----------------------------------------VALEEAAIATGVP.........PN
Q9SVE3_ARATH/161-299GDFTFLIGDWF.KHDH----------------------------------------KVLKAILDRGHKL.........PL
LAC4_TRAVE/164-306ETTIITLSDWY.HTAA----------------------------------------SL...........GAAF.....PI
P93366_TOBAC/156-307HEAVVILAEWW.KSDT----------------------------------------EAVINEAIKSGLA.........PN
SKU5_ARATH/156-311GDITVTIGDWY.IRNH----------------------------------------TALRKALDDGKDL.........GM
Q56795_XANCA/189-368D.YVVMLSDWT.D...----------------------------------------LDPAA.LFARLKKMAGHDNYYRRT
FA8_HUMAN/218-349FAVFDEGKSWHSETKN----------------------------------------SLMQDRDAASARAWPKM.......
Q38757_ACEPS/157-308GEQTIVLASWY.KADV----------------------------------------MEVYEEAVASGAE.........FN
FET3_YEAST/155-302E.LSLSLSEWY.HDLV----------------------------------------TDLTK.SFMSVYNPTGA.....EP
O65449_ARATH/157-295GDFWLLAGDWY.KTNH----------------------------------------YVLRRLLEAGRNL.........PN
Q9SFF1_ARATH/160-297DDYTLLVGDWY.KTNH----------------------------------------KDLKAQLDNGGKL.........PL
ASOL_BRANA/159-302DDYTVLIGDWY.TKSH----------------------------------------TQLKKFLDGGRTI.........GR
FET5_YEAST/157-305E.RVITLSDHY.HENY----------------------------------------KTVTK.EFLSRYNPTGA.....EP
Q9ZQW2_POPTR/167-320KEIPILFGEWF.NVDP----------------------------------------EAVIAQALQTGAG.........PN
LAC3_TRAVI/163-301ESTVITLADWY.HTPA----------------------------------------PL...........LP.........
O23170_ARATH/162-300GDFTLLVSDWFSNMTH----------------------------------------KDLRKSLDAGSAL.........PL
LAC1_TRAHI/163-305DDTVITLADWY.HTAA----------------------------------------KL...........GPAF.....PL
O04947_ARATH/149-316EFNLL.LSDWW.HEAI----------------------------------------PSQEL.GLSS..KPMRW.....IG
COPA_PSEUB/172-350E.HVVMLTDWT.D...----------------------------------------EDPVS.LMRTLKKQSDYYNFHKRT
Q9ZR60_CUCME/20-183DRNLI.LTDWY.HKSS----------------------------------------NEHAA.GLATPGSGFTW.....VG
LAC1_AGABI/160-312ESTVITLAEWY.HILA----------------------------------------PDATN.EFF....SSGI.....IP
LAC2_PODAS/213-360G..VFPITDYY.HKPA----------------------------------------DVLVEETMNGG...........PP
LAC2_ARATH/161-314KQVPILFGEWF.NADP----------------------------------------QAVVQQALQTGAG.........PN
O65670_ARATH/168-334DRNFL.LTDWY.HKSM----------------------------------------SEKAT.GLAS..IPFKW.....VG
LAC4_THACU/161-317ASTVVMLEDWY.HTPA----------------------------------------PVLEK.QMFSTNNTALL.....SP
Q9SUD0_ARATH/159-299EDFTFLVNDWY.RRNH----------------------------------------TTLKKILDGGRKL.........PL
LAC3_ARATH/159-310RDIPILLGEWW.DRNP----------------------------------------MDVLKQAQFTGAA.........AN
NIR_ALCFA/210-362KIYYVGEQDFYVPRDE----------------------------------------NGKYKKYEAPGDAYEDTVKVMRTL
O24093_MEDTR/158-324EFNLL.LSDLW.HTSS----------------------------------------HEQEV.GLSS..APMRW.....IG
Q9ZR59_CUCME/170-333EINLL.LSDWW.HTSI----------------------------------------QEQEV.GLKS..NPMRW.....IG
NIR_ALCXX/164-316RVYTIGESDLYVPKAA----------------------------------------DGNYSDYPALASAYADTVAVMRTL
Q9SGR6_ARATH/159-296GDTTVLIGDWY.KANH----------------------------------------TDLRAQLDNGKKL.........PL
Q9SMW3_ARATH/157-300DDYTVLLGDWY.TAGH----------------------------------------TALKNFLDSGRTL.........GL
O60199_PLEOS/162-303ESTVLTVGDWY.HAPS----------------------------------------LS...........LTGV.....P.
Q9Y780_COPCI/160-305ENTIITLADWY.HIPA----------------------------------------PS...........IQGA.....A.
LAC6_ARATH/163-315NEHTILLGEYW.LKNV----------------------------------------VELEQHVLESGGP.........PP
O61263_9APHY/163-305DSTVITLADWY.HVAA----------------------------------------RL...........GPRF.....PL
SKS1_ARATH/160-314GELIFIIGDWY.TQDH----------------------------------------KALRRALDSGKEL.........GM
O24041_LIRTU/158-311KEVPIIFGEWW.NANT----------------------------------------EAVINQSLQTGAG.........PN
O04870_SOLLC/136-274NDYTILIGDWY.KKNH----------------------------------------TDLKAILDGGRKL.........PF
ASOL_TOBAC/157-300DEYNVFVGDWY.NKGH----------------------------------------KTLKKILDGGRTI.........GR
LAC1_PLEOS/174-315ADTIITLEDWY.HVVA----------------------------------------PQ...........NAVL.....P.
O59944_CERSU/165-307ESTVITLSDWY.HAAA----------------------------------------ST..........L...T.....FP
CERU_HUMAN/221-358FSVVDENFSWYLEDNI----------------------------------------KTYCSEPEKVDKDNEDFQESNRM.
Q9UUY5_HETAN/31-173ESTVITLADWY.HYVS----------------------------------------TN...........PPAG.....PP
O31380_BRAJP/193-345KVYYVGEQDMYVPRDE----------------------------------------KGNFKSYDSPGEASTDTEEMMKKL
ASO_CUCMA/166-331EINLL.LSDWW.HQSI----------------------------------------HKQEV.GLSS..KPIRW.....IG
Q9UVU8_PYCCI/165-307DDTVITLADWY.HVAA----------------------------------------KL...........GPQF.....PR
O42702_9ASCO/162-324E.RTLHWSDFF.PQTD----------------------------------------HEIEV........GLQSVPLVWPG

PF00127

AZUP_METEA/30-118----P--GGM.M-------------------------------------VFDPALVRLKPGDSIK----FLP----....
AZUR1_METJ/22-149----E--ANDAM-------------------------------------QYNTKNIDVEKSCKEF----TVN----LKHT
AZUP_ALCFA/28-116----A--EGA.M-------------------------------------VFEPAYIKANPGDTVT----FIP----....
AMCY_METEA/31-119----K--IAK.M-------------------------------------KFQTPEVRIKAGSAVT----WTN----T...
PLAS2_POPNI/70-168----D--DGS.L-------------------------------------AFVPSEFSVPAGEKIV----FKN----N...
AZUR_ALCFA/1-127----E--GNDSM-------------------------------------QFNTKSIVVDKTCKEF----TIN----LKHT
PLAS_CHLFU/2-98----D--SGA.L-------------------------------------VFEPSSVTIKAGETVT----WVN----N...
PLAS_SILPR/67-165----S--DGG.L-------------------------------------AFVPSDLSIASGEKIT----FKN----N...
AZUP_PARPN/27-115----E--SGA.M-------------------------------------VFEPAFVRAEPGDVIN----FVP----....
PLAS_NOSS1/37-138----D--KGL.L-------------------------------------VFEPAKLTIKPGDTVE----FLN----N...
PLAS_CUCSA/1-99----D--DGS.L-------------------------------------AFVPNNFTVASGEKIT----FKN----N...
AMCY_PARDE/43-131----D--IAK.M-------------------------------------KYETPELHVKVGDTVT----WIN----R...
PLAS2_ARATH/69-167----G--DGS.L-------------------------------------AFIPNDFSIAKGEKIV----FKN----N...
AZUP_ACHCY/33-121----K--DGA.M-------------------------------------VFEPASLKVAPGDTVT----FIP----....
PLAS_SYNY3/31-126----D--SGA.L-------------------------------------VFEPSTVTIKAGEEVK----WVN----N...
AZUR_PSEFB/1-128----D--STDQM-------------------------------------SFNTKAIEIDKACKTF----TVE----LTHS
PLAS_DAUCA/1-97----D--DGA.L-------------------------------------VFSPSSFSVAKGEGIS----FKN----N...
PLAS_CHLRE/49-145----D--SGA.L-------------------------------------EFVPKTLTIKSGETVN----FVN----N...
AZUR_BORPE/22-149----A--GTDQM-------------------------------------QFDKKAIEVSKSCKQF----TVN----LKHT
PLAS_VICFA/1-99----S--DGG.L-------------------------------------AFVPNSFEVSAGDTIV----FKN----N...
AZUR_PSEAE/21-148----Q--GNDQM-------------------------------------QFNTNAITVDKSCKQF----TVN----LSHP
HCY_NATPH/73-163----G--NNG.F-------------------------------------AFDPAAIRVDVGTTVT----WEW----T...
AZUR_ALCSP/1-128----A--GNDQM-------------------------------------QFDKKEITVSKSCKQF----TVN----LKHP
AZUR_PSECL/1-128----D--STDQM-------------------------------------SFNTKEITIDKSCKTF----TVN----LTHS
AZUR_ALCDE/21-148----E--SNDAM-------------------------------------QYNLKEMVVDKSCKQF----TVH----LKHV
H81_NEIGO/57-182----E--SNDNM-------------------------------------QFNTKDIQVSKACKEF----TIT----LKHT
PLAS_ULVPR/2-98----D--DGS.L-------------------------------------AFVPNNITVGAGESIE----FIN----N...
AZUR2_METJ/1-128----T--SGDTM-------------------------------------TYSTRSISVPASCAEF----TVN----FEHK
AMCY_PARVE/44-132----G--IEK.M-------------------------------------KYLTPEVTIKAGETVY----WVN----G...
PLAS_SOLLC/72-170----D--DGS.L-------------------------------------AFIPGNFSVSAGEKIT----FKN----N...
PLAS_HORVU/59-155----N--GGV.L-------------------------------------VFEPNDFSVKAGETIT----FKN----N...

PF13473

B3CV67_ORITI/16-120-...D..SDSEL.....CKLVIK.DH.-........-------------KFEPSEIHVHANKRIE.LI.IEN----L---
B5WRG9_9BURK/6-109-...A..ADLPT.....FKLEMN.DG.-........-------------KLNPARIEVPAGQRIK.IE.VRN----T---
Q4ULV7_RICFE/15-124-...S..DNKTNDNILEVKITIK.DH.-........-------------KFVPNIIEVPKSTKIR.LI.VHN----E---
A9VLT2_BACWK/13-122-...F..AESDVVR.QPIEVELN.DD.-........-------------YFNPSIITVPAGKTTT.LL.LKN----K---
Y394_RICPR/15-123-.DKT..NDNIL....EVKITIK.DH.-........-------------KFVPNIVEVPKSTKIR.LI.IHN----A---
A8GXF3_RICB8/19-125-...N..NNEEIL...EIKIVIK.DH.-........-------------KFVPDIVEVPKSTKIR.LV.IHN----E---
B2JD79_BURP8/6-110-..AA..EEAVT.....FKLEMT.DG.-........-------------KLTPARIEVPAGKRIR.IE.VKN----T---
A3P8U3_BURP0/8-112-...F..AADDV.....YSLTLK.NH.-........-------------RFSPADLTIPAGKKVK.VT.IKN----L---
C7JG61_ACEP3/11-115-...A..HSQTV.....FQLTVK.DH.-........-------------HFEPDHITVPAGERFM.IE.LNN----Q---
D0P677_BRUSS/22-123-...W..AEEPT.....FRLEFK.DG.-........-------------VITPDRLEVPANTRFR.IE.LVN----T---
B1FN56_9BURK/5-109-...F..AADDV.....VNLTLK.DH.-........-------------KFSPDGVTIPAGKKVK.FV.VKN----L---
B3Z7I0_BACCE/13-128-AQPI..ASAKV.....IEVELN.DD.-........-------------YFNPNVITIPINESTT.LL.LKN----K---
Q210L9_RHOPB/21-125-...A..DDEPS.....FRIEFR.DG.-........-------------KVTPSRIEVPANTRFK.LE.LHN----L---
Q7NZX4_CHRVO/5-110-...A..EDMPV.....FKLQMK.DG.-........-------------QLIPARLVVPAGKKFK.IE.VMN----I---
B4EUB3_PROMH/7-110-...A..AEKYT.....VELEMK.EG.-........-------------ELIPRVLNVPAKTPIR.IK.IRN----T---
D8JYC6_HYPDA/23-127-...A..AEELE.....IEIKIK.DH.-........-------------KFDPAAIKLQAGQRAK.LI.VKN----L---
B6XG39_9ENTR/6-110-...S..AEKYT.....VELEMK.NG.-........-------------DLIPRVLEVPAKTIIR.IK.ITN----T---
Q1YSM9_9GAMM/7-113-...S..QAAPI.....IKIEIK.DH.-........-------------LFYPSEFSVPANTKIK.LL.IIN----N---
A0YB47_9GAMM/4-108-...V..AATPI.....IKIEIR.NH.-........-------------LFYPAEVIVPANQKVK.LL.IHN----T---
B2IE20_BEII9/7-115-.ALA..EDTPT.....FLIEFN.DG.-........-------------KVNPLRLEVPANQRFR.IE.LKN----S---
Q11MW3_MESSB/9-113-...A..EDYPV.....FVVEFK.DG.-........-------------AISPSTIEVPAGTRFK.LE.LRN----T---
Q480M3_COLP3/12-116-...L..AQREE.....FNIILK.SH.-........-------------LFYPAEMTIPSNKKIK.LI.IDN----Q---
D8JSD6_HYPDA/6-111-..LA..EEDQV.....FTIKFA.DG.-........-------------KIDPPVVEVPANRRFK.LI.LQN----E---
Q2C9M1_9GAMM/6-110-...A..AEKFT.....VELTIN.NG.-........-------------VFTPEVLNVPTKKIIR.IK.VSN----I---
E3I4P1_RHOVT/6-110-...L..ADEPV.....FEIEMK.DG.-........-------------VITPPRLEVPANTRFK.IV.IKN----S---
B5ZI01_GLUDA/5-109-...A..AAQDP.....YRLVLK.DH.-........-------------HFTPDHLDVPAGQRFL.IT.LSN----Q---
A5E8V2_BRASB/12-114-...D..G.RNE.....ICLTYA.NG.-........-------------QFEPKEPTVPADAPLT.IR.VKN----L---
Q2L118_BORA1/3-106-...A..DEMPT.....FTLTFKPDG.-........-------------TFEPVRLEVPAG.RFK.VE.LIN----E---
C0ZL71_BREBN/21-137-ASYA..IATRT.....HTVTIS.SA.-........-------------GFLPNQLTAHEGERVS.LM.IVN----T---
Q089I9_SHEFN/11-115-...T..THQAT.....NAIVVK.DG.-........-------------VYSPARITVPANTATQ.LT.FLR----Q---
Q1QPM6_NITHX/9-114-...A..QQATS.....LTVTYA.NG.-........-------------KFQLSALHAPANTPLA.LT.VKN----L---
A3WJP7_9GAMM/11-116-..LK..LGEGD.....LVIAVE.NG.-........-------------TYSPSRIKIPEGKPVE.LK.FLR----K---
Q15U28_PSEA6/11-116-...A.QSTSNQ.....IKILVN.NG.-........-------------VYQPSNITVSAGTKIT.LD.FDR----Q---
C7RBS9_KANKD/11-116-...A.VLGDND.....LLITVE.NG.-........-------------TYSPSRIKVPAGSVVE.IK.FIR----K---
Q3IJ88_PSEHT/11-116-..VQ..SNDNK.....VVIVVD.NG.-........-------------IYQPAQIKVVAGKELT.LN.FDR----Q---
D1RR85_SEROD/12-118-...A..ADVPQ.....VKITVN.DK.-........-------------QCEPMQLTVPAGK.TQ.FV.VHN----T---
A4Y220_SHEPC/12-115-...D..SSVDA....STLILVK.DG.-........-------------VYTPARIKISANRPTE.IT.FLR----Q---
C4T4D8_YERIN/12-116-...A..ADIPQ.....IKITVN.DK.-........-------------QCEPMVLSVPAGK.TQ.FI.VHN----A---
A4W945_ENT38/11-115-...A..ADVPQ.....VKVTVN.DK.-........-------------QCEPMTITVNSGK.TQ.FI.IQN----H---
D4HVX9_ERWAC/11-115-...A..ADIPQ.....VKVSVN.DR.-........-------------QCEPMTLTVAAGK.TQ.FI.IKN----N---
B4WYZ8_9GAMM/12-118-...Q..AATQE.....ATIIVE.DG.-........-------------VYSPASIRANTGQSLT.LH.FDR----R---
A3Y901_9GAMM/11-116-...Q.VFDTQH.....QVIKVN.SG.-........-------------VYLPAKLMLKANQAVQ.LR.FLR----E---
C6D115_PAESJ/19-132-VTMQ..DGYQI.....VTIQAK.KD.-........-------------GFYPSKVEVKAGVPVK.LNFVKN----T---
A6X5Q9_OCHA4/30-135-...A..EAGDT.....IQVAIN.AK.-........-------------SCEPNELTVPAGR.SV.FE.IVN----K---
B8G648_CHLAD/16-123-...P..LRERT.....IEITAT.EM.-........-------------RFDPDRVEAQTGEQIF.IR.LRN----R---
B8IQ01_METNO/8-113-...A..EAPDP.....VAVTVT.DK.-........-------------GCEPASLTVPAGKSV..FR.IRN----Q---
B8ELX4_METSB/25-132-...RAPEGAKI.....VSITVN.AD.-........-------------SCNPNELSVPAGR.TV.FE.IVN----A---
C4VLJ4_9LACO/14-121-AKTS..KNKQK.....AQIII..QG.-........-------------GYSPSTLVLQKGIPAE.VE.FVQ----K---
A9G130_SORC5/13-119-...A..EPQKAP..RVVEI.MV.HG.-........-------------AFVPDKIAAVEGERLK.LR.LVR----H---
D7V688_9LACO/12-124-GTIV..NDEQT.....ATIVV..NG.-........-------------GYSPSTVVLKKGVPAQ.VN.FDM----R---
C2HKM0_LACAI/12-124-ANVN..QGIQE.....ANIVVK..G.-........-------------GYSPSTVVLKQGVPAK.IN.FDM----K---
D2ENS3_9STRE/12-122-AQQK..KGYQE.....IRVEVK..G.-........-------------GYTPELIILKKSVPAR.IV.FDR----K---
C2EV15_9LACO/12-122-AAVA..NDQQT.....ATVVVQ..G.-........-------------GYSPEEVVLKKGIPAT.VN.FNM----K---
D0RSM9_9STRE/13-122-ARQK..SGYQE.....IEVEVM..G.-........-------------GYSPETIVLKKNVPAR.II.FNR----K---
B2GF85_LACF3/12-122-KAVI..EGDHQ.....VATVVV.NG.-........-------------GYSPSTVVLKKGVSGS.VK.FEM----R---
A1B2T7_PARDP/18-125-...A..GTQTAA...DQLVTVN.AT.-........-------------TCEPNAITVPGGR.RS.FE.IVN----A---
C0XM16_LACHI/13-122-...V..ADNKQ.....ETTVLV.DG.-........-------------GYSPSTLFLKKGIPAK.VS.FRM----N---
D3PXY6_STANL/11-120-...E..SDDGP.....IAVTAT.DD.-........-------------SCEVASTKAKAGT.VT.FK.VKN----D---
Q46BR6_METBF/35-147-..AA..AKEAT.....IVVKSA.DTS-ANRVAIFS-------------AFSPEKIEIHSGENVTWIN.FKK----P---
Q04BF3_LACDB/16-123-.DLA..NGRQE.....GQVVVK..G.-........-------------GYEPEVLYLKQGVPAE.VT.FKM----E---
A8UZZ4_9AQUI/6-124-...K..PADKV.....VEIKVS.KN.-........-------------GYEPDVIHLKKGQVVL.FK.ITA----L---
A7NN78_ROSCS/15-116-...S..EHRPS.....VSMTFV.SG.-........-------------D.TPVRLDAQVEPDAT.VV.WRN----N---

PF00116

COX2_NEUCR/114-238-SYIV--PESDL------------EEG-ALR....M-------------LEVDNRVILPELTHVR-FI-ITA....G---
COX2_ALBTU/95-214-SYMI--PEDDL------------KPG-EYR....L-------------LEVDNRPTVPYGMDIN-VI-ATS....A---
COX2_CHLAE/95-214-SYML--PPLFL------------NPG-DLR....L-------------LEVDNRVVLPIEAPVR-MM-ITS....Q---
COX2_BREAN/107-231-SYMI--PEDLL------------EEG-QLR....Q-------------LDVDSPMVCPVDTHMR-FM-VTA....A---
COX2_ACHDO/95-213-SYMS--ALDKL------------..S-SFR....L-------------LDVDNRTILPMNTQIR-TL-VTA....A---
COX2_EMEND/114-237-SYIV--PESDL------------EEG-QFR....M-------------LEVDNRVIIPELTHTA-FV-ISA.....---
COX2_BETVU/116-240-SYTI--PEDDP------------ELG-QSR....L-------------LEVDNRVVVPAKTHIR-II-VTS....A---
COX2_ASCSU/98-217-SYMK--SLDQL------------ELG-EPR....L-------------LEVDNRCVVPCDVNIR-FC-ITS....G---
COX2_PARLI/95-214-SYMV--PTSDV------------SLG-NPR....L-------------LEVDNRLILPMQNPIR-VL-VSS....A---
COX2_EXERO/95-212-SFMI--NSKNL------------..N-HFR....L-------------LDVDNRMIIPMNNQIR-ML-INS....A---
COX2_PNECA/107-231-SYML--PTEDL------------EEG-QLR....Q-------------LEVDNRVLVPVNTPLR-FI-ITA....T---
COX2_ADABI/95-214-SYML--SYDNL------------NPF-NFR....L-------------LEVDNRTILPYLSNIR-LL-TSS....A---
COX2_ONCFA/95-214-SYMK--PTNEL------------MNN-EFR....L-------------LEVDNRVLLPMNKQIR-IL-ITA....A---
Q8ZXC2_PYRAE/67-155-....--.....------------...-........-------------..FPRNITLVDPVEVK-FR-LTA....L---
Q9XDX2_MAGMG/93-178-....--.....------------...-........-------------...YPVLELEKGKSYR-LH-LSS....L---
Q9YB77_AERPE/72-160-....--.....------------...-........-------------..IPSTIVLEDPKQVT-FY-VAT....S---
COX2_PARDE/141-263-ALML--EKEAL------------ADA-GYSEDEYL-------------LATDNPVVVPVGKKVL-VQ-VTA....T---
COX2_FORLA/95-214-SYMI--PTQDL------------TPG-QFR....L-------------LETDHRMVVPMESPIR-IL-VSA....E---
Q8XPI7_RALSO/39-125-....--.....------------...-........-------------..TPDHITLKRGVPVV-FE-LTG....Q---
COX2_APILI/95-212-SYML--NYNNL------------..N-QFR....L-------------LETDNRMVIPMKIPLR-LI-TTS....T---
COX2_CANGA/115-239-SYVI--PDDLL------------EEG-QLR....L-------------LDTDTSVVVPVDTHIR-FV-VTG....A---
COX2_SCHPO/111-235-SYMV--PEEDL------------EEG-SLR....Q-------------LEVDNRLVLPIDTRIR-LI-LTS....G---
COX2_SYMST/95-214-SYMI--PYNEM------------EES-GLR....L-------------LEVDNRTTLPMQTQVR-IL-ITA....A---
COX2_SITGR/95-214-SYMI--PTKEL------------NSF-NFR....L-------------LEVDNRTPIPYKTQIR-IL-VTS....A---
COX2_LASSP/94-213-SFMI--PSNQL------------NPN-EFR....L-------------LDTDNRCILPFNYPIR-IL-TTS....M---
COX2_BALMU/95-214-SYMI--PTSDL------------KPG-ELR....L-------------LEVDNRVVLPMEMTIR-ML-VSS....E---
COX2_CTEFE/95-214-SYMI--PSNEL------------NLN-SFR....L-------------LDVDNRIILPINSQIR-IL-ITA....T---
O08448_NATPH/70-159-....--.....------------...-........-------------..FPGDFEVPADSEVT-FH-VTS....E---
COX2_PERAM/95-214-SYMI--PQDEM------------DHS-MFR....L-------------LDVDNRAVLPMNTFIR-II-VTA....A---
COX2_LOCMI/95-214-TYMT--PENEL------------NTD-EFR....L-------------LEVDNRTTLPMNTEVR-VL-TSA....S---
COX2_CHICK/94-213-SYMT--PTTDL------------PLG-HFR....L-------------LEVDHRIVIPMESPIR-VI-ITA....D---
Q8L1B7_9PSED/541-631-....--.....------------...-........-------------....TEFTVKQGDEVT-VT-ITNIDQIE---

PF06525

A4YDJ8_METS5/12-195.PTKVTLPVISSNKTVVISLVALSSAS..TFNLNGT-------------SFGQMTIYIPAGYNVE-VE-FTN----Q---
A4YEZ9_METS5/6-222PPGAVKLNYDAQNYTVFIYLYASPTAP.NFLDYNGT-------------TNGEMKIYIPANWSIL-FT-FYN----P---
SOXE_SULAC/11-198.PSKISIPYSSSNKTVFLTIVVESSSNVNQFNFNGT-------------SSGSLVIYIPAGSTVI-VK-FIN----Q---
Q97UN1_SULSO/11-196.SSQIPLKYDSTNKTVFLIISVLTTGP..TFNFNGT-------------SNGQLKIYIPAGWSVY-VK-FVN----E---
Q4J829_SULAC/7-202PSGAYALPYNSNNKTVFIYLVVSSSSS.NLFNFNGT-------------SDGSLKIYVPAGWNVM-VI-LKN----T---
Q97VW6_SULSO/21-249PPGANMLPYNPNNKTVFIYLAVTATGP..AFNYNGT-------------SNGQMKIYVPAGWNVM-II-LTN----E---

PF02298

O82081_ARATH/34-115----A.....SL-------------------------------------RTWAAGQTFAVGDNLV----FSY----P---
O82761_ARATH/37-119----S....VNY-------------------------------------ETWASTITFQVGDSLV----FKY----N---
NO16_MEDTR/36-121----LPSRRA.F-------------------------------------ARWASAHEFTVGDTIL----FEY----D---
O81500_ARATH/32-115----AN...VDY-------------------------------------KLWASTKTFHIGDTVL----FEY----N---
Q39040_ARATH/37-119----IN.....Y-------------------------------------TLWAQGKHFYVGDWLY----FVF----Y---
NO552_SOYBN/38-124----LSKPDS.L-------------------------------------SHWANSHRFKIGDTLI----FKY----E---
BCP_PEA/35-116----G.....DY-------------------------------------STWASDKTFAVGDSLV----FNY----G---
O82083_ARATH/38-140----QERPSANY-------------------------------------QKWADSKSFSLGDFLI----FNT----D---
O48787_ARATH/37-119----G....GDY-------------------------------------EAWASSRVFQVGDTLV----FAY----N---
STEL_TOXVR/11-97----FFGDVDYD-------------------------------------WKWASNKTFHIGDVLV----FKY----D---
Q9ZNX8_TOBAC/35-119----KVKDDQVY-------------------------------------DQWAGKNRFKIGDTLS----FEY----K---
BABL_CUCSA/11-89----T.......-------------------------------------ESWPKGKRFRAGDILL----FNY----N---
NO20_MEDTR/36-121----LPTRHA.L-------------------------------------TRWASNYQFIVGDTIT----FQY----N---
Q9ZRV5_CICAR/37-115----T.......-------------------------------------IAWPNGKNFKAGDTLV----FNY----S---
BCB2_ARATH/36-118----V.....DY-------------------------------------SGWATGKTFRVGDILE----FKY----G---
O82080_SPIOL/37-114----........-------------------------------------VNGARGKSFRAGDVLV----FKY----I---
MAVI_CUCPE/12-95----VP...YDY-------------------------------------AKWASSNKFHVGDSLL----FNY----N---
CPC_CUCSA/13-99----SSP..NFY-------------------------------------SQWAAGKTFRVGDSLQ----FNF----P---
BABL_ARATH/44-122----A.......-------------------------------------VGWPKGKHFRAGDVLV----FNY----N---
MPAA3_AMBEL/14-92----SDP..RAY-------------------------------------ALWSARQQFKTTDVLW----FNF----T---
BCB1_ARATH/33-117----MDP..EFY-------------------------------------TTWATGKTFRVGDELE----FDF----A---
O04596_ARATH/250-336----QES..YFY-------------------------------------YRWSEKTQFPIGDSLL----FEY----D---
Q9ZTU7_WHEAT/34-115----T.....DY-------------------------------------SSWVSGKKFNVGDEIV----FKY----S---
Q96316_ARATH/32-112----L.....DY-------------------------------------TVWLTGKTFRVGDTLE----FVY----G---
LAML_ARATH/37-119----IN.....Y-------------------------------------TIWAQGKHFYLGDWLY----FVF----D---
O82227_ARATH/36-122----ESPNHS.L-------------------------------------NHWAESVRFQVGDALL----FKY----D---

PF00812

EFNB1_XENLA/20-159-------NPRFI-------------------------------------SGKGLVLYPEIGDRLDIICPKGDSS......
EFNB2_MOUSE/28-169-------NSKFL-------------------------------------PGQGLVLYPQIGDKLDIICPKVDSK......
EFNA5_CHICK/26-164-------NPRFQ-------------------------------------Q.GDYHIDVCINDYLDVFCPHYEDSVP....
O93431_DANRE/17-155-------NANFL-------------------------------------W.DDYTVDVRINDYLDIICPHYAHGEI....
EFNA3_HUMAN/27-171-------NQHLR-------------------------------------R.EGYTVQVNVNDYLDIYCPHYNSSGVGPGA
EFNA1_XENLA/25-163-------NYRFM-------------------------------------Q.EDYTVQVQLNDYLDIVCPYYEEGSV....
EFNA1_HUMAN/15-153-------NPKFR-------------------------------------N.EDYTIHVQLNDYVDIICPHYEDHSV....
EFNA4_MOUSE/22-160-------NPRLL-------------------------------------R.GDAVVELGFNDYLDIFCPHYESPGP....
EFNB1_RAT/27-166-------NPKFL-------------------------------------SGKGLVIYPKIGDKLDIICPRAE........
EFNB2_DANRE/22-163-------NTKFV-------------------------------------PGQGLVLYPQIGDKMDIVCPRVEGG......
EFNA2_CHICK/25-163-------NPRFH-------------------------------------R.GDYTVEVSINDYLDIYCPHYEEPLP....
EFNB3_HUMAN/25-169-------NKRFQ-------------------------------------AEGGYVLYPQIGDRLDLLCPRARPPGPH...
EFN4_CAEEL/17-180-------NSLFR-------------------------------------N.RQPTIEVRMGDVVRFVCPDNEEG......
EFNA2_DANRE/21-159-------NSRFW-------------------------------------Q.GEYTVAVSINDYLDVYCPYYESPQP....

PF07732

Q9P8C3_9HYPO/104-220.ADLVGYDG----------------------------------------ISPGPTFIQEKGRESV----VRF----VN--
Q9P861_BLAAD/25-143ERKVIGING----------------------------------------QWPLPRIEVDKGDRLV----VNM----YN--
Q9UVW1_ASPFM/25-141.REMIFVNG----------------------------------------QFPGPAIILNEGDEAI----IDV----TN--
Q9UVV2_ASPFM/26-143.RPMIGINN----------------------------------------EWPCPIVNADLGDRLI----VDV----HN--
Q19687_CAEEL/100-218HKRVISING----------------------------------------DMPGAPVVVPYMSEVW----IRV----SN--
MCO_STAES/58-173..NTLGYNG----------------------------------------NLLGPTLKLKKGDKVK----IKL----IN--
LAC1_EMENI/28-145PREMVFTNG----------------------------------------EYPGPDLIFDEDDDVE----VLV----IN--
LAC4_ORYSJ/36-152.KSMVTVNG----------------------------------------QCPGPELVAREGDRVV----IRV----TN--
Q7S4C0_NEUCR/80-197.RQCQTING----------------------------------------TVPGPTIFADWGDSLI----IHV----TN--
LAC10_ARATH/30-146.KQIVTVNG----------------------------------------KFPGPTIYANEDDTIL----VNV----VN--
Q7RX46_NEUCR/32-148.ATLWGYDG----------------------------------------MSPGPTFIVEKGTETV----VRF----VN--
Q7S6W1_NEUCR/62-171KHDAMLFN.----------------------------------------.........DWGDYVN----VTI----IN--
Q7PNZ9_ANOGA/51-163......VNG----------------------------------------RYVGPTLTVCENDFLV----VDV----EN--
Q8RMC6_9ACTO/88-204.TPVLTYGG----------------------------------------SFPGPTIKARSGRRVV----VKQ----PN--
BLRO_MYRVE/82-198.ADLVGYDG----------------------------------------MSPGPTFQVPRGVETV----VRF----IN--
Q38757_ACEPS/31-147.KSMLTVND----------------------------------------SFPGPEIHVHKGDTVF----VNV----HN--
Q7VPL4_HAEDU/53-170LVDVWGVNG----------------------------------------QYLAPTVRVKRGDVVR----LSY----VN--
Q7NRY4_CHRVO/82-200ATEFWAYND----------------------------------------SVPGPAIELFEGETLG----LRF----DN--
LAC2_ARATH/35-151.KTIVTVNG----------------------------------------KFPGPRVTAREGDNLQ----IKV----VN--
O23170_ARATH/36-152PQQVILING----------------------------------------QFPGPAIEAVTNNNIV----VNL----IN--
Q9LX04_ORYSJ/32-148PQKVIAINK----------------------------------------QFPGPVMNLTTNYNVV----VNV----LN--
Q9AUI1_PINTA/41-156.KPLVTVNG----------------------------------------RYPGPTIFAR.GDRVI----IKL----VN--
Q8RQE2_9LACT/61-172...DESENN----------------------------------------YLAGMPIILDKGKEAT----IKV----SN--
Q9SMW3_ARATH/31-147PQKVILING----------------------------------------QFPGPNLNSTSNNNVV----INV----FN--
Q8LFM3_ARATH/42-158PQQVILING----------------------------------------QFPGPKLEVVTNDNII----LNL----IN--
Q98FW8_RHILO/79-198DTPILAYNG----------------------------------------TSPGPLIEAVEGDRVE----ITF----AN--
FTSP_PASMU/54-168TVEVWGFNG----------------------------------------HYLGPTIKIRKGDFAK----LNY----RN--
Q8TFE2_9PEZI/64-183KSKAMLINN----------------------------------------QFPGPIIKADWGDWVE----VTV----TN--
Q8TFD9_GAEGR/75-195PRYVQAFNG----------------------------------------TVPGPTLVMDWGDDVV----IHV----TN--
Q00292_ASPTE/65-183.RLGTVFNG----------------------------------------QYPGPLIEADWGDTLR----ITV----HN--
Q84ZL7_ORYSJ/38-154SQKVIAINN----------------------------------------QFPGPLLNVTTNWNVR----VNV----QN--
Q7W3D4_BORPA/52-166.RMATTVNG----------------------------------------SIPAPILRWREGDTVT----LRV----TN--
FTSP_HAEIN/51-168NVTVWGFNG----------------------------------------NYLGPTIKIKSGSFAK----LNY----HN--
Q9CJQ6_PASMU/79-197ETEFWAYNG----------------------------------------QLPGPQIEVFEGDTVE----IEF----IN--
Q8TFE1_GAEGR/83-200.RYCQTFNG----------------------------------------SFPGPLIWANWGDNLV----IHV----TN--
FTSP_PHOLL/52-169KTSVWGING----------------------------------------QYLGPTIRVHKNDDVK----LIY----SN--
Q94ID0_TOXVR/9-125.KSMLVVNG----------------------------------------SFPGPTITARKGDTIF----VNV----IN--
Q9AUI6_PINTA/39-155.KPLITVNG----------------------------------------KSPGPKIVVREDDRVI----IKV----HN--
Q7SDL8_NEUCR/27-146.RDVLLVNG----------------------------------------AFPGPLIEANWGDMIV----VNV----FN--
Q8H6A0_LOLPR/37-153.KSIVTVNG----------------------------------------EYPGPALVARKGHRVL----VRV----TN--
Q9SUD0_ARATH/33-149PRRGILING----------------------------------------QFPGPEIRSLTNDNLV----INV----QN--
CUEO_YERPE/53-168..QTWGYNG----------------------------------------NLLGPAIRLQRGKAVT----IDI----TN--
Q9ZQW3_POPTR/30-146.KSIPTING----------------------------------------KFPGPTIYAREGDNVN----IRL----TN--
Q875H3_PHACH/52-169.KPMLVVNG----------------------------------------LFPGPTIEVNQYDRLV----VRV----IN--
Q9VX11_DROME/122-239ESEVMVVNG----------------------------------------QLPGMNIEVCYGDTVV----ADV----IN--
O24042_LIRTU/42-158.KSIVTVNG----------------------------------------QFPGPKIVAREGDRVV----VKV----VN--
Q8L3Q4_ORYSJ/49-161...VIGING----------------------------------------KFPGPTVNISTNWNVV----VNV----LN--
Q9VBK7_DROME/139-256ANPVMAVNR----------------------------------------MVPGPSIELCENDTVV----VDV----LN--
O04947_ARATH/22-139.GAVMTVNG----------------------------------------EFPGPTIKAFAGDTIV----VNL----TN--
Q8YCF0_BRUME/28-145TAASAGING----------------------------------------AYLGPLVRLMSGESVT----LSV----EN--
Q7S9Z8_NEUCR/154-264MEHGKVFNR----------------------------------------TYPGP........WLE----VTV----KN--
LAC5_ARATH/34-150.HNSITVNG----------------------------------------MFPGPMLVVNNGDTLV----VKV----IN--
Q9SFF1_ARATH/34-150AQQGILING----------------------------------------KFPGPDIISITNDNLI----INV----FN--
Q82JK0_STRAW/63-180TSTTAGYNQ----------------------------------------SFLGPTMKWTSGDTVL----LNI----TN--
O04870_SOLLC/10-126PQQGILING----------------------------------------QFPGPDINSVTNDNLV----INI----HN--
O24041_LIRTU/32-148.KSILTVNG----------------------------------------RFPGPKLVAREGDRVV----VEV----VN--
Q8I8Y1_MANSE/186-304NRALSVVNR----------------------------------------KMPGPAIEVCQDDRII----VDV----EN--
LAC1_CRYPA/73-193KEDVMLVNG----------------------------------------NILGPVIHAQWGDTIS----VTV----TN--
Q9A9L6_CAUCR/56-170.GHAVTVNG----------------------------------------AIPGPLIRLKEGQNVR----LSV----TN--
Q7XSQ1_ORYSJ/36-152QQQGILING----------------------------------------QFPGPEIDCQTNDNLI----VNV----HN--
LAC9_ARATH/33-149.QMIPIVNG----------------------------------------SLPGPTINVREGDTLV----VHV----IN--
Q8W0V4_LOLPR/45-161.TDIIAVNG----------------------------------------QLPGPTIDVFEGDEVV----VDV----IN--
FET3_CANGA/25-144ERPVITCNG----------------------------------------EYPWPDVRVAKGDRIE----VYL----TN--
LAC4_ARATH/32-148.KPTVTVNG----------------------------------------RYPGPTIYAREDDTLL----IKV----VN--
Q9R9E7_PSESX/50-164.RTAMVING----------------------------------------GLPGPLLRWKEGDTVT----LRV----RN--
Q9X3V2_PSEPU/46-162.TEAWAFGP----------------------------------------SAPGTELRVRQGTWLR----VRF----IN--
COPA_PSESM/50-164.RTAMTING----------------------------------------GIPGPLLRWREGDTVT----LRV----KN--
Q9AUI4_PINTA/36-152.KPLITVNG----------------------------------------EYPGPAIIAREGDRVV----INV----TN--
Q7S1M8_NEUCR/27-114......MKH----------------------------------------MCPRPVSPDR......----...----..--
Q9L914_9GAMM/58-175.RIATVVNR----------------------------------------SIPAPTLRLKEGDEVT----LRV----TN--
A9CFX2_AGRT5/76-193TARLWGYNG----------------------------------------QSPGPTIEAVEGDRVR----IFV----TN--
Q9AUI0_PINTA/32-148.EPIVTANG----------------------------------------KFPGPTIHAREGDTVT----VKV----TN--
LAC6_ARATH/37-153.NEIVTVNK----------------------------------------KFPGPAISAQEDDRIV----IKV----IN--
Q87F38_XYLFT/61-176.RPAITVNN----------------------------------------SLPGPVLRWRQGDTVQ----IHV----TN--
Q7N890_PHOLL/51-168VTKTWGYNG----------------------------------------DLLGPALKLMSGKPVT----IDI----RN--
Q8RNQ3_LEGPN/119-233.RRAIAVNG----------------------------------------QIPAPTLHFKEGDDVT----INV----YN--
O42702_9ASCO/36-154.RQSAVVNG----------------------------------------TSPGPELRVPAGQRTW----IRV----YN--
FTSP_ECOLI/51-168RASVWGING----------------------------------------RYLGPTIRVWKGDDVK----LIY----SN--
LAC2_PODAS/85-205KQKVMLVNG----------------------------------------DIFGPTITANWGDWIQ----VNV----IN--
O24093_MEDTR/31-148.HVVMGING----------------------------------------QFPGPTIRAEVGDTLV----IDL----TN--
Q8L4Y3_SOYBN/42-158.HNSITVNG----------------------------------------QYPGPTLEINNGDTLV----VKV----TN--
ASOL_TOBAC/31-147PQQGILING----------------------------------------QFPGPRINCTSNNNIV----VNV----FN--
Q8L8N6_ARATH/32-148NKQVIVIND----------------------------------------MFPGPILNATANDIIV----VNI----FN--
O65449_ARATH/31-147KQQGILING----------------------------------------QFPGPHIDAITNDNII----ISV----FN--
Q82XJ1_NITEU/53-167.ATATTING----------------------------------------TVPGPLLHLREGQDIT----LNV----TN--
Q942J6_ORYSJ/33-149AQKVMLIND----------------------------------------MFPGPTINCSSNNNIV----VNV----FN--
Q9VLC3_DROME/283-401ERSITVVNR----------------------------------------MMPGPAIEVCEGDEIV----VDV----KN--
Q8S2A8_ORYSJ/35-151.KSIVTVNG----------------------------------------QFPGPTVFAREGDLVV----IRV----IN--
SKU5_ARATH/30-146PQQVIAING----------------------------------------KFPGPTINVTTNENLV----VNV----RN--
CUEO_SALTI/53-167.ATTWGYNG----------------------------------------NLLGPAVQLHKGKSVT----VDI----HN--
Q9LV68_ARATH/34-150RQQVIGING----------------------------------------QFPGPILNVTTNWNVV----MNV----KN--
LAC1_NEUCR/91-211KDKVMMVND----------------------------------------KIIGPTIQADWGDYIE----ITV----IN--
Q9ZQW2_POPTR/41-157.RSLVTVNG----------------------------------------QFPGPRLVAREGDQVL----VKV----VN--
FIO1_SCHPO/30-151SRWVIGVNN----------------------------------------KWPIDPLVVDYGDQVI----IKM----TN--
Q8W0V5_LOLPR/30-146.TVATVVNG----------------------------------------QLPGPALEVTEGDSVV----VHV----VN--
LAC17_ARATH/30-146.KSLVSVNG----------------------------------------QFPGPKLIAREGDQVL----IKV----VN--
LAC11_ARATH/31-147.KPIVTVNG----------------------------------------MFPGPTVYAREGDRVI----INV----TN--
LAC7_ARATH/31-147.QVITVVNG----------------------------------------SLPGPTIRVKEGDSLV----IHV----LN--
LAC3_ORYSJ/32-148.HNVITVNG----------------------------------------QLPGPTLEVREGDTVV----INV----VN--
LAC3_ARATH/33-149.HQSITVNG----------------------------------------QYPGPTLVVRNGDSLA----ITV----IN--
Q93M03_STRAU/64-181MSKVRTYDG----------------------------------------TFPGPTIRATQGREVV----VRQ----IN--
CUEO_ECOLI/51-167.ATTWGYNG----------------------------------------NLLGPAVKLQRGKAVT----VDI----YN--
LAC14_ARATH/41-157.NKILTVNG----------------------------------------EFPGPTLKAYRGDKLI----VNV----IN--
Q8X010_NEUCS/27-145ERPVIGINN----------------------------------------QWPPPRIDVQVGDRLI----VNL----HN--
PCOA_ECOLX/50-164.RQAKTING----------------------------------------GLPGPVLRWKEGDTIT----LKV----KN--
Q9C497_GLOLA/74-192SKPAMLING----------------------------------------QFPGPTIEADWGDWVE----INV----HN--
LAC2_ORYSJ/34-150.KAMVTVNG----------------------------------------SYPGPTIYAREGDRVI----VNV----TN--
Q9SDV9_BRAJU/30-147.GIVIAING----------------------------------------EFPGPTINAVAGDTVI----VHV----TN--
LAC15_ARATH/27-143.KAILTVNS----------------------------------------QFPGPIIKVHKGDTIY----VNV----QN--
Q96VT5_EMEND/39-149..KMILANG----------------------------------------QFPAPALRLKQGDDVE----FLV----NN--
Q8ZWA8_PYRAE/48-158.......AE----------------------------------------GVLNPTIILRRGQRVD----MTL----KN--
Q8PCX4_XANCP/56-171.RSAITVNQ----------------------------------------SLPAPTLRWREGDTVS----VRV----RN--
Q9M5B5_CUCME/45-162.NLVMGINH----------------------------------------QFPGPTIRANVGDTVV----VEL----IN--
Q8XS25_RALSO/63-177.AMATTVNG----------------------------------------MLPGPTLRWREGDTVT----LRV----TN--
Q7MGM1_VIBVY/42-159ATDVLAFNG----------------------------------------AIPAPTIRCRQGEEVI----IHF----TN--
SKS1_ARATH/34-150PQQVIAVNG----------------------------------------QFPGPLLNATTNYNVV----VNV----FN--
Q8NK87_CANAX/29-147ERPMIGFND----------------------------------------TWPLPTLRVKKGDRVQ----LYL----IN--
Q989B7_RHILO/43-161TNNVLTYGN----------------------------------------AGMPPVLRMKKGEPFA----ARL----VN--
Q7XIF0_ORYSJ/35-152PQQGILING----------------------------------------QFPGPRIDCVTNDNII----VNV----FN--
Q9AUI3_PINTA/36-152.HNIITVNG----------------------------------------QFPGPTLHVRNGDTLV----VKV----YN--
LAC2_BOTFU/74-191.RSAMTFNG----------------------------------------TVPGPAITADWGDNLI----IHV----TN--

PF07731

Q9P861_BLAAD/361-500DLVTNELVY----------------------------------------GEYTHTVVVNHLDVVE----IVV----NN..
Q9UVV2_ASPFM/370-504ENASNA.SI----------------------------------------YGQVNPFVVQYGEVVE----III----NN..
Q9UVW1_ASPFM/438-575.......PE----------------------------------------FADALKITTRNDTWVD----IVF----QL..
Q93F47_9PSED/243-350QAWDINDKT----------------------------------------CADRPIATLKLGNHYI----FEL----RN..
Q96UP8_GIBIN/312-437...EERKEW----------------------------------------PDDYVIVPAENRDGWV----YLV----IT..
Q9P8C3_9HYPO/398-542NRLLAN.VP----------------------------------------LGTVQLWQLTNAAQGW----...----....
Q96V70_GIBIN/302-411..KLGNHTF----------------------------------------EPEWNVINTGKAKSVR----VVV----NN..
Q7S065_NEUCR/364-497.GNNTNPLV----------------------------------------YGQINPVVVRKGDIVQ----LVI----NN..
Q7S4C0_NEUCR/422-556..FNGESLF----------------------------------------PTDYNVLAINKTTTDD----EWI----VL..
Q7S6W1_NEUCR/414-557.REDIT.FW----------------------------------------PYSENVLEIPPESEWS----FWL----IE..
LAC15_ARATH/408-547NQPLFLETP----------------------------------------RLATEVKVIEFGQVVE----LVI----QGT.
Q7RX46_NEUCR/320-463NRVLAR.PK----------------------------------------RGTVEVWELENSSGGW----...----....
Q9C1Z1_PICPA/365-505EDAINPLVY----------------------------------------GSNTNSFVLEKDEVIE----IVL----NN..
LAC1_ARATH/429-565DPVSENMNT----------------------------------------EFGTKLFEVEFGSRLE----IVF----QGT.
PHSA_STRAT/471-624.......AT----------------------------------------FNDGLGFTIGEGTHEQ----WTF----LN..
FIO1_SCHPO/364-501GYNLEPVTY----------------------------------------GPYTNAYIFEYGDVVD----VII----DN..
Q8TFD9_GAEGR/415-543.ASNATVAF----------------------------------------SNSNAVMELPEADKWA----YVI----IQ..
Q7SDL8_NEUCR/387-512..MKGNMSF----------------------------------------PEVSNVKDFGSAKTVR----VVV----IN..
Q8VYB3_ARATH/384-525DKPRRGRGM----------------------------------------RMETSVMGAHHRDFLE----IIF----QN..
Q8NID5_9APHY/368-496SGAQTAPDL----------------------------------------LPNGSVYVLPSNATVE----LSF----PM..
Q7XIF0_ORYSJ/383-523ARPDGA.AP----------------------------------------RSGTPVVRLNLHEFIE----VVF----QN..
Q8CXJ7_OCEIH/350-508HDPITEKPQ----------------------------------------LGDTEIWSIVNVTNF.----...----....
Q8I8Y1_MANSE/570-726.......GY----------------------------------------CECPHVLSVKLNAIVE----VII----VD..
Q8NK87_CANAX/361-501DAATNELVY----------------------------------------GTNTNSFVLQGGDVVD----IVL----NN..
Q00292_ASPTE/424-564ADHDEEFPP----------------------------------------ETVPVTLDFDTGEWVY----FLL----TS..
LAC6_ARATH/417-553NDIANDTQA----------------------------------------ANGTRAIVFEYGSRIQ----IIF----QNT.
Q7NRY4_CHRVO/360-497NRMDFT.GQ----------------------------------------VGAVEEWEIDNQADM.----...----....
LAC1_AGABI/371-491SGAKRPEDV----------------------------------------LPSEQIFFVPKNSLIE----VNI----PG..
Q9ZQW5_POPTR/254-388.TPPTNLQT----------------------------------------TSGTKAYRLPYNSTVQ----LVM----QDT.
Q804X3_CHICK/941-1065FHAING.YV----------------------------------------GDTLPGLVMAQQQRIR----WHL----LN..
O65449_ARATH/375-516TSPSGGNGG----------------------------------------YLQSSVMAANFREFIE----VVF----QN..
Q9LQT5_ARATH/347-487VYPSNK.TP----------------------------------------TLGTSVVDIHYKDFIH----IVF----QN..
Q90ZT2_DANRE/489-613MHGING.LV----------------------------------------FGNLKGLNMKVGDKVY----WYL----MG..
BLRO_MYRVE/371-515NRLLAN.VP----------------------------------------VGTVERWELINAGNGW----...----....
LAC3_ARATH/419-554NVSRGLWQP----------------------------------------IKGTKAYKLKYKSNVQ----IVL----QDT.
SKS1_ARATH/397-536DRPFNR.PL----------------------------------------RLDRSMINATYKGFIQ----VVF----QN..
Q82JK0_STRAW/341-480AMAMIS.TT----------------------------------------LDAEEIWTVTNSTQL.----...----....
Q7MGM1_VIBVY/340-461RAWEGMSQD----------------------------------------SIPAPLATLERGQTYI----FNL----KN..
Q9SFF1_ARATH/376-516DQPTNG.AI----------------------------------------FPTTSVMQADFRAFVE----VIF----EN..
Q8XX19_RALSO/116-246.......NG----------------------------------------NIPAPLMAIDEDDEFF----LTL----TNVG
LAC7_ARATH/412-551QTNPGLLFT----------------------------------------QKSTSAKILKFNTTVE----VVL----QNH.
Q9ZVV3_ARATH/388-531PAAKIT.AL----------------------------------------TVQPNVLNITFRTFVE----IIF----EN..
Q9UVT5_LENED/376-499SGAQSPQDL----------------------------------------LPPGSVYTLPINKTIE----INF----FG..
Q7S2V2_NEUCR/516-661.........----------------------------------------...TNIGQGENDNVIR----LPY----SS..
SKU5_ARATH/394-533KRPLTG.PA----------------------------------------KVATSIINGTYRGFME----VVL----QN..
Q7RYF6_NEUCR/414-556..VEGNFTF----------------------------------------PRQANIIQLPEAVKWS----FWV----IQ..
Q8J0L7_CLAPU/359-497EQAENPAIY----------------------------------------GEYTHPFVLKKDEIVQ----IVV----NN..
Q8RNQ3_LEGPN/688-807.......LP----------------------------------------EYKAKPILIEPGKRYR----IIF----TN..
LAC2_ORYSJ/411-546VPLTAGLGT----------------------------------------SLGTRLSKIAYNATVE----LVL----QDT.
LAC1_THACU/419-544EDGVTESDF----------------------------------------TKEEHTVILPKNKCIE----FNI----KG..
FET3_CANAX/362-502EAATNELIY----------------------------------------GTNTNSFVLQGGDIVD----IVL----NN..
O24041_LIRTU/420-554.TPPNNTFV----------------------------------------SHGTKVVVIPFNTSVE----VVL----QNT.
O68054_RHOCA/369-490.......RS----------------------------------------WDNRRPIGAKSGERVE----MMF----HN..
Q9VX11_DROME/473-628.......RH----------------------------------------CQCSNVIQVPANQQVE----FVI----SS..
Q9FSC9_POPTR/404-539NNTAMNLKT----------------------------------------TNGTRAYRLAFNSAVQ----VVL----QGT.
LAC2_BOTFU/413-547..FNNETIF----------------------------------------PTDYNVVALNQTDANE----EWV----VY..
Q93HV5_STRGR/170-308.......KT----------------------------------------AHNSVNFEATVGDRLE----FVM----IT..
Q8GB87_STRLA/454-610.......RT----------------------------------------FNDGLGFTVAEGSYEQ----WSF----LN..
E9ACP0_LEIMA/403-552HGFTVPLQA----------------------------------------VVTARVYGDPTDKR..----...----....
LAC4_TRAVI/366-494SGTTSAADL----------------------------------------LPSGSLFAVPSNSTIE----ISF----PI..
Q9P8G4_9APHY/369-494SGNYSAQSL----------------------------------------LPPGVVYTLPPNQSVE----LSI----P...
Q87F38_XYLFT/490-609.......IP----------------------------------------FASAQPLRLNYGERVR----IVL----VN..
FTSP_PHOLL/334-472NRVDIT.SQ----------------------------------------QGTWERWIVNASA...----...----....
Q8WZH9_LENED/381-493SGAQSPQDL----------------------------------------LPPGSVYTLPINKTIE----INF----FG..
Q9CJQ6_PASMU/378-515NRIDFV.AK----------------------------------------LNEVEQWEIFNESHM.----...----....
O53858_MYCTU/384-503.......EP----------------------------------------YSTTNPLHVRLGQRPT----LMF----DN..
LAC9_ARATH/411-552NSDMEMMFP----------------------------------------ERKTSVKTIRFNSTVE----IVL----QNT.
Q96VT5_EMEND/456-583.........----------------------------------------.......TSKNGTWVD----VVF----DV..
COPA_PSEUB/489-608.......IK----------------------------------------FADAQPLILKYGERVR----IVL----VN..
O23170_ARATH/380-520STPTTG.PA----------------------------------------HIGTSVIDVELHEFVE----IVF----QN..
Q8GP36_CORDP/379-493.......LT----------------------------------------DGQSSSATVQEGQRLR----MVM----RN..
Q942J6_ORYSJ/381-524PPATTV.PQ----------------------------------------KLAPNVISAEFRTFIE----VVF----EN..
FET3_YEAST/362-504DQANNSEIY----------------------------------------GSNTHTFILEKDEIVE----IVL----NN..
FET5_YEAST/367-517KLASDPRIY----------------------------------------GDNINAQLLKHNDIIE----VVL----NN..
Q89KF9_BRAJA/312-434WTRPAD.FS----------------------------------------TSSAPAFRTRTGRTVV----LTL----KN..
Q9LV68_ARATH/382-521KRPMNR.HP----------------------------------------RVDTSVINGTFKGFVE----IIF----QN..
O60199_PLEOS/365-491SGTRDAHDL----------------------------------------APAGSIYDIKLGDVVE----ITM----P...
Q7X4G1_XANEU/217-341.......RV----------------------------------------FPGIDSLNVRLNDKVR----VRI----GN..
Q7Z8S2_PLESA/371-496SGASSASEL----------------------------------------LPPGSIYTLPRNKVVE----LSI----P...
O13420_9APHY/364-493SGASTAQDL----------------------------------------LPPGSVYPLPAHSSIE----ITL----P...
O67206_AQUAE/387-526PKVLFE.QN----------------------------------------NGDVVIIEYVNNTGM.----...----....
Q96TR4_PLEOS/372-492SGARKPQDF----------------------------------------LPSEQVIILPANKLIE----VSI----PG..
Q8I8Y0_MANSE/577-738NRPANCGQN----------------------------------------CMCTHKVDIPLNAVVE----IVL----VD..
Q9VBK7_DROME/508-666.......EL----------------------------------------CECVNVMRLPAYRPLE----MVV----AN..
Q84ZL7_ORYSJ/403-540TMPGNA.PP----------------------------------------KMASSTLNASYKGFLE----IVF----QN..
O74171_SCHCO/363-488SGARTAQEL----------------------------------------LPEGSVYTLPPNQTVE----ISI----P...
LAC2_PODAS/426-569..IAQNTSY----------------------------------------PPQANVITVNSVNQWT----YWL----IE..
O59944_CERSU/368-493SGAMTAQEL----------------------------------------LPAGSVYTLPRNATVQ----LSL----P...
Q94ID0_TOXVR/389-516KKANFSLNT----------------------------------------AQGTQVLMIEYGEAVE----IVY----QGT.
Q8XS25_RALSO/486-605.......VE----------------------------------------YGRSAPIHFRHGERLR----VIL----HN..
Q7S9Z8_NEUCR/523-687.........----------------------------------------...SSLDSLITKPHLD----IVT----LP..
Q8X010_NEUCS/358-513DLTTNPSIY----------------------------------------GTYTHPFILSHNSIVQ----IVL----NN..
Q7N890_PHOLL/374-513TEPAFD.VK----------------------------------------QGQYERWVISGVGDMM----...----....
Q84SA8_ASTTR/257-395SFDLNLIMT----------------------------------------PKSTSVKSVMFNATVQ----MVL----QNT.
Q8X1W2_LENED/396-521SGAHHAQDL----------------------------------------LPKGGVHTLPPNKVIE----INF----FG..
FET3_CANGA/362-504QDALNPFIY----------------------------------------GTNTNTFVLKKGEVVD----LIV----NN..
ASOL_TOBAC/383-524APADPS.KL----------------------------------------TIATNVKNATYRNFVE----IIF----EN..
Q9C497_GLOLA/416-556..AEGNDSW----------------------------------------PHQANVVDLSGADVWT----WWV----IE..
Q8YQ92_NOSS1/200-332YAFNGL.PH----------------------------------------HYMDNPIQIYQNQLIR----LYV----LN..
Q7NG83_GLOVI/190-322YAFNGV.PN----------------------------------------YYLRHAIPVYQNQPIR----LYL----LN..
LAC2_ARATH/423-557.TPPNNTMV----------------------------------------SRGTKVVVLKYKTTVE----LVL----QGT.
Q9A9L6_CAUCR/444-566.......AF----------------------------------------GPLKKPIAFQRDERAR----VVL----IN..
Q9AUI3_PINTA/418-554NVSRGLWSP----------------------------------------VKSTRVKILNYNTTVQ----VIL----QGT.
Q9FKY9_ARATH/382-522SVPSNS.PP----------------------------------------TVATSVVQTSHHDFLE----IVF----QN..
CUEO_YERPE/393-532TEPAFD.AK----------------------------------------QGKYEKWTISGEGDMM----...----....
Q8TFE2_9PEZI/409-548..VKGNMNF----------------------------------------PQNFNVFQVPQGNQWS----FWI----IQ..
Q7S1M8_NEUCR/347-488.ANNTLSSV----------------------------------------PRSRNLIQIPGSNTLT----YFL----LQ..
Q8YCF0_BRUME/358-494ERIDVE.AK----------------------------------------LGSWEIWELTSREM..----...----....
FTSP_SALTI/333-470NRIDIT.AQ----------------------------------------QGTWERWTVRADM...----...----....
Q9AUI1_PINTA/428-562.TPPNNTKP----------------------------------------MNGTRVKVIPFNTTVQ----LVL----QDT.
LAC4_THACU/380-502NNASNDADF----------------------------------------TPNEHTIVLPHNKVIG----AQH----HR..
LAC14_ARATH/420-553TGENLPFPT----------------------------------------RFGTKVVVLDYNSSVE----LIL----QGT.
LAC3_ORYSJ/415-551NVPRYLWQP----------------------------------------VPATKLYKLKFGSVVQ----IVL----QDT.
O04870_SOLLC/354-493DSPTGG.GI----------------------------------------YQDTSVLGVNYRQFIE----IIF----EN..
Q9X8C0_STRCO/91-236DRIDQE.VQ----------------------------------------AGTVEEWRIVNEDVF.----...----....
Q9LX04_ORYSJ/396-535TMPIDG.PP----------------------------------------VMKTSVINSTYKNFLE----IVF----QN..
Q9Y781_COPCI/368-493SGAQTAQQL----------------------------------------LPSGSVYVLPRNKVIE----LSM----P...
COTA_BACSU/354-512HDPVTETPK----------------------------------------VGTTEIWSIINPTRG.----...----....
Q82XJ1_NITEU/485-608.......KY----------------------------------------SDAKESILFRHGERLR----WIF----VN..
Q8W0V5_LOLPR/411-556AKLLELEPS----------------------------------------RRATTMRHIAYNSTVE----VVF----QST.
A9CFX2_AGRT5/212-336.......RV----------------------------------------FPGIDPLVVSKNDRVR----VRV----GN..
Q89T40_BRAJA/212-336.......RV----------------------------------------FPGIDPLPVRLGDKVR----VRI----GN..
Q7W3D4_BORPA/466-585.......LK----------------------------------------FSQAKPIVLKYGERVR----FVL----VN..
LAC1_NEUCR/427-569..LTGNTNY----------------------------------------SQSDNIVQVEGVNQWK----YWL----IE..
Q875H3_PHACH/405-542FAPEGASVQ----------------------------------------FGNQFLITEDKIEVLD----LVL----EN..
Q875H1_COPCO/371-497NGKQMNELL----------------------------------------PNQGSLFPIPRNSVIE----LTM----P...
Q8FQU9_COREF/414-557QRVDVV.ID----------------------------------------HDGPEIWEITNDNSDW----...----....

PF00394

Q9UVV2_ASPFM/150-308LPAAALINE........................................GFDTTTLRVEPNKTYL----IHL----V.--
LAC4_ORYSJ/162-316VSDAFTINGLPGPLYNCSA......Q......................D...TFKLKVKPGKTYM----LRL----I.--
NIR_RHOS5/206-358IPSHIVFNG................A......................VGALTGEGALKAKVGDN----VLF----VH--
LAC1_NEUCR/219-366.SNNVLFNG...FAKHPTT.............................GAGQYATVSLTKGKKHR----LRL----I.--
LAC1_BOTFU/191-337TLLTGLMNGTNTYNGAGKK..................................FQTTFTPGLKYR----IRV----V.--
LAC1_CRYPA/201-349ASDNVLFNGTNINPANTTQ...............................GQYKTITLTPGKRHR----LRI----I.--
O68601_ALCXX/192-344TPSHIVFNG................K......................VGALTGANALTAKVGET----VLL----IH--
LAC1_PHLRA/163-307AADTTLINGLGRCGEAGCP..............................VSDLAVISVTKGKRYR----FRL----V.--
LAC5_ARATH/160-312NSDAYTINGQPGDLYKCSS......Q......................D...TTVVPINVGETIL----LRV----I.--
O64838_ARATH/161-298.PDGLLINGASKGL........................................VFTGQHGKIYR----FRI----S.--
Q9Y781_COPCI/165-306TPDSTLINGKGRYAGG..P..............................TVPLAVISVTRNRRYR----FRL----V.--
ASO_TOBAC/163-329EPQTLLLNGRGQYNCSLAA......RFSKPPLP........QCKLRGGEQYAPQILRVRPNKIYR----LRV----A.--
Q9UVT5_LENED/175-316PADATLINGKGRYLGG..P..............................AVPLAVINVQQGKRYR----FRM----I.--
O53858_MYCTU/190-352MQNTTGMPEGEGVDSNLLG......GDGGDIAY.......PYYLINGRIPVAATSFKAKPGQRIR----IRI----I.--
Q9SDV9_BRAJU/154-321EPQSLLINGRGQFNCSLAA......YFNKGGLK........ECKFKENDECAPSILRVEPNKVYR----LRI----A.--
FET3_CANAX/155-302IPQNFLFNETRN.........................................ATWKVEPGKTYF----VRI----L.--
LAC5_TRAVE/165-309GPDSVLINGLGRFSGDGGG..............................ATNLTVITVTQGKRYR----FRL----V.--
O74171_SCHCO/158-299TPDSTLINGKGRYNGG..S..............................LTNLTRINVVRGLRYR----LRI----V.--
Q00292_ASPTE/189-347IPVSTLLNGKGTYDCDPGL......DPA..................CTGKQEYFETTFQQGTKYK----MAI----V.--
O13422_9APHY/167-309RADATLINGLGRSTDT..P..............................TADLAVIKVTSGKRYR----FRL----A.--
LAC4_ARATH/158-308VSDSHMINGHPGPVRNCPS.............................Q...GYKLSVENGKTYL----LRL----V.--
FIO1_SCHPO/158-306VPDTGLFNDTAN.........................................ATFAMEPGKTYR----LRF----I.--
Q9ZQW3_POPTR/156-306ISDAHTVNGHTGAVPGCTS.............................P...GFTLHVESGKTYL----LRI----I.--
LAC7_ARATH/157-310NSDAYTINGRPGNLYPCSK......D......................R...MFSLNVVKGKRYL----LRI----I.--
Q9SVE3_ARATH/161-299PQGKSIILSHHLFF........................................VVEQLSGKTYR----FRI----S.--
LAC4_TRAVE/164-306GSDSTLINGLGRFAGG..D..............................STDLAVITVEQGKRYR----MRL----L.--
P93366_TOBAC/156-307VSDAHTINGHPGPVSNCAS......Q......................G...GYKLNVDPGKTYM----LRV----I.--
SKU5_ARATH/156-311.PDGVLINGKGPYRYNDTL......V.....................ADGIDFETITVHPGKTYR----LRV----S.--
Q56795_XANCA/189-368VGDFVRDAREDGLKATLADRKMWGQMRMTPTDLSDVNANTYTYLMNGTTSLGNWTGLFRSGEKVR----LRF----I.--
FA8_HUMAN/218-349....HTVNG................Y......................VNRSLPGLIGCHRKSVY----WHV----IG--
Q38757_ACEPS/157-308TSDAFTINGQPGALFDCST......G......................T...TFRLPVKKGETYL----LRI----I.--
FET3_YEAST/155-302IPQNLIVNNTMN.........................................LTWEVQPDTTYL----LRI----V.--
O65449_ARATH/157-295.PDGVLINGRGWGG.......................................NTFTVQPGKTYR----FRI----S.--
Q9SFF1_ARATH/160-297.PDGILINGRSSGA........................................TLNIEPGKTYR----LRI----S.--
ASOL_BRANA/159-302.PDGIVINGKSGKG..................................DGSDAPLFTLKPGKTYR----VRI----C.--
FET5_YEAST/157-305IPQNILFNNTMN.........................................VTLDFTPGETYL----FRF----L.--
Q9ZQW2_POPTR/167-320VSDAYTINGLPGPLYNCSA......K......................D...TYKLKVKPGKTYL----LRL----I.--
LAC3_TRAVI/163-301.PAATLINGLGRWPGN..P..............................TADLAVIEVQHGKRYR----FRL----V.--
O23170_ARATH/162-300.PDALLINGVSKGL........................................IFTGQQGKTYK----FRV----S.--
LAC1_TRAHI/163-305GADATLINGLGRSPST..T..............................AADLAVINVTKGKRYR----FRL----V.--
O04947_ARATH/149-316EAQSILINGRGQFNCSLAA......QFSNNTSL.......PMCTFKEGDQCAPQILHVEPNKTYR----IRL----S.--
COPA_PSEUB/172-350VGDFVNDVADKGWAATVADRKMWAEMKMNPTDLADVSGATYTYLLNGQAPNMNWTGLFRPGEKLR----LRF----I.--
Q9ZR60_CUCME/20-183EPDSLLIQGRGRFNCS.........VLGSSSG.........TCNSSSTE.CVLYPLTVVPGKTYR----LRV----S.--
LAC1_AGABI/160-312VQDSGLINGKGRFNGG..P..............................LTPFAVVNVRRGKRYR----LRV----I.--
LAC2_PODAS/213-360PSDTVLFKGHGKNPQTGA................................GKFANVTLTPGKRHR----LRI----I.--
LAC2_ARATH/161-314ASDAHTFNGLPGPLYNCST......K......................D...TYKLMVKPGKTYL----LRL----I.--
O65670_ARATH/168-334EPQSLMIQGRGRFNCSNNL......TTPPSLVS.......GVCNVSNAD.CSRFILTVIPGKTYR----LRI----G.--
LAC4_THACU/161-317VPDSGLINGKGRYVGG..P..............................AVPRSVINVKRGKRYR----LRV----I.--
Q9SUD0_ARATH/159-299MPDGVMINGQGVST......................................VYSITVDKGKTYR----FRV----S.--
LAC3_ARATH/159-310VSDAYTINGQPGDLYRCSR......A......................G...TIRFPIFPGETVQ----LRV----I.--
NIR_ALCFA/210-362TPTHVVFNG................A......................VGALTGDKAMTAAVGEK----VLI----VH--
O24093_MEDTR/158-324EPQNLLINGRRQFHCSLAS......KYGSTNLP........QCNLKGGEECAPQILHVEPKKTYR----IRI----A.--
Q9ZR59_CUCME/170-333ELQVILINGTGQFNCTSLD......KYNTSS...........EHCEWKDQCAPFVLKVEPNKTYR----IRI----A.--
NIR_ALCXX/164-316TPSHAVFNG................A......................VGALTGANALTAAVGES----VLI----IH--
Q9SGR6_ARATH/159-296.PDGILINGRSSGA........................................TLNVEQGKTYR----FRI----S.--
Q9SMW3_ARATH/157-300.PNGVLINGKSGKV..................................GGKNEPLFTMKPGKTYK----YRL----C.--
O60199_PLEOS/162-303HPDSTLFNGLGRSLNG..P..............................ASPLYVMNVVKGKRYR----IRL----I.--
Q9Y780_COPCI/160-305QPDATLINGKGRYVGG..P..............................AAELSIVNVEQGKKYR----MRL----I.--
LAC6_ARATH/163-315PADAFTINGQPGPNYNCSS......K......................D...VYEIQIVPRKIYL----LRL----I.--
O61263_9APHY/163-305GADSTVINGLGRSLST..P..............................NADLAVISVTQGKRYR----FRL----I.--
SKS1_ARATH/160-314.PDGVLINGKGPYKYNSSV......P......................DGIDYLTFHVEPGKTYR----IRV----H.--
O24041_LIRTU/158-311VSDAYTINGMPGPLYNCSA......K......................D...TFKLKVKPGKTYL----LRL----I.--
O04870_SOLLC/136-274.PDGILINGRGPNG.......................................VTFTVDQGKTYR----LRI----S.--
ASOL_TOBAC/157-300.PDGIIINGKSAKV..................................GEAKEPLFTMEAGKTYR----YRF----C.--
LAC1_PLEOS/174-315TADSTLINGKGRFAGG..P..............................TSALAVINVESNKRYR----FRL----I.--
O59944_CERSU/165-307TFDTTLINGLGRFAGTGGS..............................DSNLTVITVEQGKRYR----FRL----V.--
CERU_HUMAN/221-358....YSVNG................Y......................TFGSLPGLSMCAEDRVK----WYL----FG--
Q9UUY5_HETAN/31-173SPSSTLINGLGRYQGG..P..............................NSTLAVVGVTQGKRYR----FRL----I.--
O31380_BRAJP/193-345IPSHVVFNG................K......................VGALTGKNALTANVGEN----VLI----VH--
ASO_CUCMA/166-331EPQTILLNGRGQFDCSIAA......KYDSNLE.........PCKLKGSEPCAPYIFHVMPKKTYR----IRI----A.--
Q9UVU8_PYCCI/165-307GANSTLINGLGRAATD..S..............................TSDLTVIAVEHGKRYR----FRL----V.--
O42702_9ASCO/162-324EVRAVLLNGKGIGIGHEAD......VS...................PSGDCSLPVIDVDPGKTYR----FRF----I.--

PF00127

AZUP_METEA/30-118.....TDKGHNVETIK.........G-MA----------PDGADYVKTTV-.....------------------------
AZUR1_METJ/22-149GSLPKNVMGHNLVITKTADFKAVMND-GV----------AAGEAGNFVKA-GDARV------------------------
AZUP_ALCFA/28-116.....VDKGHNVESIK.........D-MI----------PEGAEKFKSKI-N....------------------------
AMCY_METEA/31-119.....EALPHNVHFKS.........G-PG----------..VEKDVEGPM-LR...------------------------
PLAS2_POPNI/70-168.....AGFPHNVLFDE.........D-AV----------PSGVDVSKISM-SE...------------------------
AZUR_ALCFA/1-127GKLPKAAMGHNVVVSKKSDESAVATD-GM----------KAGLNNDYVKA-GDERV------------------------
PLAS_CHLFU/2-98.....AGFPHNIVFDE.........D-EV----------PSGANAEALSH-.....------------------------
PLAS_SILPR/67-165.....AGFPHNVVFDE.........D-EV----------PAGVDVTKISM-PE...------------------------
AZUP_PARPN/27-115.....TDKSHNVEAIK.........E-IL----------PEGVESFKSKI-N....------------------------
PLAS_NOSS1/37-138.....KVPPHNVVFDA.........A-LN----------PAKSADLAKSL-SH...------------------------
PLAS_CUCSA/1-99.....AGFPHNVVFDE.........D-EI----------PSGVDSGKISM-NE...------------------------
AMCY_PARDE/43-131.....EAMPHNVHFVA.........G-VL----------..GEAALKGPM-MK...------------------------
PLAS2_ARATH/69-167.....AGYPHNVVFDE.........D-EI----------PSGVDVAKISM-DE...------------------------
AZUP_ACHCY/33-121.....TDKGHNVETIK.........G-MI----------PDGAEAFKSKI-N....------------------------
PLAS_SYNY3/31-126.....KLSPHNIVFAA.........D-G.----------..VDADTAAKL-SH...------------------------
AZUR_PSEFB/1-128GSLPKNVMGHNLVISKQADMQPIATD-GL----------SAGIDKNYLKE-GDTRV------------------------
PLAS_DAUCA/1-97.....AGFPHNIVFDE.........D-EV----------PAGVDVSKISQ-.....------------------------
PLAS_CHLRE/49-145.....AGFPHNIVFDE.........D-AI----------PSGVNADAISR-.....------------------------
AZUR_BORPE/22-149GKLPRNVMGHNWVLTKTADMQAVEKD-GI----------AAGLDNQYLKA-GDTRV------------------------
PLAS_VICFA/1-99.....AGFPHNVVFDE.........D-EI----------PSGVDAAKISM-PE...------------------------
AZUR_PSEAE/21-148GNLPKNVMGHNWVLSTAADMQGVVTD-GM----------ASGLDKDYLKP-DDSRV------------------------
HCY_NATPH/73-163....GDGGAHNVVSEP.........E-S.----------DFEFESDRVDE-E....------------------------
AZUR_ALCSP/1-128GKLAKNVMGHNWVLTKQADMQGAVND-GM----------AAGLDNNYVKK-DDARV------------------------
AZUR_PSECL/1-128GSLPKNVMGHNWVLSKSADMAGIATD-GM----------AAGIDKDYLKP-GDSRV------------------------
AZUR_ALCDE/21-148GKMAKVAMGHNWVLTKEADKQGVATD-GM----------NAGLAQDYVKA-GDTRV------------------------
H81_NEIGO/57-182GTQPKASMGHNLVIAKAEDMDGVFKD-GV----------GA.ADTDYVKP-DDARV------------------------
PLAS_ULVPR/2-98.....AGFPHNIVFDE.........D-AV----------PAGVDADAISA-.....------------------------
AZUR2_METJ/1-128GHMPKTGMGHNWVLAKSADVGDVAKE-GA----------HAGADNNFVTP-GDKRV------------------------
AMCY_PARVE/44-132.....EVMPHNVAFKK.........G-IV----------..GEDAFRGEM-MT...------------------------
PLAS_SOLLC/72-170.....AGFPHNVVFDE.........D-EI----------PAGVDASKISM-SE...------------------------
PLAS_HORVU/59-155.....AGYPHNVVFDE.........D-AV----------PSGVDVSKISQ-.....------------------------

PF13473

B3CV67_ORITI/16-120-------------------------D-DS..........V..EEFESRD.-....L------------------------
B5WRG9_9BURK/6-109-------------------------G-KG..........A..AEFESVQ.-....L------------------------
Q4ULV7_RICFE/15-124-------------------------D-DT..........V..EEFESHD.-....L------------------------
A9VLT2_BACWK/13-122-------------------------G-NR..........D..HTFTVKK.-....L------------------------
Y394_RICPR/15-123-------------------------D-DT..........I..EEFESHD.-....L------------------------
A8GXF3_RICB8/19-125-------------------------D-DT..........V..EEFESHD.-....L------------------------
B2JD79_BURP8/6-110-------------------------G-KG..........A..AEFESVE.-....L------------------------
A3P8U3_BURP0/8-112-------------------------D-AT..........P..AEFESDD.-....F------------------------
C7JG61_ACEP3/11-115-------------------------D-TT..........T..DEFESYD.-....M------------------------
D0P677_BRUSS/22-123-------------------------G-SM..........P..AEFESLE.-....L------------------------
B1FN56_9BURK/5-109-------------------------D-AT..........P..AEFESDD.-....F------------------------
B3Z7I0_BACCE/13-128-------------------------G-KS..........E..HTFTVKK.-....L------------------------
Q210L9_RHOPB/21-125-------------------------G-QE..........P..AEFESKE.-....L------------------------
Q7NZX4_CHRVO/5-110-------------------------G-KT..........P..AEFESTP.-....L------------------------
B4EUB3_PROMH/7-110-------------------------G-SS..........P..VEFESTQ.-....L------------------------
D8JYC6_HYPDA/23-127-------------------------D-PT..........P..EEFESND.-....I------------------------
B6XG39_9ENTR/6-110-------------------------G-TE..........P..AEFESLQ.-....L------------------------
Q1YSM9_9GAMM/7-113-------------------------D-PT..........P..EEFESYE.-....L------------------------
A0YB47_9GAMM/4-108-------------------------D-PT..........P..EEFESYE.-....L------------------------
B2IE20_BEII9/7-115-------------------------G-VT..........P..AEFESTE.-....L------------------------
Q11MW3_MESSB/9-113-------------------------G-LS..........P..VEFESLE.-....L------------------------
Q480M3_COLP3/12-116-------------------------D-AS..........V..EEFDSFS.-....L------------------------
D8JSD6_HYPDA/6-111-------------------------G-TT..........P..VEFESNE.-....L------------------------
Q2C9M1_9GAMM/6-110-------------------------G-DQ..........P..AEFESTQ.-....L------------------------
E3I4P1_RHOVT/6-110-------------------------G-TV..........P..AEFESYD.-....L------------------------
B5ZI01_GLUDA/5-109-------------------------D-DT..........V..DEFESYD.-....M------------------------
A5E8V2_BRASB/12-114-------------------------D-AK..........A..MEFESET.-....L------------------------
Q2L118_BORA1/3-106-------------------------S-NE..........P..VEFESIP.-....L------------------------
C0ZL71_BREBN/21-137-------------------------D-TR..........P..HNLSIRD.-....L------------------------
Q089I9_SHEFN/11-115-------------------------D-KAG........CS..ASLLFPD.-....L------------------------
Q1QPM6_NITHX/9-114-------------------------D-AK..........S..MEFESAS.-....L------------------------
A3WJP7_9GAMM/11-116-------------------------D-QS..........PCSETLLIPK.-....L------------------------
Q15U28_PSEA6/11-116-------------------------D-PA..........PCAETVIFPQ.-....L------------------------
C7RBS9_KANKD/11-116-------------------------D-QS..........PCSETLLIPK.-....L------------------------
Q3IJ88_PSEHT/11-116-------------------------D-SA..........PCSETVIFPQ.-....L------------------------
D1RR85_SEROD/12-118-------------------------S-QK..........N..VEWEILKG-V.MVV------------------------
A4Y220_SHEPC/12-115-------------------------D-KSG........CS..ATVLLPY.-....L------------------------
C4T4D8_YERIN/12-116-------------------------S-QK..........G..LEWEILKG-V.MVV------------------------
A4W945_ENT38/11-115-------------------------S-QK..........A..LEWEILKG-V.MVV------------------------
D4HVX9_ERWAC/11-115-------------------------S-QK..........G..LEWEILKG-V.MVV------------------------
B4WYZ8_9GAMM/12-118-------------------------D-PS..........PCAEQVIFQG.-....L------------------------
A3Y901_9GAMM/11-116-------------------------D-EA..........ACSQTLVIPD.-....L------------------------
C6D115_PAESJ/19-132-------------------------S-FT..........C.ITSVDSDD.-....L------------------------
A6X5Q9_OCHA4/30-135-------------------------S-DR..........T..VEWEILDG-V.MVL------------------------
B8G648_CHLAD/16-123-------------------------G-QV..........A..HSFTIELP-...AG------------------------
B8IQ01_METNO/8-113-------------------------S-RR..........V..LEWEILQG-T.LIV------------------------
B8ELX4_METSB/25-132-------------------------S-QR..........V..VEWEILDG-V.MVL------------------------
C4VLJ4_9LACO/14-121-------------------------D-ST..........ACLAEIKSGD.-....L------------------------
A9G130_SORC5/13-119-------------------------D-SGG........CT..KEIVFPS.-....L------------------------
D7V688_9LACO/12-124-------------------------D-ST..........ACLSHVVFEQ.-....L------------------------
C2HKM0_LACAI/12-124-------------------------D-ST..........ACLSHVVFEQ.-....L------------------------
D2ENS3_9STRE/12-122-------------------------D-PS..........PCLDQIVFPD.-....F------------------------
C2EV15_9LACO/12-122-------------------------D-ST..........ACLSHVVFDK.-....L------------------------
D0RSM9_9STRE/13-122-------------------------D-PS..........SCLAQVIFPD.-....F------------------------
B2GF85_LACF3/12-122-------------------------D-ST..........ACLSHIVFEQ.-....L------------------------
A1B2T7_PARDP/18-125-------------------------S-DR..........P..IEWEILNG-V.MVV------------------------
C0XM16_LACHI/13-122-------------------------D-ST..........ACLSHVVFEK.-....L------------------------
D3PXY6_STANL/11-120-------------------------G-KK..........V..TEFYVYAK-GDRVM------------------------
Q46BR6_METBF/35-147-------------------------K-AS..........V..VLVSADE.-....L------------------------
Q04BF3_LACDB/16-123-------------------------D-KT..........ACLSHVVFSS.-....L------------------------
A8UZZ4_9AQUI/6-124-------------------------D-EGIGDDYTEKYYG..HCFYILPP-..YDV------------------------
A7NN78_ROSCS/15-116-------------------------D-TR..........P..HRLRSVD.-....G------------------------

PF00116

COX2_NEUCR/114-238-------------------------D-VI-------------HSFAVPS------L------------------------
COX2_ALBTU/95-214-------------------------D-VI-------------HAWALPS------M------------------------
COX2_CHLAE/95-214-------------------------D-VL-------------HSWTIPT------L------------------------
COX2_BREAN/107-231-------------------------D-VM-------------HDFAMPS------L------------------------
COX2_ACHDO/95-213-------------------------D-VI-------------HSWTVSA------L------------------------
COX2_EMEND/114-237-------------------------D-VI-------------HSYACPS------L------------------------
COX2_BETVU/116-240-------------------------D-VL-------------HSWAVPS------S------------------------
COX2_ASCSU/98-217-------------------------D-VI-------------HSWALPS------M------------------------
COX2_PARLI/95-214-------------------------D-VL-------------HSWAVPS------L------------------------
COX2_EXERO/95-212-------------------------D-VI-------------HSWTVPS------L------------------------
COX2_PNECA/107-231-------------------------D-VL-------------HDFAVPS------L------------------------
COX2_ADABI/95-214-------------------------D-VI-------------HSWTIPS------S------------------------
COX2_ONCFA/95-214-------------------------D-VL-------------HSWAIPS------L------------------------
Q8ZXC2_PYRAE/67-155-------------------------D-VI-------------HGFQIVG------T------------------------
Q9XDX2_MAGMG/93-178-------------------------D-WQ-------------HGFSVQP------A------------------------
Q9YB77_AERPE/72-160-------------------------D-VI-------------HGFEIAG------T------------------------
COX2_PARDE/141-263-------------------------D-VI-------------HAWTIPA------F------------------------
COX2_FORLA/95-214-------------------------D-VL-------------HSWALPA------M------------------------
Q8XPI7_RALSO/39-125-------------------------D-IL-------------MGFSIPD------F------------------------
COX2_APILI/95-212-------------------------D-VI-------------HSWTVPS------L------------------------
COX2_CANGA/115-239-------------------------D-VI-------------HDFAIPS------L------------------------
COX2_SCHPO/111-235-------------------------D-VI-------------HSWAVPS------L------------------------
COX2_SYMST/95-214-------------------------D-VL-------------HSWTVPS------L------------------------
COX2_SITGR/95-214-------------------------D-VI-------------HSWTIPS------M------------------------
COX2_LASSP/94-213-------------------------D-VI-------------HSWTVPS------L------------------------
COX2_BALMU/95-214-------------------------D-VL-------------HSWAVPS------L------------------------
COX2_CTEFE/95-214-------------------------D-VL-------------HSWTIPS------L------------------------
O08448_NATPH/70-159-------------------------D-VI-------------HSFSVVG------T------------------------
COX2_PERAM/95-214-------------------------D-VL-------------HSWTIPS------L------------------------
COX2_LOCMI/95-214-------------------------D-VL-------------HSWAVPA------L------------------------
COX2_CHICK/94-213-------------------------D-VL-------------HSWAVPA------L------------------------
Q8L1B7_9PSED/541-631-------------------------D-VS-------------HGFVMTN------H------------------------

PF06525

A4YDJ8_METS5/12-195-----ESLQHNLLLVMNNTATPNAAD-LA-------------SDGKILLY-VGTTS------------------------
A4YEZ9_METS5/6-222-----EPTGHALAVVQNNTPIPNQLV-LS-------------QDGKVIFE-IGYNN------------------------
SOXE_SULAC/11-198-----ESLPHNLVLLQNSTPTPQSPE-IS-------------SDGKIIDI-VGATT------------------------
Q97UN1_SULSO/11-196-----QSLPHNLILLQNTTATPSNPD-VG-------------QFGKILYI-VGATT------------------------
Q4J829_SULAC/7-202-----ESLPHNANIVQNNTPIPNSIN-IS-------------SDGKIILY-VGDGP------------------------
Q97VW6_SULSO/21-249-----QSIPHNANIVLNDTQIPNNPN-IS-------------ADGKILLY-VGDSP------------------------

PF02298

O82081_ARATH/34-115-------------------------A-AF-------------HDVVEVT.-KPEFD------------------------
O82761_ARATH/37-119-------------------------K-DF-------------HDVTEVT.-HNDYE------------------------
NO16_MEDTR/36-121-------------------------N-ET-------------ESVHEVN.-EHDYI------------------------
O81500_ARATH/32-115-------------------------P-QF-------------HNVMRVT.-HPMYR------------------------
Q39040_ARATH/37-119-------------------------R-DQ-------------HNILEVN.-KADYE------------------------
NO552_SOYBN/38-124-------------------------K-RT-------------ESVHEGN.-ETDYE------------------------
BCP_PEA/35-116-------------------------A-GA-------------HTVDEVK.-ESDYK------------------------
O82083_ARATH/38-140-------------------------S-N.-------------HSVVQTYD-FKTYK------------------------
O48787_ARATH/37-119-------------------------K-DY-------------HDVTEVT.-HNDFE------------------------
STEL_TOXVR/11-97-------------------------R-RF-------------HNVDKVT.-QKNYQ------------------------
Q9ZNX8_TOBAC/35-119-------------------------K-..-------------DSVLVVT.-KEEYE------------------------
BABL_CUCSA/11-89-------------------------P-XM-------------HNVVVVN.-QGGFS------------------------
NO20_MEDTR/36-121-------------------------N-KT-------------ESVHEVE.-EEDYD------------------------
Q9ZRV5_CICAR/37-115-------------------------P-GA-------------HNVVAVS.-KAGYG------------------------
BCB2_ARATH/36-118-------------------------S-S.-------------HTVDVVD.-KAGYD------------------------
O82080_SPIOL/37-114-------------------------K-GQ-------------HNVVAVN.-GRGYA------------------------
MAVI_CUCPE/12-95-------------------------N-KF-------------HNVLQVD.-QEQFK------------------------
CPC_CUCSA/13-99-------------------------A-NA-------------HNVHEMET-KQSFD------------------------
BABL_ARATH/44-122-------------------------P-RM-------------HNVVKVD.-SGSYN------------------------
MPAA3_AMBEL/14-92-------------------------T-GE-------------DSVAEVWR-EEAYH------------------------
BCB1_ARATH/33-117-------------------------A-GR-------------HDVAVVS.-EAAFE------------------------
O04596_ARATH/250-336-------------------------N-EV-------------NDVLEISG-DLEFI------------------------
Q9ZTU7_WHEAT/34-115-------------------------S-AA-------------HDVVEVS.-KAGYD------------------------
Q96316_ARATH/32-112-------------------------.-LS-------------HSVSVVD.-KAGYD------------------------
LAML_ARATH/37-119-------------------------R-NQ-------------HNILEVN.-KTDYE------------------------
O82227_ARATH/36-122-------------------------S-KI-------------DSVLQVT.-KENYE------------------------

PF00812

EFNB1_XENLA/20-159.....QPYEYYKLYMVRRDQLEACST.VI-------------DPNVLVTC-NQPGK..----------------------
EFNB2_MOUSE/28-169...TVGQYEYYKVYMVDKDQADRCTI.KK-------------ENTPLLNC-ARPDQ..----------------------
EFNA5_CHICK/26-164....EDKTERYVLYMVNFDGYSSCDH.IS-------------KGFKRWEC-NRPHSPN----------------------
O93431_DANRE/17-155...ASQEAERYVLYMVELEDYENCKP.HS-------------FDQLRWEC-SRPFAPH----------------------
EFNA3_HUMAN/27-171GPGPGGGAEQYVLYMVSRNGYRTCN..AS-------------QGFKRWEC-NRPHAPH----------------------
EFNA1_XENLA/25-163...AGHTVERYTLFLVDYEEYETCKP.KS-------------KDQVRWEC-NKPFAPH----------------------
EFNA1_HUMAN/15-153...ADAAMEQYILYLVEHEEYQLCQP.QS-------------KDQVRWQC-NRPSAKH----------------------
EFNA4_MOUSE/22-160....PEGPETFALYMVDWSGYEACTAEGA-------------NAFQRWNC-SMPFAPF----------------------
EFNB1_RAT/27-166...AGRPYEYYKLYLVRPEQAAACST.VL-------------DPNVLVTC-NKPQQ..----------------------
EFNB2_DANRE/22-163...SMEGVEYYKLYMVPLEQLKSCQV.TK-------------ADTPLLNC-VKPDQ..----------------------
EFNA2_CHICK/25-163....AERMERYVLYMVNYEGHASCDH.RQ-------------KGFKRWEC-NRPDSPS----------------------
EFNB3_HUMAN/25-169...SSPNYEFYKLYLVGGAQGRRCEA.PP-------------APNLLLTC-DRPDL..----------------------
EFN4_CAEEL/17-180....RNDGEYLIVYEVTEFAMDDCAL.ES-------------HSREVIRC-APEGTAE----------------------
EFNA2_DANRE/21-159....HSRMERYILFMVNHDGYLTCEH.RM-------------RGFKRWEC-NRPQSPD----------------------

PF07732

Q9P8C3_9HYPO/104-220-----KA...TV----------------------------E.SSIHLHGS-FSRAP..------...W------------
Q9P861_BLAAD/25-143-----DM..PDR----------------------------N.ASIHFHGM-YQNGTNY------MDGP------------
Q9UVW1_ASPFM/25-141-----HL...PF----------------------------N.TSIHFHGI-EQKNTPW------ADGV------------
Q9UVV2_ASPFM/26-143-----GL..GNQ----------------------------S.TGIHWHGF-HQYMTGT------MDGS------------
Q19687_CAEEL/100-218-----QI..LMD----------------------------S.MTIHVHGI-DKHGMWY------MDGV------------
MCO_STAES/58-173-----NL...DE----------------------------N.TTFHWHGL-EINGK..------...V------------
LAC1_EMENI/28-145-----NL...PF----------------------------N.TTVHWHGL-EMRETPE------ADGV------------
LAC4_ORYSJ/36-152-----NV...AH----------------------------N.ISLHWHGV-RQVRTGW------ADGP------------
Q7S4C0_NEUCR/80-197-----NL..KSN----------------------------G.TGIHWHGL-RQSGSNI------YDGV------------
LAC10_ARATH/30-146-----NV...KY----------------------------N.VSIHWHGI-RQLRTGW------ADGP------------
Q7RX46_NEUCR/32-148-----NA...RL----------------------------A.NSVHLHGS-YSRAP..------...F------------
Q7S6W1_NEUCR/62-171-----KL..LYN----------------------------G.TSIHWHGL-QMEDNNI------NDGV------------
Q7PNZ9_ANOGA/51-163-----RI..PGE----------------------------S.ITLHWTGQ-SQRRTPF------MDGV------------
Q8RMC6_9ACTO/88-204-----RI...TT----------------------------G.TSMHLHGA-VVDPA..------...N------------
BLRO_MYRVE/82-198-----NA...EA----------------------------P.NSVHLHGS-FSRAA..------...F------------
Q38757_ACEPS/31-147-----QG...TY----------------------------G.ITIHWHGV-KMPRNPW------SDGP------------
Q7VPL4_HAEDU/53-170-----NL...SQ----------------------------E.VAMNIQGL-LASTN..------...M------------
Q7NRY4_CHRVO/82-200-----RL...PQ----------------------------P.TTVHWHGL-PIPSD..------...Q------------
LAC2_ARATH/35-151-----HV...SN----------------------------N.ISIHWHGI-RQLRSGW------ADGP------------
O23170_ARATH/36-152-----KL...DE----------------------------P.FLITWNGV-KQRRTSW------QDGV------------
Q9LX04_ORYSJ/32-148-----SL...DE----------------------------P.LLITWDGI-QQRKNCW------QDGV------------
Q9AUI1_PINTA/41-156-----HV...KD----------------------------N.VTIHWHGV-RQLRSGW------ADGP------------
Q8RQE2_9LACT/61-172-----KS...ST----------------------------T.TNVHWHGL-SIPNN..------....------------
Q9SMW3_ARATH/31-147-----HL...DE----------------------------P.FLLTWSGI-QHRKNCW------QDGV------------
Q8LFM3_ARATH/42-158-----KL...DQ----------------------------P.FLLTWNGI-KQRKNSW------QDGV------------
Q98FW8_RHILO/79-198-----RI..ANE----------------------------A.STIHWHGM-PVPAD..------...Q------------
FTSP_PASMU/54-168-----NL...PQ----------------------------G.VSMSIQGL-QASGE..------...L------------
Q8TFE2_9PEZI/64-183-----RL..RTN----------------------------G.TSMHWHGV-RMLNNNP------NDGA------------
Q8TFD9_GAEGR/75-195-----KLTQSIN----------------------------G.TSVHWHGL-HQKDTVL------SDGV------------
Q00292_ASPTE/65-183-----NLT.NGN----------------------------G.TAVHWHGI-RLFETNW------IDGV------------
Q84ZL7_ORYSJ/38-154-----NL...DE----------------------------P.LLLTWDGI-QMRMNSW------QDGV------------
Q7W3D4_BORPA/52-166-----RL...DE----------------------------D.TSIHWHGI-LLPTG..------MDGV------------
FTSP_HAEIN/51-168-----NL...PQ----------------------------S.VALSIQGL-QASGE..------...L------------
Q9CJQ6_PASMU/79-197-----HL...PQ----------------------------P.STVHWHGL-DVPNE..------...A------------
Q8TFE1_GAEGR/83-200-----NM..KTN----------------------------G.TSIHWHGL-HQRGSVE------YDGV------------
FTSP_PHOLL/52-169-----RL...AE----------------------------P.VSMTVSGL-QLPGT..------...L------------
Q94ID0_TOXVR/9-125-----QG...KY----------------------------G.LTIHWHGV-KQPRNPW------SDGP------------
Q9AUI6_PINTA/39-155-----HV...KD----------------------------N.VSIHWHGI-RQLRSGW------ADGP------------
Q7SDL8_NEUCR/27-146-----NISSPEE----------------------------G.TAMHWHGF-LQDDTPW------DDGA------------
Q8H6A0_LOLPR/37-153-----HV...AH----------------------------N.MTLHWHGI-RQLRSGW------ADGP------------
Q9SUD0_ARATH/33-149-----DL...DD----------------------------P.FLLSWNGV-HMRKNSY------QDGV------------
CUEO_YERPE/53-168-----AL...PE----------------------------A.TTVHWHGL-EIPGE..------...V------------
Q9ZQW3_POPTR/30-146-----QV...QY----------------------------N.VTVHWHGV-SSCFTGW------ADGP------------
Q875H3_PHACH/52-169-----RI...QN----------------------------A.TTIHWHGI-PQNGTAY------YDGT------------
Q9VX11_DROME/122-239-----SM...HE----------------------------T.TTIHWHGM-HQRLTPF------MDGV------------
O24042_LIRTU/42-158-----HV...QN----------------------------N.ITLHWHGV-RQLRSGW------ADGP------------
Q8L3Q4_ORYSJ/49-161-----DL...DE----------------------------P.LLITWNGI-QHRKNCW------QDGV------------
Q9VBK7_DROME/139-256-----YL...SE----------------------------P.TTMHWHGV-HMHRTPE------MDGA------------
O04947_ARATH/22-139-----KL..TTE----------------------------G.LVIHWHGI-RQFGSPW------ADGA------------
Q8YCF0_BRUME/28-145-----AM...DE----------------------------E.TTLHWHGL-FVPSH..------...L------------
Q7S9Z8_NEUCR/154-264-----NL..RWN----------------------------G.TSVHWHGF-RQFESFH------MDGV------------
LAC5_ARATH/34-150-----RA...RY----------------------------N.ITIHWHGV-RQMRTGW------ADGP------------
Q9SFF1_ARATH/34-150-----HL...DE----------------------------P.FLLSWNGI-RNWKNSF------QDGV------------
Q82JK0_STRAW/63-180-----SL...DA----------------------------D.TTVHFHGA-HIPPK..------...M------------
O04870_SOLLC/10-126-----SL...DE----------------------------P.FLLSWNGI-QNRRNSF------VDGV------------
O24041_LIRTU/32-148-----NV...QN----------------------------N.VTVHWHGI-RQLQNGW------ADGP------------
Q8I8Y1_MANSE/186-304-----DL..MTE----------------------------G.TTVHWHGQ-HQRGTPY------MDGT------------
LAC1_CRYPA/73-193-----NL..KYN----------------------------G.TTIHWHGI-RQLNTNL------QDGV------------
Q9A9L6_CAUCR/56-170-----TL...DE----------------------------D.TSIHWHGL-LVPFQ..------MDGV------------
Q7XSQ1_ORYSJ/36-152-----RL...SE----------------------------P.FLLSWNGL-QHRKNSW------QDGV------------
LAC9_ARATH/33-149-----KS...TY----------------------------N.VTIHWHGV-FQLKSVW------MDGA------------
Q8W0V4_LOLPR/45-161-----SS...PY----------------------------N.LTIHWHGI-MQLRTPW------ADGP------------
FET3_CANGA/25-144-----GF...NN----------------------------TNTSLHFHGM-FQRGTNQ------MDGV------------
LAC4_ARATH/32-148-----HV...KY----------------------------N.VSIHWHGV-RQVRTGW------ADGP------------
Q9R9E7_PSESX/50-164-----NV...RD----------------------------H.TSIHWHGI-ILPPN..------MDGV------------
Q9X3V2_PSEPU/46-162-----HL...PV----------------------------E.TTIHWHGI-RLPLE..------MDGV------------
COPA_PSESM/50-164-----RL...DE----------------------------T.TSIHWHGI-ILPAN..------MDGV------------
Q9AUI4_PINTA/36-152-----HV...KD----------------------------N.VTIHWHGI-RQIRSAW------ADGP------------
Q7S1M8_NEUCR/27-114-----....PIS----------------------------S.TSIHYHGL-RMLNANT------QDGV------------
Q9L914_9GAMM/58-175-----KL...SE----------------------------T.TSIHWHGI-ILPFE..------MDGV------------
A9CFX2_AGRT5/76-193-----KL...PE----------------------------H.TTIHWHGM-ILPSG..------MDGV------------
Q9AUI0_PINTA/32-148-----HV...TY----------------------------N.VSIHWHGI-RQLRTGW------ADGP------------
LAC6_ARATH/37-153-----MT...PY----------------------------N.TTIHWHGI-KQKRSCW------YDGP------------
Q87F38_XYLFT/61-176-----TL...PD----------------------------VMTSIHWHGI-VLPSN..------MDGV------------
Q7N890_PHOLL/51-168-----HL...PE----------------------------E.STVHWHGL-EITGE..------...A------------
Q8RNQ3_LEGPN/119-233-----HL...DE----------------------------G.TSIHWHGL-LVPWQ..------MDGV------------
O42702_9ASCO/36-154-----DL..EQE----------------------------N.LTMHWHGL-AQRMAIF------ADGS------------
FTSP_ECOLI/51-168-----RL...TE----------------------------N.VSMTVAGL-QVPGP..------...L------------
LAC2_PODAS/85-205-----NL..RTN----------------------------G.TSIHWHGL-HQKGTNM------HDGA------------
O24093_MEDTR/31-148-----KL..HTE----------------------------G.TVIHWHGI-RQFGTPW------ADGT------------
Q8L4Y3_SOYBN/42-158-----KA...RY----------------------------N.VTIHWHGV-RQMRTGW------ADGP------------
ASOL_TOBAC/31-147-----NL...DE----------------------------P.FLFTWNGV-QHRKNSW------QDGT------------
Q8L8N6_ARATH/32-148-----NL...PE----------------------------P.FLMTWNGL-QLRKNSW------QDGV------------
O65449_ARATH/31-147-----YL...KE----------------------------P.FLISWNGV-QQRKNSW------QDGV------------
Q82XJ1_NITEU/53-167-----HL...DE----------------------------T.SSIHWHGI-LLPPE..------MDGV------------
Q942J6_ORYSJ/33-149-----QL...DH----------------------------P.LLFNWHGI-QQRKNSW------MDGM------------
Q9VLC3_DROME/283-401-----HL..LGE----------------------------S.TSIHWHGL-HQKKTPY------MDGV------------
Q8S2A8_ORYSJ/35-151-----HS...PY----------------------------N.MSIHWHGI-RQLRSGW------ADGP------------
SKU5_ARATH/30-146-----KL...DE----------------------------G.LLLHWNGI-QQRRVSW------QDGV------------
CUEO_SALTI/53-167-----QL...AE----------------------------D.TTLHWHGL-EIPGI..------...V------------
Q9LV68_ARATH/34-150-----NL...DE----------------------------P.LLLTWNGI-QHRKNSW------QDGV------------
LAC1_NEUCR/91-211-----KL..KSN----------------------------G.TSIHWHGM-HQRNSNI------QDGV------------
Q9ZQW2_POPTR/41-157-----HV...AE----------------------------N.ITIHWHGV-RQLTTGW------ADGP------------
FIO1_SCHPO/30-151-----SLA.NNR----------------------------T.TSLHSHGL-FQKFTPY------MDGV------------
Q8W0V5_LOLPR/30-146-----QS...PF----------------------------G.VTIHWHGV-KQRLTCW------ADGA------------
LAC17_ARATH/30-146-----QV...PN----------------------------N.ISLHWHGI-RQLRSGW------ADGP------------
LAC11_ARATH/31-147-----HV...QY----------------------------N.MSIHWHGL-KQYRNGW------ADGP------------
LAC7_ARATH/31-147-----HS...PH----------------------------N.ITIHWHGI-FHKLTVW------ADGP------------
LAC3_ORYSJ/32-148-----HA...QY----------------------------N.VTIHWHGI-RQFRTGW------ADGP------------
LAC3_ARATH/33-149-----RA...RY----------------------------N.ISIHWHGI-RQLRNPW------ADGP------------
Q93M03_STRAU/64-181-----EL...QV----------------------------N.TAVHLHGA-HVLSE..------...H------------
CUEO_ECOLI/51-167-----QL...TE----------------------------E.TTLHWHGL-EVPGE..------...V------------
LAC14_ARATH/41-157-----NA...NY----------------------------N.ITLHWHGA-RQIRNPW------SDGP------------
Q8X010_NEUCS/27-145-----SL...GD----------------------------EDTSLHFHGL-FMNGSNH------MDGP------------
PCOA_ECOLX/50-164-----RL...NE----------------------------Q.TSIHWHGI-ILPAN..------MDGV------------
Q9C497_GLOLA/74-192-----QL..ADN----------------------------G.TSIHWHGM-HQRNSND------QDGA------------
LAC2_ORYSJ/34-150-----HV...KH----------------------------N.MTIHWHGL-KQRRNGW------ADGP------------
Q9SDV9_BRAJU/30-147-----KL..STE----------------------------G.VVIHWHGI-RQNGTPW------ADGA------------
LAC15_ARATH/27-143-----RA...SE----------------------------N.ITMHWHGV-EQPRNPW------SDGP------------
Q96VT5_EMEND/39-149-----EM...PF----------------------------S.TTVHFHG.-....TPW------SDGV------------
Q8ZWA8_PYRAE/48-158-----KL...TE----------------------------P.TIVHWHGF-DVNWH..------...N------------
Q8PCX4_XANCP/56-171-----AL...AD----------------------------QFTSVHWHGL-LLPAN..------MDGV------------
Q9M5B5_CUCME/45-162-----KL..STE----------------------------D.VVIHWHGI-LQKGTPW------ADGT------------
Q8XS25_RALSO/63-177-----RL...RE----------------------------P.TSIHWHGI-LLPFQ..------MDGV------------
Q7MGM1_VIBVY/42-159-----KL...NE----------------------------P.TTIHWHGL-RVPIE..------MDGV------------
SKS1_ARATH/34-150-----HL...DE----------------------------P.LLLTWPGI-QMRRNSW------QDGV------------
Q8NK87_CANAX/29-147-----GF...DN----------------------------LNTTLHFHGL-FQNGTNQ------MDGP------------
Q989B7_RHILO/43-161-----AI...DD----------------------------P.TTIHWHGI-RLPNK..------MDGV------------
Q7XIF0_ORYSJ/35-152-----NL...DE----------------------------P.FLLTWNGI-KQRKNSW------QDGV------------
Q9AUI3_PINTA/36-152-----NA...QY----------------------------N.ATIHWHGV-RQFRTGW------SDGP------------
LAC2_BOTFU/74-191-----NL..QHN----------------------------G.TSIHWHGI-RQLGSLE------YDGV------------

PF07731

Q9P861_BLAAD/361-500.....ND---AG..............-.............F-HPFHLHGH-EFQVVER------SPEYEGFVPYN.....
Q9UVV2_ASPFM/370-504.....HH---GN..............-.............L-HPWHMHGH-QFQVLQR------TIPEGGYF........
Q9UVW1_ASPFM/438-575.....VV---SETTP...........-..........IQPP-HPLHKHSN-KGFLLGT------GHGKFNWTSIK.....
Q93F47_9PSED/243-350.....MA---QY..............-.............L-HPVHLHGM-SFKVISS------DRKKI...........
Q96UP8_GIBIN/312-437.....AP---SLDRIGTN........-.......KTFRSLA-HPLHLHGH-DFALLAQ------GTNSSQIND.......
Q9P8C3_9HYPO/398-542.......---................-.............T-HPIHIHLV-DFKILSR------TGAATGAT........
Q96V70_GIBIN/302-411.....KT---PV..............-.............A-HPMHLHGF-NMYVLHE------GPGSW...........
Q7S065_NEUCR/364-497.....QE---AA..............-.............G-HPFHLHGH-SFQILDR------ARPYAGDW........
Q7S4C0_NEUCR/422-556.....VI---QDQSN...........-..........LGLE-HPIHLHGH-DFWILDQ------STGTFDAA........
Q7S6W1_NEUCR/414-557.....NK---SK..............-............IP-HPMHLHGH-DFVIVGR------SPAPDGPGLSDAMMP.
LAC15_ARATH/408-547...SLVG---GG..............-............LD-HPMHLHGF-SFYVVGV------GFGNYNISE.......
Q7RX46_NEUCR/320-463.......---................-.............T-HPIHIHLV-DFRVKKR------VNGK............
Q9C1Z1_PICPA/365-505.....LD---TG..............-.............K-HPFHLHGH-VFQTVVR------GPDYGEESTPV.....
LAC1_ARATH/429-565...SFLN---IE..............-.............N-HPLHVHGH-NFFVVGR------GFGNFDPE........
PHSA_STRAT/471-624.....LS---PI..............-.............L-HPMHIHLA-DFQVLGR------DAYDASGFDLALGGTR
FIO1_SCHPO/364-501.....HD---TG..............-.............K-HPFHLHGH-TFQVLER------GEENAGLYS.......
Q8TFD9_GAEGR/415-543.....TD---FG..............-............VA-HPIHLHGH-DYSVLAQ------GSGAYQPG........
Q7SDL8_NEUCR/387-512.....KG---PG..............-.............P-HPMHLHGY-NFYVLSS------GPGDWDGK........
Q8VYB3_ARATH/384-525.....RE---KI..............-.............V-QSYHLDGY-SFWVVGT------DRGTWSKA........
Q8NID5_9APHY/368-496.....TA---TNAP............-...........GAP-HPFHLHGH-TFYVVRS------AGQTDY..........
Q7XIF0_ORYSJ/383-523.....TE---NE..............-.............L-QSWHLDGY-DFWVVGY------GNGQWTEN........
Q8CXJ7_OCEIH/350-508.......---................-.............T-HPIHLHLV-QFQVLDR------QPFDLEKYNEDGS...
Q8I8Y1_MANSE/570-726.....EG---VTF.............-...........DAN-HPFHLHGH-SFRVVGL------RRLNRTTTIEEIK...
Q8NK87_CANAX/361-501.....LD---TG..............-.............K-HPFHLHGH-AFQLIER------HKEIPEGEDPV.....
Q00292_ASPTE/424-564.....NY---SLEDVVTP........-.......RNLTPSV-HPIHLHGH-DFAILAQ------GKGPFTPD........
LAC6_ARATH/417-553...GTLT---TE..............-.............N-HPIHLHGH-SFYVIGY------GTGNYDQQ........
Q7NRY4_CHRVO/360-497.......---................-.............D-HPFHLHGT-QFQVTER------HDGKGW..........
LAC1_AGABI/371-491.....EG---................-.............A-HPFHLHGH-NFDVVLA------SNDDTF..........
Q9ZQW5_POPTR/254-388...GIIS---PE..............-.............N-HPIHLHGF-NFFAVGR------GVGNYNPK........
Q804X3_CHICK/941-1065.....MG---STE.............-............DI-HSVHFHGQ-MFSIRTS------QEYR............
O65449_ARATH/375-516.....WE---NS..............-.............V-QSWHVSGY-SFFVVGM------DGGQWTPG........
Q9LQT5_ARATH/347-487.....PL---FG..............-.............L-ESYHIDGY-NFFVVGY------GFGAWSES........
Q90ZT2_DANRE/489-613.....LG---NEV.............-............DI-HTAHFHGH-SFDYKVS------GTHR............
BLRO_MYRVE/371-515.......---................-.............T-HPIHIHLV-DFKVISR------TSGNNAR.........
LAC3_ARATH/419-554...SIVT---PE..............-.............N-HPMHLHGY-QFYVVGS------GFGNFNPR........
SKS1_ARATH/397-536.....ND---TK..............-.............I-QSFHVDGY-SFFVVGM------DFGIWSED........
Q82JK0_STRAW/341-480.......---................-.............E-HSFHLHDV-PFQLISI------NGEEP...........
Q7MGM1_VIBVY/340-461.....VT---QY..............-.............H-HPIHLHGH-TFTVLEL------NGQT............
Q9SFF1_ARATH/376-516.....SE---DI..............-.............V-QSWHLDGY-SFYVVGM------ELGKWSPA........
Q8XX19_RALSO/116-246MIMRPDL---FE..............-.............R-HTVHFHGY-PNASSFY------DGVP............
LAC7_ARATH/412-551...ALIA---AE..............-.............S-HPMHLHGF-NFHVLAQ------GFGNYDPS........
Q9ZVV3_ARATH/388-531.....HE---KT..............-.............M-QSFHLDGY-SFFAVAS------EPGRWTPE........
Q9UVT5_LENED/376-499.......---NATP............-...........GGP-HPFHLHGH-SFDVVRS------ADNTTY..........
Q7S2V2_NEUCR/516-661.....HP---TDFIHMVIDGSLLPST-NQTDLDPDVIPLLA-HPMHWHGS-DVVLLAQ------SEQPFDPA........
SKU5_ARATH/394-533.....ND---TK..............-.............M-QSYHMSGY-AFFVVGM------DYGEWTEN........
Q7RYF6_NEUCR/414-556.....NN---SP..............-............SP-HPMHLHGH-DFLILGR------SRFPANPLVDPGQP..
Q8J0L7_CLAPU/359-497.....LD---SG..............-.............R-HPFHLHGH-SFQAIYR------SNESAGTWEA......
Q8RNQ3_LEGPN/688-807.....NS---MM..............-.............R-HPMHIHGH-WFILRNG------HGAY............
LAC2_ORYSJ/411-546...NLLS---VE..............-.............S-HPFHLHGY-NFFVVGR------GVGNFDPA........
LAC1_THACU/419-544.....NS---GIP.............-............IT-HPVHLHGH-TWDVVQF------GNNPP...........
FET3_CANAX/362-502.....FD---TG..............-.............K-HPFHLHGH-VFQLIER------HEAIGSKESAV.....
O24041_LIRTU/420-554...SILG---ME..............-.............S-HLLHLHGY-NFFVVGQ------GFGNFDPD........
O68054_RHOCA/369-490.....MS---MM..............-.............A-HPMHLHGH-VFQVIAV------NGTR............
Q9VX11_DROME/473-628.....LS---QT..............-.............P-HPIHLHGY-TFRVVGM------GVLGEQKIGQIE....
Q9FSC9_POPTR/404-539...TIIA---PE..............-.............S-HPFHLHGF-NFFVVGK------GIGNFDPD........
LAC2_BOTFU/413-547.....VI---EDLTG...........-..........FGIW-HPIHLHGH-DFYVVAQ------ETDVFSAT........
Q93HV5_STRGR/170-308.....HG---EF..............-.............Y-HTFHIHGH-RWADNRT------GILTGPDD........
Q8GB87_STRLA/454-610.....LA---VNP.............-...........PVV-HPMHIHLA-DFQILGR------DTYDVSGFDVTAGGTR
E9ACP0_LEIMA/403-552.......---................-.............P-HPLHFHVN-HFQFLSF------EPRPGGNHE.......
LAC4_TRAVI/366-494.....TA---TNAP............-...........GAP-HPFHLHGH-TFSIVRT------AGSTDT..........
Q9P8G4_9APHY/369-494.......---GGVL............-...........GGP-HPFHLHGH-AFSVVRS------AGSSVY..........
Q87F38_XYLFT/490-609.....DT---MM..............-.............A-HPIHLHGL-WSDLEDA------NAAF............
FTSP_PHOLL/334-472.......---................-.............P-QPFHIEGV-QFKLINH------NGEAP...........
Q8WZH9_LENED/381-493.......---NATP............-...........GGP-HPFHLHGH-SFDVVRS------ADNTTY..........
Q9CJQ6_PASMU/378-515.......---................-.............D-HPFHLHGT-QFEVIQH------TLNGKT..........
O53858_MYCTU/384-503.....TT---MM..............-.............Y-HPIHLHGH-TFQMIKA------DGSP............
LAC9_ARATH/411-552...GILT---PE..............-.............S-HPMHLHGF-NFYVLGY------GFGNYDPI........
Q96VT5_EMEND/456-583.....AN---AIQ.............-............PP-HPIHKHSN-KFYVLGG------GNGKWNYTSVAE....
COPA_PSEUB/489-608.....DT---MM..............-.............T-HPIHLHGM-WSDLEDE------DGNF............
O23170_ARATH/380-520.....DE---RS..............-.............I-QSWHMDGT-SAYAVGY------GSGTWNVT........
Q8GP36_CORDP/379-493.....RT---MM..............-.............P-HPMHIHGH-TWALPGS------GGLR............
Q942J6_ORYSJ/381-524.....PE---KS..............-.............I-DSFHINGY-AFFAAGM------GPGIWTPE........
FET3_YEAST/362-504.....QD---TG..............-.............T-HPFHLHGH-AFQTIQR------DRTYDDALGEVP....
FET5_YEAST/367-517.....YD---SG..............-.............R-HPFHLHGH-NFQIVQK------SPGFHVDEAYDESEQD
Q89KF9_BRAJA/312-434.....PA---PL..............-.............T-AVFHLHGH-PFRLLDK------LDDG............
Q9LV68_ARATH/382-521.....SD---TT..............-.............V-KSYHLDGY-AFFVVGM------DFGLWTEN........
O60199_PLEOS/365-491.......---ALVF............-...........AGP-HPIHLHGH-TFAVVRS------AGSSTY..........
Q7X4G1_XANEU/217-341.....LT---MT..............-.............N-HPMHLHGH-EFVVTGT------DGGPT...........
Q7Z8S2_PLESA/371-496.......---ALAI............-...........GGP-HPIHLHGH-AFDVVRS------AGSSTY..........
O13420_9APHY/364-493.....AT---TLAP............-...........GAP-HPFHLHGH-VFAVVRS------AGSTAY..........
O67206_AQUAE/387-526.......---................-.............Y-HPMHIHGF-QFQVLER------SLGPL...........
Q96TR4_PLEOS/372-492.....AG---................-.............A-HPFHLHGH-TFDIVRT------SNSDVV..........
Q8I8Y0_MANSE/577-738.....EV---QIT.............-...........NLS-HPFHLHGY-AYNVIGI------GRSPDQNVKKINLKHA
Q9VBK7_DROME/508-666.....YL---DS..............-.............T-HPFHIHGF-TFRLVGQ------GVLGNLNDLRNIQE..
Q84ZL7_ORYSJ/403-540.....ND---TG..............-.............V-QTYHLDGY-SFFVVGM------DNGDWTPD........
O74171_SCHCO/363-488.......---GGSA............-...........GAP-HPFHLHGH-TFDVVRS------AGSTDY..........
LAC2_PODAS/426-569.....ND---PTGP............-..........FSIP-HPMHLHGH-DFLVVGR------SPDQPAGVPQTRY...
O59944_CERSU/368-493.......---GNII............-...........AGP-HPFHLHGH-TFSVIRS------AGQSDY..........
Q94ID0_TOXVR/389-516...NLGA---AT..............-.............S-HPMHLHGF-NFYLVGT------GAGTFNNV........
Q8XS25_RALSO/486-605.....DT---MM..............-.............T-HPMHLHGM-WSELEAP------DGRF............
Q7S9Z8_NEUCR/523-687.....TS---NPDDDKWIWMVITAPD-KVPTEGARIFFPAA-HPIHLHGH-DFAVLRQ------SSKNWYDDPEIGHIGE
Q8X010_NEUCS/358-513.....LD---SG..............-.............R-HPFHLHGH-QFQILHR------SGADEGTWSPSSSSS.
Q7N890_PHOLL/374-513.......---................-.............L-HPFHIHGA-RFRILSE------NGRKP...........
Q84SA8_ASTTR/257-395...ALIG---VE..............-.............N-HPMHLHGF-NFYVLAQ------GFGNYNAT........
Q8X1W2_LENED/396-521.......---GDAP............-...........AGP-HPFHLHGH-AFDVVRT------SDSSEY..........
FET3_CANGA/362-504.....QD---TG..............-.............K-HPFHLHGH-VFQTILR------DREFDDAKGEKP....
ASOL_TOBAC/383-524.....HE---KT..............-.............I-RTYHLDGY-SFFAVAV------EPGRWSPE........
Q9C497_GLOLA/416-556.....NT---GA..............-............LP-HPIHLHGH-DFLLLGI------GDGKFSNSSSTNGT..
Q8YQ92_NOSS1/200-332.....II---EYD.............-............PA-VTFHLHAN-FFDVYRY------GMSM............
Q7NG83_GLOVI/190-322.....MI---EWD.............-............AA-VTFHLHAN-FFKLLRS------GRAL............
LAC2_ARATH/423-557...SILG---IE..............-.............A-HPIHLHGF-NFYVVGQ------GFGNFNPA........
Q9A9L6_CAUCR/444-566.....DT---MM..............-.............A-HPIHLHGH-FFELVNG------QERQ............
Q9AUI3_PINTA/418-554...NIFA---GE..............-.............S-HPIHLHGY-DFYIVGS------GFGNYNPK........
Q9FKY9_ARATH/382-522.....NE---KS..............-.............M-QSWHLDGY-DFWVVGF------GSGQWTPA........
CUEO_YERPE/393-532.......---................-.............L-HPFHVHGT-QFRILTE------NGKPP...........
Q8TFE2_9PEZI/409-548.....NP---TV..............-............AP-HPMHLHGH-DFYLLGR------SPAQTNPFAGPVR...
Q7S1M8_NEUCR/347-488.....NN---SP..............-............IP-HPIHLHGH-DVMILGS------SPPLADPLAETQIR..
Q8YCF0_BRUME/358-494.......---................-.............A-HPFHIHGA-SFRILSM------NGKKP...........
FTSP_SALTI/333-470.......---................-.............P-QSFHIEGV-SFLIRNV------NGAMP...........
Q9AUI1_PINTA/428-562...SIAG---TV..............-.............S-HPFHLHGF-NFFVVGQ------GVGNYNES........
LAC4_THACU/380-502.....GA---................-.............D-HPIHLHGH-VFDIVKS------LGGTP...........
LAC14_ARATH/420-553...TVWA---SN..............-.............I-HPIHLHGY-NFYVVGS------GFGNFDRR........
LAC3_ORYSJ/415-551...SIVS---PE..............-.............N-HPIHIHGY-DFYILAE------GFGNFDPK........
O04870_SOLLC/354-493.....NE---DI..............-.............V-QSWHLDGY-SFWVVGM------DGGQWTQA........
Q9X8C0_STRCO/91-236.......---................-.............Q-HPLHIHVN-PFQVIDV------KGIPPRD.........
Q9LX04_ORYSJ/396-535.....ND---TK..............-.............V-QTYHIDGY-AFWVVGM------DYGEWTEN........
Q9Y781_COPCI/368-493.......---GGST............-...........GSP-HPFHLHGH-EFAVVRS------AGSSTY..........
COTA_BACSU/354-512.......---................-.............T-HPIHLHLV-SFRVLDR------RPFDIARYQESGE...
Q82XJ1_NITEU/485-608.....DT---MM..............-.............E-HTMHLHGT-WMYLENG------AGAY............
Q8W0V5_LOLPR/411-556...TLME---DS..............-.............P-NPMHLHGH-DFFVLAQ------GIGNYDAA........
A9CFX2_AGRT5/212-336.....LT---MT..............-.............N-HPIHMHGY-DFEVTCT------DGGWV...........
Q89T40_BRAJA/212-336.....LS---MT..............-.............N-HPIHLHGH-SFAVTCT------DGGWI...........
Q7W3D4_BORPA/466-585.....DT---MM..............-.............T-HPIHLHGL-WSDLESP------DGNF............
LAC1_NEUCR/427-569.....ND---PDGA............-..........FSLP-HPIHLHGH-DFLILGR------SPDVTAISQTRYV...
Q875H3_PHACH/405-542.....ND---NG..............-.............D-HPFHLHGY-SPWMIGV------GDSPYDPN........
Q875H1_COPCO/371-497.......---GGGA............-...........GSP-HPMHLHGH-MFSVIRS------ASNSTP..........
Q8FQU9_COREF/414-557.......---................-.............P-HNFHIHNS-RFKVLSM------TGTDI...........

PF00394

Q9UVV2_ASPFM/150-308-----CVGNWPG------------------------------HVIVFDDH.EISVVEV......DGTWVDAY--------
LAC4_ORYSJ/162-316-----NAALNEE------------------------------LFFAVANH.TLTVVEV......DAVYVK..--------
NIR_RHOS5/206-358-----SQPNRDS------------------------------RPHLIGGH........GDLVWETGKFHNAP--------
LAC1_NEUCR/219-366-----NTSVENH------------------------------FQLSLVNH.SMTIISA......DLVPVQ..--------
LAC1_BOTFU/191-337-----NTAVDGH------------------------------FQFSIDGH.SFQVIAM......DFVPIV..--------
LAC1_CRYPA/201-349-----NTSVENN------------------------------FQVSIVGH.SMTVIES......DFVPVD..--------
O68601_ALCXX/192-344-----SQANRDT------------------------------RPHLIGGH........GDWVWETGKFANPP--------
LAC1_PHLRA/163-307-----SISCDSF------------------------------FTFSIDGH.SLNVIEV......DATNHQ..--------
LAC5_ARATH/160-312-----NSALNQP------------------------------LFFTVANH.KLTVVGA......DASYLK..--------
O64838_ARATH/161-298-----NVGISTS------------------------------INFRIQGH.MMTLVEV......EGSHTL..--------
Q9Y781_COPCI/165-306-----SLSCDPN------------------------------YVFSIDGH.TMTVIEV......DGVNVQ..--------
ASO_TOBAC/163-329-----STTALGS------------------------------LSLAIGGH.KMVVVEA......DGNYVQ..--------
Q9UVT5_LENED/175-316-----SIACDAY------------------------------HNFSIDGH.RLTVIEV......DGENHE..--------
O53858_MYCTU/190-352-----NSAADTA------------------------------FRIALAGH.SMTVTHT......DGYPVI..--------
Q9SDV9_BRAJU/154-321-----STTALAS------------------------------LNFAVEGH.QLEVVEA......DGNYIA..--------
FET3_CANAX/155-302-----NVGGFVS------------------------------QYLWMEDH.EFTIVEI......DGVYVE..--------
LAC5_TRAVE/165-309-----SISCDPN------------------------------FTFSIDGH.NMTIIEV......GGVNHE..--------
O74171_SCHCO/158-299-----SLSCDPS------------------------------FTFAIHGH.NMTIIEA......DGVNTQ..--------
Q00292_ASPTE/189-347-----NTATLLT------------------------------YTFWIDGH.NFTVIEV......DFVPVE..--------
O13422_9APHY/167-309-----SLSCDPA------------------------------FTFSIDNH.DMTIIEA......DAVNTQ..--------
LAC4_ARATH/158-308-----NAALNEE------------------------------LFFKVAGH.IFTVVEV......DAVYVK..--------
FIO1_SCHPO/158-306-----NIGAFNN------------------------------YDVMIEDH.NMTIIEV......DGEYTE..--------
Q9ZQW3_POPTR/156-306-----NAALNDE------------------------------LFFKIAGH.NITVVEV......DATFTK..--------
LAC7_ARATH/157-310-----NAAMNIQ------------------------------LFFKIANH.RLTVVAA......DAVYTA..--------
Q9SVE3_ARATH/161-299-----NVGLQHT------------------------------LNFRIQGH.QMKLVEV......EGTHTV..--------
LAC4_TRAVE/164-306-----SLSCDPN------------------------------YVFSIDGH.NMTIIEA......DAVNHE..--------
P93366_TOBAC/156-307-----NAALNEE------------------------------LFFKIAGH.KMTVVEV......DATYIK..--------
SKU5_ARATH/156-311-----NVGISTS------------------------------LNFRIQGH.NLVLAES......EGSYTV..--------
Q56795_XANCA/189-368-----NGSAMTY------------------------------FDVRIPGL.KMTVVAA......DGQYVH..--------
FA8_HUMAN/218-349-----MGTTPEV------------------------------HSIFLEGH..............TFLVRN.H--------
Q38757_ACEPS/157-308-----NAILNEE------------------------------MFFGIAQH.NLRVVGT......DGFYTK..--------
FET3_YEAST/155-302-----NVGGFVS------------------------------QYFWIEDH.EMTVVEI......DGITTE..--------
O65449_ARATH/157-295-----NVGVATS------------------------------LNFRIQGH.TMKLVEV......EGSHTV..--------
Q9SFF1_ARATH/160-297-----NVGLQNS------------------------------LNFRIQNH.TMKLVEV......EGRYTI..--------
ASOL_BRANA/159-302-----NVGVKTS------------------------------INFRIQNH.KMKLVEM......EGSHVL..--------
FET5_YEAST/157-305-----NVGLFVS------------------------------QYIILEDH.EMSIVEV......DGVYVK..--------
Q9ZQW2_POPTR/167-320-----NAALNDE------------------------------LFFSIANH.TLTVVEA......DAVYVK..--------
LAC3_TRAVI/163-301-----STSCDPN------------------------------YNFTIDGH.TMTIIEA......DGQNTQ..--------
O23170_ARATH/162-300-----NVGIATS------------------------------INFRIQNH.TMSLIEV......EGAHTL..--------
LAC1_TRAHI/163-305-----SLSCDPN------------------------------HTFSIDGH.DLTIIEV......DSINSQ..--------
O04947_ARATH/149-316-----STTALAS------------------------------LNLAVQGH.KLVVVEA......DGNYIT..--------
COPA_PSEUB/172-350-----NGSAMTY------------------------------FDIRIPGL.KMTVVAS......DGQFVN..--------
Q9ZR60_CUCME/20-183-----SLTSLSA------------------------------LSFQVEGH.SMTVVEA......DGHYVE..--------
LAC1_AGABI/160-312-----AISCRPF------------------------------FTFSVDNH.SLVFMEA......DGVEHD..--------
LAC2_PODAS/213-360-----NTSTHDH------------------------------FQLKLQNH.TMTIIAA......DMVPVQ..--------
LAC2_ARATH/161-314-----NAALNDE------------------------------LFFTIANH.TLTVVEA......DACYVK..--------
O65670_ARATH/168-334-----SLTALSA------------------------------LSFQIEGH.NLTVVEA......DGHYVE..--------
LAC4_THACU/161-317-----NASAIGS------------------------------FTFSIEGH.RLTVIEA......DGIPHQ..--------
Q9SUD0_ARATH/159-299-----NVGLQTS------------------------------LNLEILGH.QLKLIEV......EGTHTV..--------
LAC3_ARATH/159-310-----NAGMNQE------------------------------LFFSVANH.QFTVVET......DSAYTK..--------
NIR_ALCFA/210-362-----SQANRDT------------------------------RPHLIGGH........GDYVWATGKFNTPP--------
O24093_MEDTR/158-324-----STTSLAS------------------------------LNLAISNH.KLIVVEA......DGNYVH..--------
Q9ZR59_CUCME/170-333-----STTSLSA------------------------------LNFAIANH.TMLVVEA......DGNYVD..--------
NIR_ALCXX/164-316-----SQANRDS------------------------------RPHLIGGH........GDWVWTTGKFANPP--------
Q9SGR6_ARATH/159-296-----NVGLQDS------------------------------LNFRIQDH.KMKVVEV......EGTHTL..--------
Q9SMW3_ARATH/157-300-----NVGFKST------------------------------LNFRIQNH.KMKLVEM......EGSHVI..--------
O60199_PLEOS/162-303-----NTSCDSN------------------------------YQFSIDGH.TFTVIEA......DGENTQ..--------
Q9Y780_COPCI/160-305-----SLSCDPN------------------------------WQFSIDGH.ELTIIEV......DGQLTE..--------
LAC6_ARATH/163-315-----NAGINME------------------------------TFFTIANH.RLTIVEV......DGEYTK..--------
O61263_9APHY/163-305-----SLSCDPF------------------------------HTFSIDGH.DLTIIEA......DSVNTE..--------
SKS1_ARATH/160-314-----NVGISTS------------------------------LNFRIQNH.SLLLVET......EGHYTS..--------
O24041_LIRTU/158-311-----NAALNDE------------------------------LFFGIASH.TITVVEV......DATYVK..--------
O04870_SOLLC/136-274-----NVGLQNS------------------------------LNFRVEGH.KMTLVEV......EGTHTL..--------
ASOL_TOBAC/157-300-----NLGMRSS------------------------------VNIRFQGH.PMKLVEL......EGSHTV..--------
LAC1_PLEOS/174-315-----SMSCDPN------------------------------FTFSIDGH.SLQVIEA......DAVNIV..--------
O59944_CERSU/165-307-----SISCDPN------------------------------WVFSIDQH.ELTVIEV......DGVNAV..--------
CERU_HUMAN/221-358-----MGNEVDV------------------------------HAAFFHGQ.................ALTNK--------
Q9UUY5_HETAN/31-173-----YISCDSN------------------------------FVFSIDQH.KMTIIEA......GGNNVN..--------
O31380_BRAJP/193-345-----SQANRDS------------------------------RPHLIGGH........GDYVWETGKFGNAP--------
ASO_CUCMA/166-331-----STTALAA------------------------------LNFAIGNH.PLLVVEA......DGNYVQ..--------
Q9UVU8_PYCCI/165-307-----SISCDPN------------------------------HTFSIDGH.NMTIIEV......EGVNSK..--------
O42702_9ASCO/162-324-----GATGLSL------------------------------VSMGFEGHQNLTIIQV......DGGEWT.K--------

PF00127

AZUP_METEA/30-118---------------------....-.-....----GQ-------------EAVVKFD..---.K-----EGV..YGFKC
AZUR1_METJ/22-149---------------------VAHT-K-LVGG----GE-------------KDSVKVDVS---KL-----AAGEKYTFFC
AZUP_ALCFA/28-116---------------------....-.-....----.E-------------NYVLTVT..---.Q-----PGA..YLVKC
AMCY_METEA/31-119---------------------..SN-.-....----.Q-------------TYSVKFN..---.A-----PGT..YDYIC
PLAS2_POPNI/70-168---------------------..ED-L-LNAK----GE-------------TFEVALS..---.D-----KGE..YTFYC
AZUR_ALCFA/1-127---------------------IAHT-S-VIGG----GE-------------TDSVTFDVS---KL-----KEGEDYAFFC
PLAS_CHLFU/2-98---------------------..ED-Y-LNAP----GE-------------SYSAKFD..---.T-----AGT..YGYFC
PLAS_SILPR/67-165---------------------..ED-L-LNAP----GE-------------EYSVTLT..---.E-----KGT..YKFYC
AZUP_PARPN/27-115---------------------....-.-....----.E-------------SYTLTVT..---.E-----PGL..YGVKC
PLAS_NOSS1/37-138---------------------..KQ-L-LMSP----GQ-------------STSTTFPAD---AP-----AGE..YTFYC
PLAS_CUCSA/1-99---------------------..ED-L-LBAP----GZ-------------VYZVZLT..---.Z-----KGS..YSFYC
AMCY_PARDE/43-131---------------------..KE-.-....----.Q-------------AYSLTFT..---.E-----AGT..YDYHC
PLAS2_ARATH/69-167---------------------..QD-L-LNGA----GE-------------TYEVALT..---.E-----PGT..YSFYC
AZUP_ACHCY/33-121---------------------....-.-....----.E-------------NYKVTFT..---.A-----PGV..YGVKC
PLAS_SYNY3/31-126---------------------..KG-L-AFAA----GE-------------SFTSTF...---TE-----PGT..YTYYC
AZUR_PSEFB/1-128---------------------IAHT-K-VIGA----GE-------------KDSLTIDVS---KL-----NAAEKYGFFC
PLAS_DAUCA/1-97---------------------..ED-Y-LDGA----GE-------------SFTVTLT..---.E-----KGT..YKFYC
PLAS_CHLRE/49-145---------------------..DD-Y-LNAP----GE-------------TYSVKLT..---.A-----AGE..YGYYC
AZUR_BORPE/22-149---------------------LAHT-K-VLGG----GE-------------SDSVTFDVA---KL-----AAGDDYTFFC
PLAS_VICFA/1-99---------------------..ED-L-LNAP----GE-------------TYSVKLD..---.A-----KGT..YKFYC
AZUR_PSEAE/21-148---------------------IAHT-K-LIGS----GE-------------KDSVTFDVS---KL-----KEGEQYMFFC
HCY_NATPH/73-163---------------------....-.-....----GF-------------TFEQTFD..---.D-----EGV..ALYVC
AZUR_ALCSP/1-128---------------------IAHT-K-VIGG----GE-------------TDSVTFDVS---KL-----AAGEDYAYFC
AZUR_PSECL/1-128---------------------IAHT-K-IIGS----GE-------------KDSVTFDVS---KL-----TAGESYEFFC
AZUR_ALCDE/21-148---------------------IAHT-K-VIGG----GE-------------SDSVTFDVS---KL-----TPGEAYAYFC
H81_NEIGO/57-182---------------------VAHT-K-LIGG----GE-------------ESSLTLDPA---KL-----ADG.DYKFAC
PLAS_ULVPR/2-98---------------------..ED-Y-LNSK----GQ-------------TVVRKLT..---.T-----PGT..YGVYC
AZUR2_METJ/1-128---------------------IAFT-P-IIGG----GE-------------KTSVKFKVS---AL-----SKDEAYTYFC
AMCY_PARVE/44-132---------------------..KD-.-....----.Q-------------AYAITFN..---.E-----AGS..YDYFC
PLAS_SOLLC/72-170---------------------..ED-L-LNAA----GE-------------TYSVTLS..---.E-----KGT..YTFYC
PLAS_HORVU/59-155---------------------..EE-Y-LTAP----GE-------------TFSVTLT..---.V-----PGT..YGFYC

PF13473

B3CV67_ORITI/16-120---------------------K.RE.K-IIPA----HS-------------TVKIILP-P---LK-----QGS--YKFFG
B5WRG9_9BURK/6-109---------------------R.KE.K-VLAP----GA-------------DSFVVIA-P---LE-----PGE--YKFFD
Q4ULV7_RICFE/15-124---------------------H.RE.K-IVMP----NE-------------SINIILA-P---LK-----PGK--YEIFG
A9VLT2_BACWK/13-122---------------------G.ID.A-EVPS----GK-------------EITITVK-P---ET-----PGT--YELIC
Y394_RICPR/15-123---------------------H.RE.K-IVMP----HE-------------SINIILA-P---LK-----PGK--YEIFG
A8GXF3_RICB8/19-125---------------------H.RE.K-IVMP----HD-------------SIKIILA-P---LK-----PGK--YDFFG
B2JD79_BURP8/6-110---------------------R.KE.K-VLAP----GA-------------ESVVVIA-P---LD-----PGT--YKFFD
A3P8U3_BURP0/8-112---------------------K.AE.K-VVPA----GK-------------QVDVYIG-P---LK-----AGT--YEFHD
C7JG61_ACEP3/11-115---------------------K.FE.K-IVVP----QG-------------TIKVHAG-P---LH-----PGT--YTFFD
D0P677_BRUSS/22-123---------------------R.KE.K-VIAA----QS-------------ETVMVIR-T---LD-----PGE--YPFFD
B1FN56_9BURK/5-109---------------------K.AE.K-VVPA----GK-------------SVEILVG-P---LK-----AGT--YEFHD
B3Z7I0_BACCE/13-128---------------------G.ID.V-VVES----GK-------------EKNITVK-P---KS-----AGT--YELIC
Q210L9_RHOPB/21-125---------------------R.KE.K-VLAP----GA-------------SSTLVIR-T---LD-----PGE--YDFFD
Q7NZX4_CHRVO/5-110---------------------R.KE.K-VLGP----GA-------------ESFLVFQ-P---LS-----PGE--YKFFD
B4EUB3_PROMH/7-110---------------------R.KE.K-VLAP----GA-------------SSVVVIA-P---LK-----PGR--YTFFD
D8JYC6_HYPDA/23-127---------------------G.FE.K-IIAG----NS-------------EATFRVK-P---LE-----PGT--YIFFG
B6XG39_9ENTR/6-110---------------------R.KE.K-VLAP----GA-------------SSVVVIA-P---LK-----PGS--YTFFD
Q1YSM9_9GAMM/7-113---------------------N.RE.K-VIIG----NS-------------KAVIFIG-P---LS-----PGT--YPFFG
A0YB47_9GAMM/4-108---------------------N.RE.K-VIVG----NS-------------KAVVFIG-P---LE-----QGE--YPFFG
B2IE20_BEII9/7-115---------------------R.KE.K-VLAP----GS-------------VSVLVIH-T---LD-----PGE--YPFFD
Q11MW3_MESSB/9-113---------------------R.KE.K-VLGP----GV-------------TSFIVIR-S---LD-----PGE--YRFFD
Q480M3_COLP3/12-116---------------------N.RE.K-VLFP----KQ-------------KSIIYIG-P---LS-----PGH--YDFFG
D8JSD6_HYPDA/6-111---------------------R.RE.K-VLGA----GA-------------SSFIVIR-R---LD-----PGE--YEFFD
Q2C9M1_9GAMM/6-110---------------------R.KE.K-VLAP----GA-------------SSVVVIA-P---LR-----EGT--YTFFD
E3I4P1_RHOVT/6-110---------------------R.KE.E-VVPA----GG-------------TGRMIIR-R---LD-----PGE--YKFFD
B5ZI01_GLUDA/5-109---------------------K.FE.K-IVVQ----GG-------------TITVHAG-P---LH-----PGT--YKFFD
A5E8V2_BRASB/12-114---------------------K.IE.K-VVAG----NS-------------EAVLNVR-A---VK-----SGR--YEFHN
Q2L118_BORA1/3-106---------------------R.KE.K-VLGP----GV-------------KSFVVIT-I---TR-----PGE--YPFFD
C0ZL71_BREBN/21-137---------------------N.LAST-ELKP----TQ-------------STLLQFS-A---AK-----RGR--YHFVS
Q089I9_SHEFN/11-115---------------------D.IS.E-ELPL----DK-------------SVVISLP-A---LA-----KGE--YPFHC
Q1QPM6_NITHX/9-114---------------------R.VE.T-VIDA----KS-------------EGVIKLR-P---LK-----PGK--YDFYD
A3WJP7_9GAMM/11-116---------------------E.IS.E-TLPS----NK-------------LKQIQIP-A---LE-----PGE--YDFHC
Q15U28_PSEA6/11-116---------------------D.LS.L-ALKM----GQ-------------SNRIELP-A---LS-----EGQ--YDFHC
C7RBS9_KANKD/11-116---------------------Q.IS.E-TLPL----NK-------------IKTIQLS-S---LK-----AGE--YDFHC
Q3IJ88_PSEHT/11-116---------------------D.IS.K-TLVM----GD-------------ANTLKIP-E---LK-----VGE--YDFHC
D1RR85_SEROD/12-118---------------------E.ER.E-NIAP----GF-------------TQKMT.A-N---LE-----AGE--YDMTC
A4Y220_SHEPC/12-115---------------------E.IS.Q-DLAL----DK-------------TTTIALP-A---LE-----KGE--YPFHC
C4T4D8_YERIN/12-116---------------------E.ER.E-NIAP----GF-------------TQKMT.A-N---LE-----PGE--YDMTC
A4W945_ENT38/11-115---------------------E.ER.E-NIAP----GF-------------SQKMT.A-N---LQ-----PGE--YDMTC
D4HVX9_ERWAC/11-115---------------------E.ER.E-NIAP----GF-------------TQKMT.A-N---LE-----PGE--YDMTC
B4WYZ8_9GAMM/12-118---------------------D.TS.A-FLET----GK-------------TTTLTLD-N---LP-----AGK--HRFTC
A3Y901_9GAMM/11-116---------------------G.IS.V-DLSL----GK-------------ETRVDLP-P---LA-----KGE--YAFHC
C6D115_PAESJ/19-132---------------------G.FD.L-YLKK----GE-------------NYT.TLA-N---LT-----PGS--YQFDC
A6X5Q9_OCHA4/30-135---------------------E.ER.E-NIAP----GF-------------KQTIT.A-K---LT-----PGE--YQITC
B8G648_CHLAD/16-123---------------------D.RT.V-SADP----GV-------------DAILTFR-A---PA-----PGE--YRFYC
B8IQ01_METNO/8-113---------------------E.ER.E-NIIP----GF-------------VQTLT.A-T---LQ-----PGT--YAMTC
B8ELX4_METSB/25-132---------------------E.ER.E-NIAP----GI-------------TARLT.A-K---LN-----PGV--FEITC
C4VLJ4_9LACO/14-121---------------------A.LD.K-KLAP----GE-------------KVSIKVP-T---DQ-----IGE--YNYSC
A9G130_SORC5/13-119---------------------G.IR.K-ELPT----GQ-------------PVTIDLP-E---LK-----AGE--LQFEC
D7V688_9LACO/12-124---------------------G.VN.K-DLTK----QK-------------ITTIDIP-T---DK-----AGT--YNFAC
C2HKM0_LACAI/12-124---------------------G.VD.K-DLTK----QK-------------VTTIDIP-T---DK-----KGT--YNFAC
D2ENS3_9STRE/12-122---------------------G.VH.A-DLPM----GE-------------EYVVEIT-P---EQ-----AGE--YGFSC
C2EV15_9LACO/12-122---------------------G.VN.K-DLTK----QP-------------VTSIKIP-T---DK-----AGE--YNFAC
D0RSM9_9STRE/13-122---------------------G.VH.E-DLPL----GE-------------KHVIEIT-P---EK-----AGE--YGYSC
B2GF85_LACF3/12-122---------------------G.LN.K-DLTK----QP-------------TTTVEIP-T---DQ-----AGE--FNFAC
A1B2T7_PARDP/18-125---------------------A.ER.E-NIAP----GF-------------RSTLEV.-Q---LA-----PGE--YAITC
C0XM16_LACHI/13-122---------------------G.ID.K-DLTK----QS-------------VTEIEIP-T---DK-----AQE--FDYAC
D3PXY6_STANL/11-120---------------------S.EV.E-NITP----GN-------------TRELIV.-E---LP-----AGK--YETAC
Q46BR6_METBF/35-147---------------------W.EE.T-TLNY----GK-------------AFSFTF.-.---EN-----PGT--YSFTL
Q04BF3_LACDB/16-123---------------------G.VD.K-DLSK----EK-------------LAKIQIP-T---DK-----AGE--IDYAC
A8UZZ4_9AQUI/6-124---------------------M.V..E-NIKK----GE-------------TKEAKVK-M---IY-----PGK--FLFTC
A7NN78_ROSCS/15-116---------------------SWTS.P-VIAP----GD-------------VQRQWF.-.---AQ-----PGR--YPFVC

PF00116

COX2_NEUCR/114-238---------------------G-VK-C-DAYP----GR-------------LNQVSVF-I...NR-----EGV--FYGQC
COX2_ALBTU/95-214---------------------G-VK-M-DAVP----GR-------------LNSMGFH-A...NL-----PGI--YYGQC
COX2_CHLAE/95-214---------------------G-LK-T-DAVP----GR-------------LNQTTFT-A...TR-----PGV--YYGQC
COX2_BREAN/107-231---------------------G-IK-I-DAVP----GR-------------LNQTSAL-I...QR-----EGV--YYGQC
COX2_ACHDO/95-213---------------------G-VK-T-DATP----GR-------------LNQINFM-I...NR-----PGL--FYGQC
COX2_EMEND/114-237---------------------G-IK-A-DAYP----GR-------------LNQASVY-I...NG-----PGT--FFGQC
COX2_BETVU/116-240---------------------G-VK-C-DAVP----GR-------------LNQTSIL-V...QR-----EGV--YYGQC
COX2_ASCSU/98-217---------------------S-IK-L-DAMS----GI-------------LSTLSYS-F...PV-----VGV--FYGQC
COX2_PARLI/95-214---------------------G-VK-M-DAVP----GR-------------LNQTTFF-A...AR-----AGL--FYGQC
COX2_EXERO/95-212---------------------G-VK-I-DSVP----GR-------------INQTLMM-I...NR-----PGI--YFGQC
COX2_PNECA/107-231---------------------G-IK-V-DASP----GR-------------LNQVSTY-V...QR-----EGV--YYGQC
COX2_ADABI/95-214---------------------G-VK-I-DASP----GR-------------LNQMSFT-L...NR-----TGI--FYGQC
COX2_ONCFA/95-214---------------------G-VK-I-DATP----GR-------------LNQGSIK-I...NR-----PGI--LFGQC
Q8ZXC2_PYRAE/67-155---------------------N-VN-V-MVFP----GY-------------VAEITWK-VP.PDA-----KGT--YLVIC
Q9XDX2_MAGMG/93-178---------------------N-IN-L-QVHP----GI-------------DEVVTIT-P...TD-----SGD--FGIIC
Q9YB77_AERPE/72-160---------------------N-VN-F-MVIP----GY-------------IAKFTWY-PP.KNA-----EGE--YLILC
COX2_PARDE/141-263---------------------A-VK-Q-DAVP----GR-------------IAQLWFS-V...DQ-----EGV--YFGQC
COX2_FORLA/95-214---------------------G-VK-M-DAVP----GR-------------LNQTAFI-A...SR-----PGV--FYGQC
Q8XPI7_RALSO/39-125---------------------S-VR-A-DVVP----GQ-------------TARLALT-P...ER-----TGT--FEFLC
COX2_APILI/95-212---------------------G-IK-V-DAVP----GR-------------INQLNLI-S...KR-----PGI--FFGQC
COX2_CANGA/115-239---------------------G-IK-V-DANP----GR-------------LNQVSAL-I...QR-----EGV--FYGQC
COX2_SCHPO/111-235---------------------G-IK-C-DCIP----GR-------------LNQVSLS-I...DR-----EGL--FYGQC
COX2_SYMST/95-214---------------------G-IK-V-DATP----GR-------------LNQTSFF-I...NR-----PGI--FFGQC
COX2_SITGR/95-214---------------------S-IK-I-DGTP----GR-------------LNQANLI-A...NR-----SSI--FFGQC
COX2_LASSP/94-213---------------------G-IK-M-DSTP----GR-------------LNQSLLY-M...YR-----PGL--YFGQC
COX2_BALMU/95-214---------------------G-LK-T-DAIP----GR-------------LNQTTLM-S...TR-----PGL--FYGQC
COX2_CTEFE/95-214---------------------G-IK-I-DATP----GR-------------LNQSNFM-M...NR-----PGL--YFGQC
O08448_NATPH/70-159---------------------N-AN-T-MVIP----GE-------------VASLTVE-MPDVDE-----PTE--YGILC
COX2_PERAM/95-214---------------------G-VK-A-DATP----GR-------------LNQVSFL-I...NR-----PGV--LYGQC
COX2_LOCMI/95-214---------------------V-LK-I-DATP----GR-------------LNQGMFM-I...NR-----PGL--FFGQC
COX2_CHICK/94-213---------------------G-VK-T-DAIP----GR-------------LNQTSFI-T...TR-----PGV--FYGQC
Q8L1B7_9PSED/541-631---------------------G-AS-M-EISP----QQ-------------TASITFT-A...DK-----PGL--HWYYC

PF06525

A4YDJ8_METS5/12-195---------------------SAYTLQ-GLSS----GQ-------------TALGVYG-P---MA-----PGT--YWLAC
A4YEZ9_METS5/6-222---------------------GN....-GISG----GT-------------SVSGLLK-D---LP-----RGY--YWIAC
SOXE_SULAC/11-198---------------------SNYDVN-GISG----GA-------------SAEGVWG-P---IS-----AGD--YMLVC
Q97UN1_SULSO/11-196---------------------SNYQTS-GISS----GQ-------------SDSGLWG-P---LS-----AGT--YMLVC
Q4J829_SULAC/7-202---------------------SNYYSS-GVSS----GN-------------EASGMLE-N---IP-----AGY--YWIAC
Q97VW6_SULSO/21-249---------------------SNFANN-GILS----GQ-------------TAVGILD-N---IS-----AGY--YWIAC

PF02298

O82081_ARATH/34-115---------------------SCQAVK.PLIT----FA.............NGNSLVP-L---TT-----PGK--RYFIC
O82761_ARATH/37-119---------------------MCEPSK.PLAR----YE.............TGSDIVI-L---TK-----PGL--QHFIC
NO16_MEDTR/36-121---------------------MCHTNG.EHVE----HH.............DGNTKVV-L---DK-----IGV--YHFIS
O81500_ARATH/32-115---------------------SCNTSK.PIST----FT.............TGNDSIT-L---TN-----HGH--HFFFC
Q39040_ARATH/37-119---------------------KCISNL.PIRN----YTRG...........AGRDIVP-L---YE-----.TR--RYYLL
NO552_SOYBN/38-124---------------------GCNTVGKYHIV----FN.............GGNTKVM-L---TK-----PGF--RHFIS
BCP_PEA/35-116---------------------SCTSGN.SIST----DS.............TGATTIP-L---KK-----AGK--HYFIC
O82083_ARATH/38-140---------------------DCDYDNNENND----TTEWSAANPSATSPVPVSISVP-L---VK-----EGS--NYFFS
O48787_ARATH/37-119---------------------MCESSK.PLRR----YK.............TGSDSIS-L---TK-----PGL--QHFIC
STEL_TOXVR/11-97---------------------SCNDTT.PIAS----YN.............TGBBRIN-L---KT-----VGQ--KYYIC
Q9ZNX8_TOBAC/35-119---------------------KCKSSH.PIFF----SN.............NGKTIYK-L---EQ-----PGL--YYFIS
BABL_CUCSA/11-89---------------------TCNTPA.GAKV----YT.............SGRDQIK-L---PK-----.GQ--SYFIC
NO20_MEDTR/36-121---------------------RCGIRG.EHVD----HY.............DGNTMVV-L---KK-----TGI--HHFIS
Q9ZRV5_CICAR/37-115---------------------SCKTPR.GAKV----YR.............SGKDQIR-L---AR-----.GQ--NYFIC
BCB2_ARATH/36-118---------------------GCDASS.STEN----HS.............DGDTKID-L---KT-----VGI--NYFIC
O82080_SPIOL/37-114---------------------SCSAPR.GART----YS.............SGQDRIK-L---TR-----.GQ--NYFIC
MAVI_CUCPE/12-95---------------------SCNSSS.PAAS----YT.............SGADSIP-L---KR-----PGT--FYFLC
CPC_CUCSA/13-99---------------------ACNFVN.SDND----VER............TSPVIER-L---DE-----LGM--HYFVC
BABL_ARATH/44-122---------------------NCKTPT.GAKP----YT.............SGKDRIT-L---SK-----.GQ--NFFIC
MPAA3_AMBEL/14-92---------------------ACDIKD.PIRL----EP.............GGPDRFT-L---LT-----.PG--SHFIC
BCB1_ARATH/33-117---------------------NCEKEK.PISH----MT.............VPPVKIM-L---NT-----TGP--QYFIC
O04596_ARATH/250-336---------------------SCYPIS.PVAV----HM.............TGHDLVT-L---TE-----PGV--HYFIS
Q9ZTU7_WHEAT/34-115---------------------SCSIDG.AINT----FK.............SGNDVIP-L---SA-----TGT--RYFIC
Q96316_ARATH/32-112---------------------NCDSSG.ATQN----FA.............DGDTKID-L---TT-----VGT--MHFLC
LAML_ARATH/37-119---------------------GCIADH.PIRN----WTRG...........AGRDIVT-L---NQ-----.TK--HYYLL
O82227_ARATH/36-122---------------------KCNTQK.PLEE----HK.............DGYTTVK-L---DV-----SGP--YYFIS

PF00812

EFNB1_XENLA/20-159......................EYRFTIKFQE----FS-------------PNYMGLE-----FR-----RNQ--DYYIT
EFNB2_MOUSE/28-169......................DVKFTIKFQE----FS-------------PNLWGLE-----FQ-----KNK--DYYII
EFNA5_CHICK/26-164.....................GPLKFSEKFQL----FT-------------PFSLGFE-----FR-----PGR--EYFYI
O93431_DANRE/17-155.....................APEKFSEKFQR----FT-------------PFTLGKE-----FR-----QGE--SYYYI
EFNA3_HUMAN/27-171.....................SPIKFSEKFQR----YS-------------AFSLGYE-----FH-----AGH--EYYYI
EFNA1_XENLA/25-163.....................GPEKFCEKFQK----FT-------------PFTLGTE-----FR-----EGR--TYYYI
EFNA1_HUMAN/15-153.....................GPEKLSEKFQR----FT-------------PFTLGKE-----FK-----EGH--SYYYI
EFNA4_MOUSE/22-160.....................SPVRFSEKIQR----YT-------------PFPLGFE-----FL-----PGE--TYYYI
EFNB1_RAT/27-166......................EIRFTIKFQE----FS-------------PNYMGLE-----FK-----KYH--DYYIT
EFNB2_DANRE/22-163......................DVKFTLKFQE----FS-------------PNLWGLE-----FF-----RGK--DYYII
EFNA2_CHICK/25-163.....................GPLKFSEKFQL----FT-------------PFSLGFE-----FR-----PGH--EYYYI
EFNB3_HUMAN/25-169......................DLRFTIKFQE----YS-------------PNLWGHE-----FR-----SHH--DYYII
EFN4_CAEEL/17-180KVLRTQQLSGGRREDWKKQKVPPKNVAQLIRQ----LN-------------PIPNGKE-----YQ-----PGQ--TYYYM
EFNA2_DANRE/21-159.....................GPLRFSEKFQL----FT-------------PFSLGFE-----FR-----PGH--EYYYI

PF07732

Q9P8C3_9HYPO/104-220---------------------DGWAEDVTNP.----GE-------------YKDYYYP-N---AQ.A---GRF--SWYHD
Q9P861_BLAAD/25-143---------------------VGVTQCPVPP.----GG-------------KFTYNFT-V---DQ..---NGT--YWYHS
Q9UVW1_ASPFM/25-141---------------------VGLSQWAIQP.----GQ-------------SYTYQWR-A---DT..---YGT--YWYHA
Q9UVV2_ASPFM/26-143---------------------NQVTQCALPP.----GS-------------SMRYEFD-V---NQ..---TGT--YWYHS
Q19687_CAEEL/100-218---------------------AFVQQCPIQS.----TN-------------KFEYRFI-A---DN..---KGT--HWYHG
MCO_STAES/58-173---------------------DGGPSQVIKP.----GK-------------EKTIKFE-V---NQ.D---SAT--LWYHP
LAC1_EMENI/28-145---------------------PGLTQTPIEP.----GA-------------TFTYRFR-A---YP..---AGT--FWYHS
LAC4_ORYSJ/36-152---------------------AYITQCPIQT.----GQ-------------SYVYNFT-V---AG.Q---RGT--LWWHA
Q7S4C0_NEUCR/80-197---------------------PGITQCAIAI.----GQ-------------SMTYRFK-V---SQ..---YGS--TWYHS
LAC10_ARATH/30-146---------------------AYITQCPIKP.----GH-------------SYVYNFT-V---TG.Q---RGT--LWWHA
Q7RX46_NEUCR/32-148---------------------DGWAEDITPP.----GW-------------YKDYYYP-N---SQ.S---GRT--LWYHD
Q7S6W1_NEUCR/62-171---------------------GGVTECPIPP.----NA-------------TKSYLFL-A---EQ..---YGT--TWYHS
Q7PNZ9_ANOGA/51-163---------------------PMITQCPIAS.----FT-------------RFQYKFQ-A---DR..---AGT--HLYHG
Q8RMC6_9ACTO/88-204---------------------DGGPMDLITP.----GG-------------QRTYTYP-N---PQ.V---AAT--LWYHD
BLRO_MYRVE/82-198---------------------DGWAEDITEP.----GS-------------FKDYYYP-N---RQ.S---ART--LWYHD
Q38757_ACEPS/31-147---------------------EYVTQCPIPA.----GT-------------NFTQEIN-F---ST.E---EGT--LWWHA
Q7VPL4_HAEDU/53-170---------------------VGSPHHSLKA.----HS-------------HWSPIIL-V---NQ.P---ACT--AWYHA
Q7NRY4_CHRVO/82-200---------------------DGNPHDPVPP.----GQ-------------GRDYRFS-L---PEDS---AGS--YWYHP
LAC2_ARATH/35-151---------------------SYVTQCPIRM.----GQ-------------SYVYNFT-V---TG.Q---RGT--LWWHA
O23170_ARATH/36-152---------------------LG.TNCPIQP.----NS-------------NWTYQFQ-L---KD.Q---IGT--YTYFA
Q9LX04_ORYSJ/32-148---------------------LG.TTCPIPP.----GW-------------NWTYNFQ-V---KD.Q---IGS--FFYFP
Q9AUI1_PINTA/41-156---------------------GYVTQCPIQT.----GK-------------SYVYNFT-I---TG.Q---RGT--LWWHA
Q8RQE2_9LACT/61-172---------------------QDGPDITLNN.----KG-------------EKTFKIT-P---KE..---SGT--FWVHS
Q9SMW3_ARATH/31-147---------------------AG.TSCPIPA.----GQ-------------NFTYHFQ-P---KD.Q---IGS--YFYYP
Q8LFM3_ARATH/42-158---------------------LG.TNCPIQP.----NS-------------NFTYKFQ-T---KD.Q---IGT--FNYFP
Q98FW8_RHILO/79-198---------------------DGNPMDPVAT.----GT-------------DRTYSFD-L---PEAS---AGS--YWYHP
FTSP_PASMU/54-168---------------------LGGVGRVLQP.----KE-------------TWSPIIP-I---TQ.A---AST--CWYHS
Q8TFE2_9PEZI/64-183---------------------NGITECPIPP.----NA-------------SKVYRFR-V---EQ..---YGT--AWYHS
Q8TFD9_GAEGR/75-195---------------------VSVTQCPSVP.----GT-------------TQTYKFK-A---TN..---YGS--SWYHS
Q00292_ASPTE/65-183---------------------PGVTQCPIPP.----GE-------------SQVYEFR-A---TQ..---YGT--SWYHS
Q84ZL7_ORYSJ/38-154---------------------AG.TNCPIPP.----GW-------------NWTYQFQ-L---KD.Q---IGS--FFYFP
Q7W3D4_BORPA/52-166---------------------PGLSFPGIRP.----GE-------------TFTYRFQ-V---RQ..---SGT--YWYHS
FTSP_HAEIN/51-168---------------------FGGAARVLKK.----GE-------------SWAPIVP-I---EQ.P---AAS--CWYRS
Q9CJQ6_PASMU/79-197---------------------DGNPMDMVEP.----QG-------------KKVYRFT-L---PQGS---AGT--YWYHP
Q8TFE1_GAEGR/83-200---------------------PGVTQCPIAP.----GK-------------SLTYKFR-V---TQ..---YGT--TWYHS
FTSP_PHOLL/52-169---------------------TGGVARQISP.----GS-------------DWSPVLP-I---RQ.Q---AAT--CWYHA
Q94ID0_TOXVR/9-125---------------------EYITQCPIKP.----GT-------------NFIYEVI-L---ST.E---EGT--LWWHA
Q9AUI6_PINTA/39-155---------------------AYITQCPIQT.----GQ-------------TYTYNFT-V---TG.Q---RGT--LWWHA
Q7SDL8_NEUCR/27-146---------------------PGVSQCPIVP.----GK-------------SYTYEFN-A---SL..---YGT--SWYHA
Q8H6A0_LOLPR/37-153---------------------AYITQCPMQT.----GQ-------------SYLYNFT-I---TG.Q---RGT--LWWHA
Q9SUD0_ARATH/33-149---------------------YG.TNCPIPP.----GK-------------NYTYDFQ-V---KD.Q---VGS--YFYFP
CUEO_YERPE/53-168---------------------DGGPQALIQP.----GA-------------KRQVTFA-V---EQ.P---AAT--CWFHP
Q9ZQW3_POPTR/30-146---------------------AYITQCPIQP.----GQ-------------SYLYNFT-L---TG.Q---RGT--LLWHA
Q875H3_PHACH/52-169---------------------AGITECGIPP.----GQ-------------SLTYDFT-F---GD.F---SGT--TWWHS
Q9VX11_DROME/122-239---------------------PHVTQYPIEA.----GQ-------------AFRYRFE-V---DH..---GGT--NWWHS
O24042_LIRTU/42-158---------------------AYVTQCPIQT.----GQ-------------TYVYNFT-I---IG.Q---TGT--LFWHA
Q8L3Q4_ORYSJ/49-161---------------------LG.TNCPIPS.----GW-------------NWTYEFQ-V---KD.Q---IGS--FFYFP
Q9VBK7_DROME/139-256---------------------PFITQYPLQP.----GE-------------VQRHEFK-V---DR..---SGS--LWYHS
O04947_ARATH/22-139---------------------AGVTQCAINP.----GE-------------TFTYNFT-V---EK..---PGT--HFYHG
Q8YCF0_BRUME/28-145---------------------DGGPHNVIAP.----GA-------------KWEPKVA-V---NQ.P---ASF--NWFHP
Q7S9Z8_NEUCR/154-264---------------------NGITECPIAP.----GD-------------TFTYRFR-A---MQ..---YGS--AWYHS
LAC5_ARATH/34-150---------------------EFVTQCPIRP.----GS-------------SYTYRFT-I---QG.Q---EGT--LWWHA
Q9SFF1_ARATH/34-150---------------------YG.TMCPIPP.----GK-------------NYTYALQ-V---KD.Q---IGS--FYYFP
Q82JK0_STRAW/63-180---------------------DGGPQNAFAA.----GE-------------TWSPTFT-V---KD.E---AKT--LWYHP
O04870_SOLLC/10-126---------------------YG.TTCPIPP.----GR-------------NNTFNLQ-V---KD.Q---IGS--FYYFP
O24041_LIRTU/32-148---------------------SYITQCPIQT.----GQ-------------TYVYNFT-I---VG.Q---RGT--LFWHA
Q8I8Y1_MANSE/186-304---------------------PYVTQCPILP.----ET-------------TFRYQFT-A---RH..---SGT--HFWHS
LAC1_CRYPA/73-193---------------------NGITECPIPPN----GG-------------SKTYTFI-A---HQ..---YGT--SWYHS
Q9A9L6_CAUCR/56-170---------------------PGVSFPGIKP.----GE-------------TFTYEFP-I---RQ..---SGT--YWWHS
Q7XSQ1_ORYSJ/36-152---------------------SG.TNCPIPP.----GQ-------------NFTYQMQ-A---KD.Q---IGS--FFYFP
LAC9_ARATH/33-149---------------------NMITQCPIQP.----SN-------------NFTYQFD-I---TG.Q---EGT--LLWHA
Q8W0V4_LOLPR/45-161---------------------SMVTQCPIQP.----NS-------------SYIYRFN-V---TG.Q---EGT--LWWHA
FET3_CANGA/25-144---------------------PYLTQCPIGP.----GD-------------TMLYNFT-V---DE.N---VGT--YWYHS
LAC4_ARATH/32-148---------------------AYITQCPIQP.----GQ-------------VYTYNYT-L---TG.Q---RGT--LWWHA
Q9R9E7_PSESX/50-164---------------------PGLSFAGIEP.----DG-------------MYVYKIH-V---KQ..---NGT--YWYHS
Q9X3V2_PSEPU/46-162---------------------PYVSQLPVKP.----GE-------------YFDYKFR-V---PD..---AGS--YWYHP
COPA_PSESM/50-164---------------------PGLSFDGIAP.----DG-------------MYVYRFK-V---RQ..---HGT--YWYHS
Q9AUI4_PINTA/36-152---------------------AYVTQCPIQT.----GQ-------------SYIYNFT-I---TG.Q---RGT--LWWHA
Q7S1M8_NEUCR/27-114---------------------NGVTECPIPP.----GS-------------RKTYTFL-A---NQ..---...--..YHS
Q9L914_9GAMM/58-175---------------------LGISFNGIKP.----GE-------------TFTYKFK-L---EQ..---SGT--YWYHS
A9CFX2_AGRT5/76-193---------------------GGLSQPHIPV.----GK-------------TFVYEFD-L---VK..---SGT--FMYHP
Q9AUI0_PINTA/32-148---------------------AYITQCPIQT.----GQ-------------TFVYNFT-I---TG.Q---RGT--LFWHA
LAC6_ARATH/37-153---------------------SYITQCPIQS.----GQ-------------SFTYNFK-V---AQ.Q---KGT--FLWHA
Q87F38_XYLFT/61-176---------------------PGMSFDGIAP.----GE-------------HYLYRFQ-L---HQ..---SGT--YWYHS
Q7N890_PHOLL/51-168---------------------DGGPHAMIAP.----GG-------------SRTVSFT-P---EQ.P---EAT--CWFHP
Q8RNQ3_LEGPN/119-233---------------------DEVSQKPIPP.----GG-------------VFHYRFK-L---YQ..---RGT--YWYHA
O42702_9ASCO/36-154---------------------PQGSQWPIPP.----GH-------------FFDYELQ-T---TVED---AGT--YFYHS
FTSP_ECOLI/51-168---------------------MGGPARMMSP.----NA-------------DWAPVLP-I---RQ.N---AAT--LWYHA
LAC2_PODAS/85-205---------------------NGVTECPIPPK----GG-------------SRIYRFR-A---QQ..---YGT--SWYHS
O24093_MEDTR/31-148---------------------AAISQCAINP.----GE-------------TFQYKFK-V---DR..---PGT--YFYHG
Q8L4Y3_SOYBN/42-158---------------------EFVTSVPDCP.----GG-------------SYTYRFT-V---QG.Q---EGT--LWWHA
ASOL_TOBAC/31-147---------------------PG.TMCPIMP.----GQ-------------NFTYRFQ-V---KD.Q---IGS--YSYFP
Q8L8N6_ARATH/32-148---------------------RG.TNCPILP.----GT-------------NWTYRFQ-V---KD.Q---IGS--YFYFP
O65449_ARATH/31-147---------------------VG.TTCPIPP.----GK-------------NFTYVIQ-V---KD.Q---IGS--FYYFP
Q82XJ1_NITEU/53-167---------------------PGISFPGIEP.----GA-------------TFSYRFT-I---RQ..---YGT--YWFHS
Q942J6_ORYSJ/33-149---------------------PG.TNCPIQP.----GT-------------NWTYKWQ-P---KD.Q---IGT--FFYFP
Q9VLC3_DROME/283-401---------------------PHITQCPITP.----HA-------------TFRYSFP-A---DL..---SGT--HFWHS
Q8S2A8_ORYSJ/35-151---------------------AYITQCPIQP.----GG-------------SYVYKYT-I---TG.Q---RGT--LWWHA
SKU5_ARATH/30-146---------------------LG.TNCPIPP.----KW-------------NWTYEFQ-V---KD.Q---IGS--FFYFP
CUEO_SALTI/53-167---------------------DGGPQGIIPA.----GG-------------TRTVTFT-P---QQ.R---AAT--CWIHP
Q9LV68_ARATH/34-150---------------------LG.TNCPIPS.----GW-------------NWTYEFQ-V---KD.Q---IGS--FFYFP
LAC1_NEUCR/91-211---------------------NGVTECPIPPR----GG-------------SKVYRWR-A---TQ..---YGT--SWYHS
Q9ZQW2_POPTR/41-157---------------------AYVTQCPIQT.----GQ-------------AYTYNFT-I---TG.Q---RGT--LLWHA
FIO1_SCHPO/30-151---------------------PQSTQCEIPP.----GA-------------TFYYNYT-A---LQ..---NGT--YWVHS
Q8W0V5_LOLPR/30-146---------------------GMVTQCPIAP.----NT-------------TFTYRFD-V---VG.Q---EGT--LWWHA
LAC17_ARATH/30-146---------------------AYITQCPIQT.----GQ-------------SYVYNYT-I---VG.Q---RGT--LWYHA
LAC11_ARATH/31-147---------------------AYITQCPIQT.----GQ-------------SYLYDFN-V---TG.Q---RGT--LWWHA
LAC7_ARATH/31-147---------------------SMITQCPIQP.----GQ-------------RYAYRFN-I---TG.Q---EGT--LWWHA
LAC3_ORYSJ/32-148---------------------EFVTQCPIKP.----GG-------------SYKYRFT-I---EG.Q---EGT--LWWHA
LAC3_ARATH/33-149---------------------EYITQCPIRP.----GQ-------------TYTYRFK-I---ED.Q---EGT--LWWHA
Q93M03_STRAU/64-181---------------------DGLPMDTIVP.----GG-------------ERTYRYP-N---NQ.P---AAS--LWYHD
CUEO_ECOLI/51-167---------------------DGGPQGIIPP.----GG-------------KRSVTLN-V---DQ.P---AAT--CWFHP
LAC14_ARATH/41-157---------------------EYVTQCPIRP.----GE-------------SYVYRID-L---KV.E---EGT--IWWHA
Q8X010_NEUCS/27-145---------------------VMVTQCPIPP.----GA-------------SFTYNFT-V---DQ..---PGT--YWYHS
PCOA_ECOLX/50-164---------------------PGLSFMGIEP.----DD-------------TYVYTFK-V---KQ..---NGT--YWYHS
Q9C497_GLOLA/74-192---------------------NGVTECPIAP.----GH-------------SKTYKFQ-M---IQ..---YGT--SWYHS
LAC2_ORYSJ/34-150---------------------AYVTQCPIGS.----GG-------------SYVYDFN-V---TR.Q---RGT--LWWHA
Q9SDV9_BRAJU/30-147---------------------AGVTQCPINP.----GE-------------TLTYNFI-V---DK..---AGT--HFYHG
LAC15_ARATH/27-143---------------------EYITQCPIRP.----GS-------------DFLYKVI-F---SI.E---DTT--VWWHA
Q96VT5_EMEND/39-149---------------------PGLSQRPIPP.----GE-------------SFLYKWR-A---TN..---YGS--YFYHA
Q8ZWA8_PYRAE/48-158---------------------DAHPSFAITP.----GE-------------SYNYSFD-V---VN.R---AGT--YLYHP
Q8PCX4_XANCP/56-171---------------------PGMSFDGIAP.----GQ-------------EYLYRFA-L---RQ..---SGT--YWYHS
Q9M5B5_CUCME/45-162---------------------ASISQCAINP.----GE-------------SFTYQFV-V---DK..---PGT--YFYHG
Q8XS25_RALSO/63-177---------------------PGLSFHGIAP.----GE-------------TFTYRFQ-V---RQ..---SGS--YWYHS
Q7MGM1_VIBVY/42-159---------------------PFLSQKPVMP.----GE-------------SFTYRFT-P---PD..---AGT--FWYHP
SKS1_ARATH/34-150---------------------LG.TNCPIPP.----RW-------------NFTYQFQ-V---KD.Q---IGS--FFYSP
Q8NK87_CANAX/29-147---------------------EMVTQCPIPP.----GE-------------TYLYNFT-V---DQ..---VGT--YWYHS
Q989B7_RHILO/43-161---------------------PFLVQPYVNT.----GD-------------HFDYAFT-P---PD..---AGT--FWYHP
Q7XIF0_ORYSJ/35-152---------------------LG.TNCPIPP.----GA-------------NYTYKFQ-A---KD.Q---IGT--FVYFP
Q9AUI3_PINTA/36-152---------------------EYITQCPIRP.----GG-------------SYTYRFT-I---TG.Q---EGT--LWWHA
LAC2_BOTFU/74-191---------------------PGVTQCPIAP.----GD-------------TLTYKFQ-A---TQ..---YGT--TWYHS

PF07731

Q9P861_BLAAD/361-500.........PDNHTDSDFAEYPMRRDTAWVPP....NG-------------NMVLRFV-A...D.-N---PGA--WFFHC
Q9UVV2_ASPFM/370-504...........DGYFANISSTPVKRDTIMVQN....HG-------------HAVLRFR-A...N.-N---PGV--WLIHC
Q9UVW1_ASPFM/438-575........EAKEASPESFLETPVYRDTFTTSPQ..GET-------------WTAIRYH-V...E.-N---PGP--FLLHC
Q93F47_9PSED/243-350....................IPYFTDTYLLGK....NE-------------TARIAFV-A...D.-N---PGV--WMFHC
Q96UP8_GIBIN/312-437..........PNNPVTLKFDNPPRRDVALIPA....GG-------------YLIVAFK-A...D.-N---PGS--WLFHC
Q9P8C3_9HYPO/398-542............TRGVEPYESAGLKDVVYLGK....GE-------------TVVVEAH-Y...AP-W---PGV--YMFHC
Q96V70_GIBIN/302-411............DGTIINRHNPQRRDVVQIRG....NG-------------HLVIQFD-A...GE-N---PGV--WPFHC
Q7S065_NEUCR/364-497...........PGRDVNYNPVPNRRDTVTVWS....WS-------------HAVLRFR-A...D.-N---PGV--WLFHC
Q7S4C0_NEUCR/422-556...........TSPQSFKTKNPPRRDVAALPG....NG-------------YLAIAFM-P...D.-N---PGA--WLCHC
Q7S6W1_NEUCR/414-557....VRHFDPVLDTSSLNFTNPARRDVTMLPG....NG-------------WLIVAFQ-N...E.-N---PGA--WLFHC
LAC15_ARATH/408-547..........EDPSSRYNLYDPPYKNTMTVPR....NG-------------WIAIRFV-A...D.-N---PGV--WFMHC
Q7RX46_NEUCR/320-463.............RSVLPYEAQGLKDVVWLGP....GE-------------TVTVEAH-Y...AP-W---DGV--YMFHC
Q9C1Z1_PICPA/365-505........PYNASEAHDIPENPMRRDTVYVNP....QS-------------YFVIRFK-A...D.-N---PGV--WFFHC
LAC1_ARATH/429-565...........KDPKRYNLVDPPERNTFAVPT....GG-------------WAAIRIN-A...D.-N---PGV--WFIHC
PHSA_STRAT/471-624....TPVRLDPDTPVPLAPNELGHKDVFQVPG....PQ-------------GLRVMGK-F...DG-A---YGR--FMYHC
FIO1_SCHPO/364-501...........DQESHTYYDNPMRRDTVEIEP....GS-------------FIVIRFI-A...D.-N---PGA--WVIHC
Q8TFD9_GAEGR/415-543.............VTKLITTNPMRRDTAILPA....AG-------------HLVLAFK-T...D.-N---PGA--WLMHC
Q7SDL8_NEUCR/387-512..............TIVRSSNPVRRDTEVVRP....HG-------------HLVLQFD-A...N.-N---PGI--WAFHC
Q8VYB3_ARATH/384-525............SRREYNLRDAISRSTTQVYP....ES-------------WTAVYVA-L...D.-N---VGM--WNLRS
Q8NID5_9APHY/368-496.................NYVNPPQRDTVSVGA...AGD-------------NVTIRFR-T...D.-N---PGP--WFLHC
Q7XIF0_ORYSJ/383-523............QRTTYNLVDAQARHTVQVYP....NG-------------WSAILVS-L...D.-N---QGM--WNLRS
Q8CXJ7_OCEIH/350-508.......IIYTDAPLSPAENEKSWKDTLAAPS....AH-------------VTRVIAK-F...EP-F---TGD--YVWHC
Q8I8Y1_MANSE/570-726.......AFDEAGLLKRNLKNAPIKDTVTVPD....GG-------------YTVIRFK-A...D.-N---PGY--WLFHC
Q8NK87_CANAX/361-501........TYNATDHADWPEYPMVRDTVYVRP....QS-------------YIVMRFK-A...D.-N---PGV--WFFHC
Q00292_ASPTE/424-564..............IAPQLDNPPRRDVVDVDI....GG-------------YAWIAFE-V...D.-N---PGA--WLLHC
LAC6_ARATH/417-553.............TAKFNLEDPPYLNTIGVPV....GG-------------WAAIRFV-A...N.-N---PGL--WLLHC
Q7NRY4_CHRVO/360-497................RAESYLAWRDVVNVPP....GQ-------------KVRLRFR-....QD-M---PGP--RMFHC
LAC1_AGABI/371-491.................NFKNPPRRDVYPIN.....GG-------------NTTFRFF-T...D.-N---PGA--WFLHC
Q9ZQW5_POPTR/254-388...........TDPKKFNLVDPVERNTIGVPS....GG-------------WVAIRFR-A...D.-N---PGV--WFMHC
Q804X3_CHICK/941-1065........................MGVYNLYP....GV-------------FGTVEMQ-P...S.-H---AGI--WQVEC
O65449_ARATH/375-516............SRAKYNLRDAVSRSTVQVYP....RA-------------WTAIYIA-L...D.-N---VGM--WNIRS
Q9LQT5_ARATH/347-487............KKAGYNLVDAVSRSTVQVYP....YS-------------WTAILIA-M...D.-N---QGM--WNVRS
Q90ZT2_DANRE/489-613........................ADVFDLVP....GT-------------FQTVTMR-P...L.-Y---SGT--WLLHC
BLRO_MYRVE/371-515...............TVMPYESGLKDVVWLGR....RE-------------TVVVEAH-Y...AP-F---PGV--YMFHC
LAC3_ARATH/419-554...........TDPARFNLFDPPERNTIGTPP....GG-------------WVAIRFV-A...D.-N---PGA--WFMHC
SKS1_ARATH/397-536............KKGSYNNWDAISRSTIEVYP....GG-------------WTAVLIS-L...D.-N---VGV--WNIRV
Q82JK0_STRAW/341-480.................TGVDLGWFDTYEVVG....GG-------------TIKIAMQ-FTDFAD-D---TYM--YMLHC
Q7MGM1_VIBVY/340-461..................LAEPFHTDTVLLGK....NG-------------SAKAAFV-A...D.-N---PGR--WMYHC
Q9SFF1_ARATH/376-516............SRKVYNLNDAILRCTIQVYP....RS-------------WTAIYIA-L...D.-N---VGM--WNMRS
Q8XX19_RALSO/116-246........................DASVAINI....GG-------------SFTYYYL-A...P.-D---AGT--YFWHC
LAC7_ARATH/412-551...........RDRSKLNLVDPQSRNTLAVPV....GG-------------WAVIRFT-A...N.-N---PGA--WIFHC
Q9ZVV3_ARATH/388-531............KRENYNLLDAVSRHTVQVYP....KS-------------WSAILLT-F...D.-N---AGM--WNIRS
Q9UVT5_LENED/376-499.................NYKNPVSCTYVVH......PK-------------QTTIRFV-T...D.-N---PGP--WFLHC
Q7S2V2_NEUCR/516-661...........TSMDTWNYENPPRRDTIMAPA....GG-------------YVAVAFK-P...D.-N---PGV--WLVHC
SKU5_ARATH/394-533............SRGTYNKWDGIARSTIQVYP....GA-------------WSAILIS-L...D.-N---PGA--WNLRT
Q7RYF6_NEUCR/414-556.....ILFDPVVDGPHLKFDNPTRRDTTVVPS....FG-------------WLVIAFE-A...GR-N---PGS--WVFHC
Q8J0L7_CLAPU/359-497.........EGGPSGKTFPKVPMRRDTIVLYP....PG-------------NMVLRFK-A...D.-N---PGV--WLFHC
Q8RNQ3_LEGPN/688-807.....................DPLLHTIEVPP....GA-------------TAVADFD-T...E.-A---SGQ--WFFHC
LAC2_ORYSJ/411-546...........KDPAKYNLVDPPERNTVGVPA....GG-------------WTAIRFR-A...D.-N---PGV--WFLHC
LAC1_THACU/419-544.................NYVNPPRRDVVGST.....DA-------------GVRIQFK-T...D.-N---PGP--WFLHC
FET3_CANAX/362-502........TFNVSDHAEWPEYPMIRDTVYVKP....HS-------------YMVLRFK-A...D.-N---PVV--WFFHC
O24041_LIRTU/420-554...........KDPAKFNLVDPIERNTVGVPS....GG-------------WAAIRFR-A...D.-N---PGV--WFMHC
O68054_RHOCA/369-490...................IAGALRDTVSVPP....MG-------------SVTVALD-A...G.-E---AAP--WMLHC
Q9VX11_DROME/473-628.......QIDKKTPLPRRAKGAPLKDSVQVPA....FG-------------YTILRFY-S...N.-S---PGY--WMFHC
Q9FSC9_POPTR/404-539...........NDPKKFNLADPVERNTVSVPT....AG-------------WIAIRFK-A...D.-N---PGV--WFLHC
LAC2_BOTFU/413-547...........KSPANFNLVNPPRRDVAALPG....NG-------------YLAIAFK-L...D.-N---PGS--WLLHC
Q93HV5_STRGR/170-308............PSRVIGQQDLRPRDSYGLQI....IA-------------GERV...-......-G---AGA--WMYHC
Q8GB87_STRLA/454-610....APLAPDPATPVPLPPNERGYKDVFRALP....GQ-------------MLRVMGR-F...DG-A---YGR--FMYHC
E9ACP0_LEIMA/403-552..........NETMAMYGVHSGEFRDTIPIL.....DG-------------VTTIRWK-A...AT-Y---VGE--VVYHC
LAC4_TRAVI/366-494.................NFVNPVRRDVVNTGT...VGD-------------NVTIRFT-T...D.-N---PGP--WFLHC
Q9P8G4_9APHY/369-494.................NYKNPVQRDTVSIGD...STD-------------NVTIRFF-T...D.-N---PGP--WFLHC
Q87F38_XYLFT/490-609.....................QVRKHTIDMPP....GT-------------RRSYRVR-A...D.-A---LGR--WAYHC
FTSP_PHOLL/334-472.................QPQDYGWKDTVWV......DG-------------RVELLVY-MNQPSY-E---HFP--FLYYS
Q8WZH9_LENED/381-493.................NYENPVRRDVTSVAI....GN-------------QTTIRFV-T...D.-N---PGP--WFLHC
Q9CJQ6_PASMU/378-515................FKPEGRALKDVVNLRP....YE-------------KVIIRFK-....QG-H---TGL--KMYHC
O53858_MYCTU/384-503.....................GARKDTVIVLP....KQ-------------KMRAVLV-A...D.-N---PGV--WVMHC
LAC9_ARATH/411-552...........RDARKLNLFNPQMHNTVGVPP....GG-------------WVVLRFI-A...N.-N---PGI--WLFHC
Q96VT5_EMEND/456-583........AAKHMPESFNFETPQIRDTFATLPAATGPT-------------WLALRYH-V...V.-N---PGP--FLLHC
COPA_PSEUB/489-608.....................RVRKHTIDMPP....GS-------------KRSYRVT-A...D.-A---LGR--WAYHC
O23170_ARATH/380-520............MRKRYNLVDAVPRHTFQVYP....LS-------------WTTILVS-L...D.-N---KGM--WNLRS
Q8GP36_CORDP/379-493........................KDTVLLRH....GE-------------TMIADLI-A...D.-N---PGE--WAFHC
Q942J6_ORYSJ/381-524............CRKTYNLLDTVSRHTIQVYP....RS-------------WTAVMLT-F...D.-N---AGM--WNIRS
FET3_YEAST/362-504.......HSFDPDNHPAFPEYPMRRDTLYVRP....QS-------------NFVIRFK-A...D.-N---PGV--WFFHC
FET5_YEAST/367-517...EMTVPYNESAPLQPFPERPMVRDTVVLEP....SG-------------HVVLRFR-A...D.-N---PGV--WYFHC
Q89KF9_BRAJA/312-434...................WKPYWLDTLAIES....GQ-------------TQRIAFA-A...T.-S---PGR--WLIES
Q9LV68_ARATH/382-521............SRSTYNKGDAVARSTTQVFP....GA-------------WTAVLVS-L...D.-N---AGM--WNLRI
O60199_PLEOS/365-491.................NYENPVRRDVVSIGDD..PTD-------------NVTIRFV-A...D.-N---AGP--WFLHC
Q7X4G1_XANEU/217-341.................PKSTRWHEVTADVAV....GQ-------------MRQIEFV-A...D.-E---EGD--WAFHC
Q7Z8S2_PLESA/371-496.................NYNNPVRRDVVSTGT...GSD-------------NVTIRFK-T...D.-N---PGP--WFLHC
O13420_9APHY/364-493.................NYVDPIFRDVVSTGTP.AAGD-------------NVTIRFH-T...D.-N---PGP--WFLHC
O67206_AQUAE/387-526.................RATDLGWKDTVIVAP....ME-------------TVRIAVD-MSHPYN-E---HQI--YLLHC
Q96TR4_PLEOS/372-492.................NLVNPPRRDVLPIN.....GG-------------NTTFRFF-S...G.-N---SGA--WFLHC
Q8I8Y0_MANSE/577-738...LDLDRRGLLERHLKQGDLPPAKDTIAVPN....SG-------------YVILRFR-A...T.-N---PGF--WLLHC
Q9VBK7_DROME/508-666......LDRRGRLPRLSEDSAAVAKDTVQIPG....QG-------------YIIVRFI-S...N.-N---PGF--WLYHC
Q84ZL7_ORYSJ/403-540............CRSRYNKWDAISRSTTQVFP....GG-------------WTAVLVS-L...D.-N---VGI--WNLRS
O74171_SCHCO/363-488.................NYANPIRRDVVNTGL...AGD-------------NTTIRFR-T...D.-N---SGP--WILHC
LAC2_PODAS/426-569......RFNPATDMALLKSSNPVRRDVAMLPA....NG-------------WLLIAFK-S...D.-N---PGA--WLFHC
O59944_CERSU/368-493.................NYVDPIQRDVVSIGG...ATD-------------NVTIRFT-T...D.-N---PGP--WFFHC
Q94ID0_TOXVR/389-516...........TDPPKYNLVDPPELNTINLPR....IG-------------WAAIRFV-A...D.-N---PGV--WFLHC
Q8XS25_RALSO/486-605.....................QVRRHTVPVQP....AQ-------------RISFLVT-A...D.-A---LGR--WAWHC
Q7S9Z8_NEUCR/523-687GKRWFTPDKLNCENERLDCENPTRRDVVLLPA....SG-------------YVVIAFK-A...D.-N---PGA--WILHC
Q8X010_NEUCS/358-513.....SSTSSFSTSNGSNHTAPMRRDTLVVEP....NG-------------NAVIRFQ-A...D.-N---PGV--WLFHC
Q7N890_PHOLL/374-513.................AAHRSGWKDIVHVE.....GK-------------ESEVLVQ-FKHTAG-V---KHP--FMAHC
Q84SA8_ASTTR/257-395...........LDSANFNLVNPQERNTLGVPA....GG-------------WAVIRFR-A...N.-N---FCV--WYFHC
Q8X1W2_LENED/396-521.................NFKNPVRRDTTLVAM....KN-------------QTTIRFV-T...D.-N---AGP--WFLHC
FET3_CANGA/362-504.......HSFNDSDHAAYPSIPMKRDTVYLNP....QS-------------NMVLRFK-A...D.-N---PGV--WFFHC
ASOL_TOBAC/383-524............KRKNYNLVDGLSRNNIQVYP....NS-------------WAAIMLT-F...D.-N---AGM--WNLRS
Q9C497_GLOLA/416-556......GPYSSVKYPSLNFANPTRRDVAQLPG....NG-------------WMVIAFR-T...D.-N---PGA--WLMHC
Q8YQ92_NOSS1/200-332...................KASEKTDVITMGV....AE-------------RHILEFA-F...R.-Y---PGK--YMFHP
Q7NG83_GLOVI/190-322...................AADEEADVVTMGT....AE-------------RHILEFA-Y...R.-D---PGT--YMFHP
LAC2_ARATH/423-557...........RDPKHYNLVDPVERNTINIPS....GG-------------WVAIRFL-A...D.-N---PGV--WLMHC
Q9A9L6_CAUCR/444-566......................PLKHTVNVAP....GG-------------KVAFDLT-A...D.-E---PGD--WAFHC
Q9AUI3_PINTA/418-554...........TDPQKFNLVDPPMRNTVNVPV....NG-------------WAAIRFV-A...D.-N---PGA--WVMHC
Q9FKY9_ARATH/382-522............KRSLHNLVDALTRHTTQVYP....ES-------------WTTILVS-L...D.-N---QGM--WNMRS
CUEO_YERPE/393-532.................AEHRRGWKDIVRVE.....GA-------------RSEILVR-FNYLAP-A---STP--YMAHC
Q8TFE2_9PEZI/409-548......RFNAATDLATLRFDNPVRRDVTMLPA....NG-------------WIVVAFR-T...D.-N---PGA--WLFHC
Q7S1M8_NEUCR/347-488......EYNPNTDKSTLRGNNPPRRDTTMLPA....WG-------------WLLVAWR-T...N.-N---PGV--WLFHC
Q8YCF0_BRUME/358-494.................PAHQTGWKDTALI......DG-------------KAEILVH-FDREAA-R---SHP--FMFHC
FTSP_SALTI/333-470.................FPEDRGWKDTVWV......DG-------------QVELLVY-YGQPSW-P---HFP--FYFNS
Q9AUI1_PINTA/428-562...........KDAPNFNLVDPVERNTAGVPK....GG-------------WMAIRFR-A...D.-N---PGV--WFMHC
LAC4_THACU/380-502.................NYVNPPRRDVVRVG.....GT-------------GVVLRFK-A...D.-N---PGP--WFVHC
LAC14_ARATH/420-553...........KDPLRYNLVDPPEETTVGVPR....NG-------------WTAVRFV-A...N.-N---PGV--WLLHC
LAC3_ORYSJ/415-551...........KDAKKFNYVDPPQRNTVAVPT....NG-------------WAVIRFV-A...D.-N---PGV--WLMHC
O04870_SOLLC/354-493............SRNGYNLRDAVSRCTTQVYP....KS-------------WTAIYIA-L...D.-N---VGM--WNLRT
Q9X8C0_STRCO/91-236..............TSWQTDPGIWWDTFRLPP....DG-------------EFTLRTY-F..RPD-I---TGK--TVFHC
Q9LX04_ORYSJ/396-535............SRGTYNKWDGVSRCTTQVFP....GA-------------WTAVMLS-L...D.-S---PGF--WNVRT
Q9Y781_COPCI/368-493.................NFANPVRRDVVSAGV...AGD-------------NVTIRFR-T...D.-N---PGP--WILHC
COTA_BACSU/354-512.......LSYTGPAVPPPPSEKGWKDTIQAHA....GE-------------VLRIAAT-F...GP-Y---SGR--YVWHC
Q82XJ1_NITEU/485-608.....................LPRKHTVLVKP....AE-------------RVSVAIT-A...D.-A---PGP--WAFHC
Q8W0V5_LOLPR/411-556...........RDTASYNLVDPPVKNTVMVTG....LG-------------WAAVRFV-A...D.-N---PGN--WFLHC
A9CFX2_AGRT5/212-336.................RPEARWPEVSIDIPV....GA-------------MRAYEFD-A...K.-Y---VGD--WAIHC
Q89T40_BRAJA/212-336.................PESAQIPETTTDVPV....GA-------------VRVFDVL-A...D.-N---PGD--WAFHC
Q7W3D4_BORPA/466-585.....................QVRKHTISLNP....AQ-------------RISYRVS-A...D.-A---RGN--WAYHC
LAC1_NEUCR/427-569.......FDPAVDMARLNGNNPTRRDTAMLPA....KG-------------WLLIAFR-T...D.-N---PGS--WLMHC
Q875H3_PHACH/405-542.............NVTLNTVNPLSRDTVEIPA....NG-------------WVRLRFI-T...Y.-N---PGA--WTLHC
Q875H1_COPCO/371-497.................NFVNPVRRDVVSLGSN..TAD-------------RVTVRFV-T...D.-N---AGP--WIMHC
Q8FQU9_COREF/414-557.................EVPVDGWKDTVGLPP....GA-------------TARLAVE-FGYHPD-P---AWP--YMYHC

PF00394

Q9UVV2_ASPFM/150-308---------------------PARDKKIRLAT----GQ-------------RMSILLK-T...KDNT...DRN--YAIWD
LAC4_ORYSJ/162-316---------------------PFTVDTLVISP----GQ-------------TTNVLLT-A..KPYYP...GAN--FYMSA
NIR_RHOS5/206-358---------------------ERDLETWFIRG----GS-------------AGAALYK-F...LQ.....PGV--YAYVN
LAC1_NEUCR/219-366---------------------PYKVDSLFLGV----GQ-------------RYDVIID-A...NQ.A...VGN--YWFNV
LAC1_BOTFU/191-337---------------------PYNATSILVSI----AQ-------------RYDIIVT-A...NA.A...VGN--YWIRA
LAC1_CRYPA/201-349---------------------SFTTDSLFVGI----GQ-------------RYDVTID-A...SQ.A...TDN--YWMNV
O68601_ALCXX/192-344---------------------QRDLETWFIRG----GS-------------AGAALYT-F...KQ.....PGV--YAYLN
LAC1_PHLRA/163-307---------------------PLTVDELTIYA----GQ-------------RYSFILT-A...DQ.D...VDN--YWIRA
LAC5_ARATH/160-312---------------------PFTTNVIVLGP----GQ-------------TTDVLIT-G..DQ..P...PNR--YYMAA
O64838_ARATH/161-298---------------------QEVYESLDIHV----GQ-------------SVTVLVT-L...KA.P...VKD--YFIVA
Q9Y781_COPCI/165-306---------------------PLVVDSIQIFA----GQ-------------RYSFVLN-A...NR.P...VGN--YWVRA
ASO_TOBAC/163-329---------------------PFSVQDMDIYS----GE-------------SYSVLFK-T...DQ.D..PTKN--YWISI
Q9UVT5_LENED/175-316---------------------PATVDNIQIFP----GQ-------------RYSFVLT-A...TQ.P...VDN--YWVRA
O53858_MYCTU/190-352---------------------PTEVDALLIGM----AE-------------RYDVMVT-A...AG......GV--FPLVA
Q9SDV9_BRAJU/154-321---------------------PFTVDDIDLYS----GE-------------TYSVLLR-T..HNP.T..PSRN--YWISV
FET3_CANAX/155-302---------------------KNTTDLIYITV----AQ-------------RYGVLIT-T...KNST...DKN--YVFMN
LAC5_TRAVE/165-309---------------------ALDVDSIQIFA----GQ-------------RYSFILN-A...NQ.S...IDN--YWIRA
O74171_SCHCO/158-299---------------------PLVVDSLEVFA----GQ-------------RYSVVVH-A...NQ.R...IGN--YWIRA
Q00292_ASPTE/189-347---------------------PYSTNVLNVGM----GQ-------------RYEIVVE-A...NA.DRTQGSS--FWIHA
O13422_9APHY/167-309---------------------PLEVDSLQIFA----GQ-------------RYSFVLE-A...NQ.A...VDN--YWVRA
LAC4_ARATH/158-308---------------------PFKTDTVLIAP----GQ-------------TTNVLLT-A..SK..S...AGK--YLVTA
FIO1_SCHPO/158-306---------------------PQEVSSIHLTV----AQ-------------RYSVLVT-A...KNST...DRN--YAITA
Q9ZQW3_POPTR/156-306---------------------PFSTDTIFIGP----GQ-------------TTNALLT-A..DK..S...IGK--YLIAV
LAC7_ARATH/157-310---------------------PYVTDVIVIAP----GQ-------------TIDALLF-A..DQS.V...DTS--YYMAA
Q9SVE3_ARATH/161-299---------------------QSMYTSLDIHV----GQ-------------SYSVLVT-M...DQ.P...DQD--YDIVV
LAC4_TRAVE/164-306---------------------PLTVDSIQIYA----GQ-------------RYSFVLT-A...DQ.D...IDN--YFIRA
P93366_TOBAC/156-307---------------------PFKTDTIVIAP----GQ-------------TTNVIVT-A..NQ..G...SGK--YMVAA
SKU5_ARATH/156-311---------------------QQNYTSLDIHV----GQ-------------SYSFLVT-M...DQNA...SSD--YYIVA
Q56795_XANCA/189-368---------------------PVSVDEFRIAV----AE-------------TFDVIVE-P...SG.....QDA--FTIFA
FA8_HUMAN/218-349---------------------..RQASLEISP----IT-------------FLTAQTL-L...MD.....LGQ--FLLFC
Q38757_ACEPS/157-308---------------------PINTEYIMITP----GQ-------------TMDVLVT-A..NQ..P...ASY--YYMAA
FET3_YEAST/155-302---------------------KNVTDMLYITV----AQ-------------RYTVLVH-T...KNDT...DKN--FAIMQ
O65449_ARATH/157-295---------------------QNIYTSLDIHL----GQ-------------SYSVLVT-A...NQ.A...PQD--YYIVI
Q9SFF1_ARATH/160-297---------------------QNLFSSLDVHV----GQ-------------SYSVLIT-A...DQ.P...AKD--YYVVV
ASOL_BRANA/159-302---------------------QNDYDSLDVHV----GQ-------------CFGTIVT-A...NQ.E...PKD--YYMVA
FET5_YEAST/157-305---------------------PNFTDSIYLSA----GQ-------------RMSVLIK-A..KDKMP...TRN--YAMMQ
Q9ZQW2_POPTR/167-320---------------------PFEADTLLISP----GQ-------------TTNVLLK-T..KPHLP...NAT--FYMFA
LAC3_TRAVI/163-301---------------------PHQVDGLQIFA----AQ-------------RYSFVLN-A...NQ.A...VNN--YWIRA
O23170_ARATH/162-300---------------------QESYESLDVHV----GQ-------------SMTVLVT-L...KA.S...VRD--YFIVA
LAC1_TRAHI/163-305---------------------PLVVDSIQIFA----AQ-------------RYSFVLN-A...DQ.D...VGN--YWIRA
O04947_ARATH/149-316---------------------PFTTDDIDIYS----GE-------------SYSVLLT-T...DQ.D..PSHN--YYISV
COPA_PSEUB/172-350---------------------PVEVDELRIAV----AE-------------TFDVIVE-P...TA......EA--YTVFA
Q9ZR60_CUCME/20-183---------------------PFQVNNLFIYS----GE-------------TYSVLIK-A...DQ.D..PSRN--YWITT
LAC1_AGABI/160-312---------------------PVEVQNVDIYA----AQ-------------RVSVILH-A...NQ.P...IDN--YWIRA
LAC2_PODAS/213-360---------------------AQTVDSLFLAV----GQ-------------RYDVTID-A...NK.S...VGN--YWFNA
LAC2_ARATH/161-314---------------------PFQTNIVLLGP----GQ-------------TTNVLLK-T..KPIYP...NAT--FYMLA
O65670_ARATH/168-334---------------------PFTVKNLFVYS----GE-------------TYSVLLK-A...DQ.N..PRRN--YWITS
LAC4_THACU/161-317---------------------PLPVDSFQIYA----GQ-------------RYSVIVE-A...NQ.T...AAN--YWIRA
Q9SUD0_ARATH/159-299---------------------QTMYTSLDIHV----GQ-------------TYSFLVT-M...DQ.P...PQN--YSIVV
LAC3_ARATH/159-310---------------------PFTTNVIMIGP----GQ-------------TTNVLLT-A..NQ..R...PGR--YYMAA
NIR_ALCFA/210-362---------------------DVDQETWFIPG----GA-------------AGAAFYT-F...QQ.....PGI--YAYVN
O24093_MEDTR/158-324---------------------PFAVDDIDIYS----GE-------------TYSVLLT-T...DQ.D..PKKN--