Sequence alignment for CL0027

PF00680

POLG_HAVHM/1750-2215---------------------------M..NVVSKTLFRKSPIYHHIDKTMI..--------------------------
RDRP_BPPH6/19-638---------------------------FANNIKAQQASKRSFKEGAIETYEGLL--------------------------
POLG_PYFV1/2270-2778---------------------------P..KSITKSTIVPSLIQPYMPRKPL..--------------------------
POL1_CPMVS/1186-1687---------------------------I..PLPTKTALVETPSEWHLDTPCD..--------------------------
POLG_RHDVF/1279-1750---------------------------P..VSGTRYAKVPGVPDEYKTG.....--------------------------
POLG_PVYN/2293-2763---------------------------V..ATMKSQLVTKHVVKGECRHFTEFL--------------------------
POLG_EMCVR/1844-2288---------------------------I..HVPRKTALRPTVARQVFQPA....--------------------------
POLG_FCVUR/1266-1735---------------------------.....GTRLHVSPAHTEDFEECS....--------------------------
POLG_NVN68/1301-1766---------------------------...ALSTKTKFWRSSPEPLPPGV....--------------------------
Q9DLK1_FMDVP/1865-2314---------------------------V..HVMRKTKLAPTVAHGVFNPE....--------------------------
POLG_VESVA/1379-1848---------------------------....KGTRLHVSPAHVDDYEECT....--------------------------
POL1_BAYMY/1634-2098---------------------------...GQMNKGLIDKHVIVGENDDVYDFM--------------------------

PF02123

Q83093_9VIRU/437-816---------------------------SSRQVKSSQSSNSTAGLSEVVGQKEDP..........................
Q66150_9VIRU/22-408---------------------------.HRDVRAAESEFPELKELAWPSRGSKA..........................
Q86519_9VIRU/516-902---------------------------SAQLSKTQSQYSQILKDLSVLRGEVKQ..........................
RDRP_SCPMV/464-849---------------------------.ADAVTAATKVFPELSELGWPERGSGA..........................
RDRP_SBMVA/490-847---------------------------.....................................................
RDRP_PEMVW/733-1124---------------------------GERVARTSAFLQACTEKYSWPETGAEA..........................
RDRP_PLRVW/609-1004---------------------------GQKLCQVHPELADKTAGFGWPKAGFEA..........................
RDRP_TYYVF/580-974---------------------------GKTLVGNHPALGEKTSGFGWPKFGPEA..........................
Q65969_9LUTE/603-996---------------------------GDKICKQHPEMGDLTKGFGWPQFGAKA..........................
RDRP_ROTGI/108-803---------------------------RLNVEEYASIQEIELQAKQWRAENAKSLRPYHYNIPINEYLRDNEIEVLDTGD
RDRP_ROTHC/109-749---------------------------HAPQKDAKPYENNIITSEIFKEKSEYT..........................
O55590_9REOV/104-749---------------------------NDLDYENNKLTSELFNEESYTDSLMDP..........................
RDRP_ROTPY/100-748---------------------------ADLTANELDYENNKITSELFKSAEEYT..........................
Q90153_9VIRU/1025-1530---------------------------KKNNLQVKDICKIIIQKLKNPKTMKPN..........................
Q90193_9VIRU/400-785---------------------------........................HKS..........................
RDRP_PCVC/362-832---------------------------............HTFDILSMPDAKEIA..........................
RDRP_SCVLB/837-1303---------------------------RDNFTYNYNMEKEKYRITQYHHTHVRL..........................
Q87025_SCVLA/177-657---------------------------.DRNIRPKHFKGLRLYTSSKVTAQHHT..........................
Q90155_TTV1/96-539---------------------------KNPRLLTSETELQLFPLKENSAARTKA..........................
Q9JE94_9VIRU/129-560---------------------------HSLRNLTKEQEITLFPIKDIVQANRRV..........................
Q8V615_9VIRU/41-473---------------------------VNLKFLNKEMELELFPLKKAPQADLKV..........................
Q83073_9VIRU/49-523---------------------------DSLILSLEGVLGHKYKLKQHIGASTKV..........................
RDRP_LRVLG/155-619---------------------------SDPNISQNKIPRHYYQLKVHVGAQKKV..........................
Q98XW8_9VIRU/144-622---------------------------RNGRSPSKEWLLGYWPRKSHPLAGKKA..........................
Q99AT3_9VIRU/99-573---------------------------SFRWLCDPKASYAAFPPKQHPGAMNKV..........................
Q9YXE4_9VIRU/99-573---------------------------QAGWSYSDRATLAEFGLKSNPAASNKV..........................
RDRP_HV19S/122-585---------------------------GHLVCNDKAFRERYFPKKKHAAAAIKT..........................
Q9YXE6_9VIRU/120-589---------------------------FARLLNDHSFRRSCFPTKKMLPAEVKP..........................

PF04197

RDRP_IBDVU/1-875MSDVFNSPQARSKISAAFGIKPTAGQDVEELLIPKVWVPPEDPLASPSRLAKFLRENGYKILQPRSLPENEEYETDQILP
RDRP_IPNVJ/1-842MSDIFNSPQNKASILTALM.KSTTGD.VEDVLIPKRFRPAKDPLDSPQAAAQFLKDNKYRILRPRAIPTMVELETDAALP
RDRP_BSNV/1-863MSDVFNTPHARRTITQALG.LTNVSDRTQDWLLPEPWNPPMDPIKNSQEAAEYLQRNQYRMLKPRAIPENTPLDTSELFP

PF00978

R1AB_LIYV9/1925-2366--------------------------------------------------------------------------------
R1AB_BYVU/2601-3046--------------------------------------------------------------------------------
Q9YPH5_9VIRU/1359-1796--------------------------------------------------------------------------------
POLN_EEVVM/2041-2488--------------------------------------------------------------------------------
E0YCR0_9CLOS/53-491--------------------------------------------------------------------------------
RDRP_TOMS1/1168-1609--------------------------------------------------------------------------------
RDRP_PSVJ/295-726--------------------------------------------------------------------------------
Q66107_9BROM/228-662--------------------------------------------------------------------------------
Q87644_SINDV/2053-2501--------------------------------------------------------------------------------
O56790_9VIRU/1323-1760--------------------------------------------------------------------------------
RDRP_CMVFN/308-738--------------------------------------------------------------------------------
Q9WJD8_PEBV/1299-1738--------------------------------------------------------------------------------
Q80875_BSMV/195-630--------------------------------------------------------------------------------
RDRP_RBDVR/1234-1674--------------------------------------------------------------------------------
RDRP_SBWMN/1373-1810--------------------------------------------------------------------------------
POLN_ONNVI/2053-2501--------------------------------------------------------------------------------
RDRP_TAV/313-742--------------------------------------------------------------------------------
POLN_MIDDV/534-981--------------------------------------------------------------------------------
RDRP_TMGMV/1163-1604--------------------------------------------------------------------------------
RDRP_TOBSV/253-689--------------------------------------------------------------------------------
RDRP_OLV2I/310-732--------------------------------------------------------------------------------
RDRP_YOMV/1155-1594--------------------------------------------------------------------------------
RDRP_AMVLE/318-752--------------------------------------------------------------------------------
POLN_RRVN/2019-2467--------------------------------------------------------------------------------
RDRP_ASPVP/1758-2169--------------------------------------------------------------------------------
O56250_9VIRU/1240-1678--------------------------------------------------------------------------------
O90699_9VIRU/1363-1800--------------------------------------------------------------------------------
Q9Q6Q3_9CLOS/62-509--------------------------------------------------------------------------------
POLN_AURAV/2038-2486--------------------------------------------------------------------------------
RDRP_BBMV/271-697--------------------------------------------------------------------------------
RDRP_CCMV/267-697--------------------------------------------------------------------------------
Q66581_EEEV/144-598--------------------------------------------------------------------------------
Q9QGG9_9BROM/363-797--------------------------------------------------------------------------------
RDRP_TMOB/1167-1614--------------------------------------------------------------------------------
RDRP_BMV/256-688--------------------------------------------------------------------------------
O40960_9CLOS/62-506--------------------------------------------------------------------------------

PF00998

RDRP_TNVA/224-703--------------------------------------------------------------------------------
RDRP_TCV/272-752--------------------------------------------------------------------------------
RDRP_TNVD/224-709--------------------------------------------------------------------------------
RDRP_MCMVK/460-941--------------------------------------------------------------------------------
POLG_HCVEU/2430-2941--------------------------------------------------------------------------------
POLG_HCVED/2420-2931--------------------------------------------------------------------------------
POLG_HCVJL/2434-2945--------------------------------------------------------------------------------
POLG_HCVJK/2431-2942--------------------------------------------------------------------------------
POLG_HCVEV/2426-2937--------------------------------------------------------------------------------
POLG_HCVJ6/2445-2956--------------------------------------------------------------------------------
Q9IR83_9TOMB/236-712--------------------------------------------------------------------------------
Q87031_9LUTE/24-502--------------------------------------------------------------------------------
RDRP_POLVP/251-722--------------------------------------------------------------------------------
Q65987_9TOMB/269-750--------------------------------------------------------------------------------
P90338_9TOMB/1-480--------------------------------------------------------------------------------
RDRP_BYDV1/361-840--------------------------------------------------------------------------------
O09796_9HEPC/2422-2933--------------------------------------------------------------------------------
O09803_9FLAV/2373-2866--------------------------------------------------------------------------------
O37361_9VIRU/252-737--------------------------------------------------------------------------------
Q9WJD9_CARMV/267-744--------------------------------------------------------------------------------
Q83103_9TOMB/228-711--------------------------------------------------------------------------------
Q66127_9VIRU/52-520--------------------------------------------------------------------------------
RDRP_PMVK/447-937--------------------------------------------------------------------------------
POLG_GBVB/2277-2785--------------------------------------------------------------------------------
Q89801_9TOMB/1-479--------------------------------------------------------------------------------
Q9IRA1_9TOMB/266-741--------------------------------------------------------------------------------
O12301_9TOMB/231-708--------------------------------------------------------------------------------
Q83424_MNSV/290-772--------------------------------------------------------------------------------
O41892_9FLAV/2409-2899--------------------------------------------------------------------------------
RDRP_OCSVU/235-734--------------------------------------------------------------------------------
Q9IW60_9TOMB/325-800--------------------------------------------------------------------------------
Q96898_9FLAV/2396-2886--------------------------------------------------------------------------------
RDRP_RCNMV/260-745--------------------------------------------------------------------------------

PF00972

POLG_YEFV1/2758-3406--------------------------------------------------------------------------------

PF00078

A0A016RNU0_KLEPN/135-366--------------------------------------------------------------------------------
A0A025GH98_ECO57/115-332--------------------------------------------------------------------------------
D7ZFU1_ECOLX/62-269--------------------------------------------------------------------------------
F6BM08_SINMB/72-291--------------------------------------------------------------------------------
M7UYJ9_ECOLX/33-239--------------------------------------------------------------------------------
O01419_BOMMO/502-756--------------------------------------------------------------------------------
O18558_AEDAE/472-725--------------------------------------------------------------------------------
O42691_ALTAL/36-202--------------------------------------------------------------------------------
O44316_DROMR/394-650--------------------------------------------------------------------------------
O52231_STREE/68-275--------------------------------------------------------------------------------
O62658_CANFA/517-773--------------------------------------------------------------------------------
O64612_ARATH/788-1031--------------------------------------------------------------------------------
O65244_ARATH/405-664--------------------------------------------------------------------------------
O65598_ARATH/489-747--------------------------------------------------------------------------------
O81284_ARATH/58-317--------------------------------------------------------------------------------
O81454_ARATH/144-304--------------------------------------------------------------------------------
O93520_ORYLA/518-771--------------------------------------------------------------------------------
O96546_LYMDI/526-780--------------------------------------------------------------------------------
O99969_PORPU/100-315--------------------------------------------------------------------------------
POL_RSVP/769-938--------------------------------------------------------------------------------
POL_HTL1A/633-804--------------------------------------------------------------------------------
POL_SMRVH/71-240--------------------------------------------------------------------------------
POL_MMTVB/68-237--------------------------------------------------------------------------------
POL_CAMVC/289-452--------------------------------------------------------------------------------
POL_IPHA/60-229--------------------------------------------------------------------------------
POL_HV1MA/655-826--------------------------------------------------------------------------------
TF21_SCHPO/455-615--------------------------------------------------------------------------------
POK10_HUMAN/76-245--------------------------------------------------------------------------------
POL4_DROME/357-523--------------------------------------------------------------------------------
POLY_DROME/224-390--------------------------------------------------------------------------------
POL_EIAV9/249-419--------------------------------------------------------------------------------
YTX2_XENLA/513-765--------------------------------------------------------------------------------
POL_SOCMV/246-411--------------------------------------------------------------------------------
Y2R2_DROME/498-741--------------------------------------------------------------------------------
POL_BIV29/638-806--------------------------------------------------------------------------------
RDPO_ACUOB/124-343--------------------------------------------------------------------------------
POL2_DROME/249-414--------------------------------------------------------------------------------
RT67_ECOLX/48-262--------------------------------------------------------------------------------
RTJK_DROME/502-757--------------------------------------------------------------------------------
POL_BLVAU/41-212--------------------------------------------------------------------------------
POL_RTBVP/1228-1390--------------------------------------------------------------------------------
POL_CAEVC/210-380--------------------------------------------------------------------------------
P91581_CIOIN/483-644--------------------------------------------------------------------------------
P95451_PSEAC/119-326--------------------------------------------------------------------------------
Q01379_NEUCS/505-761--------------------------------------------------------------------------------
Q03261_SIV/246-416--------------------------------------------------------------------------------
Q04135_DROME/496-743--------------------------------------------------------------------------------
Q07995_CHITU/509-760--------------------------------------------------------------------------------
Q08724_9CYAN/108-336--------------------------------------------------------------------------------
YRD6_CAEEL/484-644--------------------------------------------------------------------------------
Q17329_CAEEL/1071-1231--------------------------------------------------------------------------------
Q24262_DROME/531-692--------------------------------------------------------------------------------
Q24690_DROTE/495-742--------------------------------------------------------------------------------
Q26816_9TRYP/545-793--------------------------------------------------------------------------------
Q46666_ECOLX/34-241--------------------------------------------------------------------------------
Q83013_9RETR/68-238--------------------------------------------------------------------------------
Q88285_9RETR/848-1015--------------------------------------------------------------------------------
POL_CSVMV/250-413--------------------------------------------------------------------------------
Q93137_BOMMO/515-771--------------------------------------------------------------------------------
Q93139_BOMMO/469-719--------------------------------------------------------------------------------
Q94885_DROME/759-920--------------------------------------------------------------------------------
YG31B_YEAST/639-797--------------------------------------------------------------------------------
Q9YGS2_TAKRU/573-830--------------------------------------------------------------------------------
Q9YW31_MSEPV/161-406--------------------------------------------------------------------------------
Q9ZNW4_SORBI/922-1081--------------------------------------------------------------------------------
Q9ZQ67_ARATH/542-701--------------------------------------------------------------------------------
Q9ZQQ6_ARATH/659-918--------------------------------------------------------------------------------
Q9ZS84_SOLLC/655-815--------------------------------------------------------------------------------
Q9ZVK4_ARATH/510-669--------------------------------------------------------------------------------

PF05919

Q6EH16_9VIRU/1-501--------------------------------------------------------------------------------
Q5TMB5_9VIRU/174-658--------------------------------------------------------------------------------
Q18L80_9VIRU/166-639--------------------------------------------------------------------------------
Q9WJ23_9VIRU/164-642--------------------------------------------------------------------------------
RDRP_CPMV1/246-745--------------------------------------------------------------------------------
Q9ZXZ7_THACU/214-754--------------------------------------------------------------------------------
Q9WJ22_9VIRU/155-622--------------------------------------------------------------------------------
Q6EH19_9VIRU/208-686--------------------------------------------------------------------------------
Q9WJ24_9VIRU/163-645--------------------------------------------------------------------------------
Q6GYC2_9VIRU/156-638--------------------------------------------------------------------------------
Q18L78_9VIRU/174-654--------------------------------------------------------------------------------
Q18L79_9VIRU/168-671--------------------------------------------------------------------------------
Q3S3F3_9VIRU/120-606--------------------------------------------------------------------------------
O92614_9VIRU/173-711--------------------------------------------------------------------------------

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------
B5RTA2_DEBHA/1170-1414--------------------------------------------------------------------------------
B5RTR8_DEBHA/1021-1254--------------------------------------------------------------------------------
E7KRB3_YEASL/146-383--------------------------------------------------------------------------------
Q2R072_ORYSJ/915-1159--------------------------------------------------------------------------------
Q59K02_CANAL/999-1236--------------------------------------------------------------------------------
Q5AG24_CANAL/888-1133--------------------------------------------------------------------------------
Q5AH82_CANAL/122-366--------------------------------------------------------------------------------
Q7XN23_ORYSJ/31-274--------------------------------------------------------------------------------
Q8S476_MAIZE/836-1081--------------------------------------------------------------------------------
Q8S479_MAIZE/1073-1313--------------------------------------------------------------------------------

PF00680

POLG_HAVHM/1750-2215----------------------...NFPAAMPFSKAEIDPMA.............VMLSKYSLPIVEEPED---------
RDRP_BPPH6/19-638----------------------..SVDPRFLSFKN.ELSRYLTDHFPANVDEYGRVYGNGVRTNFFGMRHM---------
POLG_PYFV1/2270-2778----------------------...TEPAILDPRDVRLGENR...YDPMIDGIKKYEEQARPIKISWRNQI---------
POL1_CPMVS/1186-1687----------------------...KVPSILVPTDPRIPAQHE.GYDPAKSGVSKYSQPMSALDPELLGEV---------
POLG_RHDVF/1279-1750----------------------...YRPANLGRSDPDSDKSL.............MNIAVKNLQVYQQEPK---------
POLG_PVYN/2293-2763----------------------TVDAEAEAEAFFRPLMDAYG.......KSLLNRDAYIKDIMKYSKPIDV---------
POLG_EMCVR/1844-2288----------------------...YAPAVLSKFDPRTEADV...........DEVAFSKHTSN...QESL---------
POLG_FCVUR/1266-1735----------------------...HQPASLGSGDPRCPKSL.............TAIVVDSLKPYC.DKV---------
POLG_NVN68/1301-1766----------------------...YEPAYLGGKDPRVQNGP...........SLQQVLRDQLKPFADPRG---------
Q9DLK1_FMDVP/1865-2314----------------------...FGPAALSNKDPRLNEGV.........VLDDVIFSKHKGDTRMSEED---------
POLG_VESVA/1379-1848----------------------...HQPASLGAGDPRCPISL.............TGIMVNNLQPYTEASP---------
POL1_BAYMY/1634-2098----------------------..REHPTFTWLKD.FMNEYA.......PSVLSYSAYYKDLCKYNRAKHV---------

PF02123

Q83093_9VIRU/437-816.....-------.............SSSKPDGFDRPAPPPT........SPSQSESSPQNTQPQQSTESSG.........
Q66150_9VIRU/22-408.....-------............EIGSLLFQAGRFERVEAP.........ANLQLAITNLQAQYPRSRPR.........
Q86519_9VIRU/516-902.....-------............SLTSLILQAGRFNRTVCP.........SGLAQAVQSLQERYPKVPP..........
RDRP_SCPMV/464-849.....-------............EIGSLLLQAGKFVPTKAP.........SNLEQAYNNLLSRYPRSKPL.........
RDRP_SBMVA/490-847.....-------..............HSLLLQAGKFNPTGIP.........RNLEGACQNLLERYPASKSC.........
RDRP_PEMVW/733-1124.....-------............ELSSLRYQAARRQSAQTTAVIP...PKDVREDLIKRTTEAYRS.............
RDRP_PLRVW/609-1004.....-------.....ELQSL...NLQAARWLQRAESATIP.......GAEARKRVIEKTVEAYRNCITNAPLC.....
RDRP_TYYVF/580-974.....-------.....ELKSL...RLQASRWLERAQSAEIP.......SDAERERVIQKTADVYHPCQTNGPAA.....
Q65969_9LUTE/603-996.....-------.....ELKSL...RLQAARWLERAQSVKIP.......SSEEREHVIERCCRAYQAAKTNGPMA.....
RDRP_ROTGI/108-803NRWKS-------DTLQGLLPNF...YHRTHTLIGAILFAVTSRLEIYSYEQKKALRYLLRTIEKCYNEGYLEMSRDRKWS
RDRP_ROTHC/109-749DIYMD-------PSINTSCQSN...CQAMMFTISEMKLNN.........IKNAARLEKLFTIIAATINKYGMPRHNTRYR
O55590_9REOV/104-749.....-------.AILTSLSSN...LNAAMFWFHNNKSKTKTDQEF...AKLYRRRESLFRIVASTVNKYGVPRHDQKYR
RDRP_ROTPY/100-748DSLMD-------PAILTSISSN...LNAVMFWLERHSNDVGDA......NKVYRRRLDLFIIVASTINKYGVPRHNEKYR
Q90153_9VIRU/1025-1530.....-------........AR...FGCAAAWLLRSQGQAAE.......FVTSVAAWVVSNRIGPAAWKWLWVGKGL...
Q90193_9VIRU/400-785.....-------..............LTIVLLIGRRRGSGLMECLS...EEEYNIRFNNAILNCYSHMTTG.........
RDRP_PCVC/362-832.....-------.................SYHVGEGHTLVTN.......LLANWKGITQFTTVSHLVFPW..........
RDRP_SCVLB/837-1303KDLFP-------SRKIVKLEGY...EALLAMMLDRFNNIESTHVT....FFTYLRALPDREKEVFISLVLN.........
Q87025_SCVLA/177-657HLRPD-------ELVEAAAKVS...PRRKYYLMCVVELLANLQVD....LEAAVATILAYVLTLSEKFVPI.........
Q90155_TTV1/96-539NFY..-------.............ARTLWNETTSDKSAFKPGT.....YNDTVAGLLMWQQCALMWSLPKLIINKI...
Q9JE94_9VIRU/129-560.....-------NAYARNLLDA...SPLPDFALQQMLLPNT........ANDVVCAILLLGEVLWMLRCPISIIV.....
Q8V615_9VIRU/41-473.....-------NCYARNVLAS...TELTDDLLKQSLPIGL........NNDSVCGIVIVLELLRIAGVPSKLLP.....
Q83073_9VIRU/49-523NIHAS-------EVIAGSRKYA....RTVYRQYVQMSSLFSGM......YDDHVAGILLYSISTLKHCDVHVAMA.....
RDRP_LRVLG/155-619.NLTA-------IEVIRGCQHE...CSVVYCEFVRYSAYFAGL......YDDQVAAILLYAVAAHNVQGFGARFC.....
Q98XW8_9VIRU/144-622NLFLD-------CVIADFLQNYKCLGPVLEGWMKRTHLLGI........YEDQACNIIVYAQAVMLEFGFE.........
Q99AT3_9VIRU/99-573NVYL.-------NEVASSLLSL...DPAAYSSASQALWPHKGKI.....ANDQASAIILYGYGLRAQAVPDAM.......
Q9YXE4_9VIRU/99-573NVYL.-------CEVMRSLSDY....STSWAWLAEDALSRAPPM.....FNDQASALVLYGTALQAKGVQNG........
RDRP_HV19S/122-585NIRL.-------.............GPLARAWAARYGLAALGS......HLAYMVGMPNDRACATLLLAQTYKAR.....
Q9YXE6_9VIRU/120-589NLALA-------PLIRSFSTCA...GPTLAGHFLRHLAGHV........TEDVAMAAMVYAHGLVACYGQKG........

PF04197

RDRP_IBDVU/1-875DLAWMRQIEGPVLKPTLSLPIGDQEYFPKYYPTHRPSKEKPNAY.P---PDIALLKQMIYLFLQVPEATDNLKDEVTLLT
RDRP_IPNVJ/1-842RLRQM..VEDGKLKDTVSVPEGTTAFYPKYYPFHKPDHDEVGTFGA---PDITLLKQLTFFLLE.....NDFPTGPETLR
RDRP_BSNV/1-863HLAEF..VGSGAFGTSTLVPAGSTEYIPRYYPTHKPEHNKPTPFGH---YDVALLKQMTYQLTN...GKDNPEEEGTTFR

PF00978

R1AB_LIYV9/1925-2366--------------------YSDYYLPPCE..DLRITLSKSKPYH.......PGAYVVSK-ILGKGER...---------
R1AB_BYVU/2601-3046--------------------TQVFESG.AD..NVVIRDSAPVNKSTD.....HDPQRVSS-IRSQAIP...---------
Q9YPH5_9VIRU/1359-1796--------------------TGGLDIE.LS..DCKIYPNRPMKVW.E.....ERRYLSPV-LRTAMPN...---------
POLN_EEVVM/2041-2488--------------------MVDGASCCLD..TASFCPAKLRSFP.K.....KHAYLEPT-IRSAVPS...---------
E0YCR0_9CLOS/53-491--------------------TSDQSFL.IE..DVRISESFSHFTSKI.....ED.RFYSF-IRSSVGL...---------
RDRP_TOMS1/1168-1609--------------------LTDISLN.VK..DCILDMSKSVAAPKD.....AKPTLIPM-VRTAAEM...---------
RDRP_PSVJ/295-726--------------------NSDFTTD.ID..HLTLKQSDLIPKA.D.....GGNYLKPV-LTTGSGS...---------
Q66107_9BROM/228-662--------------------TQDISLE.VS..KCWLDASNFKDFTKG.....QQTYAVPA-YQSGATS...---------
Q87644_SINDV/2053-2501--------------------MVDGTVACLD..TATFCPAKLRSYPKK.....HE.YRAPN-IRSAVPS...---------
O56790_9VIRU/1323-1760--------------------TGGLEID.IA..NIKYYPNKQKRMWQE.....VR.GLTPA-LRTAMPE...---------
RDRP_CMVFN/308-738--------------------SADYSID.LD..HVRLRQSDLIAKI.P.....DSGHMIPV-LNTGSGH...---------
Q9WJD8_PEBV/1299-1738--------------------TEDCNLR.LT..DVTLKSGNWKDKFVE....EKETCLVPV-LRTAMPD...---------
Q80875_BSMV/195-630--------------------TEDINMD.VQ..DCRLKFGKTFRPYEF.....KE.SLKPV-LRTAMPE...---------
RDRP_RBDVR/1234-1674--------------------VGPMSLQ.VG..SIRWDVSKISPRLFT.....NNKFAVPH-LPTGALL...---------
RDRP_SBWMN/1373-1810--------------------TSDISIE.LE..NCTVQPNKNVKVWQD.....KR.GLVPV-LRTAMPP...---------
POLN_ONNVI/2053-2501--------------------MVDGSESCLD..RATFNPSKLRSYP.K.....QHSYHAPT-IRSAVPS...---------
RDRP_TAV/313-742--------------------NADYSVD.ID..RVRLKQSDLLAKV.I.....DEGHLKPV-LNTGSGQ...---------
POLN_MIDDV/534-981--------------------MVDGSESCLD..RAAFCPSKLRSFP.K.....KHSYHRAE-IRSAVPS...---------
RDRP_TMGMV/1163-1604--------------------LRDNSLN.VK..DCVLDFSKSIPMPKE.....VKPCLEPV-LRTAAEP...---------
RDRP_TOBSV/253-689--------------------THDIDLE.VT..SCDLDMSTFNDWTKG.....VDTRLVPN-MSVGGLS...---------
RDRP_OLV2I/310-732--------------------SDDFTVDFPT..QVRLRERDEDWFRRK.....PD.FAVSS-IRTGLEM...---------
RDRP_YOMV/1155-1594--------------------LRDISLN.VK..DCRIDFSKSVQVPKE.....RPVFMKPK-LRTAAEM...---------
RDRP_AMVLE/318-752--------------------TSDKSLD.VD..PCRIDLSVFNNWQ.S.....SENCYEPR-FKTGALS...---------
POLN_RRVN/2019-2467--------------------MVDGSESCLD..RATFCPAKLRCYP.K.....HHAYHQPQ-VRSAVPS...---------
RDRP_ASPVP/1758-2169--------------------IGDITTE.........QFTDDHSKNRG.....QE......-LTNAAERYEA---------
O56250_9VIRU/1240-1678--------------------TTDCNLR.LD..NVTIKSGNWKDKFAE.....KEAFLKPV-IRTAMPD...---------
O90699_9VIRU/1363-1800--------------------TGGIHVE.ID..DLTYYPNKQTKVW.S.....EVKGLTPV-LRTAMPE...---------
Q9Q6Q3_9CLOS/62-509--------------------EDDFETSGLE..TLVETATISDNFPKYK..ITDRPRSQYV-VRSAIRR...---------
POLN_AURAV/2038-2486--------------------MVEGSVSCLD..TATFCPAKLRSFPKT.....HS.YLEPT-LRSAVPS...---------
RDRP_BBMV/271-697--------------------SADFSSD.FQ..RLKIKQSHVDWYK.D.....PDKFFEPV-LNFGASS...---------
RDRP_CCMV/267-697--------------------LGDYNVD.IS..KLSVRQSDVDWYR.D.....PEKYYEPE-LSIGSFQ...---------
Q66581_EEEV/144-598--------------------EYDAYLDMVDGASCCLDTATFCPAK.LRSFPKKHSYLRPE-IRSAVPS...---------
Q9QGG9_9BROM/363-797--------------------TSDIALE.LD..RATLDTSVFNDWTKS.....SGPKLNGL-FRTGNMS...---------
RDRP_TMOB/1167-1614--------------------CSDISLN.VK..DCVLDFSKSVPLPRD....NTKVPMTPV-IRTAAER...---------
RDRP_BMV/256-688--------------------NGDYSMD.FD..RIRLKQSDVDWYR.D.....PDKYFQPK-MNIGSAQ...---------
O40960_9CLOS/62-506--------------------YSDIELPCLE..DLLLTPTKSKPYQ.......AVNCKVPI-LIGKGER...---------

PF00998

RDRP_TNVA/224-703--------------------------------LVVIPSGRP...EKQ-----RQLLRYSG.IGGHLLI------------
RDRP_TCV/272-752--------------------------------MRVFPLANP...PKV-----RRIFHICG.MGNGLDF------------
RDRP_TNVD/224-709--------------------------------MLVTKGPPL...AKP-----RKLYRFTG.MGTHIRY------------
RDRP_MCMVK/460-941--------------------------------LRSHFKDTR...HKT-----RRVFRIAG.LGNLYEF------------
POLG_HCVEU/2430-2941--------------------------------SYSWTGALITPCAAE-----EEKLPIN..PLSNSLV------------
POLG_HCVED/2420-2931--------------------------------SYSWTGALVTPCAAE-----ESKLPIS..PLSNSLL------------
POLG_HCVJL/2434-2945--------------------------------SYSWTGALITPCAAE-----EEKLPIS..PLSNTLI------------
POLG_HCVJK/2431-2942--------------------------------SYSWTGALITPCAAE-----EEKLPIS..PLSNSLL------------
POLG_HCVEV/2426-2937--------------------------------SYTWTGALITPCSAE-----EEKLPIN..PLSNTLL------------
POLG_HCVJ6/2445-2956--------------------------------SYSWTGALITPCSPE-----EEKLPIN..PLSNSLL------------
Q9IR83_9TOMB/236-712--------------------------------MAVFPREGI...SKP-----RRIFQVCG.MGNGTTF------------
Q87031_9LUTE/24-502--------------------------------IVVRSGAAP..RKSR-----SVISFLSQ.FTLGLDY------------
RDRP_POLVP/251-722--------------------------------MVVRKGAPI...TTE-----RKWYSFAG.YASTYEY------------
Q65987_9TOMB/269-750--------------------------------MRVFPLAQP...PKI-----RRIFHICG.MGNGLDF------------
P90338_9TOMB/1-480--------------------------------MIEVRRNAL...VRP-----RRLYYQQE.IGTGLQY------------
RDRP_BYDV1/361-840--------------------------------IAVTDGARL..RKVS-----CNIRYLSQ.THLGLVY------------
O09796_9HEPC/2422-2933--------------------------------SYTWTGALITPCAAE-----ESKLPIN..PLSNSLL------------
O09803_9FLAV/2373-2866--------------------------------SYIWSGVPL..TRAT-----PAKPPVVR.PVGSLLV------------
O37361_9VIRU/252-737--------------------------------ATNLGDSRP...LTD-----TNIRRVVGPFSSDYDI------------
Q9WJD9_CARMV/267-744--------------------------------VIEVDGQCP...LKE-----RKLYVQNA.ITTGYEY------------
Q83103_9TOMB/228-711--------------------------------LSVVKGPPL...SKP-----RKLYRFTG.FGANIRY------------
Q66127_9VIRU/52-520--------------------------------LHIRPSARP..RPVK-----RVSYQIDA.VRPSADF------------
RDRP_PMVK/447-937--------------------------------LRCHFKDRD...PKV-----RSIYRIAG.LGDQYEF------------
POLG_GBVB/2277-2785--------------------------------SYTWTDVIS..FKTA-----SKVLSATR.AITSGFL------------
Q89801_9TOMB/1-479--------------------------------MLITPRTGS...HKV-----RKMGHVNF.MGNGKLF------------
Q9IRA1_9TOMB/266-741--------------------------------LTVSREKPA...SKV-----RRIYQITG.LDSGINF------------
O12301_9TOMB/231-708--------------------------------LVVKPSGRP...EKQ-----RQLSAIVD.SWGRKPL------------
Q83424_MNSV/290-772--------------------------------MTEFPQDRP...IKT-----RKLYCLGG.VGTSVKF------------
O41892_9FLAV/2409-2899--------------------------------SYVWSGQPL..GCGR-----VIPPPITR.PVGTHLT------------
RDRP_OCSVU/235-734--------------------------------LRVKRLLGV...TKN-----RTCMRVSG.VSPNIQI------------
Q9IW60_9TOMB/325-800--------------------------------LEVRTGPPN...AKD-----RNIFMVAG.CPSQARF------------
Q96898_9FLAV/2396-2886--------------------------------SYIWSGAPL..GTGR-----SVPQPMTR.PIGTHLT------------
RDRP_RCNMV/260-745--------------------------------VAEKRASRV..MKSK-----RVVG.LPA.VSAGLKV------------

PF00972

POLG_YEFV1/2758-3406-------------------TLEADVILPIGTRSVETDKGPLDKEAIE-----ERVERIKSEYMTSWFY------------

PF00078

A0A016RNU0_KLEPN/135-366--------------------------------IPKAD....-----------...-------------------------
A0A025GH98_ECO57/115-332--------------------------------IPKSN....-----------...-------------------------
D7ZFU1_ECOLX/62-269--------------------------------IPKID....-----------...-------------------------
F6BM08_SINMB/72-291--------------------------------IPKKA....-----------...-------------------------
M7UYJ9_ECOLX/33-239--------------------------------IPKRT....-----------...-------------------------
O01419_BOMMO/502-756--------------------------------IPKEGRP..-----------.RD-------------------------
O18558_AEDAE/472-725--------------------------------IPKGGRAS.-----------.YE-------------------------
O42691_ALTAL/36-202--------------------------------VRDPTTG..-----------..G-------------------------
O44316_DROMR/394-650--------------------------------IPKTVRA..-----------..N-------------------------
O52231_STREE/68-275--------------------------------IPKPD....-----------...-------------------------
O62658_CANFA/517-773--------------------------------IPKPDKD..-----------.PT-------------------------
O64612_ARATH/788-1031--------------------------------YAKEM....-----------...-------------------------
O65244_ARATH/405-664--------------------------------IPKKKEA..-----------..K-------------------------
O65598_ARATH/489-747--------------------------------IPKFPNA..-----------..S-------------------------
O81284_ARATH/58-317--------------------------------IPKVPGA..-----------..D-------------------------
O81454_ARATH/144-304--------------------------------VPKKD....-----------...-------------------------
O93520_ORYLA/518-771--------------------------------IPKEGKD..-----------.RL-------------------------
O96546_LYMDI/526-780--------------------------------IHKPGKR..-----------.RT-------------------------
O99969_PORPU/100-315--------------------------------IPKPN....-----------...-------------------------
POL_RSVP/769-938--------------------------------IRKAS....-----------...-------------------------
POL_HTL1A/633-804--------------------------------VKKAN....-----------...-------------------------
POL_SMRVH/71-240--------------------------------IKKKS....-----------...-------------------------
POL_MMTVB/68-237--------------------------------IKKKS....-----------...-------------------------
POL_CAMVC/289-452--------------------------------VNNEAE...-----------..K-------------------------
POL_IPHA/60-229--------------------------------IKKKS....-----------...-------------------------
POL_HV1MA/655-826--------------------------------IKKKD....-----------...-------------------------
TF21_SCHPO/455-615--------------------------------VPKKE....-----------...-------------------------
POK10_HUMAN/76-245--------------------------------IQKKS....-----------...-------------------------
POL4_DROME/357-523--------------------------------VPKKSSP..-----------.NS-------------------------
POLY_DROME/224-390--------------------------------VDKKGTD..-----------.AF-------------------------
POL_EIAV9/249-419--------------------------------IKKRS....-----------...-------------------------
YTX2_XENLA/513-765--------------------------------LPKKGDL..-----------..R-------------------------
POL_SOCMV/246-411--------------------------------VENHNE...-----------..I-------------------------
Y2R2_DROME/498-741--------------------------------LLKGPDKD.-----------.KC-------------------------
POL_BIV29/638-806--------------------------------IKKKG....-----------...-------------------------
RDPO_ACUOB/124-343--------------------------------IPKRD....-----------...-------------------------
POL2_DROME/249-414--------------------------------VPKKPDA..-----------..S-------------------------
RT67_ECOLX/48-262--------------------------------IPKKG....-----------...-------------------------
RTJK_DROME/502-757--------------------------------IHKTGKT..-----------.PT-------------------------
POL_BLVAU/41-212--------------------------------VRKPN....-----------...-------------------------
POL_RTBVP/1228-1390--------------------------------VRNHSE...-----------..E-------------------------
POL_CAEVC/210-380--------------------------------IKKKS....-----------...-------------------------
P91581_CIOIN/483-644--------------------------------AREGS....-----------...-------------------------
P95451_PSEAC/119-326--------------------------------IPKPQ....-----------...-------------------------
Q01379_NEUCS/505-761--------------------------------LKKPGKSAA-----------QQK-------------------------
Q03261_SIV/246-416--------------------------------IRKKD....-----------...-------------------------
Q04135_DROME/496-743--------------------------------IPKPGKD..-----------.KT-------------------------
Q07995_CHITU/509-760--------------------------------IPKHGKP..-----------.AS-------------------------
Q08724_9CYAN/108-336--------------------------------IPKPG....-----------...-------------------------
YRD6_CAEEL/484-644--------------------------------IKKKG....-----------...-------------------------
Q17329_CAEEL/1071-1231--------------------------------VKKKD....-----------...-------------------------
Q24262_DROME/531-692--------------------------------VRKKD....-----------...-------------------------
Q24690_DROTE/495-742--------------------------------ILKPNTD..-----------.KT-------------------------
Q26816_9TRYP/545-793--------------------------------ILKAGKK..-----------.AE-------------------------
Q46666_ECOLX/34-241--------------------------------IPKRT....-----------...-------------------------
Q83013_9RETR/68-238--------------------------------IQKKD....-----------...-------------------------
Q88285_9RETR/848-1015--------------------------------VGKPD....-----------...-------------------------
POL_CSVMV/250-413--------------------------------VNKHSE...-----------..Q-------------------------
Q93137_BOMMO/515-771--------------------------------KPKND....-----------...-------------------------
Q93139_BOMMO/469-719--------------------------------LRKSGKDS.-----------.YT-------------------------
Q94885_DROME/759-920--------------------------------VKKKT....-----------...-------------------------
YG31B_YEAST/639-797--------------------------------VPKKD....-----------...-------------------------
Q9YGS2_TAKRU/573-830--------------------------------LLKKPSLD.-----------.PD-------------------------
Q9YW31_MSEPV/161-406--------------------------------IHKNGDK..-----------..N-------------------------
Q9ZNW4_SORBI/922-1081--------------------------------PKKN.....-----------...-------------------------
Q9ZQ67_ARATH/542-701--------------------------------KKKN.....-----------...-------------------------
Q9ZQQ6_ARATH/659-918--------------------------------IPKKDEA..-----------..T-------------------------
Q9ZS84_SOLLC/655-815--------------------------------QKKQD....-----------...-------------------------
Q9ZVK4_ARATH/510-669--------------------------------KKKD.....-----------...-------------------------

PF05919

Q6EH16_9VIRU/1-501--------------------------------MKLRLKGSL-----------........-..KAGP....---------
Q5TMB5_9VIRU/174-658--------------------------------TPLEFKKYH-----------FST.....-..HREP....---------
Q18L80_9VIRU/166-639--------------------------------LDFKISSTM-----------APW....L-IQSSGPCSKK---------
Q9WJ23_9VIRU/164-642--------------------------------LQWSRDDHY-----------LSF.....-..KSSP....---------
RDRP_CPMV1/246-745--------------------------------LKLKITGSM-----------........-..KAGP....---------
Q9ZXZ7_THACU/214-754--------------------------------FNKLDKKSL-----------APT.KFIM-SRSASP....---------
Q9WJ22_9VIRU/155-622--------------------------------PIYTDNDHY-----------LSI.....-..KGSP....---------
Q6EH19_9VIRU/208-686--------------------------------FEPTDWKFR-----------WVV.....-..TAGP....---------
Q9WJ24_9VIRU/163-645--------------------------------VQWDVKNFK-----------LLT.....-..KAGP....---------
Q6GYC2_9VIRU/156-638--------------------------------SEFDDSNHF-----------VSV.....-..KSSP....---------
Q18L78_9VIRU/174-654--------------------------------FKKEDINDP-----------YSVNRLMD-ITKAGP....---------
Q18L79_9VIRU/168-671--------------------------------VPFKISDLL-----------NPF....L-IYSSGPCSPK---------
Q3S3F3_9VIRU/120-606--------------------------------PTYDLSKHY-----------LSP.....-..KGGP....---------
O92614_9VIRU/173-711--------------------------------PKGRSKHLL-----------TLSNPIIY-LLSAGP....---------

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------
B5RTA2_DEBHA/1170-1414--------------------------------------------------------------------------------
B5RTR8_DEBHA/1021-1254--------------------------------------------------------------------------------
E7KRB3_YEASL/146-383--------------------------------------------------------------------------------
Q2R072_ORYSJ/915-1159--------------------------------------------------------------------------------
Q59K02_CANAL/999-1236--------------------------------------------------------------------------------
Q5AG24_CANAL/888-1133--------------------------------------------------------------------------------
Q5AH82_CANAL/122-366--------------------------------------------------------------------------------
Q7XN23_ORYSJ/31-274--------------------------------------------------------------------------------
Q8S476_MAIZE/836-1081--------------------------------------------------------------------------------
Q8S479_MAIZE/1073-1313--------------------------------------------------------------------------------

PF00680

POLG_HAVHM/1750-2215----------YKEASIFYQ--------------NKIVGKTQLVDDF.---------...LDLDMAITG------------
RDRP_BPPH6/19-638----------NGFPMIPAT--------------WPLASNLKKRADAD---------LADGPVSERDNL------------
POLG_PYFV1/2270-2778----------IESMAAQMQ--------------DWETFMVRE..GYM---------TMDLPMSVVING------------
POL1_CPMVS/1186-1687----------ANDVLELWH--------------DCAVD......WDD---------FGEVSLEEALNG------------
POLG_RHDVF/1279-1750----------LDKVDEFIE--------------RAAADVLGYLRFLT---------KGERQANLNFKA------------
POLG_PVYN/2293-2763----------GVVDRMHLR--------------KPSIGLSSTCNVHG---------FKKCAYVTDEQE------------
POLG_EMCVR/1844-2288----------PPVFRMVAK--------------EYANRVFTLL.GKD---------NGRLTVKQALEG------------
POLG_FCVUR/1266-1735----------EGPPHDILH--------------RVQKMLIDHLSGFV---------PVNISSETSMLS------------
POLG_NVN68/1301-1766----------RMPEPGLLE--------------AAVETVTSMLEQTM---------DTPSPWSYADA.------------
Q9DLK1_FMDVP/1865-2314----------KALFRRCAA--------------DYASRLHSVL.GTA---------NAPLSVYEAIKG------------
POLG_VESVA/1379-1848----------GPD.TATLN--------------RVSKMLTSHMEGYV---------PKVHKTEEDSIS------------
POL1_BAYMY/1634-2098----------LTYNPEELH--------------YATKGLIKMLEDAG---------LTQGSVRTPQQ.------------

PF02123

Q83093_9VIRU/437-816.................................GQSGVKKKSQRRRG......KSERQKSTQKPPQVP............
Q66150_9VIRU/22-408..........SCFRREPWCRE............DFVAEIEKIAHSGE...........INLKASPGVP............
Q86519_9VIRU/516-902..........RRCLRDEWRFD............DIFDEVERILCETG..........EVNSASSPGVP............
RDRP_SCPMV/464-849..........ACFRQGTWSFD............AIFEQVVSKATSAE...........INQKASPGVP............
RDRP_SBMVA/490-847..........YCLRGEAWSFD............AVYEEVCKKAQSAE...........INEKASPGVP............
RDRP_PEMVW/733-1124..........TALPAPMWA..............HNFDESHMRFEFWECVRKLKGQAGSGVPYAAFSGR............
RDRP_PLRVW/609-1004..........SLKSKLDWA..............GFQQDIREAVQSLE......LDAGVGIPYIAYGLP............
RDRP_TYYVF/580-974..........TRGGTLTWN..............NFMIDFKQAVFSLE......FDAGIELPYIAYGKP............
Q65969_9LUTE/603-996..........TRGDRLSWD..............NFLQDFKQAVLSLE......MDAGIGVPYIAYGKP............
RDRP_ROTGI/108-803HTLPELRTLTFRLYNSKVIHAACAMISLVHANPIDYEFLCQVVAVYQIIPANAAKLLSTPMTLYVGVATFSSNQVASTGN
RDRP_ROTHC/109-749YEWETMKNKPYHL..AAWINSSIEMIACVVDHHTYMIARELIVKSFTNRTSLAKLVSSPMTVLTAMLP............
O55590_9REOV/104-749YTYDVMKDKPYYL..VTWANSSIEILMSVHDHNDYLIAEELIINSYSNRSTLAKIVSSPMSILVALLD............
RDRP_ROTPY/100-748YEYEVMKDKPYYL..VTWANSAIEMLMSVFSHEDYLIAKELIILSYSNRSTLAKLVSSPMSILVALID............
Q90153_9VIRU/1025-1530..........YQTNEDDWV..............AKAKSIHDDLRKHGYPPHVQATEEDWSQSLYLQA.............
Q90193_9VIRU/400-785..........YSAKFGRLAND..............VESFKSFMQLRK...........PGHSQVPGNR............
RDRP_PCVC/362-832..........FKVCERDWS..............DKMKTLHSLVRCSK.FFMNTRITEKDRQALMYMDL............
RDRP_SCVLB/837-1303..........YNGLGREWLKSE...........GVRAKQAQGTVKYD............MSKLFELNV............
Q87025_SCVLA/177-657..........FLDSRAIWVGEPGPDALT.....ARLKASSGQIKSIH......TADYEPLTELFELAV............
Q90155_TTV1/96-539..........ISGVCDALTEKVSL.........TLLKRISDWLKQLG......LAYSPIFRLFIELPT............
Q9JE94_9VIRU/129-560..........NIS..RAICRND...........SFLKDLSDFNKMLG......LTKIPIANCLTELNT............
Q8V615_9VIRU/41-473..........IIG..QAIANKD...........PFIKELSDFNKMIG......ATTSRIANILTECNT............
Q83073_9VIRU/49-523..........YAIAAVRDLTQ............SVIADLSDVLKLRA........LAAWCPNYVELKC............
RDRP_LRVLG/155-619...............VLWALMCVRIA.......GFADDINIYIKHRG........MSGLLPQLVEMKC............
Q98XW8_9VIRU/144-622..........ESLYLATWAVLRA..........KQAKALSDVLKAMG......QNMCAVGRHLCELAV............
Q99AT3_9VIRU/99-573..........HVA..ATLATTP...........DLAKALTNFLKATG......ANGSRLGALLCESNV............
Q9YXE4_9VIRU/99-573..........YHAATALIANP............EYAKDMTTVLKAVG......ANSNHLGACLVEAQT............
RDRP_HV19S/122-585..........FGSEGVAWAIASVRQP.......ENAKGLSNALKALG......SNTSEPGALFVEANT............
Q9YXE6_9VIRU/120-589..........YDI..AAWLVLRP..........AAAKGISTAIKALG......ANAHDFGAVLCEAQT............

PF04197

RDRP_IBDVU/1-875Q...NIRDKAYGSGTYMGQA-------------TRLVAMKEVATGRNPNKDPLKLGYTFESIAQLLDITLPVGPPGEDDK
RDRP_IPNVJ/1-842QVREAIATLQYGSGSYSGQL-------------NRLLAMKGVATGRNPNKTPKTVGYTNEQLAKLLEQTLPINTPKHED.
RDRP_BSNV/1-863QFRDTIVEQQYGSGTSQGQL-------------ARLVAMKEVATGRNPNKSPKELGLSMEEIATMLEQTLPIGQPGGDEG

PF00978

R1AB_LIYV9/1925-2366----------..NRPNTWK--------------QV..IQSLSHRNFN---------------------------------
R1AB_BYVU/2601-3046----------..KRKPSLQ--------------EN..LYSYESRNYN---------------------------------
Q9YPH5_9VIRU/1359-1796----------..KRQSSQA--------------ES..LLALKKRNMA---------------------------------
POLN_EEVVM/2041-2488----------..AIQNTLQ--------------NV..LAAATKRNCN---------------------------------
E0YCR0_9CLOS/53-491----------..PKRNTLK--------------CN..LVTFENRNFN---------------------------------
RDRP_TOMS1/1168-1609----------..PRQTGLL--------------EN..LVAMIKRNFN---------------------------------
RDRP_PSVJ/295-726----------..KRLGTTK--------------EV..LTAIKKRNAD---------------------------------
Q66107_9BROM/228-662----------..KRVNTQR--------------ET..LLAVKKRNMN---------------------------------
Q87644_SINDV/2053-2501----------..AMQNTLQ--------------NV..LIAATKRNCN---------------------------------
O56790_9VIRU/1323-1760----------..KRQSGLI--------------ES..VLALNKRNMA---------------------------------
RDRP_CMVFN/308-738----------..KRVGTTK--------------EV..LTAIKKRNAD---------------------------------
Q9WJD8_PEBV/1299-1738----------..KRKTTQL--------------EG..LLALQKRNQA---------------------------------
Q80875_BSMV/195-630----------..KRQGSLI--------------ES..VLAFRKRNLA---------------------------------
RDRP_RBDVR/1234-1674----------..RRNTSSR--------------QV..GLAIEKRNAN---------------------------------
RDRP_SBWMN/1373-1810----------..KRQNLPV--------------EA..MLALKKRNMA---------------------------------
POLN_ONNVI/2053-2501----------..PFQNTLQ--------------NV..LAAATKRNCN---------------------------------
RDRP_TAV/313-742----------..KRIGTTR--------------EV..LCAIKKRNAD---------------------------------
POLN_MIDDV/534-981----------..PFQNTLQ--------------NV..LAAATKRNCN---------------------------------
RDRP_TMGMV/1163-1604----------..PRAAGLL--------------EN..LVAMIKRNFN---------------------------------
RDRP_TOBSV/253-689----------..HRVPTQR--------------EA..LLAIKKRNMN---------------------------------
RDRP_OLV2I/310-732----------..PRIATKK--------------EM..LMAFSKRNVG---------------------------------
RDRP_YOMV/1155-1594----------..PRTAGLL--------------EN..LVAMIKRNMN---------------------------------
RDRP_AMVLE/318-752----------..TRKGTQT--------------EA..LLAIKKRNMN---------------------------------
POLN_RRVN/2019-2467----------..PFQNTLQ--------------NV..LAAATKRNCN---------------------------------
RDRP_ASPVP/1758-2169----------IYPRHKGTD--------------TATFLMAVKKR...---------------------------------
O56250_9VIRU/1240-1678----------..KRKTTQL--------------ES..LLALQKRNQA---------------------------------
O90699_9VIRU/1363-1800----------..KRQGGLV--------------ES..PLALNKRNMA---------------------------------
Q9Q6Q3_9CLOS/62-509----------..PKRNSLK--------------CN..LVTFESRNFN---------------------------------
POLN_AURAV/2038-2486----------..AFQNTLQ--------------NV..LSAATKRNCN---------------------------------
RDRP_BBMV/271-697----------..RRVGSQK--------------TV..LTALKKRNAD---------------------------------
RDRP_CCMV/267-697----------..RRIGTQK--------------TV..LTALKKRNAD---------------------------------
Q66581_EEEV/144-598----------..PIQNTLQ--------------DV..LAAATKRNCN---------------------------------
Q9QGG9_9BROM/363-797----------..KRIPTQR--------------EA..ALAIKKRNLN---------------------------------
RDRP_TMOB/1167-1614----------..PRSQGLL--------------EN..LVAMIKRNFN---------------------------------
RDRP_BMV/256-688----------..RRVGTQK--------------EV..LTALKKRNAD---------------------------------
O40960_9CLOS/62-506----------..SRPDTWK--------------QV..ILSLSKRNFA---------------------------------

PF00998

RDRP_TNVA/224-703-----------GIHNNSLS--------------NL--RRGLMERVFY---------------------------------
RDRP_TCV/272-752-----------GVHNNSLN--------------NL--RRGLMERVFY---------------------------------
RDRP_TNVD/224-709-----------GVHDHSLG--------------NV--RRGLVERLYM---------------------------------
RDRP_MCMVK/460-941-----------GVHNNSAV--------------NL--ERGLMERVFY---------------------------------
POLG_HCVEU/2430-2941-----------RHHNMVYS--------------TT--SRSASLRQKK---------------------------------
POLG_HCVED/2420-2931-----------RHHNMVYA--------------TT--TRSAVTRQKK---------------------------------
POLG_HCVJL/2434-2945-----------RHHNMVYS--------------TT--SRSAALRQKK---------------------------------
POLG_HCVJK/2431-2942-----------RHHNLVYS--------------TS--SRSAAQRQKK---------------------------------
POLG_HCVEV/2426-2937-----------RHHNLVYS--------------TS--SRSAGLRQKK---------------------------------
POLG_HCVJ6/2445-2956-----------RYHNKVYC--------------TT--SKSASLRAKK---------------------------------
Q9IR83_9TOMB/236-712-----------GVHNNSLT--------------NL--RRGLVERVFY---------------------------------
Q87031_9LUTE/24-502-----------QCPNPSLH--------------NA--LVAVERRVFT---------------------------------
RDRP_POLVP/251-722-----------IVHNSSLV--------------NV--CRGLVERVFC---------------------------------
Q65987_9TOMB/269-750-----------GVHNNSLN--------------NL--RRGLMERVFY---------------------------------
P90338_9TOMB/1-480-----------RVHNASYA--------------NL--RRGLLERVFY---------------------------------
RDRP_BYDV1/361-840-----------KAPNASLH--------------NA--LVAVERRVYT---------------------------------
O09796_9HEPC/2422-2933-----------RHHNMVYA--------------TT--SRSAGLRQKK---------------------------------
O09803_9FLAV/2373-2866-----------ADTTKVYV--------------TN--PDNVGRRVDK---------------------------------
O37361_9VIRU/252-737-----------VFYTNSRN--------------NL--MRGLVNRVLT---------------------------------
Q9WJD9_CARMV/267-744-----------RVHNHSYA--------------NL--RRGLLERVFY---------------------------------
Q83103_9TOMB/228-711-----------GVHDHSLG--------------NV--RRGLVERVFM---------------------------------
Q66127_9VIRU/52-520-----------GVHNNSLV--------------NL--VRGINERVFY---------------------------------
RDRP_PMVK/447-937-----------GLHNNSAA--------------NL--ERGLAERVYM---------------------------------
POLG_GBVB/2277-2785-----------KQRSLVYV--------------TE--PRDAELRKQK---------------------------------
Q89801_9TOMB/1-479-----------GVHNASLV--------------NL--RRGLLERVFY---------------------------------
Q9IRA1_9TOMB/266-741-----------GVHNNSLN--------------NL--RRGLIERVYY---------------------------------
O12301_9TOMB/231-708-----------VFTITRLA--------------NL--RRGMIERMYY---------------------------------
Q83424_MNSV/290-772-----------NVHNNSLA--------------NL--RRGLVERVFF---------------------------------
O41892_9FLAV/2409-2899-----------CDTTKVYA--------------TD--PDRAAERAEK---------------------------------
RDRP_OCSVU/235-734-----------IPFNNDIT--------------TL--ERAIKERVFF---------------------------------
Q9IW60_9TOMB/325-800-----------LVHNHCLK--------------NL--KRGLVERVFC---------------------------------
Q96898_9FLAV/2396-2886-----------CDTTKVYV--------------TD--PDRAAERAEK---------------------------------
RDRP_RCNMV/260-745-----------CVHQTSLH--------------NM--IVSLERRVFR---------------------------------

PF00972

POLG_YEFV1/2758-3406------------DNDNPYR--------------TWHYCGSYVTKTSG---------------------------------

PF00078

A0A016RNU0_KLEPN/135-366-------------..GKQR--------------P.--.LGIASLEDK---------------------------------
A0A025GH98_ECO57/115-332-------------..GKSR--------------P.--.LGIPTMKDR---------------------------------
D7ZFU1_ECOLX/62-269-------------..GSKR--------------I.--.VYSLHPKMR---------------------------------
F6BM08_SINMB/72-291-------------..GGER--------------V.--.LGVPTVSDR---------------------------------
M7UYJ9_ECOLX/33-239-------------..IGYR--------------I.--.IAQPTPRVK---------------------------------
O01419_BOMMO/502-756-------------QPSGYR--------------P.--.IVVLSEAGK---------------------------------
O18558_AEDAE/472-725-------------EAKSFR--------------P.--.ISLTSFLLK---------------------------------
O42691_ALTAL/36-202-------------RSGQLR--------------LV--I......DYR---------------------------------
O44316_DROMR/394-650-------------RPQDFR--------------P.--.ISVPSIVVR---------------------------------
O52231_STREE/68-275-------------..GGIR--------------Q.--.LGIPTVMDR---------------------------------
O62658_CANFA/517-773-------------KKENYR--------------P.--.ISLMNMDAK---------------------------------
O64612_ARATH/788-1031-------------..KDYR--------------P.--.ISCCNVLYK---------------------------------
O65244_ARATH/405-664-------------EMKDYR--------------P.--.ISCCNVLYK---------------------------------
O65598_ARATH/489-747-------------CTSDFR--------------P.--.ISCMNTLYK---------------------------------
O81284_ARATH/58-317-------------QLNLFR--------------P.--.VACCTTIYK---------------------------------
O81454_ARATH/144-304-------------..GTWR--------------MC--L......DCR---------------------------------
O93520_ORYLA/518-771-------------DCANYR--------------P.--.VSVLNIDYK---------------------------------
O96546_LYMDI/526-780-------------EPSSYR--------------P.--.ISLLRGLGK---------------------------------
O99969_PORPU/100-315-------------..GSVR--------------N.--.LGIPTIRDR---------------------------------
POL_RSVP/769-938-------------..GSYR--------------L.--.L....HDLR---------------------------------
POL_HTL1A/633-804-------------..GTWR--------------FI--H......DLR---------------------------------
POL_SMRVH/71-240-------------..GSWR--------------LL--Q......DLR---------------------------------
POL_MMTVB/68-237-------------..GKWR--------------LL--Q......DLR---------------------------------
POL_CAMVC/289-452-------------RRGKKR--------------MV--V......NYK---------------------------------
POL_IPHA/60-229-------------..GKWR--------------LL--H......DLR---------------------------------
POL_HV1MA/655-826-------------.STKWR--------------KL--V......NFR---------------------------------
TF21_SCHPO/455-615-------------..GTLR--------------MV--V......DYK---------------------------------
POK10_HUMAN/76-245-------------..GKWH--------------TL--T......DLR---------------------------------
POL4_DROME/357-523-------------DKKKWR--------------LV--I......DYR---------------------------------
POLY_DROME/224-390-------------GNPNKR--------------LV--I......DFR---------------------------------
POL_EIAV9/249-419-------------..GKWR--------------LL--Q......DLR---------------------------------
YTX2_XENLA/513-765-------------LIKNWR--------------P.--.VSLLSTDYK---------------------------------
POL_SOCMV/246-411-------------KRGKRR--------------MV--I......NYK---------------------------------
Y2R2_DROME/498-741-------------EPSSYR--------------G.--.ICLLPVFGK---------------------------------
POL_BIV29/638-806-------------.TGRWR--------------ML--M......DFR---------------------------------
RDPO_ACUOB/124-343-------------..GSAR--------------P.--.LSIPSYTDR---------------------------------
POL2_DROME/249-414-------------GANKYR--------------VV--I......DYR---------------------------------
RT67_ECOLX/48-262-------------..KGVR--------------T.--.ISAPTDRLK---------------------------------
RTJK_DROME/502-757-------------DVDSYR--------------P.--.TSLLPSLGK---------------------------------
POL_BLVAU/41-212-------------..GAWR--------------FV--H......DLR---------------------------------
POL_RTBVP/1228-1390-------------VAQKPR--------------IV--Y......NYK---------------------------------
POL_CAEVC/210-380-------------..GKWR--------------ML--I......DFR---------------------------------
P91581_CIOIN/483-644-------------..KKPR--------------MV--I.....DYSQ---------------------------------
P95451_PSEAC/119-326-------------..GGTR--------------Q.--.LGIPSVVDR---------------------------------
Q01379_NEUCS/505-761-------------LAGAWR--------------P.--.ISLLSNVGK---------------------------------
Q03261_SIV/246-416-------------.KKKWR--------------ML--I......DFR---------------------------------
Q04135_DROME/496-743-------------QPSSYR--------------P.--.ISLLTCLSK---------------------------------
Q07995_CHITU/509-760-------------ELSSYR--------------P.--.ISLLSSISK---------------------------------
Q08724_9CYAN/108-336-------------.NVEKR--------------P.--.LGIPTMQDR---------------------------------
YRD6_CAEEL/484-644-------------.TGKIR--------------VC--A....DFKCS---------------------------------
Q17329_CAEEL/1071-1231-------------..GSIR--------------MC--I......DYR---------------------------------
Q24262_DROME/531-692-------------..GTLR--------------VC--V......DYR---------------------------------
Q24690_DROTE/495-742-------------KTTSYR--------------P.--.ISLNCCIAK---------------------------------
Q26816_9TRYP/545-793-------------DLDSYR--------------P.--.VTLTSCLCK---------------------------------
Q46666_ECOLX/34-241-------------..TGFR--------------V.--.IAQPAKGLK---------------------------------
Q83013_9RETR/68-238-------------.KSKFR--------------ML--H......DLR---------------------------------
Q88285_9RETR/848-1015-------------..GSWR--------------LT--I......DYR---------------------------------
POL_CSVMV/250-413-------------KRGKTR--------------MV--I......DYK---------------------------------
Q93137_BOMMO/515-771-------------.PTSYR--------------P.--.ISLLMSLGK---------------------------------
Q93139_BOMMO/469-719-------------EPKSHR--------------P.--.IGLLPVLGK---------------------------------
Q94885_DROME/759-920-------------..GDLR--------------MC--V......DFR---------------------------------
YG31B_YEAST/639-797-------------..GTFR--------------LC--V......DYR---------------------------------
Q9YGS2_TAKRU/573-830-------------VLANYR--------------P.--.ISNLPFISK---------------------------------
Q9YW31_MSEPV/161-406-------------ICNNYR--------------G.--.INLINWACK---------------------------------
Q9ZNW4_SORBI/922-1081-------------..GKMR--------------MC--I......DFT---------------------------------
Q9ZQ67_ARATH/542-701-------------..DKWR--------------VC--I......DFT---------------------------------
Q9ZQQ6_ARATH/659-918-------------LMRDYR--------------P.--.ISCCNVIYK---------------------------------
Q9ZS84_SOLLC/655-815-------------..GTMR--------------MC--V......DYR---------------------------------
Q9ZVK4_ARATH/510-669-------------..GSFR--------------LC--I......DYR---------------------------------

PF05919

Q6EH16_9VIRU/1-501----------..NGKISLL--------------TS--LLDALAFWSD---------------------------------
Q5TMB5_9VIRU/174-658----------...NGHAIS--------------SV--LNDALSYDEK---------------------------------
Q18L80_9VIRU/166-639----------GCNNTEGWL--------------TA--IRRLKHLFTW---------------------------------
Q9WJ23_9VIRU/164-642----------...NGQSTL--------------HS--SYGLFSMIFV---------------------------------
RDRP_CPMV1/246-745----------..NGKISLL--------------TS--SVDALSFITQ---------------------------------
Q9ZXZ7_THACU/214-754----------..SNKVSWF--------------GI--LTDTRLLREG---------------------------------
Q9WJ22_9VIRU/155-622----------...NGKASM--------------SS--LYSIISFNSS---------------------------------
Q6EH19_9VIRU/208-686----------...NGPSIS--------------SC--LQDLPKFNGL---------------------------------
Q9WJ24_9VIRU/163-645----------...HGPQSL--------------TW--YHTIKLYDFN---------------------------------
Q6GYC2_9VIRU/156-638----------...TGPSTL--------------TA--LWGLWNHSYE---------------------------------
Q18L78_9VIRU/174-654----------..NGGVSLR--------------NV--IIDAYALMKH---------------------------------
Q18L79_9VIRU/168-671----------GMNNTAGWI--------------LA--FRRLKALFLD---------------------------------
Q3S3F3_9VIRU/120-606----------...MGKSTW--------------SS--IWSMYALKHE---------------------------------
O92614_9VIRU/173-711----------..NHSISMM--------------GI--WKDIYAWYVS---------------------------------

PF07727

Q7G640_ORYSJ/781-1029--------------NGTWE--------------L----VHLLKQK.K---------------------------------
Q7XLN3_ORYSJ/465-703--------------RDVFL--------------P----VMPTCRGFF---------------------------------
Q7XTU6_ORYSJ/940-1185--------------NQTWS--------------L----AELPAGH.K---------------------------------
Q7XKS1_ORYSJ/160-403--------------TCTWD--------------L----VPLPSHA.R---------------------------------
Q9FWI2_ORYSJ/795-1030--------------NNTWE--------------L----VDRPRDR.K---------------------------------
Q94I36_ORYSJ/864-1109--------------NKDWT--------------L----VEPPSGH.N---------------------------------
Q7G6C9_ORYSJ/1047-1286--------------NQVWT--------------L----VERPK.Q.N---------------------------------
Q94LQ7_ORYSJ/550-793--------------NKTWH--------------R----VPSKKGQ.N---------------------------------
Q7XKG6_ORYSJ/514-759--------------NKTWE--------------L----VPFPTGK.K---------------------------------
Q7X5X4_ORYSJ/138-383--------------NGTWE--------------L----VPRHAGH.C---------------------------------
Q84M55_ORYSJ/910-1155--------------NKTWE--------------L----VKLPPEK.R---------------------------------
Q7Y173_ORYSJ/398-645--------------NGVWD--------------L----VEIPKGS.K---------------------------------
Q8W5F4_ORYSJ/472-717--------------NGTWE--------------V----TERPCGC.K---------------------------------
Q7XUD9_ORYSJ/916-1161--------------NNTWR--------------L----VDLPSGH.R---------------------------------
Q8LNW7_ORYSJ/880-1128--------------NHTWE--------------F----VKLPKEK.K---------------------------------
Q94HQ0_ORYSJ/485-718--------------NRTWE--------------L----ADLPRGH.R---------------------------------
Q7Y1I1_ORYSJ/727-972--------------NKTWR--------------L----VDLPRGH.H---------------------------------
Q94GR9_ORYSJ/975-1220--------------NKVWT--------------L----IERPRDH.N---------------------------------
Q7X7N0_ORYSJ/758-1003--------------NGTWR--------------L----VPRPPGA.N---------------------------------
Q7XZY2_ORYSJ/297-542--------------NSTWC--------------L----TNLPPRH.K---------------------------------
Q7XN62_ORYSJ/915-1162--------------NDVWD--------------L----EEIPKGA.K---------------------------------
Q7XLI2_ORYSJ/53-298--------------NRTWD--------------L----VPRPNGA.N---------------------------------
B5RTA2_DEBHA/1170-1414--------------.EVYT--------------V----VKNPKNV.K---------------------------------
B5RTR8_DEBHA/1021-1254--------------NNTWD--------------L----VSLPKDR.K---------------------------------
E7KRB3_YEASL/146-383--------------.KTYR--------------L----VSLPKQR.R---------------------------------
Q2R072_ORYSJ/915-1159--------------NKTWR--------------L----VDLPSGH.R---------------------------------
Q59K02_CANAL/999-1236--------------NNTWS--------------L----EPLPEGR.K---------------------------------
Q5AG24_CANAL/888-1133--------------NQVYT--------------V----EKTPKNV.V---------------------------------
Q5AH82_CANAL/122-366--------------.DVYE--------------E----VPIPTGV.K---------------------------------
Q7XN23_ORYSJ/31-274--------------NNTWH--------------L----VPYEKGQ.N---------------------------------
Q8S476_MAIZE/836-1081--------------NGTWE--------------V----VDRPYGC.Q---------------------------------
Q8S479_MAIZE/1073-1313--------------..FWT--------------L----VPRPK.Q.N---------------------------------

PF00680

POLG_HAVHM/1750-2215------------APG......IDAIN.......MDSSPGFPYV-----QE......KLTK--------------------
RDRP_BPPH6/19-638------------LFRAAVRLMFSDLEPVPLKIRKGSSTCIPYF-----SNDMGTKIEIAE--------------------
POLG_PYFV1/2270-2778------------IDG...VEYYEPLN.......MSTSEGYPLI-----LNRPK.DAHGKE--------------------
POL1_CPMVS/1186-1687------------CEG...VEYMERIP.......LATSEGFPHI-----LSRNG.KEKGKR--------------------
POLG_RHDVF/1279-1750------------A........FNTLD.......LSTSCG.PFV-----........PGKK--------------------
POLG_PVYN/2293-2763------------I........FKALN.......MKAAVGASY.-----........GCKK--------------------
POLG_EMCVR/1844-2288------------LEG......MDPMD.......RNTSPGLPYT-----AL......GMRR--------------------
POLG_FCVUR/1266-1735------------A........FHKLN.......HDTSCG.PYL-----........GGRK--------------------
POLG_NVN68/1301-1766------------.........CQSLD.......KTTSSGYPH.-----........HKRK--------------------
Q9DLK1_FMDVP/1865-2314------------VDG......LDAME.......PDTAPGLPWA-----LQ......GKRR--------------------
POLG_VESVA/1379-1848------------A........FYMLN.......HDTLCG.PYI-----........GARK--------------------
POL1_BAYMY/1634-2098------------V........ISDIQ.......WNTSAGPSY.-----........QGKK--------------------

PF02123

Q83093_9VIRU/437-816............LSVLGQSNAEVLSR-------HGDLVYIAVA.......ERLIALSEAD....................
Q66150_9VIRU/22-408............LAEIGVSNQQVIDV-------AWPLVCEAVV.......ERLHALASVD....................
Q86519_9VIRU/516-902............LAGLANSNGEVRGL-------ARDLVCLAVV.......ERLNPLPSVD....................
RDRP_SCPMV/464-849............LSRLATTNKDLMAQ-------HMQFVAACVT.......GRVPLLASFE....................
RDRP_SBMVA/490-847............LSRLASTNKDLLKR-------HLELVALCVT.......ERLFLLSEAE....................
RDRP_PEMVW/733-1124.................KTNDKWVFD-------HESTEDLWET.......VRDRLFRLLN....................
RDRP_PLRVW/609-1004..................THRGWVED-------HKLLPVLTQL.......TFDRLQKMSE....................
RDRP_TYYVF/580-974..................THRGWVED-------QKLLPILAQL.......TFFRLQKMLE....................
Q65969_9LUTE/603-996..................THRGWVED-------KKLLPILARL.......TFNRLQKMLE....................
RDRP_ROTGI/108-803ASECAPLQIENNIYVSEAQKKEWAES-------FKSDPLNKSRMLKLMNENLNTTLDKFS....................
RDRP_ROTHC/109-749............IRGTFITTENLELE-------YSNKSINYLISKEMAEDFMQAIKQLRDEGLEYIPDYYEKWFKSPDPL
O55590_9REOV/104-749............INGTFITTEELELE-------FSNKYVKAIVPQKTLDELNDMLIAMEKANLYNIPKLIRNWIDAPTLS
RDRP_ROTPY/100-748............INGTFITNEELELE-------FSDKYVKAIVPDQTFNELQEMIDNMKKAGLVDIPRMIQEWLVDCSLE
Q90153_9VIRU/1025-1530............LYGRGGVLVNWAED-------FANKASHPDPIQAWDGRCYSQKLATEI....................
Q90193_9VIRU/400-785..........................-------.................CTKVIIRLTE....................
RDRP_PCVC/362-832............LVGRGEYTVDEMAE-------VELRTDDTYNTKHLSYDPNRQVFTNQQ....................
RDRP_SCVLB/837-1303............LENGVDEEVDWEKE-------KRNRSDIKTV.....NISYAKVLEHCR....................
Q87025_SCVLA/177-657............LMNRGVGHVSWQAE-------KDHRLNPDVA...........VVDQAR....................
Q90155_TTV1/96-539............LLGRGAIPGDAALD-------MKHRLTYNPL........MTVDVPKTQ....................
Q9JE94_9VIRU/129-560............LQGRGVTSSDAKRD-------LTHRIA.DVN.......PHEAKISREN....................
Q8V615_9VIRU/41-473............LIGRGVKSSDPSAD-------LYHRVAPEGN.......RHEAKIPRHI....................
Q83073_9VIRU/49-523............LRGRGIAELDVIAE-------AKQRLKKPTH.......PYAYADNEEL....................
RDRP_LRVLG/155-619............LLGRGVNEIDVETE-------ARRRLDVGSL.......SMQRLDENEL....................
Q98XW8_9VIRU/144-622............LQGRGVNRLDLLED-------AERRVSATFN.......CPIVHVPADA....................
Q99AT3_9VIRU/99-573............LLGRAAGPADLSEE-------ARYRTSSDVE.......SHLAIFSDAD....................
Q9YXE4_9VIRU/99-573............LQGRAVQPADMHSE-------AISRTTTAVA.......DIVVDYPDDV....................
RDRP_HV19S/122-585............LQGRYDRTLDMDHE-------VESRCSPAAI.......ADQVIPYTDE....................
Q9YXE6_9VIRU/120-589............LLGRAVSTIDLAHE-------AEYRCDPDLV.......AKQVIEPGEE....................

PF04197

RDRP_IBDVU/1-875PWVPLTRVPSRMLVLTGDVDGEFEVEDYLPKINLKSSSGLPYVGRTKGETIGEMIAISNQ------------FLRELSAL
RDRP_IPNVJ/1-842..PDLRWAPSWLINYTGDLSTD...KSYLPHVTIKSSAGLPYIGKTKGDTTAEALVLADS------------FIRDLGR.
RDRP_BSNV/1-863.WPSLTTTLSELLNPAEGM.......DYLPHITMKSSSGLPFIGKTKGETVTSALAICDT------------FLREVSEC

PF00978

R1AB_LIYV9/1925-2366---------------------------------APIINHKL------------------D--------------------
R1AB_BYVU/2601-3046---------------------------------F.TVCERF------------------S--------------------
Q9YPH5_9VIRU/1359-1796---------------------------------APRLQESV------------------N--------------------
POLN_EEVVM/2041-2488---------------------------------VTQMRELP------------------.--------------------
E0YCR0_9CLOS/53-491---------------------------------ADRGCNVG------------------C--------------------
RDRP_TOMS1/1168-1609---------------------------------SPELSGVV------------------D--------------------
RDRP_PSVJ/295-726---------------------------------VPELSGSV------------------D--------------------
Q66107_9BROM/228-662---------------------------------IPELQSTF------------------D--------------------
Q87644_SINDV/2053-2501---------------------------------VTQMRELP------------------.--------------------
O56790_9VIRU/1323-1760---------------------------------APRLQESV------------------N--------------------
RDRP_CMVFN/308-738---------------------------------VPELGDSV------------------N--------------------
Q9WJD8_PEBV/1299-1738---------------------------------APDLQQNV------------------H--------------------
Q80875_BSMV/195-630---------------------------------APRLQGAL------------------N--------------------
RDRP_RBDVR/1234-1674---------------------------------VMNSQKYF------------------D--------------------
RDRP_SBWMN/1373-1810---------------------------------APKLQEAV------------------N--------------------
POLN_ONNVI/2053-2501---------------------------------VTQMRELP------------------T--------------------
RDRP_TAV/313-742---------------------------------VPELCGSV------------------N--------------------
POLN_MIDDV/534-981---------------------------------VTQMRELP------------------T--------------------
RDRP_TMGMV/1163-1604---------------------------------APDLTGTI------------------D--------------------
RDRP_TOBSV/253-689---------------------------------VPELQSNF------------------D--------------------
RDRP_OLV2I/310-732---------------------------------APQMVEVP------------------.--------------------
RDRP_YOMV/1155-1594---------------------------------APDLTGTI------------------D--------------------
RDRP_AMVLE/318-752---------------------------------VPNLGQIY------------------D--------------------
POLN_RRVN/2019-2467---------------------------------VTQMRELP------------------T--------------------
RDRP_ASPVP/1758-2169---------------------------------...LSFSS------------------P--------------------
O56250_9VIRU/1240-1678---------------------------------APDLQENV------------------H--------------------
O90699_9VIRU/1363-1800---------------------------------APQLQESV------------------N--------------------
Q9Q6Q3_9CLOS/62-509---------------------------------ADRGCDVS------------------S--------------------
POLN_AURAV/2038-2486---------------------------------VTQMRELP------------------.--------------------
RDRP_BBMV/271-697---------------------------------VPELSDVV------------------D--------------------
RDRP_CCMV/267-697---------------------------------VPELADSV------------------D--------------------
Q66581_EEEV/144-598---------------------------------VTQMRELP------------------.--------------------
Q9QGG9_9BROM/363-797---------------------------------VPDLQQVL------------------F--------------------
RDRP_TMOB/1167-1614---------------------------------SPELSGTV------------------D--------------------
RDRP_BMV/256-688---------------------------------VPEMGDAI------------------N--------------------
O40960_9CLOS/62-506---------------------------------APRLNEDI------------------S--------------------

PF00998

RDRP_TNVA/224-703---------------------------------VEG..PNG....LQD........APKP--------------------
RDRP_TCV/272-752---------------------------------VED.AQKQ....LKP........APQP--------------------
RDRP_TNVD/224-709---------------------------------VEV..KGE....LQP........TPKP--------------------
RDRP_MCMVK/460-941---------------------------------VKD.DKGE....LVS........CPEP--------------------
POLG_HCVEU/2430-2941---------------------------------VTFDRV.Q....VFD..........QH--------------------
POLG_HCVED/2420-2931---------------------------------VTFDRL.Q....VVD..........ST--------------------
POLG_HCVJL/2434-2945---------------------------------VTFDRQ.Q....VVD..........QH--------------------
POLG_HCVJK/2431-2942---------------------------------VTFDRL.Q....VLD..........DH--------------------
POLG_HCVEV/2426-2937---------------------------------VTFDRL.Q....VLD..........DH--------------------
POLG_HCVJ6/2445-2956---------------------------------VTFDRMQA....LDA...........H--------------------
Q9IR83_9TOMB/236-712---------------------------------VED.ACKN....LVP........TPQP--------------------
Q87031_9LUTE/24-502---------------------------------VG.KGNEV....VLP.........YKN--------------------
RDRP_POLVP/251-722---------------------------------VVR..DGK....LQR........PLRP--------------------
Q65987_9TOMB/269-750---------------------------------VED.AQKE....LKP........APQP--------------------
P90338_9TOMB/1-480---------------------------------VEDKVNKT....LVP........CPEP--------------------
RDRP_BYDV1/361-840---------------------------------VG.KGDKA....IYP.........PRP--------------------
O09796_9HEPC/2422-2933---------------------------------VTFDRL.Q....VLD..........DH--------------------
O09803_9FLAV/2373-2866---------------------------------VTFWRAPR....VHD..........KF--------------------
O37361_9VIRU/252-737---------------------------------YK...GGP....VLE...........P--------------------
Q9WJD9_CARMV/267-744---------------------------------VER..NKE....LVS........CPQP--------------------
Q83103_9TOMB/228-711---------------------------------VEK..SGK....LEY........TPKP--------------------
Q66127_9VIRU/52-520---------------------------------TDNRGSLP....VRP............--------------------
RDRP_PMVK/447-937---------------------------------VKN.YKTD....FVASLDPAFCPAPEP--------------------
POLG_GBVB/2277-2785---------------------------------VTINRQ.P....LFP..........PS--------------------
Q89801_9TOMB/1-479---------------------------------VER.EGK.....LVP........PPEP--------------------
Q9IRA1_9TOMB/266-741---------------------------------VE..SNGV....LQP........PLKP--------------------
O12301_9TOMB/231-708---------------------------------VER..DKN....LVE........PPAP--------------------
Q83424_MNSV/290-772---------------------------------VEN.DKKE....LEP........APKP--------------------
O41892_9FLAV/2409-2899---------------------------------VTIWRGQR....KYD..........KE--------------------
RDRP_OCSVU/235-734---------------------------------VKNLDKGSPTKFVSP.........PRP--------------------
Q9IW60_9TOMB/325-800---------------------------------VER..NGK....LTR........TPQP--------------------
Q96898_9FLAV/2396-2886---------------------------------VTIWRGDR....KYD..........KH--------------------
RDRP_RCNMV/260-745---------------------------------VKNSAGEL....VVP.........PKP--------------------

PF00972

POLG_YEFV1/2758-3406---------------------------------SAASMVNGVIKILTYPWDRIEEVTRMA--------------------

PF00078

A0A016RNU0_KLEPN/135-366---------------------------------I----------------------------------------------
A0A025GH98_ECO57/115-332---------------------------------A----------------------------------------------
D7ZFU1_ECOLX/62-269---------------------------------L----------------------------------------------
F6BM08_SINMB/72-291---------------------------------I----------------------------------------------
M7UYJ9_ECOLX/33-239---------------------------------A----------------------------------------------
O01419_BOMMO/502-756---------------------------------L----------------------------------------------
O18558_AEDAE/472-725---------------------------------C----------------------------------------------
O42691_ALTAL/36-202---------------------------------D----------------------------------------------
O44316_DROMR/394-650---------------------------------Q----------------------------------------------
O52231_STREE/68-275---------------------------------M----------------------------------------------
O62658_CANFA/517-773---------------------------------I----------------------------------------------
O64612_ARATH/788-1031---------------------------------A----------------------------------------------
O65244_ARATH/405-664---------------------------------V----------------------------------------------
O65598_ARATH/489-747---------------------------------V----------------------------------------------
O81284_ARATH/58-317---------------------------------V----------------------------------------------
O81454_ARATH/144-304---------------------------------A----------------------------------------------
O93520_ORYLA/518-771---------------------------------L----------------------------------------------
O96546_LYMDI/526-780---------------------------------I----------------------------------------------
O99969_PORPU/100-315---------------------------------A----------------------------------------------
POL_RSVP/769-938---------------------------------A----------------------------------------------
POL_HTL1A/633-804---------------------------------A----------------------------------------------
POL_SMRVH/71-240---------------------------------A----------------------------------------------
POL_MMTVB/68-237---------------------------------A----------------------------------------------
POL_CAMVC/289-452---------------------------------A----------------------------------------------
POL_IPHA/60-229---------------------------------A----------------------------------------------
POL_HV1MA/655-826---------------------------------E----------------------------------------------
TF21_SCHPO/455-615---------------------------------P----------------------------------------------
POK10_HUMAN/76-245---------------------------------A----------------------------------------------
POL4_DROME/357-523---------------------------------Q----------------------------------------------
POLY_DROME/224-390---------------------------------K----------------------------------------------
POL_EIAV9/249-419---------------------------------E----------------------------------------------
YTX2_XENLA/513-765---------------------------------I----------------------------------------------
POL_SOCMV/246-411---------------------------------K----------------------------------------------
Y2R2_DROME/498-741---------------------------------V----------------------------------------------
POL_BIV29/638-806---------------------------------E----------------------------------------------
RDPO_ACUOB/124-343---------------------------------C----------------------------------------------
POL2_DROME/249-414---------------------------------K----------------------------------------------
RT67_ECOLX/48-262---------------------------------D----------------------------------------------
RTJK_DROME/502-757---------------------------------I----------------------------------------------
POL_BLVAU/41-212---------------------------------V----------------------------------------------
POL_RTBVP/1228-1390---------------------------------R----------------------------------------------
POL_CAEVC/210-380---------------------------------E----------------------------------------------
P91581_CIOIN/483-644---------------------------------T----------------------------------------------
P95451_PSEAC/119-326---------------------------------L----------------------------------------------
Q01379_NEUCS/505-761---------------------------------I----------------------------------------------
Q03261_SIV/246-416---------------------------------K----------------------------------------------
Q04135_DROME/496-743---------------------------------L----------------------------------------------
Q07995_CHITU/509-760---------------------------------I----------------------------------------------
Q08724_9CYAN/108-336---------------------------------A----------------------------------------------
YRD6_CAEEL/484-644---------------------------------G----------------------------------------------
Q17329_CAEEL/1071-1231---------------------------------K----------------------------------------------
Q24262_DROME/531-692---------------------------------K----------------------------------------------
Q24690_DROTE/495-742---------------------------------K----------------------------------------------
Q26816_9TRYP/545-793---------------------------------V----------------------------------------------
Q46666_ECOLX/34-241---------------------------------D----------------------------------------------
Q83013_9RETR/68-238---------------------------------A----------------------------------------------
Q88285_9RETR/848-1015---------------------------------P----------------------------------------------
POL_CSVMV/250-413---------------------------------D----------------------------------------------
Q93137_BOMMO/515-771---------------------------------L----------------------------------------------
Q93139_BOMMO/469-719---------------------------------L----------------------------------------------
Q94885_DROME/759-920---------------------------------K----------------------------------------------
YG31B_YEAST/639-797---------------------------------T----------------------------------------------
Q9YGS2_TAKRU/573-830---------------------------------V----------------------------------------------
Q9YW31_MSEPV/161-406---------------------------------L----------------------------------------------
Q9ZNW4_SORBI/922-1081---------------------------------D----------------------------------------------
Q9ZQ67_ARATH/542-701---------------------------------D----------------------------------------------
Q9ZQQ6_ARATH/659-918---------------------------------V----------------------------------------------
Q9ZS84_SOLLC/655-815---------------------------------A----------------------------------------------
Q9ZVK4_ARATH/510-669---------------------------------G----------------------------------------------

PF05919

Q6EH16_9VIRU/1-501---------------------------------P..LRVIHFIWFNIRCYGYFWGLIWSM--------------------
Q5TMB5_9VIRU/174-658---------------------------------S..SNALLGVS.........PEVHKRM--------------------
Q18L80_9VIRU/166-639---------------------------------G..E.ITSILD................--------------------
Q9WJ23_9VIRU/164-642---------------------------------G..HTILENIL.............KIV--------------------
RDRP_CPMV1/246-745---------------------------------P..TKIFTYLDFSVRVYK.FRGLLLWM--------------------
Q9ZXZ7_THACU/214-754---------------------------------S..PRLWENIQ...........AYLTM--------------------
Q9WJ22_9VIRU/155-622---------------------------------N..IRYLFNIV................--------------------
Q6EH19_9VIRU/208-686---------------------------------F..RSQVEVIL................--------------------
Q9WJ24_9VIRU/163-645---------------------------------Q..WLGIIGIL................--------------------
Q6GYC2_9VIRU/156-638---------------------------------S..FNWLFKIT................--------------------
Q18L78_9VIRU/174-654---------------------------------P..KVYASLLELSNVMSPYLGLLLRNQ--------------------
Q18L79_9VIRU/168-671---------------------------------K..EFFLTLLD................--------------------
Q3S3F3_9VIRU/120-606---------------------------------L..HLSLSYFL................--------------------
O92614_9VIRU/173-711---------------------------------PLFPTLLSFIG..........RMNRGN--------------------

PF07727

Q7G640_ORYSJ/781-1029---------------------------------P----------------------------------------------
Q7XLN3_ORYSJ/465-703---------------------------------P----------------------------------------------
Q7XTU6_ORYSJ/940-1185---------------------------------A----------------------------------------------
Q7XKS1_ORYSJ/160-403---------------------------------P----------------------------------------------
Q9FWI2_ORYSJ/795-1030---------------------------------V----------------------------------------------
Q94I36_ORYSJ/864-1109---------------------------------I----------------------------------------------
Q7G6C9_ORYSJ/1047-1286---------------------------------V----------------------------------------------
Q94LQ7_ORYSJ/550-793---------------------------------I----------------------------------------------
Q7XKG6_ORYSJ/514-759---------------------------------V----------------------------------------------
Q7X5X4_ORYSJ/138-383---------------------------------P----------------------------------------------
Q84M55_ORYSJ/910-1155---------------------------------A----------------------------------------------
Q7Y173_ORYSJ/398-645---------------------------------T----------------------------------------------
Q8W5F4_ORYSJ/472-717---------------------------------P----------------------------------------------
Q7XUD9_ORYSJ/916-1161---------------------------------A----------------------------------------------
Q8LNW7_ORYSJ/880-1128---------------------------------P----------------------------------------------
Q94HQ0_ORYSJ/485-718---------------------------------A----------------------------------------------
Q7Y1I1_ORYSJ/727-972---------------------------------A----------------------------------------------
Q94GR9_ORYSJ/975-1220---------------------------------V----------------------------------------------
Q7X7N0_ORYSJ/758-1003---------------------------------V----------------------------------------------
Q7XZY2_ORYSJ/297-542---------------------------------P----------------------------------------------
Q7XN62_ORYSJ/915-1162---------------------------------T----------------------------------------------
Q7XLI2_ORYSJ/53-298---------------------------------V----------------------------------------------
B5RTA2_DEBHA/1170-1414---------------------------------P----------------------------------------------
B5RTR8_DEBHA/1021-1254---------------------------------A----------------------------------------------
E7KRB3_YEASL/146-383---------------------------------A----------------------------------------------
Q2R072_ORYSJ/915-1159---------------------------------P----------------------------------------------
Q59K02_CANAL/999-1236---------------------------------A----------------------------------------------
Q5AG24_CANAL/888-1133---------------------------------P----------------------------------------------
Q5AH82_CANAL/122-366---------------------------------P----------------------------------------------
Q7XN23_ORYSJ/31-274---------------------------------I----------------------------------------------
Q8S476_MAIZE/836-1081---------------------------------P----------------------------------------------
Q8S479_MAIZE/1073-1313---------------------------------V----------------------------------------------

PF00680

POLG_HAVHM/1750-2215-------------------RDLIWLDENGLLL..................................GVHPRLAQRILFNT
RDRP_BPPH6/19-638-------------------RALEKAEEAGNLMLQGKFDDAYQLHQMGGAYYVVYRAQSTDAITLDPKTGKFVSKDRMVAD
POLG_PYFV1/2270-2778-------------------YLFETMESGERR....................................IKSAKLEAHYESY
POL1_CPMVS/1186-1687-------------------RFVQGDDCVVSL....................................IPGTTVAKAYEEL
POLG_RHDVF/1279-1750-------------------IDHVKDGVMD........................................QVLAKHLYKCW
POLG_PVYN/2293-2763-------------------KDYFEHFTDA........................................DKEEIVMQSCL
POLG_EMCVR/1844-2288-------------------TDVVDWESAT..........................................LIPFAAERL
POLG_FCVUR/1266-1735-------------------KDHMTNGEPD........................................KPLLDLLSAKW
POLG_NVN68/1301-1766-------------------NDDWNGTTFV........................................GELGEQAAHAN
Q9DLK1_FMDVP/1865-2314-------------------GALIDFENGT..........................................VGPEVEAAL
POLG_VESVA/1379-1848-------------------KDHVKDGVLD........................................KNLLDLLSSKW
POL1_BAYMY/1634-2098-------------------RDLCAHLSDD........................................EVLHLAEVCRQ

PF02123

Q83093_9VIRU/437-816....................LEAHPKPSDLV.......RLGLCDPV....RLFVKNEP.........HPANKVREGRFRL
Q66150_9VIRU/22-408...................PRQHDWSPEELV.......KRGLCDPV....RLFVKQEP.........HSRQKIEQGRFRL
Q86519_9VIRU/516-902...................PPQHNWTPRELV.......EKGLCDPV....RLFVKNEP.........HPRKKLLERRFRL
RDRP_SCPMV/464-849....................DIHALSPTEMV.......EMGLCDPV....RLFVKQEP.........HPSRKLKEGRYRL
RDRP_SBMVA/490-847....................DLLDESPVDLV.......RRGLCDPV....RLFVKQEP.........HASRKVREGRFRL
RDRP_PEMVW/733-1124...................QDFID..PVQAV.......KDGLVDPI....RLFVKLEP.........HKMEKIRNKRYRL
RDRP_PLRVW/609-1004...................ASFEDMSAEELV.......QEGLCDPI....RLFVKGEP.........HKQSKLDEGRYRL
RDRP_TYYVF/580-974...................VNFEDMGPEELV.......RNGLCDPI....RLFVKGEP.........HKQAKLDEGRYRL
Q65969_9LUTE/603-996...................VRYVDLSPAELV.......RRGLCDPI....RVFVKGEP.........HKQAKLDEGRYRL
RDRP_ROTGI/108-803...LIFNCFSSTFHVGHRIDNAQDAITDQVTATYTSNVNREMYDSYYYKLKQMLKEEIVQYVED...HVAKQYKDVTAES
RDRP_ROTHC/109-749TFPNIALIYSFSFHVGYRKQALSDAVYDQITVTYSDNVNMEMYKEY....SERIENEIFTILKDKIIHEDKRLEEYELSA
O55590_9REOV/104-749GFKLMAKIYSFSFHVGFRKQKMIDAALDQLSTEYSDDVDDEMYQEY....SMLIRDEVVKMLQESVIHDDHLLVDSELAG
RDRP_ROTPY/100-748KFTLMSKIYSWSFHVGFRKQKMIDAALDQLKTEYTEDVDNEMYNEY....TMLIRDEIVKMLEVPVKHDDHLLRDSELAG
Q90153_9VIRU/1025-1530..................INETVNSVVETAY.......PKAVPQSF....DRFMDNAYEWLVSGSSAGIPSPLKNSPMRD
Q90193_9VIRU/400-785....................HMAELDADPSA.......GELLTDPI......................DRIQLRLNKSTL
RDRP_PCVC/362-832.................YKKDFITSVEEAYV.RLKIEPKPVNVDGF....IDFYHRRASWLTKGGLVYNKLPPEMKKFGG
RDRP_SCVLB/837-1303............................ELFIMARAEGKRPMRMKW....QEYWRQRAVIMPGGSV.HSQHPVEQDVIRV
Q87025_SCVLA/177-657..................LYSCVRDMFEGSK.....QTYKYPFMTW....DDYTANRWEWVPGGSVHSQYEEDNDYIYPG
Q90155_TTV1/96-539..................LHDLIYRLLSRNY.......NNTKISSF....EHHLEERLLWSRSGSHYYPDEQIDQ....L
Q9JE94_9VIRU/129-560..................LREAINQIYKEEI......TRKEVPDTF....KQHVFTSPLWVKKGAHHHPLFGSYDNRLEF
Q8V615_9VIRU/41-473..................LIEAINKIYKNEM......TDMPPPGDF....KLHLITSPLWCKAGSHHHPHFAKYSSRLDF
Q83073_9VIRU/49-523..................LRNAIRRVFDEEL.....PRDKVVLRPK....DDFWSSRWLWAANG...GHSRALEHAHPEL
RDRP_LRVLG/155-619...................RAAVRLIYSEEL......RRPVTYPLI....CDFWSSRWLWAANG...SHSRALEHAHPEL
Q98XW8_9VIRU/144-622..................LRQCVRDVLRREL......RTRVVLPPS....DDFFRRRYAWCVGGAHNLNGNDHWLPRSLL
Q99AT3_9VIRU/99-573..................LGAAIDAILDEEI.KRVEGSQHIEFDSY....QEHWNDRWAWAVNGA..HSGHVSRL..YPR
Q9YXE4_9VIRU/99-573..................LRSHIRTVLEREI.QRVGDSHAIEYPTL....QEHWDSRWLWAVNG...SQSGLLSREHLEA
RDRP_HV19S/122-585..................LGACIDFILDTEL.....GGDTIELPDE....DEWWTSRWLWCVNG....SQNALSDKALGI
Q9YXE6_9VIRU/120-589..................LRSHIRAVLAMEL.....AGRDLSLPDL....DSWWSSRWLWCVNGS..QNDASSRLLGIDT

PF04197

RDRP_IBDVU/1-875LKQGAGTKGSNKKKLLSMLSDYWYLSCGLLFPKAERYDKSTCCTKTRNKWSAQSSTHLMISMITWPVMSNSPNNVLNIEG
RDRP_IPNVJ/1-842....AATSADPEAGVKKTITDFWYLSCGLLFPKGERYTQVDWDKKTRNIWSAPYPTHLLLSMVSTPVMNESKLNITNTQ.
RDRP_BSNV/1-863VKEGA..MASDNQKLQKLLQDYWYLSCGLLFPKAERYEKKAWLTKTRNIWSAPFPTHLLLSTISWPIMNSSKNNILNVPE

PF00978

R1AB_LIYV9/1925-2366------------------VKRSAQ.ILYDSVV..KSLRQDRLTE......WYEPILPDLFKIGKWLDDRDGSKYRML...
R1AB_BYVU/2601-3046------------------GPQEFG.QAMAMVMLERSFDLEKVAK.....VRSDVIAITEKGVRTWMSKREPSQLRAL...
Q9YPH5_9VIRU/1359-1796------------------EFEIIE.NTISKAK..RVFLNEDLID.......CSPISNI.EASQRWWQNQSEQAKKQL...
POLN_EEVVM/2041-2488------------------VLDSAA.FNVECFK..KYACNNEYWET....YKKNPIRLTEENVVNYITKLKGPKAAALY.A
E0YCR0_9CLOS/53-491------------------DDSVAH.ELKEIFF..EEVVNKARLAE....VTESHLSSNTMLLSDWLDKRAPNAYKSLK.R
RDRP_TOMS1/1168-1609------------------IENTAS.LVVDKFF..DSYLLKEKRK.....PNKNFSLFSRESLNRWIAKQEQVTIGQL...
RDRP_PSVJ/295-726------------------LTRISK.AVARRFK..ESYFNTN.AL......AQSNFLNV...VGNFHAYMQKWAASGL...
Q66107_9BROM/228-662------------------LDAEVA.TCFKRFC..THVVDIPRSK......RLPQMLGT..EIQFFSDYLAGKNP..P...
Q87644_SINDV/2053-2501------------------TLDSAT.FNVECFR..KYACNDEYWEE....FARKPIRITTEFVTAYVARLKGPKAAALF.A
O56790_9VIRU/1323-1760------------------EFEIIE.NVISKAK..AVFFDEKFID........ASPMNSVSNCQKWWDKQSVTAQKQM...
RDRP_CMVFN/308-738------------------LSRLSK.AVAERFF..ISYINGN.SL......ASSNFVNV...VSNFHDYMEKWKSSGL...
Q9WJD8_PEBV/1299-1738------------------STLLVE.DTIKRLK..EVVYDVEKIR........SDPINNKAHMQKWWRNQSTAVQAKV...
Q80875_BSMV/195-630------------------EWHTIE.NVLTKAL..KVFFFEDLID........RTDHCTYESALRWWDKQSVTARAQL...
RDRP_RBDVR/1234-1674------------------LENLAN.KAVERFF..DFFIDMEKFS..........KLPTGVLGSSAEQIQTYQNKTGN...
RDRP_SBWMN/1373-1810------------------EFEVIE.RTVNRAK..EIFFDTSLID........DSEVSTRESNLRWWKRQSTTAKAQL...
POLN_ONNVI/2053-2501------------------MDSAVF.NV.ECFK..KYACNQEYWRE....FASSPIRVTTENLTMYVTKLKGPKAAALF.A
RDRP_TAV/313-742------------------LKRLSD.DVAECFM..LSFMNGDKLC.......SSNFINI...VSDFHAYMSKWQS.VL...
POLN_MIDDV/534-981------------------LDSAVF.NV.ECFK..KYACNNDYWDE....FAQKPIRLTTENITSYVTRLKGPKAAALF.A
RDRP_TMGMV/1163-1604------------------IESTAS.VVVDKFF..DSYFIKKEKY.....TKNIAGVMTKDSMMRWLENRKEVLLDDL...
RDRP_TOBSV/253-689------------------HDDVLN.RCVTRFI..THVVDKTRLS......KLNPISGE..ELHYFNQYLENKNP..P...
RDRP_OLV2I/310-732------------------QEIHVK.RLADRFF..RTFLKEGGWD.........KGD.....GHYWDDFFHRKGRKVF...
RDRP_YOMV/1155-1594------------------IEDTAS.LVVEKFW..DAYVVKEFSG.......TDGMAMTRESFSRWLSKQESSTVGQL...
RDRP_AMVLE/318-752------------------VNSVAN.SVVNKLL..TTVIDPDKLC......MFPDFISE.GEVSYFQDYIVGKNP..D...
POLN_RRVN/2019-2467------------------LDSAVF.NV.ECFK..KFACNGEYWQE....FKDDPIRITTENITTYVTRLKGPKAAALF.A
RDRP_ASPVP/1758-2169------------------AAEHAKLRRAKPFG..KFLLDTFLKRVP.LNSSHDEKMMQ.EAVHAFEEKKLSKSMATI...
O56250_9VIRU/1240-1678------------------ATVLIE.ETMKKLK..SVVYDVGKIR........ADPIVNRAQMERWWRNQSTAIQAKV...
O90699_9VIRU/1363-1800------------------EFEIIE.KTVTRAR..DIFFDVDRID........ASVMNTVENAARWWGKQSFTAQKQM...
Q9Q6Q3_9CLOS/62-509------------------DPVAAA.ELASLFF..NTWVDGSKLAS....CVGDTISQNAVAASSWLDSRSSMAKQSLWVR
POLN_AURAV/2038-2486------------------VLDSAV.FNVECFK..KYACNTDYWEE....FKEKPIRITTECVTSYVARLKGPEAAALF.A
RDRP_BBMV/271-697------------------....AT.EVPICLR..QSYLNIYGAD......CLFESFNI...MAKGLDYHKRWKS.HK...
RDRP_CCMV/267-697------------------IKRVAC.EVAEKFK..RAYLNHSGIG......LLGQSMDV...MSRGLEYHKKWKD.HK...
Q66581_EEEV/144-598------------------VLDSAA.FNVECFK..KYACNDEYWDF....YKTNPIRLTAENVTQYVTKLKGPKAAALF.A
Q9QGG9_9BROM/363-797------------------EDDEAR.KIANRFI..NTVIDPNKLA......QFPGYISE.GEMGYFNKYLSGKNI..P...
RDRP_TMOB/1167-1614------------------MENTAS.VVADRFF..DSYFLKDKLSGCSLGDSGGKNIIDRQALIRWMEKQEKSTIGQL...
RDRP_BMV/256-688------------------MKDTAK.AIAKRFR..STFLNVDGED......CLRASMDV...MTKCLEYHKKWGK.HM...
O40960_9CLOS/62-506------------------IDETAN.RLLTSLM..RCMEPSRLAE......YFDVVEPDVNKINSWLLTRDRRKYGNV...

PF00998

RDRP_TNVA/224-703------------------VKGAFR-T.LDKFR--DLYTKNSW..------.RHTPVTSEQFLMNYTGRKLTIYREAV---
RDRP_TCV/272-752------------------IPGIFG-K.LSGIR--RRLVRLAG..------.NHTPVPREKYPSFYKGRRATIYQKAL---
RDRP_TNVD/224-709------------------TPGAFN-Q.MSRFS--DRLSIHLP..------.KTTRLTPREFLGFYTGRKLERYQKAV---
RDRP_MCMVK/460-941------------------ISGIFW-KNLKGFR--NSIVHHVG..------.HRHPVSRETFLAYYTGPKRTMYEKAV---
POLG_HCVEU/2430-2941------------------YQDVLK-E.IKLRA--STVQAKLLSI------EEACDLTPSHSARSKYGYGAQ.DVRSR---
POLG_HCVED/2420-2931------------------YNEVLK-E.IKARA--SRVKPRLLTT------EEACDLTPPHSARSKFGYGKK.DVRSH---
POLG_HCVJL/2434-2945------------------YYDTLK-E.MKARA--STVSAKLLSV------EEACDLTPAHSARSKFGYGAK.DVRGR---
POLG_HCVJK/2431-2942------------------YNTTLK-E.IKELA--SGVKAELLSV------EEACRLVPSHSARSKFGYGAK.EVRSL---
POLG_HCVEV/2426-2937------------------YREVVD-E.MKRLA--SKVKARLLPL------EEACGLTPPHSARSKYGYGAK.EVRSL---
POLG_HCVJ6/2445-2956------------------YDSVLK-D.IKLAA--SKVTARLLTL------EEACQLTPPHSARSKYGFGAK.EVRSL---
Q9IR83_9TOMB/236-712------------------LPGKFQ-E.LKYLA--RRVARIAG..------.HHTPIPREHYPGLYKGRRYQIYADAV---
Q87031_9LUTE/24-502------------------KPGIFS-N.LDYFR--DSIVNKV...------GCPRTHTPEELAATYHSGKRSLYNAAV---
RDRP_POLVP/251-722------------------KNNVFE-RKLGNVG--RRISSIVG..------.YCPAMTRSEFCESYSGTRRATYERAR---
Q65987_9TOMB/269-750------------------LPDAFA-K.LSGIR--RKLVKLAG..------.NHTPILREDYSKLYKGRRATIYQNAC---
P90338_9TOMB/1-480------------------DRNAFK-E.LAYLK--RRLVRIVG..------.LHTRISAAQVVDCYQGRKRTVYHNAR---
RDRP_BYDV1/361-840------------------EHDIFT-DTMDYFQ--KSIIEEV...------GYCKTYPAQLLANSYSAGKRAMYHKAI---
O09796_9HEPC/2422-2933------------------YRDVLK-E.MKAKA--STVKAKLLSI------EEACKLTPPHSAKSKYGYGAK.DVRNL---
O09803_9FLAV/2373-2866------------------LVDSIE-R.AKRAA--QACLSMGYTY------EEAIRTVRPHAA...MGWGSKVSVKDL---
O37361_9VIRU/252-737------------------SPGAWK-S.LRGLA--TSLGNRC...------.LTTPLSPEEFLACYVGRKRTIYTKAM---
Q9WJD9_CARMV/267-744------------------EPGSFK-E.MGYLR--RRFHRVCG..------.NHTRISANDLVDCYQGRKRTIYENAA---
Q83103_9TOMB/228-711------------------TPGAFN-.QLSRFT--RALLPFLT..------.KTTRLTTKEFLGFYTGRKLERYTKAS---
Q66127_9VIRU/52-520------------------TPGRFD-R....LT--VDIKHFK...------..INAWSMEDVVNSYTGRQRARYEQAM---
RDRP_PMVK/447-937------------------VRGIFK-R.LDKYK--KEIVRRVG..------.RKSPITDEMFLSYYDGPQLTTYSKAV---
POLG_GBVB/2277-2785------------------YHKQVR-L.AKEKA--SKVVGVMWDY------DEVAAHTPSKSAKSHITGLRGTDVRSG---
Q89801_9TOMB/1-479------------------IPGIFS-R.LAGFK--SKLKKIVG..------.THSRISDDAFVALYHGRRNTIYQNAV---
Q9IRA1_9TOMB/266-741------------------KVHQFR-K.LKYFA--RRLVNIVG..------.PYTPIEREEYPLLYQGRRKAIYQKAL---
O12301_9TOMB/231-708------------------S.VDFR-..LPHFS--SAFKKVIG..------.RHTPVTRQAFVEFYRGRKRTIYEKAV---
Q83424_MNSV/290-772------------------LSGAFD-R.LTWFR--RKLHSIVG..------.THSSISPGQFLDFYTGRRRTIYEGAV---
O41892_9FLAV/2409-2899------------------YYSVVD-E.ALKKA--RATKSPGWTY------EQAISKVRRRAA...AGWGSKVTASTL---
RDRP_OCSVU/235-734------------------APGVFA-QRLSNTL--GLLVPFLP..------.STAPMSHQQFVDSTPSRKRKVYQQAL---
Q9IW60_9TOMB/325-800------------------TKGAFG-.RLSPFR--KAVCEKVG..------.VAHRYGYDGFLSYYSGAKLRTYTRAV---
Q96898_9FLAV/2396-2886------------------YEAVVE-A.VLKKA--AATKSHGWTY------SQAIAKVRRRAA...AGYGSKVTASTL---
RDRP_RCNMV/260-745------------------IQNAFD-S.ISYFR--EEWLRKLSHK------GQILKSSLADVVACYSSEKRKLYQKAA---

PF00972

POLG_YEFV1/2758-3406------------------MTDTTPFGQQRVFK--EKVDTRAKDP-------PAGTRKIMKVVNRWLFRHLAREKNPR---

PF00078

A0A016RNU0_KLEPN/135-366--------------------------------------------------------------------------------
A0A025GH98_ECO57/115-332--------------------------------------------------------------------------------
D7ZFU1_ECOLX/62-269--------------------------------------------------------------------------------
F6BM08_SINMB/72-291--------------------------------------------------------------------------------
M7UYJ9_ECOLX/33-239--------------------------------------------------------------------------------
O01419_BOMMO/502-756--------------------------------------------------------------------------------
O18558_AEDAE/472-725--------------------------------------------------------------------------------
O42691_ALTAL/36-202--------------------------------------------------------------------------------
O44316_DROMR/394-650--------------------------------------------------------------------------------
O52231_STREE/68-275--------------------------------------------------------------------------------
O62658_CANFA/517-773--------------------------------------------------------------------------------
O64612_ARATH/788-1031--------------------------------------------------------------------------------
O65244_ARATH/405-664--------------------------------------------------------------------------------
O65598_ARATH/489-747--------------------------------------------------------------------------------
O81284_ARATH/58-317--------------------------------------------------------------------------------
O81454_ARATH/144-304--------------------------------------------------------------------------------
O93520_ORYLA/518-771--------------------------------------------------------------------------------
O96546_LYMDI/526-780--------------------------------------------------------------------------------
O99969_PORPU/100-315--------------------------------------------------------------------------------
POL_RSVP/769-938--------------------------------------------------------------------------------
POL_HTL1A/633-804--------------------------------------------------------------------------------
POL_SMRVH/71-240--------------------------------------------------------------------------------
POL_MMTVB/68-237--------------------------------------------------------------------------------
POL_CAMVC/289-452--------------------------------------------------------------------------------
POL_IPHA/60-229--------------------------------------------------------------------------------
POL_HV1MA/655-826--------------------------------------------------------------------------------
TF21_SCHPO/455-615--------------------------------------------------------------------------------
POK10_HUMAN/76-245--------------------------------------------------------------------------------
POL4_DROME/357-523--------------------------------------------------------------------------------
POLY_DROME/224-390--------------------------------------------------------------------------------
POL_EIAV9/249-419--------------------------------------------------------------------------------
YTX2_XENLA/513-765--------------------------------------------------------------------------------
POL_SOCMV/246-411--------------------------------------------------------------------------------
Y2R2_DROME/498-741--------------------------------------------------------------------------------
POL_BIV29/638-806--------------------------------------------------------------------------------
RDPO_ACUOB/124-343--------------------------------------------------------------------------------
POL2_DROME/249-414--------------------------------------------------------------------------------
RT67_ECOLX/48-262--------------------------------------------------------------------------------
RTJK_DROME/502-757--------------------------------------------------------------------------------
POL_BLVAU/41-212--------------------------------------------------------------------------------
POL_RTBVP/1228-1390--------------------------------------------------------------------------------
POL_CAEVC/210-380--------------------------------------------------------------------------------
P91581_CIOIN/483-644--------------------------------------------------------------------------------
P95451_PSEAC/119-326--------------------------------------------------------------------------------
Q01379_NEUCS/505-761--------------------------------------------------------------------------------
Q03261_SIV/246-416--------------------------------------------------------------------------------
Q04135_DROME/496-743--------------------------------------------------------------------------------
Q07995_CHITU/509-760--------------------------------------------------------------------------------
Q08724_9CYAN/108-336--------------------------------------------------------------------------------
YRD6_CAEEL/484-644--------------------------------------------------------------------------------
Q17329_CAEEL/1071-1231--------------------------------------------------------------------------------
Q24262_DROME/531-692--------------------------------------------------------------------------------
Q24690_DROTE/495-742--------------------------------------------------------------------------------
Q26816_9TRYP/545-793--------------------------------------------------------------------------------
Q46666_ECOLX/34-241--------------------------------------------------------------------------------
Q83013_9RETR/68-238--------------------------------------------------------------------------------
Q88285_9RETR/848-1015--------------------------------------------------------------------------------
POL_CSVMV/250-413--------------------------------------------------------------------------------
Q93137_BOMMO/515-771--------------------------------------------------------------------------------
Q93139_BOMMO/469-719--------------------------------------------------------------------------------
Q94885_DROME/759-920--------------------------------------------------------------------------------
YG31B_YEAST/639-797--------------------------------------------------------------------------------
Q9YGS2_TAKRU/573-830--------------------------------------------------------------------------------
Q9YW31_MSEPV/161-406--------------------------------------------------------------------------------
Q9ZNW4_SORBI/922-1081--------------------------------------------------------------------------------
Q9ZQ67_ARATH/542-701--------------------------------------------------------------------------------
Q9ZQQ6_ARATH/659-918--------------------------------------------------------------------------------
Q9ZS84_SOLLC/655-815--------------------------------------------------------------------------------
Q9ZVK4_ARATH/510-669--------------------------------------------------------------------------------

PF05919

Q6EH16_9VIRU/1-501------------------WLIFIMIISLPY......YLIAL...................CLGARAPV.........---
Q5TMB5_9VIRU/174-658------------------MNFLKLNEIVPLRHKL...CRAL...................FLDKIISKPA.......---
Q18L80_9VIRU/166-639------------------..........PYKEGK..WEKSD...................FYSFWASIQP.LTDNVP---
Q9WJ23_9VIRU/164-642------------------GEKQYHEIIGNHIKKLYHDHRLF...................IPGKIDYL.........---
RDRP_CPMV1/246-745------------------WMMCILLITLPY......AIVSF...................MLGALIPI.........---
Q9ZXZ7_THACU/214-754------------------VGADQFRFDLDYACSLADRLKSFDDKVDSQGQWIRQVSKSGQVLTQVDSMKSKDSIRGH---
Q9WJ22_9VIRU/155-622------------------..GDYQLVLNKFYQDLSQFYTKY...................INRDKLG..........---
Q6EH19_9VIRU/208-686------------------......PELLPIIDTLLTWEKSF...................KLSTLMGLAGFKDDS..---
Q9WJ24_9VIRU/163-645------------------.....PKSVLDLFTETLSYASKL...................VLPEIKSNIKSTKL...---
Q6GYC2_9VIRU/156-638------------------.....SLSGVDYLTKIMNWTWLK...................DLGNKNNNKWSKQF...---
Q18L78_9VIRU/174-654------------------TTI..IRAITDFDPIKWERIKPF...................MAPVYQSIKDQTLNLIP---
Q18L79_9VIRU/168-671------------------..........PYKERRQWWESSP...................FIKYFNAILPDFDDNVS---
Q3S3F3_9VIRU/120-606------------------GEAYKTLFYLPYLKNMALSYGHD...................VPPKQWP..........---
O92614_9VIRU/173-711------------------VLIDLLRAEVSY......WEATG...................VKPSVSPLDLK......---

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------
B5RTA2_DEBHA/1170-1414--------------------------------------------------------------------------------
B5RTR8_DEBHA/1021-1254--------------------------------------------------------------------------------
E7KRB3_YEASL/146-383--------------------------------------------------------------------------------
Q2R072_ORYSJ/915-1159--------------------------------------------------------------------------------
Q59K02_CANAL/999-1236--------------------------------------------------------------------------------
Q5AG24_CANAL/888-1133--------------------------------------------------------------------------------
Q5AH82_CANAL/122-366--------------------------------------------------------------------------------
Q7XN23_ORYSJ/31-274--------------------------------------------------------------------------------
Q8S476_MAIZE/836-1081--------------------------------------------------------------------------------
Q8S479_MAIZE/1073-1313--------------------------------------------------------------------------------

PF00680

POLG_HAVHM/1750-2215VMMENC.---------SDLDVVFTTCPKDELRPL-----EKV........LESK---TRAIDACPLDYSILCRMYWG---
RDRP_BPPH6/19-638FEYAVT.---------GGEQGSLFAASKDASRLK-----EQYGIDVPDGFFCER---RRTAMGGPFALNAPIMAVAQ---
POLG_PYFV1/2270-2778GHALQST---------EPFPLICIECPKDERRAL-----DKI.......YEKPK---TRLFSILPVEFNMHARRLFL---
POL1_CPMVS/1186-1687EASAHR.---------FVPALVGIECPKDEKLPM-----RKV.......FDKPK---TRCFTILPMEYNLVVRRKFL---
POLG_RHDVF/1279-1750SVANSG.---------KALHHIYACGLKDELRPL-----DKV........KEGK---KRLLWGCDVGVAVCAAAVFH---
POLG_PVYN/2293-2763RLYKGL.---------LG...IWNGSLKAELRCK-----EKI........LANK---TRTFTAAPLDTLLGGKVCVD---
POLG_EMCVR/1844-2288RKMNEG.---------DFSEVVYQTFLKDELRPI-----EKV........QAAK---TRIVDVPPFEHCILGRQLLG---
POLG_FCVUR/1266-1735KLATQG.---------IALPHEYTIGLKDELRPV-----EKV........AEGK---RRMIWGCDVGVATVCAAAFK---
POLG_NVN68/1301-1766NMYENA.---------KHMKPIYTAALKDELVKP-----EKI.......YQKVK---KRLLWGADLGTVVRAARAFG---
Q9DLK1_FMDVP/1865-2314KLMESR.---------EY.KFVCQTFLKDEIRPL-----EKV........RAGK---TRIVDVLPVEHILYTRMMIG---
POLG_VESVA/1379-1848NRAKLG.---------LALPHEYALGLKDELRPK-----DKV........AVGK---RRLIWGCDVGVSTVCAAAFK---
POL1_BAYMY/1634-2098QFLEGK.---------.S.TGVWNGSLKAELRTI-----EKV........EPEK---TRVFTASPITSLFAMKFYVD---

PF02123

Q83093_9VIRU/437-816ISSVSLVDQ.......LVERLLFGPQNKAEIALW.....QSVPSKPGMGL.......SQKWQFEALWKDLQIKHASA---
Q66150_9VIRU/22-408ISSVSLVDQ.......LVERMLFGPQNTTEIALW.....HSNPSKPGMGL.......SKASQVALLWEDLARKHQTH---
Q86519_9VIRU/516-902ISSVSLVDQ.......LVERMLFGPQNNTEISTW.....WQWPSKPGMGL.......LTPEQIRLVWDDVFQKHQAH---
RDRP_SCPMV/464-849ISSVSIVDQ.......LVERMLFGAQNELEIAEW.....QSIPSKPGMGL.......SVIHQADAIFRDLRVKHTVC---
RDRP_SBMVA/490-847ISSVSLVDQ.......LVERMLFGPQNQLEIAEW.....EHIPSKPGMGL.......SLRQQAKSLFDDLRVKHSRC---
RDRP_PEMVW/733-1124IASVSIVDQ.......LVARMLFRDQNEEELLQH.....MAIPSKPGLGF.......SQDHQVLAFTESVAALAG.T---
RDRP_PLRVW/609-1004IMSVSLVDQ.......LVARVLFQNQNKREISLW.....RSVPSKPGFGL.......STDTQTAEFLECLQKVSGAP---
RDRP_TYYVF/580-974IMSVSLVDQ.......LVARVLFQNQNKREIALW.....RAIPSKPGFGL.......STDEQVLDFVESLARQVGTT---
Q65969_9LUTE/603-996IMSVSLVDQ.......LVARVLFQNQNKREIALW.....RVVPSKPGFGL.......STDEQVAEFMQILSAQVGLT---
RDRP_ROTGI/108-803LSALANSSNGFSKEVKFIDRNIKTTKKILHLDNDLI...TNDYSDLSKALSHGIPMGTRNVPARQTRGIFILPWQVA---
RDRP_ROTHC/109-749LLSMSSASNGILREINFGGQKVRSTKKNMHVIDDIYHKKYTTDI.PPVDARNPIPLGRRDVPGRRTRAIFILPYQYF---
O55590_9REOV/104-749LLSMSSASNGESRQLKFGKKTIFSTKKNMHVMDDMYNGKYNPELVPKVDQTHPIPLGRRDVPGRRTRIIFILPYEYF---
RDRP_ROTPY/100-748LLSMSSASNGESRQLKFGRKTIFSTKKNMHVMDDIAHGRYTPGVIPPVNVDRPIPLGRRDVPGRRTRIIFILPYEYN---
Q90153_9VIRU/1025-1530LVLKEYGLS.....PRPTKRSVMEAIPRDKVLKILTETSPKIVAKAHMKLNETGGK.ARAIYGVTLWHYIFSNWLMA---
Q90193_9VIRU/400-785LNFLPVVEA........VEAAWRNYDPNSFTGVF.......WKHEVGKNA.......SRSLWPAHLVHYVLVSMILH---
RDRP_PCVC/362-832QVFDAIYNTCREIQGRHNKKSLFEVYELAEVLQG...ANENNFNLTKTQIKYEVGKKDRTLLPGTLVHFVVFTYVLY---
RDRP_SCVLB/837-1303LPREIRSKKGVASVMPYKEQKYFTSRR............PEIHAYTSTKYEWGK...VRALYGCDFSSHTMADFGLL---
Q87025_SCVLA/177-657QYTRNKFITVNKMPKHKISRMIASPP...EVRAW...........TSTKYEWGK...QRAIYGTDLRSTLITNFAMF---
Q90155_TTV1/96-539LPPQPTRKE.......FLDIVTIDYIKQCK.........PQVFIRQSRKLEHGK...ERFIYNCDTISYVYFDFVLK---
Q9JE94_9VIRU/129-560VENV............DLDRVLKSH..............PAVYITQAPKLEHGK...TRFIYNCDTVSYIYFDYILN---
Q8V615_9VIRU/41-473VMDV............PADKIAAVP..............PSVFITQAEKLEHGK...TRYIYNCDTXSYLFFDYILH---
Q83073_9VIRU/49-523RTRKEVR.........AYRKCVLEQWRNNPMDAW....DGQVYVTPSQKLEHGK...SRLLLACDTLSYLWFEYYLK---
RDRP_LRVLG/155-619ATRKEGQ.........AYRKAVMEQWQHNPMDRW....DGTVYVTPSAKLEHGK...TRLLLACDTLSYMWFEYALR---
Q98XW8_9VIRU/144-622PQFPAALL........WNRRAALNCVERNPLKRW....SGHVRVSVAEKVEQGK...GRAIYSCDTLSYTAFSWLLE---
Q99AT3_9VIRU/99-573VPKPPGMLR.......EHRRAWLESVTEDPRTDW....DGKTFVSASPKLEAGK...TRAIFACDTVNYLAFEHLLA---
Q9YXE4_9VIRU/99-573APRPPGAAR.......EYRAVMARESEQDPRPAW....DGHTYVSGSPKLEHGK...TRAIFACDTLNYLAFEHLLA---
RDRP_HV19S/122-585KNKSGQ..........RYRRMAAEEVNNNPVPAW....NGHTSVSPSVKLENGK...DRAIFACDTRSYFAFTYWLT---
Q9YXE6_9VIRU/120-589ARFREFHTR.......EYRRMASEALTHEPITSW....DGYTNISASPKLEHGK...TRAIFACDTRSYFAFEWLLG---

PF04197

RDRP_IBDVU/1-875CPSLYKFNPFRGGLNRIVEWI...MAPDEPKALVYADNIYIVHSNTWYSIDLEKGEANCTRQHMQAAMYYILTRGWS.DN
RDRP_IPNVJ/1-842TPSLYGFSPFHGGMDRIMTIIRDSLDNDEDLVMIYADNIYILQDNTWYSIDLEKGEANCTPQHMQAMMYYLLTRGWTNED
RDRP_BSNV/1-863CVSLYGFNPFSGGMDAVVTNIL..AQPDETLFLIYADNIYIYMDRTWFSIDLEKGEANATPEHAQAVSYYLLTRGWTQDD

PF00978

R1AB_LIYV9/1925-2366NR-RLDFAS.LA...DKFKTLNLMVKGETKPKMD-----LSTYD..SYNAPANI---VYYQQIVNLYFSPIFLECFA---
R1AB_BYVU/2601-3046SS-DLQKPLNLE...EEITTFKLMVKRDAKVKLD-----SSCLV..KHPPAQNI---MFHRKAVNAIFSPCFDEFKN---
Q9YPH5_9VIRU/1359-1796IA-.ETKIL.SE...IDVGVYNFMIKRDVKPKLD-----LSPQS..EYGALQTV---VYPDKIVNALFGPVIKEINE---
POLN_EEVVM/2041-2488KT-HNLDML.QD...IPMDRFIMDLKRDVK..VT-----PGTKHTEERPKVQVI---QAADPLATAYLCGIHRELVR---
E0YCR0_9CLOS/53-491AL-.GSFVF.HP...SMLTSYTLMVKADVKPKLD-----NTPLS..KYVTGQNI---VYHDRCVTALFSCIFTACVE---
RDRP_TOMS1/1168-1609AD-FDFVDL.PA...VD..QYRHMIKAQPKQKLD-----LSIQT..EYPALQTI---VYHSKKINAIFGPLFSELTR---
RDRP_PSVJ/295-726TY-DDLPDL.HA...ENLQLYEHMVKSDVKPVVA-----DTLNV..DRPVPATI---TFHAKGITSQFSPLFISLFE---
Q66107_9BROM/228-662LS-EYQGPL.TL...QSLDKYMHMVKTIVKPVED-----NSLKF..ERPLCATI---TYHKKGIVMQSSPLFLSAMS---
Q87644_SINDV/2053-2501KT-YNLVPL.QE...VPMDRFVMDMKRDVK..VT-----PGTKHTEERPKVQVI---QAAEPLATAYLCGIHRELVR---
O56790_9VIRU/1323-1760LA-.DTRII.SE...IDLCTYNFMIKNDVKPKLD-----LSPQS..EYSALQTV---VYPDKIVNAIFGPVMKEINE---
RDRP_CMVFN/308-738SY-DDLPDL.HA...ENLQFYDHMIKSDVKPVVS-----DTLNI..DRPVPATI---TYHKKSITSQFSPLFTALFE---
Q9WJD8_PEBV/1299-1738MQ-.DVREL.HE...IDFSSYMFMIKSDVKPKMD-----STPQH..EYSALQTV---IYHEKLINSLFGPIFKEINE---
Q80875_BSMV/195-630VA-.DQRRL.CD...VDFTTYNFMIKNDVKPKLD-----LTPQV..EYAALQTV---VYPDKIVNAFFGPIIKEINE---
RDRP_RBDVR/1234-1674KV-TDPVCV.AL...SPIQKYKHMIKRDVKFNLT-----DGAQS..EYTKAATI---TYHQPEITQVATAIFGQFKT---
RDRP_SBWMN/1373-1810KK-.ETRLL.HE...LDLCYYNYCIKGDEKPKMD-----RSPQH..EYGALQTV---VFPDKIVNALFGPAMKEINE---
POLN_ONNVI/2053-2501KT-HNLLPL.QE...VPMDRFTMDMKRDVK..VT-----PGTKHTEERPKVQVI---QAAEPLATAYLCGIHRELVR---
RDRP_TAV/313-742SY-DDLPDL.NA...ENLQFYEHMVKSDVKPSVT-----DTLNI..DRPLPATI---TFHRKQLTSQFSPLFTALFQ---
POLN_MIDDV/534-981KT-YDLKPL.QE...VPMDRFVVDMKRDVK..VT-----PGTKHTEERPKVQVI---QAAEPLATAYLCGIHRELVR---
RDRP_TMGMV/1163-1604AN-YNFTDL.PA...ID..QYKHMIKAQPKQKLD-----LSIQN..EYPALQTI---VYHSKQINGILAG.FSELTR---
RDRP_TOBSV/253-689LS-EYKGPV.PL...VALDKYMHMIKTTLKPVEE-----DNLHI..ERPIPATI---TYHKKGVVMMTSPYFLCAMV---
RDRP_OLV2I/310-732SL-ENCYDD.PL...SS...YLVMLKSAGKFSLD-----LNFP...VRSVPQTI---TYHEKWVTEVFSPMFLQVMA---
RDRP_YOMV/1155-1594AD-FNFVDL.PA...VD..EYKHMIKSQPKQKLD-----LSIQD..EYPALQTI---VYHSKKINAIFGPMFSELTR---
RDRP_AMVLE/318-752PE-LYSDPL.GV...RSIDSYKHMIKSVLKPVED-----NSLHL..ERPMPATI---TYHDKDIVMSSSPIFLAAAA---
POLN_RRVN/2019-2467KT-HNLVPL.QE...VPMDRFVVDMKRDVK..VT-----PGTKHTEERPKVQVI---QAAEPLATAYLCGIHRELVR---
RDRP_ASPVP/1758-2169EN-.HSGRS.CEDWPVD.KALIFM.KSQLCTKFD-----NRFR...SAKAGQTL---ACFQHSVLCRFAPYMRYIES---
O56250_9VIRU/1240-1678VA-.DVREL.HE...IDYSSYMYMIKSDVKPKTD-----LTPQF..EYSALQTV---VYHEKLINSLFGPIFKEINE---
O90699_9VIRU/1363-1800IA-.DTRVV.HE...IDVCTYNFMIKNDVKPKLD-----LSPQS..EYAALQTV---VLPDKIVNALFGPIMKKINE---
Q9Q6Q3_9CLOS/62-509LR-SFVYDL.AA...MT..RYQLMVKADAKPKLD-----STPLQ..QYVTGQNI---VYHDRAITAMFSHIFTQAVE---
POLN_AURAV/2038-2486KT-HQLVPL.QE...VPMDRFVMDMKRDVK..VT-----PGTKHTEERPKVQVI---QAAEPLATAYLCGIHRELVR---
RDRP_BBMV/271-697EL-QGVTLL.CE...TNLQRYQHMIKSDVKPTVT-----DTLHV..ERDVPATI---TFHGKGVTSCFSPFFTACFE---
RDRP_CCMV/267-697DL-TGVTVL.SE...INLQRYQHMIKSDIKPVVS-----DTLHL..ERAVAATI---TFHGKGVTSCFSPYFTACFE---
Q66581_EEEV/144-598KT-HNLQPL.HE...IPMDRFVMDLKRDVK..VT-----PGTKHTEERPKVQVI---QAADPLATAYLCGIHRELVR---
Q9QGG9_9BROM/363-797ED-AFVDPC.AL...VSMDKYRHMIKTQLKPVED-----CSQIF..ERPLASPI---TYHDKGKVMSTSPILVMMCN---
RDRP_TMOB/1167-1614AD-YDFVDL.PA...ID..QYRHIIKSQPKQKLD-----LSIQS..EYPSLQTI---VYHSKKINALFGPIFSELTR---
RDRP_BMV/256-688DL-QGVNVA.AE...TDLCRYQHMLKSDVKPVVT-----DTLHL..ERAVAATI---TFHSKGVTSNFSPFFTACFE---
O40960_9CLOS/62-506LR-GFDGND.WT...TKLFNLKLMVKGDMKPKLD-----MSGVS..EYSPASNI---IYYQTMINMFFSPIFLEIFG---

PF00998

RDRP_TNVA/224-703DS.LSHQPL-SSR.DAKLKTFVKAEKLNLSKKPD-----PAPR.------..VI---QPRSPRYNVCLGRYLRHYEH---
RDRP_TCV/272-752DS.LHDRPV-SRK.DAELKTFVKAEKINFTAKKD-----PAPR.------..VI---QPRDPRYNIEVGKYLKPYEH---
RDRP_TNVD/224-709ES.LEMHPV-REK.DAWLSTFVKAEKLNITAKPD-----PAPR.------..VI---QPRDPRYNVEVGRFLRHSEE---
RDRP_MCMVK/460-941NS.LYEMPV-SYD.DAKLKTFVKAEKINLTKKAD-----PVPR.------..VI---QPRAPRYNVELGRYLRPVEH---
POLG_HCVEU/2430-2941AS.KAVDHI-PSVWEGLLEDSDTPIPTTIMAKNE-----VFCVD------PSKG---GRKPARLIVYPDLGVRVCEK---
POLG_HCVED/2420-2931SR.KAINHI-SSVWKDLLDDNNTPIPTTIMAKNE-----VFAVN------PAKG---GRKPARLIVYPDLGSRVCEK---
POLG_HCVJL/2434-2945TS.KALNHI-NSVWEDLLEDNVTPIPTTIMAKNE-----VFCVD------VSKG---GRKPARLIVYPDLSVRVCEK---
POLG_HCVJK/2431-2942SS.KAINHI-NSVWEDLLEDNTTPIPTTIMAKNE-----VFAVA------PHKG---GRKPARLIVYPDLGVRICEK---
POLG_HCVEV/2426-2937DK.KALKHI-EGVWQDLLDDSDTPLPTTIMAKNE-----VFAVE------PSKG---GKKPARLIVYPDLGVRVCEK---
POLG_HCVJ6/2445-2956SG.RAVNHI-KSVWKDLLEDTQTPIPTTIMAKNE-----VFCVD------PTKG---GKKAARLIVYPDLGVRVCEK---
Q9IR83_9TOMB/236-712NS.LASNPV-HRR.DSFLKTFVKAEKINFSAKPD-----PAPR.------..VI---QPRDPRYNVEVGRYLKPYEH---
Q87031_9LUTE/24-502QS.LKKKAV-ERS.DANVTAFLKMEK.HLMSK.K-----IAPR.------..LI---CPRNKRYNVELGRRLKFNEK---
RDRP_POLVP/251-722LS.LDVLPC-TRK.DAYLKTFVKAEKINITLKPD-----PAPR.------..VI---QPRDPRYNVEVGRYLKPLEP---
Q65987_9TOMB/269-750ES.LADRAC-TQGGSAELKTFVKAEKINFTAKKD-----PAPR.------..VI---QPRDPRYNIEVGKYLKCYEH---
P90338_9TOMB/1-480LS.LDEIPL-DRR.DSHLRTFTKAEKFCVDLKPD-----PAPR.------..VI---QPRSPRYNLQVARYLKKTEH---
RDRP_BYDV1/361-840AS.LRTIPY-HQK.DANVQAFLKKEK.HWMTK.D-----IAPR.------..LI---CPRSKRYNIILGTRLKFNEK---
O09796_9HEPC/2422-2933SS.RAVNHI-RSVWEDLLEDTETPIDTTIMAKSE-----VFCVQ------PEKG---GRKPARLIVFPDLGVRVCEK---
O09803_9FLAV/2373-2866ATPAGKMAV-HDRLQEILEG..TPVPFTLTVKKE-----VFFK.------.DRK---EEKAPRLIVFPPLDFRIAEK---
O37361_9VIRU/252-737ES.FKTKPW-DARKDMIVKAFIKKEK.DKLVDES-----CDPR.------..II---QPRTPRFVTRFGRYVRAIEK---
Q9WJD9_CARMV/267-744AS.LLDRAI-ERK.DGDLKTFIKAEKFNVNLKSD-----PAPR.------..VI---QPRSPRYNVELGRYLKKYEH---
Q83103_9TOMB/228-711ES.LEVISF-QEK.DSWLSTFVKAEKINITAKPD-----PAPR.------..VI---QPRDPRYNVELGRYLRIVKS---
Q66127_9VIRU/52-520LS.IMERPL-ERR.DARVSTFIKAEKINFSAKPD-----PAPR.------..VI---QPRDPRFNVVFAKYIKPLEP---
RDRP_PMVK/447-937IS.LSERPV-AVQ.DSYLKTFIKAEKLNLTLKTD-----PCPR.------..VI---QPRHPRYNVELGKYLKHIEH---
POLG_GBVB/2277-2785AARKAVLDL-QKCVEAGEIPS.HYRQTVIVPKEE-----VFVKT------PQKP---TKKPPRLISYPHLEMRCVEK---
Q89801_9TOMB/1-479DS.LRIGGV-QRK.DSYLSTFIKAEKIPIYRKPD-----PAPR.------..VI---QPRNPRYNVEVGRYLRPFEH---
Q9IRA1_9TOMB/266-741ES.LSERPC-TRK.DAKLRTFVKAEKINFTSKGD-----PAPR.------..VI---QPRDPRYNIEVGKYLKKAEH---
O12301_9TOMB/231-708ES.LSAAPV-THR.DARLKTFVKAEKLVLSRKPD-----PAPR.------..II---QPRAPRYNVELGVYLRPFEH---
Q83424_MNSV/290-772KS.LEGLSV-QRR.DAYLKTFVKAEKINTTKKPD-----PAPR.------..VI---QPRNVRYNVEVGRYLRRFEH---
O41892_9FLAV/2409-2899DK..GWPHV-KEMLDKIAFH..KEVPFTFVTKXE-----VFFS.------..KT---TRKPPRFIVFPPLDFRIAEK---
RDRP_OCSVU/235-734ED.ISCHGL-NLETDSKVKVFVKYEKTDHTSKAD-----PVPR.------..VI---SPRDPKYNLALGRYLRPMEE---
Q9IW60_9TOMB/325-800ES.LHITPV-SER.DSHLTTFVKAEKIS.TAKSD-----PAPR.------..VI---QPRNPRYNVELGRYLRHMES---
Q96898_9FLAV/2396-2886AT..GWPHV-EEMLDKIARG..QEVPFTFVTKRE-----VFFS.------..KT---TRKPPRFIVFPPLDFRIAEK---
RDRP_RCNMV/260-745DS.LEKKPV-QWR.DSKVQAFIKVEKLECDTK.D-----PVPR.------..TI---QPRSKRYNLAIGQYLRLNEK---

PF00972

POLG_YEFV1/2758-3406LCTKEEFIA-KVRSHAAIGAYLEEQEQWKTANEA-----VQDPKFWELVDEERK---LHQQGRCRTCVYNMMGKREK---

PF00078

A0A016RNU0_KLEPN/135-366-----------------VQYALVKILNAVY....-----..EN---------DF---MGFSYGFRPGRSQHDA-------
A0A025GH98_ECO57/115-332-----------------MQALYLLALEPVA....-----..EV---------TA---DQRSFGFRTGRSTADA-------
D7ZFU1_ECOLX/62-269-----------------LQSRINKRIFKE.....-----..LV---------VF---PSFLFGSVPSKNDVLN-------
F6BM08_SINMB/72-291-----------------AQMVVKQMIEPDL....-----..DS---------LF---LPDSYGYRPGKSALDA-------
M7UYJ9_ECOLX/33-239-----------------IQRDIIEILKQH.....-----...T---------HI---HDAATAYVDGKNILD.-------
O01419_BOMMO/502-756-----------------LERVVAGRLVRHLE...-----NVGP---------NL---ADSQYGFRRGRSTLDA-------
O18558_AEDAE/472-725-----------------LERIIDHHIRDVYL...-----.ANM---------PL---HVNQHAYQSGKSTVTL-------
O42691_ALTAL/36-202-----------------LNSKIVL..........-----....---------.D---EYPIPLSRTL......-------
O44316_DROMR/394-650-----------------LNAILASRLTAA.....-----...V---------SW---DPRQRGFLPTDGCADN-------
O52231_STREE/68-275-----------------IQQAIVQVMSPIC....-----..EP---------HF---SDTSYGFRPNRSCEKA-------
O62658_CANFA/517-773-----------------LNKILANRIQQYI....-----..KK---------II---HHDQVGFIPGTQGWFN-------
O64612_ARATH/788-1031-----------------ISKLLANRLKCLL....-----..PE---------FI---APNQSAFISDRLLMEN-------
O65244_ARATH/405-664-----------------ISKIIANRLKLVL....-----..PK---------FI---VGNQSAFVKDRLLIEN-------
O65598_ARATH/489-747-----------------IARLLTDRLQKLL....-----..SC---------VI---SPSQSAFLPGRLLAEN-------
O81284_ARATH/58-317-----------------ITRLISKRLNLFI....-----..DQ---------AV---QSNQVGFIKGRLLCEN-------
O81454_ARATH/144-304-----------------INNITIK..........-----....---------.Y---RHPIPRLYDM......-------
O93520_ORYLA/518-771-----------------FTSIISRRLETIL....-----..PM---------LM---HKDQTGFIKQRQTQDS-------
O96546_LYMDI/526-780-----------------YERIVLSRLRTFAE...-----.ANN---------LV---PDAQFGFRAKHSCVQQ-------
O99969_PORPU/100-315-----------------KQCLVKFALEPQY....-----..EA---------IF---EPNSYGFRPGRSANDA-------
POL_RSVP/769-938-----------------VNAKLVP..........-----....---------.F---GAVQQGAPVLSAL...-------
POL_HTL1A/633-804-----------------TNSLTID..........-----....---------.L---SSSSPGPPDLSSL...-------
POL_SMRVH/71-240-----------------VNKVMVP..........-----....---------.M---GALQPGLPSPVAI...-------
POL_MMTVB/68-237-----------------VNATMHD..........-----....---------.M---GALQPGLPSPVAV...-------
POL_CAMVC/289-452-----------------MNKATIG..........-----....---------.D---AYNLPNKDEL......-------
POL_IPHA/60-229-----------------INNQMHL..........-----....---------.F---GPVQRGLPLLSAL...-------
POL_HV1MA/655-826-----------------LNKRTQD..........-----....---------.F---WEVQLGIPHPAGL...-------
TF21_SCHPO/455-615-----------------LNKYVKP..........-----....---------.N---IYPLPLIEQL......-------
POK10_HUMAN/76-245-----------------VNAVIQP..........-----....---------.M---GPLQPGLPSPAMI...-------
POL4_DROME/357-523-----------------INKKLLA..........-----....---------.D---KFPLPRIDDI......-------
POLY_DROME/224-390-----------------LNEKTIP..........-----....---------.D---RYPMPSIPMI......-------
POL_EIAV9/249-419-----------------LNKTVQV..........-----....---------.G---TEISRGLPHPGGL...-------
YTX2_XENLA/513-765-----------------VAKAISLRLKSVL....-----..AE---------VI---HPDQSYTVPGRTIFDN-------
POL_SOCMV/246-411-----------------MNEATIG..........-----....---------.D---SYKLPRKDFI......-------
Y2R2_DROME/498-741-----------------LEAIMVNRVREV.....-----..LP---------EG---CRWQFGFRQGRCVEDA-------
POL_BIV29/638-806-----------------LNKITVK..........-----....---------.G---QEFSTGLPYPPGI...-------
RDPO_ACUOB/124-343-----------------LQALYKLAIEPMA....-----..EE---------VA---DLSSYGFRPMRNVSWA-------
POL2_DROME/249-414-----------------LNEITIP..........-----....---------.D---RYPIPNMDEI......-------
RT67_ECOLX/48-262-----------------IQRRICDLLSDCRDEIF-----AIRK---------IS---NNYSFGFERGKSIIL.-------
RTJK_DROME/502-757-----------------MERLILNRLLTCKD...-----.VTK---------AI---PKFQFGFRLQHGTPEQ-------
POL_BLVAU/41-212-----------------TNALTKP..........-----....---------.I---PALSPGPPDLTAI...-------
POL_RTBVP/1228-1390-----------------LNDNMHT..........-----....---------.D---PFNIPHKISM......-------
POL_CAEVC/210-380-----------------LNKQTED..........-----....---------.L---TEAQLGLPHPGGL...-------
P91581_CIOIN/483-644-----------------VNVFTEL..........-----....---------.D---AYPLPSIESI......-------
P95451_PSEAC/119-326-----------------IQQALQQQLTPIF....-----..DP---------LF---SDYSYGFRPGRSTHQA-------
Q01379_NEUCS/505-761-----------------LEALVAKRLTQAAE...-----.EFN---------LL---PEGQMGNRAGRSTEFA-------
Q03261_SIV/246-416-----------------LNEATQD..........-----....---------.F---FEVQLGIPHPGGL...-------
Q04135_DROME/496-743-----------------FEKMLLLRISPHLR...-----.INN---------TL---PTHQFGFREKHGTIEQ-------
Q07995_CHITU/509-760-----------------LERVLLNRINDHLE...-----.DNN---------II---PNQQCGFRTGRSTSHQ-------
Q08724_9CYAN/108-336-----------------TQSLVKLALEPEW....-----..EA---------KF---EPNSYGFRPGRNAHDA-------
YRD6_CAEEL/484-644-----------------LNAALKD..........-----....---------.E---FHPLPTSEDIFSR...-------
Q17329_CAEEL/1071-1231-----------------VNKVVKN..........-----....---------.N---AHPLPNIEAT......-------
Q24262_DROME/531-692-----------------LNTMVLM..........-----....---------.D---CFPVPIMEEV......-------
Q24690_DROTE/495-742-----------------LDKIIAKRLWWLVT...-----.HSN---------LL---SENQFGFKKGKSTSDC-------
Q26816_9TRYP/545-793-----------------MERIIAARLRDTV....-----..ES---------QL---TPQQSAFRPGCSTLEQ-------
Q46666_ECOLX/34-241-----------------IQRAFVQ.LYNF.....-----....---------PV---HDASMAYMKGKGIRD.-------
Q83013_9RETR/68-238-----------------VNALIKD..........-----....---------.W---GALQPGTPWPGAI...-------
Q88285_9RETR/848-1015-----------------LNSAVSC...P......-----....---------.Y---PTVASTPELF......-------
POL_CSVMV/250-413-----------------LNKKAKV..........-----....---------.V---KYPIPNKDTL......-------
Q93137_BOMMO/515-771-----------------YERLLYKRLRDFVS...-----.SKG---------IL---IDEQFGFRTNHSCVQQ-------
Q93139_BOMMO/469-719-----------------YEKMLVARLKYHL....-----..LP---------RM---STRQFGFMPQRSTEDS-------
Q94885_DROME/759-920-----------------LNKMTMK..........-----....---------.D---NYPLPLIDDL......-------
YG31B_YEAST/639-797-----------------LNKATIS..........-----....---------.D---PFPLPRIDNL......-------
Q9YGS2_TAKRU/573-830-----------------LEKVVVTQLLEHLQ...-----.RNS---------LF---EMFQSGFRAHHSTETA-------
Q9YW31_MSEPV/161-406-----------------YSKILNNRLKPIM....-----..EN---------LI---SEEQSGFRKNRSIKDN-------
Q9ZNW4_SORBI/922-1081-----------------LNKACVK..........-----....---------.D---SFPLPRIDTS......-------
Q9ZQ67_ARATH/542-701-----------------LNKACPK..........-----....---------.D---SFPLPHIDRM......-------
Q9ZQQ6_ARATH/659-918-----------------ISKIIANRLKVMLPT..-----FILQ---------NQ---SAFVRERLLMENVLLA-------
Q9ZS84_SOLLC/655-815-----------------LNKATIK..........-----....---------.N---KYSVPLVQDL......-------
Q9ZVK4_ARATH/510-669-----------------LNWVTVK..........-----....---------.N---KYPLPRIDEL......-------

PF05919

Q6EH16_9VIRU/1-501----------.......MGQLATV--YDQAGKAR-----IVAS---------TN---SWIQCSLFGLHNKIFS-------
Q5TMB5_9VIRU/174-658----------.......FARLVCI--PAPEGKSR-----IIGE---------MN---FWAQCALKPLHDKEMK-------
Q18L80_9VIRU/166-639----------.......IGKLAAK--EEP.GKVR-----IFAM---------VD---AVTQWLLKPLHEAIFK-------
Q9WJ23_9VIRU/164-642----------.......FGKISIV--KDPELKMR-----VIAM---------VD---YHSQFVLKKIHNSLFN-------
RDRP_CPMV1/246-745----------.......MGKLSVV--YDQAGKAR-----IVAI---------TN---SWIQTAFYSLHLHVFK-------
Q9ZXZ7_THACU/214-754----------GIGPGLGLSQFALK--EEAAGKIR-----LFAL---------MD---SITQSVMSPLHDYMFA-------
Q9WJ22_9VIRU/155-622----------.......LGKLSIV--HDPELKER-----VIAM---------VD---YTTQFALRPIHNILLN-------
Q6EH19_9VIRU/208-686----------.......LRKIAIK--DDREGKSR-----PFAI---------FD---YWSQTVLSPLHDWAYA-------
Q9WJ24_9VIRU/163-645----------.......IRRLSIV--HDPECKER-----VIAI---------FD---YGSQMVLKPIADVLFD-------
Q6GYC2_9VIRU/156-638----------.......LGSLSLI--YDPECKVR-----IVAM---------LD---YTTQLFLRPIHNDLFK-------
Q18L78_9VIRU/174-654----------DLSC...IGKLSTK--EEAAGKVR-----VFAM---------VD---IWTQSILNPLHKKIFS-------
Q18L79_9VIRU/168-671----------.......LGKLAFK--EEP.GKVR-----VFAM---------AD---CITQWVLHPLHQYLFS-------
Q3S3F3_9VIRU/120-606----------.......SGKLGIV--KDPEGKRR-----IIAM---------VD---YHSQLVLRSIHDGLLN-------
O92614_9VIRU/173-711----------.......LGKLAIK--EEAAGKAR-----VFAM---------AD---SITQSVMAPLNSWVFS-------

PF07727

Q7G640_ORYSJ/781-1029-----------------VHCKWIFKRKEGLSPSG-----PPRF---------NA---RLVAKGFSQIAGVDYN..DV---
Q7XLN3_ORYSJ/465-703-----------------VGYKWVFVRKRNENN.E-----VVRY---------KA---RLVAQGFTQKSGDDFN..ET---
Q7XTU6_ORYSJ/940-1185-----------------IGLKWVYKLKKDPSG.A-----IVKH---------KA---RLVAKGYVQQQGVDFD..EV---
Q7XKS1_ORYSJ/160-403-----------------ITCKWIYKIKTRSDG.T-----LERY---------KA---RLVACGFQQEHGRDYD..ET---
Q9FWI2_ORYSJ/795-1030-----------------IGVKWVYKTKLNPDG.S-----VQKY---------KA---RLVAKGFKQKPGIDYY..ET---
Q94I36_ORYSJ/864-1109-----------------IGTKWVFKNKQNEDG.L-----IVRN---------KA---RLVAQGFTQVEGLYFD..ET---
Q7G6C9_ORYSJ/1047-1286-----------------IGTKWIFRNKQDEYG.V-----VVRN---------KA---RLVAQGFTQVEGLDFG..ET---
Q94LQ7_ORYSJ/550-793-----------------IDCKWVYKVKRKADG.S-----LDRY---------KA---RLVAKGFKQRYGIDYE..DT---
Q7XKG6_ORYSJ/514-759-----------------VSCKWVNAVKQDPFG.K-----VERY---------KA---RLVAKGYSQTYGIDYD..ET---
Q7X5X4_ORYSJ/138-383-----------------IGLKWVFKVKCDEHG.E-----IVRH---------KA---RLITKGYVQRQGIDFE..EV---
Q84M55_ORYSJ/910-1155-----------------VGCKWVFTVKQTPEG.K-----VDRY---------KA---RLVAKGYSQTYGIDYD..ET---
Q7Y173_ORYSJ/398-645-----------------VGCKWVYKTKLDSKG.K-----IERF---------KA---RLVAKGFSQREGIDYN..ET---
Q8W5F4_ORYSJ/472-717-----------------VGCKWVFKKKLRPDG.T-----IKKY---------KA---RLVAKGYTQKEGEDFF..DT---
Q7XUD9_ORYSJ/916-1161-----------------IGLKWVFKLKKDAEG.R-----VAKH---------KA---RLIAKGYVQQPGIDFE..EV---
Q8LNW7_ORYSJ/880-1128-----------------IRCKWIFKRKEGMSPSD-----EARY---------KA---RLVAKGYSQIPGIDFN..DV---
Q94HQ0_ORYSJ/485-718-----------------VTLKWVFKLKRDEAG.A-----IVKH---------KA---RLVARGFVQQEGIDYD..DA---
Q7Y1I1_ORYSJ/727-972-----------------IGLKWVFKVKKDARG.E-----VTKF---------KA---RLVAKGYVQQPGVDFN..EV---
Q94GR9_ORYSJ/975-1220-----------------IGTKWIFRNKQDENG.L-----VVRN---------KT---RLVAQGFTQVEGLDFG..EI---
Q7X7N0_ORYSJ/758-1003-----------------VTGKWIFKHKFHSDG.S-----LARH---------KA---RWVVHGYSQQHGIDYD..ET---
Q7XZY2_ORYSJ/297-542-----------------IGLKWVFKVKRDASG.K-----ILKH---------KA---RLVAKGYVQQHGVDYD..EV---
Q7XN62_ORYSJ/915-1162-----------------VGCKWVYKTKYDSRG.N-----IEKF---------KA---RLVAKGFTQREGIDYN..ET---
Q7XLI2_ORYSJ/53-298-----------------VTGKWIFRYKFQSDG.S-----LDRY---------KA---RWVLRGFTQRPGIDFD..EI---
B5RTA2_DEBHA/1170-1414-----------------IPTTWVHTHKINDL..K-----EVQY---------KS---RCVVQGFRQIANEHYDTSKV---
B5RTR8_DEBHA/1021-1254-----------------IGNRWVFTKKD......-----DGRY---------KA---RLVAQGFSQVPGEDYL..DT---
E7KRB3_YEASL/146-383-----------------LGSRWVFTIK......D-----SGKY---------KA---RLVAQGHTQKAGIDYQ..ET---
Q2R072_ORYSJ/915-1159-----------------IGLKWVYKLKKDAQG.V-----VVKH---------KA---RLVAKGYVQRAGIDFD..EV---
Q59K02_CANAL/999-1236-----------------IGVKWVYTIK......D-----TGRY---------KA---RLVALGYRQQAGVDFL..ET---
Q5AG24_CANAL/888-1133-----------------LKTMWVHTYKTNDL..K-----NHNY---------KS---RCVVMGNYMVENRDFDPHAI---
Q5AH82_CANAL/122-366-----------------ISMGWVHTEKIDSLK.G-----.VVR---------KS---RCVVHGNRQKEKLDYDPFSV---
Q7XN23_ORYSJ/31-274-----------------IGCKWVYKIKRKADG.T-----LDRY---------KA---RLVAKGFKQRYGIDYE..DT---
Q8S476_MAIZE/836-1081-----------------IGCKWIFKKKLRPDG.T-----IERY---------KA---RLVAKGYTQKEGEDFF..DT---
Q8S479_MAIZE/1073-1313-----------------VGTKWVFRNKQDEHG.V-----VTRN---------KA---RLVAKGCAQVAGLDFE..ET---

PF00680

POLG_HAVHM/1750-2215---PAISYFHLNPGFHTGV------AIGIDP.DRQW---DELFKTMIRFGDVG------LDL------------------
RDRP_BPPH6/19-638---PVRNKIYSKYAYTFHH------TTRLNKEEKVK---E.........WSLC------VAT------------------
POLG_PYFV1/2270-2778---DFNVFVMAN.RHKHGI------MVGINPHSREW---SDLAISLASFSPYG------FNG------------------
POL1_CPMVS/1186-1687---NFVRFIMAN.RHRLSC------QVGINPYSMEW---SRLAARMKEKGNDV------LCC------------------
POLG_RHDVF/1279-1750---NICYKLKMV.ARFGPI------AVGVDMTSRDV---DVIINNLTSKASDF------LCL------------------
POLG_PVYN/2293-2763---DFNNQFYSK.NIECCW------TVGMTKFYGGW---DKLLRRLPE.NWVY------CDA------------------
POLG_EMCVR/1844-2288---KFASKFQTQPGLELGS------AIGCDP.DVHW---TAFGVAMQG.FERV------YDV------------------
POLG_FCVUR/1266-1735---GVSDAITAN.HQYGPV------QVGINMDSPSV---EALHQRIKS.AAKV------YAV------------------
POLG_NVN68/1301-1766---PFCDAIKSH.VIKLPI------KVGMNT.IEDG---PLIYAEHAK.YKNH------FDA------------------
Q9DLK1_FMDVP/1865-2314---RFCAQMHSNNGPQIGS------AVGCNP.DVDW---QRFGTHFAQ.YKNV------WDV------------------
POLG_VESVA/1379-1848---RVSESIMAN.HALGFI------QVGINMDGPAV---EDLFKRLERPKHDR------YCV------------------
POL1_BAYMY/1634-2098---DFNKKFYAT.NLKAPH------TVGINKFGRGW---ERLHDKLNRPGWLH------GSG------------------

PF02123

Q83093_9VIRU/437-816---PAAEA................DISGFDWSVQKW.................------..E------------------
Q66150_9VIRU/22-408---PGAMA................DISGFDWSVQDW.................------..E------------------
Q86519_9VIRU/516-902---PAAEA................DISGFDWSVQDW.................------..E------------------
RDRP_SCPMV/464-849---PAAEA................DISGFDWSVQDW.................------..E------------------
RDRP_SBMVA/490-847---PAAEA................DISGFDWSVQDW.................------..E------------------
RDRP_PEMVW/733-1124---SAQDLVDNWSRYLTPT.....DCSGFDWSVPMW.................------..L------------------
RDRP_PLRVW/609-1004---SVEELCANHKEHTRPT.....DCSGFDWSVAYW.................------..M------------------
RDRP_TYYVF/580-974---TTE.VVANWKNYLTPT.....DCSGFDWSVADW.................------..M------------------
Q65969_9LUTE/603-996---PSD.LITEWRAHMIAT.....DCSGFDWSVSDW.................------..L------------------
RDRP_ROTGI/108-803---AVQHTIAESLYKRAKKGAYQGSFAEAYTAKTASLTYGVLAEDTSKATKII------LYT------------------
RDRP_ROTHC/109-749---IAQHSFAEIMLNYAKR...EREYSEFYSQANQVLSYGDVTRYLDSNSILC------F.T------------------
O55590_9REOV/104-749---LAQHAVVEKMLQYAKH...TREYAEFYSQSNQLLSYGDVTRFLSDDALVL------Y.T------------------
RDRP_ROTPY/100-748---SAQHAVVEKMLSYAKH...TREYAEFYSQSNQLLSYGDVTRFLSSNSMVL------Y.T------------------
Q90153_9VIRU/1025-1530---PVEKHLNHRSVDINLD.....GSAMLTATLHRL........GQVEANMVF------NSY------------------
Q90193_9VIRU/400-785---LIDKSGEIPGSRNNAPSDRQLKDHWMWSECQDF...............VP------LMM------------------
RDRP_PCVC/362-832---LAEKQGQIGSVRLNTD..SEVDIRYFDKKMCTG..............VFH------VLY------------------
RDRP_SCVLB/837-1303---QCEDTF........PGFVPTGSYANEDYVRTRI.........AGTHSLIP------FCY------------------
Q87025_SCVLA/177-657---RCEDVLTHKFPVGDQA.....EAAKVHKRVNMM...........LDGASS------FCF------------------
Q90155_TTV1/96-539---LFESGWQDSEAILSPG...DYSSECLHAKISGY..............KYK------AML------------------
Q9JE94_9VIRU/129-560---YIESVWSNKHVLLNPDYMNPVIFSTLNYDEYCM.................------..L------------------
Q8V615_9VIRU/41-473---YVECVWSNESVLLNPAAMSVERFSVLDYPEYCM.................------..I------------------
Q83073_9VIRU/49-523---PVETAWLNKRTLLNPG...VVNHYSMAKKVKVLLADAEHDETNIERGTKL------YSL------------------
RDRP_LRVLG/155-619---PVERIWENSNVILDPG...SMGNCGIATRINGW........RNGMPGQSF------FAV------------------
Q98XW8_9VIRU/144-622---AVEKEWASRSVILNPG...KGGTLGMMNRIRGA........ATGGRRQCY------LML------------------
Q99AT3_9VIRU/99-573---PVEKRWRNSKVILDPG...RGGHLGMIFRTTAA..........RARAGVS------MML------------------
Q9YXE4_9VIRU/99-573---SVESRWRGERVVLNPG...RGGNVGMSFRVAAA..........RQRAGIS------LML------------------
RDRP_HV19S/122-585---PIEKKWRGARVILNPG...EGGLYGTARRIRGS..........QTSGGVN------LML------------------
Q9YXE6_9VIRU/120-589---ATQKAWRNHRVLLDPG...GGGHLGISRRVRSF..........MKHGGVN------LML------------------

PF04197

RDRP_IBDVU/1-875GDPMFNQTWATFAMNIAPALVVDSSCLIMNLQIKTY-GQGSGNAATFINNHLL------STL------------------
RDRP_IPNVJ/1-842GSPRYNPTWATFAMNVAPSMVVDSSCLLMNLQLKTY-GQGSGNAFTFLNNHLM------STI------------------
RDRP_BSNV/1-863GSPAFNATWATIAMMIAPSLVVDSSCLFMNLQLKTY-GQGSGNAWTFLINHTL------STI------------------

PF00978

R1AB_LIYV9/1925-2366---RLTYC------LSD.KIVLYSGMNTDVLAE.LI--ESKLPLGLN..AYHT......LEI------------------
R1AB_BYVU/2601-3046---RVITC------TNS.NIVFFTEM....TNSTLA--SIAKEMLGSEHVYNV......GEI------------------
Q9YPH5_9VIRU/1359-1796---RIIHA------LKP.HVIYNTRM....TAA.EM--DRSLEFLNVYEDYDS......VEI------------------
POLN_EEVVM/2041-2488---RLNAV------LLP.NIHTLFDMSAEDFDA.II--AEHFQPGD.....WV......LET------------------
E0YCR0_9CLOS/53-491---RLKYV------VDE.RWLFYHGM...DTAE.LA--AALRNNLGDIRQYYT......YEL------------------
RDRP_TOMS1/1168-1609---QLLDS------IDSSRFLFFTRK....TPA.QI--EDFFGDLDSHVPMDV......LEL------------------
RDRP_PSVJ/295-726---RFQRC------LRG.RVVVPVGK....ISS.LE--MDNFSVLN....KHC......LEI------------------
Q66107_9BROM/228-662---RLFYV------LKS.KIHIPSGK....WHQ.LF--TLDAAAFDA..AKWF......KEV------------------
Q87644_SINDV/2053-2501---RLTAV------LLP.NIHTLFDMSAEDFDA.II--AEHFKQGDP.....V......LET------------------
O56790_9VIRU/1323-1760---RILLA------LRP.HVVYNTRM....TAE.EL--DRSVEFLDVREQYDA......VEI------------------
RDRP_CMVFN/308-738---RFQRC------LRE.RIILPVGK....ISS.LE--MAGFDVKN....KHC......LEI------------------
Q9WJD8_PEBV/1299-1738---RRLDA------IHP.HFVFNTRM....TAS.DL--NDRVRCLHPDADYDF......IEV------------------
Q80875_BSMV/195-630---RIIRA------LRP.HVVFNSRM....TAD.EL--NETVAFLTP.HKYRA......LEI------------------
RDRP_RBDVR/1234-1674---RLLAC------RNK.FLNIPLEH....DND.LS--GYLTKYHLGSENNTF......TEI------------------
RDRP_SBWMN/1373-1810---RIRLA------LKP.HVVYNSRM....NAE.EL--NRTVEFLDPEEDFNA......FEI------------------
POLN_ONNVI/2053-2501---RLNAV------LLP.NVHTLFDMSAEDFDA.II--ATHFKPGDA.....V......LET------------------
RDRP_TAV/313-742---RFQRC------LTK.RVILPVGK....ISS.LE--IKDFSVLN....KFC......LEI------------------
POLN_MIDDV/534-981---RLNAV------LLP.NVHTLFDMSAEDFDA.II--SEHFRPGDA.....V......LET------------------
RDRP_TMGMV/1163-1604---LLLEA------FDSKKFLFFTRK....TPE.QI--QEFFSDLDSHVPMDV......LEL------------------
RDRP_TOBSV/253-689---RLLYV------LKS.KFVVPTGK....YHQ.IF--QMNPELLKH..SKEF......KEI------------------
RDRP_OLV2I/310-732---RFFSR------LQD.WVVVPAGP.....MA.DF--SRVWPSFEG...KCL......TEI------------------
RDRP_YOMV/1155-1594---MLLET------IDTSKFLFYTRK....TPT.QI--EEFFSDLDSSQAMEI......LEL------------------
RDRP_AMVLE/318-752---RLMLI------LRD.KITIPSGK....FHQ.LF--SIDAEAFDA..SFHF......KEI------------------
POLN_RRVN/2019-2467---RLKAV------LAP........N....IHT.LF--DMSAEDFDAIIAAHFQPGDAVLET------------------
RDRP_ASPVP/1758-2169---KVTEV------LPK.NLYIHSGK....NID.DL--AAWVTTSKF..NGVC......TES------------------
O56250_9VIRU/1240-1678---RKLDA------MQP.HFVFNTRM....SSS.DL--NDRVKFLNTEAAYDF......VEI------------------
O90699_9VIRU/1363-1800---RIRFA------LKP.HVIYNTRM....TAS.EL--DAAVEFLDVREEFES......VEI------------------
Q9Q6Q3_9CLOS/62-509---RLKYV------LHS.KVMAYHGMSTDDFSR.EV--CERLRDISG...YYV......YEL------------------
POLN_AURAV/2038-2486---RLTAV------LLP.NIHTLFDMSAEDFDA.II--AANFSYVHP.....V......LET------------------
RDRP_BBMV/271-697---KFSLA------LRE.SIYVPIGK....ISS.LE--LKSKALNN....KFF......LEA------------------
RDRP_CCMV/267-697---KFSKA------LKS.RFVVPIGK....ISS.LE--LKNVPLSN....KWF......LEA------------------
Q66581_EEEV/144-598---RLNAV------LLP.NIHTLFDMSAEDFDA.II--AEHFQFGDA.....V......LET------------------
Q9QGG9_9BROM/363-797---RLLLC------LTE.KISIPTGN....ISL.FS--LDPFASEMT...KEF......KEI------------------
RDRP_TMOB/1167-1614---QMLSA------IDTSRYLFFTRK....TPE.QI--EEFFSDLDAHQPMEV......LEL------------------
RDRP_BMV/256-688---KLSLA------LKS.RFIVPIGK....ISS.LE--LKNVRLNN....RYF......LEA------------------
O40960_9CLOS/62-506---RIKYC------LGD.KVILFSGMNLDEMGD.LL--ESRLCYPLN..SYNF......VEV------------------

PF00998

RDRP_TNVA/224-703---HAFKT......IAK-CFGEITVFKGFTLEQ-QG--EIMRSKWNKYVNPVA------VGL------------------
RDRP_TCV/272-752---HLYRA......IDA-MWGGPTVLKGYDVGE-LG--NIMSNTWDKFRKTCA------IGF------------------
RDRP_TNVD/224-709---MLFKA......INK-TFGGRTIFKGLSSDQ-AG--EEFKTLWDSFKDPVG------IGM------------------
RDRP_MCMVK/460-941---PIYHA......IDK-IWGGPTIMKGYSVEQ-IG--RHIENAFRSFTDPVA------IGF------------------
POLG_HCVEU/2430-2941---MALYDVT..QKLPQ-AVMGPAYGFQYSPNQ-RV--EYLLKMWRSKKVPMG------FSY------------------
POLG_HCVED/2420-2931---RALHDVI..KKTAL-AVMGAAYGFQYSPAQ-RV--EFLLTAWKSKNDPMG------FSY------------------
POLG_HCVJL/2434-2945---RALYDVT..RKLPV-AVMGAAYGFQYSPSQ-RV--EYLLKIWRSKKTPMG------FSY------------------
POLG_HCVJK/2431-2942---RALYDVI..QKLPS-AIMGSAYGFQYSPKQ-RV--EYLLKMWNSKKTPLG------FSY------------------
POLG_HCVEV/2426-2937---RALYDVA..QKLPT-ALMGPSYGFQYSPAQ-RV--DFLLKAWKSKKIPMA------FSY------------------
POLG_HCVJ6/2445-2956---MALYDIT..QKLPQ-AVMGASYGFQYSPAQ-RV--EFLLKAWAEKKDPMG------FSY------------------
Q9IR83_9TOMB/236-712---HLYRA......LDV-VWKGPTVLKGYTVSE-IG--SIMHSHWSQFQKPCA------VGF------------------
Q87031_9LUTE/24-502---KFMHA......IDS-TFDSPTVLSGYDSFR-VG--KIIANKWSKFKRPVA------IGV------------------
RDRP_POLVP/251-722---RLMKA......IDK-LWGEKTAIKGYTVEK-VG--EILHQKSLRFKNPCF------VGL------------------
Q65987_9TOMB/269-750---HLYRA......IDK-MWCGPTVLKGYNVEE-IG--NIMSDAWNQFQKPCA------IGF------------------
P90338_9TOMB/1-480---HIYRG......LDK-IWGGPCVMKGYNVEE-VA--SHIIGAWEQFQKPVA------IGF------------------
RDRP_BYDV1/361-840---KIMHA......IDS-VFGSPTVLSGYDNFK-QG--RIIAKKWQKFACPVA------IGV------------------
O09796_9HEPC/2422-2933---MALYDVV..STLPQ-AVMGSSYGFQYSPKQ-RV--EFLVNTWKSKKCPMG------FSY------------------
O09803_9FLAV/2373-2866---LILGDP...GRVAK-AVLGGAYAFQYTPNQ-RV--REMLKLWESKKTPCA------ICV------------------
O37361_9VIRU/252-737---RLYIEWTKSFSSFT-VTTTPVCLKGMNYRT-RA--RALLEKWQSFDSPVA------VCL------------------
Q9WJD9_CARMV/267-744---HAYKA......LDK-IWGGPTVMKGYTTEE-VA--QHIWSAWNQFQTPVA------IGF------------------
Q83103_9TOMB/228-711---ICSRL......LIA-LFGGRTIFKGINADE-AG--VEMKEIWDSFVDPIG------IGM------------------
Q66127_9VIRU/52-520---MLYKA......LGR-LYEQPCVAKGFNAFQ-TG--EIIRKKWDSFRNPVC------VGL------------------
RDRP_PMVK/447-937---PIYKA......IDR-IWGGKTIFKGMNVEA-MG--AEIHKKMCKYSNPCA------IGF------------------
POLG_GBVB/2277-2785---MYYGQVA..PDVVK-AVMGDAYGF.VDPRT-RV--KRLLSMWSP..DAVG------ATC------------------
Q89801_9TOMB/1-479---HLYRG......IDE-IMGGPTVIKGYDVNQ-IG--NIMEKASGQFVRPVA------VGF------------------
Q9IRA1_9TOMB/266-741---HIYSA......IDR-IWGGPTVLKGYTVEQ-LG--TNIANIWSQFQRPCA------VGF------------------
O12301_9TOMB/231-708---KAFRA......VER-VFGSPTIMKGYTAEE-QA--SIAREKWDRFSKPVA------IGL------------------
Q83424_MNSV/290-772---YLYRG......IDE-IWNGPTIIKGYTVEQ-IG--KIARDAWDSFVSPVA------IGF------------------
O41892_9FLAV/2409-2899---MILGDP...GIVAK-AVLGSAYLFQYTPNQ-RV--KALVAAWEGKKHPAA------ITV------------------
RDRP_OCSVU/235-734---RIFKA......LGK-LFGHRTVMKGMDTDV-TA--RVIQEKWNMFNKPVA------IGL------------------
Q9IW60_9TOMB/325-800---KLMKA......VDG-VFGETTCIKGYTADE-VG--AIFREKWDRFDKPVA------IGL------------------
Q96898_9FLAV/2396-2886---MILGDP...GIVAK-SILGDAYLFQYTPNQ-RV--KALVKAWEGKLHPAA------ITV------------------
RDRP_RCNMV/260-745---KMLDS......IDD-VFKEKTVLSGLDNRA-QG--RAIAHKWRKYQNPIG------IGL------------------

PF00972

POLG_YEFV1/2758-3406---KLSEF-GKAKGSRA-IWYMWLGARYLEFEA-LG--FLNEDHWASRENSGGGVEGIGLQYLGYVIRDLAAMDGGGFYA

PF00078

A0A016RNU0_KLEPN/135-366-----L..----------..DALATG..LVRTNVNW----------------V------LDA------------------
A0A025GH98_ECO57/115-332-----I..----------..AQCFCVLAQKTSA.EW----------------V------LEG------------------
D7ZFU1_ECOLX/62-269-----SNV----------.KRDYVSCAKAHCGA.KT----------------V------LKV------------------
F6BM08_SINMB/72-291-----VG.----------..VTRQRC....WKY.DW----------------V------LEF------------------
M7UYJ9_ECOLX/33-239-----...----------......NA.KIHQSS.VY----------------L------LKL------------------
O01419_BOMMO/502-756-----VQR----------.VRDLSDQACSRGGV.LL----------------A------VSI------------------
O18558_AEDAE/472-725-----LHK----------.VVYDIEKAFAQKQS.CL----------------G------VFL------------------
O42691_ALTAL/36-202-----...----------........MNDLAGA.DW----------------I------TAM------------------
O44316_DROMR/394-650-----ATI----------VDLVLRDH..HKRYASCY----------------I------ATL------------------
O52231_STREE/68-275-----I..----------..MKLLEY..LNDGY.EW----------------I------VDI------------------
O62658_CANFA/517-773-----TRK----------TINVIHHISKRKTKN.HM----------------I------LSL------------------
O64612_ARATH/788-1031-----LLL----------.ASELVKDYHKDGLSPRC----------------A------MKI------------------
O65244_ARATH/405-664-----VLL----------ATEIVKDYHKDSVSS.RC----------------A------LKI------------------
O65598_ARATH/489-747-----VLL----------ATEMVHGYNWRNISL.RG----------------M------LKV------------------
O81284_ARATH/58-317-----VLL----------ASELVDNFQAEGDTS.RG----------------C------LQV------------------
O81454_ARATH/144-304-----...----------........LDELSGA.II----------------F------SKV------------------
O93520_ORYLA/518-771-----IRK----------.VLNIIHQVVQQKQE.TL----------------V------ISL------------------
O96546_LYMDI/526-780-----VHR----------.LVEYTSSQFIMNRY.TG----------------V------LFL------------------
O99969_PORPU/100-315-----R..----------..KAIVKC..LQRKP.KH----------------I------LDA------------------
POL_RSVP/769-938-----...----------............PRG.WP----------------L------MVL------------------
POL_HTL1A/633-804-----...----------............PTTLAH----------------L------QTI------------------
POL_SMRVH/71-240-----...----------............PLN.YH----------------K------IVI------------------
POL_MMTVB/68-237-----...----------............PKG.WE----------------I------III------------------
POL_CAMVC/289-452-----...----------........LTLIRGK.KI----------------F------SSF------------------
POL_IPHA/60-229-----...----------............PQD.WK----------------L------III------------------
POL_HV1MA/655-826-----...----------............KKK.KS----------------V------TVL------------------
TF21_SCHPO/455-615-----...----------........LAKIQGS.TI----------------F------TKL------------------
POK10_HUMAN/76-245-----...----------............PKD.WP----------------L------III------------------
POL4_DROME/357-523-----...----------........LDQLGRA.KY----------------F------SCL------------------
POLY_DROME/224-390-----...----------........LANLGKA.KF----------------F------TTL------------------
POL_EIAV9/249-419-----...----------............IKC.KH----------------M------TVL------------------
YTX2_XENLA/513-765-----VFL----------.IRDLLHFARRTGLS.LA----------------F------LSL------------------
POL_SOCMV/246-411-----...----------........LEKIKGS.LW----------------F------SSL------------------
Y2R2_DROME/498-741-----WRH----------.VKSSVGA..SAAQY.VL----------------G------TFV------------------
POL_BIV29/638-806-----...----------............KEC.EH----------------L------TAI------------------
RDPO_ACUOB/124-343-----VG.----------..RVLNGLNNPLANY.QY----------------V------VEI------------------
POL2_DROME/249-414-----...----------........LGKLGKC.QY----------------F------TTI------------------
RT67_ECOLX/48-262-----...----------.....NAY..KHRGK.QI----------------I------LNI------------------
RTJK_DROME/502-757-----LHR----------VVNFALEA.MENKEY.AV----------------G------AFL------------------
POL_BLVAU/41-212-----...----------............PTHLPH----------------I------ICL------------------
POL_RTBVP/1228-1390-----...----------........INLIQKA.NI----------------F------SKF------------------
POL_CAEVC/210-380-----...----------............QKK.KH----------------V------TIL------------------
P91581_CIOIN/483-644-----...----------........VNKVTQD.KV----------------Y------SSL------------------
P95451_PSEAC/119-326-----I..----------..EMARAH..VTAGH.RW----------------C------VEL------------------
Q01379_NEUCS/505-761-----VRV----------.VTDAVHTAWKLGAV.TS----------------L------MLL------------------
Q03261_SIV/246-416-----...----------.............KR.QK----------------L------TII------------------
Q04135_DROME/496-743-----VNR----------.ITSEIRTAFEHREY.CT----------------A------IFL------------------
Q07995_CHITU/509-760-----LIK----------.VIKSAKENLNNKKS.TG----------------M------IFL------------------
Q08724_9CYAN/108-336-----REA----------IFNSIRYS......N.KW----------------V------LDA------------------
YRD6_CAEEL/484-644-----...----------............LKG.TV----------------Y------SQI------------------
Q17329_CAEEL/1071-1231-----...----------........LQSLAGK.KL----------------Y------TVF------------------
Q24262_DROME/531-692-----...----------........LEKLQSA.KW----------------F------TTM------------------
Q24690_DROTE/495-742-----LLY----------VDYLITKS....KMH.TS----------------L------VTL------------------
Q26816_9TRYP/545-793-----LL.----------..HVRAALCRPTHQS.RT----------------G------AVF------------------
Q46666_ECOLX/34-241-----...----------.....NAA..AHAGN.QY----------------L------LKA------------------
Q83013_9RETR/68-238-----...----------............PSE.WP----------------V------IAM------------------
Q88285_9RETR/848-1015-----...----------........AKLEKKY.QV----------------Y------SSL------------------
POL_CSVMV/250-413-----...----------........IHRSIQA.RY----------------Y------SKF------------------
Q93137_BOMMO/515-771-----VHR----------LTEHILVGLNRPKPLYTG----------------A------LFF------------------
Q93139_BOMMO/469-719-----LYT----------.LMQHVKEKLKEKRI.IT----------------I------VSL------------------
Q94885_DROME/759-920-----...----------........LDRMNEK.TV----------------F------TKL------------------
YG31B_YEAST/639-797-----...----------........LSRIGNA.QI----------------F------TTL------------------
Q9YGS2_TAKRU/573-830-----LLK----------.VTNDLLIASDHGLV.SM----------------L------VLL------------------
Q9YW31_MSEPV/161-406-----I..----------..YILHEIIRNRKKE.TY----------------F------AFI------------------
Q9ZNW4_SORBI/922-1081-----...----------........VDKAAGC.QR----------------F------SLL------------------
Q9ZQ67_ARATH/542-701-----...----------........VEATTGN.EL----------------L------SFM------------------
Q9ZQQ6_ARATH/659-918-----TEL----------VKDYHKDS....ISP.RC----------------A------MKI------------------
Q9ZS84_SOLLC/655-815-----...----------........MDRLSKA.CW----------------F------TKL------------------
Q9ZVK4_ARATH/510-669-----...----------........LDQLRGA.TC----------------F------SKI------------------

PF05919

Q6EH16_9VIRU/1-501-----ILR----------SIPQ.DGTFDQNKPF-DL--LLESLQPGY.M...L------YGF------------------
Q5TMB5_9VIRU/174-658-----ALR----------SIRQ.DLTFYQGIGP-QV--LKLHPGSK......Y------YSF------------------
Q18L80_9VIRU/166-639-----LLN----------IFAF.DGTFDQIGQL-EK--FMDRMKDKAPY...Y------YSF------------------
Q9WJ23_9VIRU/164-642-----KLK----------LIKS.DRTFTQDPIF-TT--PTMGHR........F------WSM------------------
RDRP_CPMV1/246-745-----LLK----------NIDQ.DGTFDQERPF-KL--LIKWLNEPTQK...F------YGF------------------
Q9ZXZ7_THACU/214-754-----ILR----------NIPN.DGTFDQEASI-AR--SQEKAVTAG.K...A------FSY------------------
Q9WJ22_9VIRU/155-622-----NLS----------KLPC.DRTFTQDPFH-KW--.NDDHKER......Y------HSL------------------
Q6EH19_9VIRU/208-686-----TLR----------SIPQ.DCTFNQAEGL-SK--VTARPSQKY.....F------YSY------------------
Q9WJ24_9VIRU/163-645-----LLR----------NIPS.DRTFTQSPFF-TH--TDLDNKSK......F------WSI------------------
Q6GYC2_9VIRU/156-638-----LLK----------KLPQ.DRTFTQNPLN-DW--ENNEHS........F------WSI------------------
Q18L78_9VIRU/174-654-----IIR----------ELPT.DGTFDQLKPL-DR--LHELSTQD......R------FSF------------------
Q18L79_9VIRU/168-671-----ILK----------QISIVDATFDQEEGV-KT--LSAKIKAGKRV...V------FSL------------------
Q3S3F3_9VIRU/120-606-----KLR----------NLPQ.DRTYNQDPNN-AW--EENKEC........F------HSL------------------
O92614_9VIRU/173-711-----KLK----------DLPM.DGTFNQQAPL-NR--LVQLYQDGLLHDVEF------YSY------------------

PF07727

Q7G640_ORYSJ/781-1029---FSPVV----------KHSSIRTFFCIVAMHDLE----------------L------EQL------------------
Q7XLN3_ORYSJ/465-703---YSPVM----------SGITFRYLISLAVQNRIV----------------M------QLM------------------
Q7XTU6_ORYSJ/940-1185---FAPVA----------RMETVRLLVALAAQKGWE----------------I------HHM------------------
Q7XKS1_ORYSJ/160-403---FAPVA----------HMTTVRTLLAIASARHWN----------------I------SQL------------------
Q9FWI2_ORYSJ/795-1030---YAPVA----------RLETIRTIIALAAQKRWK----------------I------YQL------------------
Q94I36_ORYSJ/864-1109---FAPVA----------RIEAIRLLLAFAASKGFK----------------L------YQM------------------
Q7G6C9_ORYSJ/1047-1286---FAPVA----------RFESIRILLAYAAHHDFR----------------L------FQM------------------
Q94LQ7_ORYSJ/550-793---FRPVV----------KAATIRTILSIAISRGWT----------------L------RQL------------------
Q7XKG6_ORYSJ/514-759---FAPVA----------KMSTVRTLISCAANFDWP----------------L------YQL------------------
Q7X5X4_ORYSJ/138-383---FSPIV----------RIESVRLLLAVTACEGWE----------------V------HHM------------------
Q84M55_ORYSJ/910-1155---FAPVA----------KMGTVRALVSCAVNFGWP----------------L------HQL------------------
Q7Y173_ORYSJ/398-645---FSPVS----------KKDSFRIVMALVAHYDLE----------------L------HQM------------------
Q8W5F4_ORYSJ/472-717---YSPIA----------GLTTIRVLLSLAASHGLL----------------V------HQM------------------
Q7XUD9_ORYSJ/916-1161---FTPVA----------RLESVRLLLAQAAQAGWT----------------V------HHM------------------
Q8LNW7_ORYSJ/880-1128---FSPIM----------KHSSIRTLLGIVAMHDYE----------------L------EQM------------------
Q94HQ0_ORYSJ/485-718---FAPVA----------RMESVRLLLALAAQEGRG----------------I------HHM------------------
Q7Y1I1_ORYSJ/727-972---FAPMA----------RLESVRMLLALAAQAGWF----------------V------HHM------------------
Q94GR9_ORYSJ/975-1220---FAPMA----------RLEAIRILFAFASCFDIK----------------L------FQM------------------
Q7X7N0_ORYSJ/758-1003---FSPVV----------KPSTIRVVLSIATSRSWP----------------I------HQL------------------
Q7XZY2_ORYSJ/297-542---FAPVA----------RMETVRLLVAMAAQEGWE----------------I------HHM------------------
Q7XN62_ORYSJ/915-1162---FSPVS----------CKDSFRIIMALVAHYDLE----------------L------HQM------------------
Q7XLI2_ORYSJ/53-298---FSPVI----------KPATVRTVLSLAVSRDWP----------------V------HQL------------------
B5RTA2_DEBHA/1170-1414---SSPVI----------ELSIIRLLTAIAVEYEWP----------------I------HHL------------------
B5RTR8_DEBHA/1021-1254---FSPVI----------RYESVKLLLAFSAVDNRV----------------V------HQM------------------
E7KRB3_YEASL/146-383---FAPVI----------RYDSVRLFLALASCLKLI----------------V------YQM------------------
Q2R072_ORYSJ/915-1159---FAPVA----------RLDSVRLLLALAAQEGWM----------------V------HHM------------------
Q59K02_CANAL/999-1236---YAPVI----------RGESIKLIFALASKSKLK----------------I------HSI------------------
Q5AG24_CANAL/888-1133---SSPVV----------DLTSIRLLSAIAVENNLV----------------M------HQL------------------
Q5AH82_CANAL/122-366---SSPVI----------DLVTIRLLTIIGCELGMT----------------I------QHL------------------
Q7XN23_ORYSJ/31-274---FSSVV----------KAATIRIILSIAISRGWS----------------L------RQL------------------
Q8S476_MAIZE/836-1081---YSPVA----------RLTTIRTLIAVAASYGLI----------------I------HQM------------------
Q8S479_MAIZE/1073-1313---FAPVA----------RLESIRILLAYVAHHSFR----------------L------FQM------------------

PF00680

POLG_HAVHM/1750-2215-DFSAFD-ASLSPFMIREA..GRIMS----ELS....GTPSHF--------GTALINTII---YSKHLLY--NCCY....
RDRP_BPPH6/19-638-DVSDHD-TFWPGWLRDLICDELLNM----GYA.PWWVKLFET--------SLKLPVYVG---APAPEQG--HTLLGDPS
POLG_PYFV1/2270-2778-DFANFD-GMFHPSSFSMV..SELAN----IFY...GNFLSTE--------RDNLTRMLT---NRFSLMK--GAIL....
POL1_CPMVS/1186-1687-DYSSFD-GLLSKQVMDVI..ASMIN----ELC.GGEDQLKNA--------RRNLLMACC---SRLAICK--NTVW....
POLG_RHDVF/1279-1750-DYSKWD-STMSPCVVRLA..IDILA----DCC....EQTELT--------KSVVLTLKS---HPMTILD--AMIV....
POLG_PVYN/2293-2763-DGSQFD-SSLTPYLINAV..LTIRS----TYMEDWDVGLQML--------RNLYTEIVY---TPISTPD--GTIV....
POLG_EMCVR/1844-2288-DYSNFD-STHSVAMFRLL..A...E----EFF.TPENGFDPL--------TREYLESLA---ISTHAFE--EKRF....
POLG_FCVUR/1266-1735-DYSKWD-STQSPRVSAAS..IDILR----YFS....DRSPIV--------DSAANTLKS---PPIAIFN--GVAV....
POLG_NVN68/1301-1766-DYTAWD-STQNRQIMTES..FSIMS----RLT....ASPELA--------EVVAQDLLA---PSEMDVG--DYVI....
Q9DLK1_FMDVP/1865-2314-DYSAFD-ANHCSDAMNIMFEEVFRT----EFG......FHPN--------AEWILKTLV---NTEHAYE--NKRI....
POLG_VESVA/1379-1848-DYSKWD-STQPPKVTSQS..IDILR----HFT....DKSPIV--------DSACATLKS---NPIGIFN--GVAF....
POL1_BAYMY/1634-2098-DGSRFD-SSIDPFFFDVV..KTIRK----HFL..PSEHHKAI--------DLIYDEILN---TTICLAN--GMVI....

PF02123

Q83093_9VIRU/437-816-LEADVC.MRIERGNFPA.RMRKAAL..........................NRFKCFAN---AVFQLSN--GELI----
Q66150_9VIRU/22-408-LWADVS.MRIELGSFPA.LMAKAAI..........................SRFYCLMN---ATFQLTN--GELL----
Q86519_9VIRU/516-902-LWSDLA.IRINRGNFQG.NLRRAAI..........................SRYYCFMN---SVFQLSD--GTLI----
RDRP_SCPMV/464-849-LWADVE.MRIVLGSFPP.MMARAAR..........................NRFSCFMN---SVLQLSN--GQLL----
RDRP_SBMVA/490-847-LWADVE.MRIVLGGFGH.KLAKAAQ..........................NRFSCFMN---SVFQLSD--GTLI----
RDRP_PEMVW/733-1124-LEDDLAVRNELTLGLPH.GLRKMRE..........................TWLKCLGQ---SVFCLSN--GLLL----
RDRP_PLRVW/609-1004-LEDDMEVRNRLTFNNTQ.LTERLRA..........................AWLKCIGN---SVLCLSD--GTLL----
RDRP_TYYVF/580-974-LHDDMIVRNRLTIDLNP.ATERLRS..........................CWLRCISN---SVLCLSD--GTLL----
Q65969_9LUTE/603-996-LEDDMEVRNRLTLDLNE.TTRRLRS...........................WLYCISN---SVLCLSD--GTLL----
RDRP_ROTGI/108-803-DVSQWDASQHNTEPYRS.AWINAIREARAELKWRYDDEPKVL........EMNVLDSMI---KIQEYLL--NSNL----
RDRP_ROTHC/109-749-DVSQWDASQHNTKVLRRSIIRAMKRLKQLTHNINIHKAINIY.........IQSQENLE---NSYVLID--KKAI----
O55590_9REOV/104-749-DVSQWDSSQHNTEPFRKGIIAGLDKLITMTNNRRVKETLEKY........RQTQINLMD---SYVQIPD--GNKI----
RDRP_ROTPY/100-748-DVSQWDSSQHNTQPFRKGIIMGLDMLANMTNDPKVVQTLNLY........KQTQINLMD---SYVQIPD--GNVI----
Q90153_9VIRU/1025-1530-DYPDFN.SMHTYEHMAS.IYRAAKRCAIKELRQRRGAQVSDQDLALIEHGFDWLIESVY---HQYVIHP--DTGA----
Q90193_9VIRU/400-785-DYANFN.EQHSIEAMKA.TIQPLRD..VYAKAGVLSKDLADA........IDWVVKSFD---QICAIDE--NGDL----
RDRP_PCVC/362-832-DWADFN.EQHSAWEMGV.VVDYLKH......LIVAPRDYAVF........VEAIVAGMY---NMGLHDR--DGNV----
RDRP_SCVLB/837-1303-DFDDFN.SQHSKEAMQA.VIDAWIS....VYHDKLTDDQIEA........AKWTRNSVD---RMVAHQP--NTGE----
Q87025_SCVLA/177-657-DYDDFN.SQHSIASMYT.VLCAFRD....TFSRNMSDEQAEA........MNWVCESVR---HMWVLDP--DTKE----
Q90155_TTV1/96-539-DYTDFN.SQHTIQSMRL.IFETMKE........LLPPEASFA........LDWCIASFD---NMQTSDG--....----
Q9JE94_9VIRU/129-560-DYTDFN.SQHSIESMKQ.VFLCLFP........FLPRSMHSI........LQWCVTSFD---NMYINK.--....----
Q8V615_9VIRU/41-473-DYTDFN.SQHSLESQKL.VFECLRP........YLPSEMHPI........LDWCIASMD---HMEIGG.--....----
Q83073_9VIRU/49-523-DFEDFN.SQHSLAAQKM.VFEELFK........HVGIENEET.........RKVVSSFE---RMIVYNG--KEPL----
RDRP_LRVLG/155-619-DYDDFN.SQHTLMSQKI.VFEELFH........HIGYNASWV.........KTLVDSFD---SMELWIK--GKCA----
Q98XW8_9VIRU/144-622-DYSDFN.SQHSNEAMRI.VIEETLA........CCDHNEPEL........AAKLLKSID---DMHIYLR--GVHI----
Q99AT3_9VIRU/99-573-DYDDFN.SHHSTRAMQM.LFQRLGD........RVGYPADKL.........AKLVASFE---KMYIYNG--MEQV----
Q9YXE4_9VIRU/99-573-DYDDFN.SHHSIRAMQI.LFEETAA.........LTHYPPEL........AAKLVASFE---NMDLYLG--SSCI----
RDRP_HV19S/122-585-DYDNFN.SQHSNETMAA.LYEKALS.........RTNAPAYL........KKAVAASVE---STYIHYK--GRD.----
Q9YXE6_9VIRU/120-589-DFDDFN.SHHSLNSQRM.LFGELCD.........RANAPGWY........RKVLSDSWG---KMHVNIA--GHM.----

PF04197

RDRP_IBDVU/1-875-VLDQWNLMKQPSPDSEEFKSIEDKL----GINFKIERSIDDI--------RGKLRQLVPLA.QPGYLSG--GVE.----
RDRP_IPNVJ/1-842-VVAEWVKAGKPNPMTKEFMDLEEKT----GINFKIERELKNL--------RETIVEAVETAPQDGYLAD--GSDL----
RDRP_BSNV/1-863-LVGKWIEAGQPNPRSKEFMDLEAAT----GINFKIEREIEGL--------PTRLQEAMDKAVHTGFLGD--GTTN----

PF00978

R1AB_LIYV9/1925-2366-DFSKFDKSQGTCFKLYEEMMYKMFGFSP----ELYDR.DF.KY.......TEYFCR.....A...KATC..GV------
R1AB_BYVU/2601-3046-DFSKFDKSQDAFIKSFERTLYSAFGFDE----DLLDV.WM.QG.......EYTSNA.....T...TLDG..QL------
Q9YPH5_9VIRU/1359-1796-DFRKFDKSKVSLHIKVVIELYKLFGLDD----MLAVL.WE.KS.......QCQTLV.....K...DRIN..GV------
POLN_EEVVM/2041-2488-DIASFDKSEDDAMALTALMILEDLGVDP----ELLTL.IEAAF.......GEISSIHLPTKT...KFRF..GA------
E0YCR0_9CLOS/53-491-DISKYDKSQSALMKQVEELILLTLGVDR----EVLST.FF.CG.......EYDSVV.....R...TMTK..EL------
RDRP_TOMS1/1168-1609-DVSKYDKSQNEFHCAVEYEIWRRLGLED----FLAEV.WK.QG.......HRKTTL.....K...DYTA..GI------
RDRP_PSVJ/295-726-DLSKFDKSQGELHLMIQEEILNLLGCPV----DISKW.WC.DF.......HRYSYI.....K...DKRA..GV------
Q66107_9BROM/228-662-DFSKFDKSQGELHHKVQKMIFDLLKLPP----EFVEM.WF.TS.......HERSYI.....T...DRDT..GV------
Q87644_SINDV/2053-2501-DIASFDKSQDDAMALTGLMILEDLGVDQ----PLLDLIEC.AF.......GEISSTHLPTGT...RFKF..GA------
O56790_9VIRU/1323-1760-DFSKFDKSKTSLHIRAVIELYKIFGLDD----MLAFL.WE.KS.......QCQTTI.....R...DRQN..GL------
RDRP_CMVFN/308-738-DLSKFDKSQGEFHLLIQEHILNGLGCPA----PITKW.WC.DF.......HRFSYI.....R...DRRA..GV------
Q9WJD8_PEBV/1299-1738-DLSKFDKSANRFHLQLQLEIYRMFGLDE----WAAFL.WE.VS.......HSQTTV.....R...DVQN..GM------
Q80875_BSMV/195-630-DFSKFDKSKTGLHIKAVIGLYKLFGLDG----LLKVL.WE.KS.......QYQTYV.....K...DRNF..GL------
RDRP_RBDVR/1234-1674-DFSKFDKSQGEIHQLIQDLILIKFGCDP----EFVAL.WS.TA.......HRSSSI.....F...DQNV..GI------
RDRP_SBWMN/1373-1810-DFSKFDKSKTSLHIRAVIELYKLFGLND----LFALL.WE.KS.......QCQTKI.....R...DFVN..GI------
POLN_ONNVI/2053-2501-DIASFDKSQDDSLALTAMMLLEDLGVDQ----PILDL.IE.AAFGEISSCHLPTGT.....R....FKF..GA------
RDRP_TAV/313-742-DLSKFDKSQGELHLMIQEGILNRLGCPV----HISKW.WC.DF.......HRMSYI.....K...DKRA..GV------
POLN_MIDDV/534-981-DIASFDKSQDDSLAYTGLMLLEDLGVDQ----PLLEL.IE.ASF....GEITSTHLP..TGT...RFKF..GA------
RDRP_TMGMV/1163-1604-DISKYDKSQNEFHCAVEYEIWKRLGLNE----FLAEV.WK.QG.......HRKTTL.....K...DYIA..GI------
RDRP_TOBSV/253-689-DFSKFDKSQGRLHHDVQFRLFLALGIPE----HFVTT.WF.NS.......HEKSYI.....R...DRDC..GI------
RDRP_OLV2I/310-732-DLSKFDKSQGKLLHDVQREIFLRLGFPP----IWCDW.WF.KF.......HESSYL.....N...DKNL..GI------
RDRP_YOMV/1155-1594-DISKYDKSQNEFHCAVEYKIWEKLGIDD----WLAEV.WR.QG.......HRKTTL.....K...DYTA..GI------
RDRP_AMVLE/318-752-DFSKFDKSQNELHHLIQERFLKYLGIPN----EFLTL.WF.NA.......HRKSRI.....S...DSKN..GV------
POLN_RRVN/2019-2467-DIASFDKSQDDSLALTALMLLEDLGVDQ----ELLDLIEE.AF.......GEITSVHLPTGT...RFKF..GA------
RDRP_ASPVP/1758-2169-DYEAFDASQDHFILAFELEVMKFLGLPS----DLIA...............DYTFI.....KTHLGSKL..G.------
O56250_9VIRU/1240-1678-DMSKFDKSANRFHLQLQLEIYRLFGLDE----WAAFL.WE.VS.......HTQTTV.....R...DIQN..GM------
O90699_9VIRU/1363-1800-DFSKFDKSKTSLHIRAVLELYRMFGLDD----LCAYL.WE.KS.......QCQTIV.....K...DRVN..GL------
Q9Q6Q3_9CLOS/62-509-DISKYDKSQGACMKDVERLILIGLGVAE----SVVDA.FF.CG.......EYDSVV.....T...MGKN..EL------
POLN_AURAV/2038-2486-DIGSFDKSQDDSLALTALMILEDLGVDD----RLMDLIEC.AF.......GEITSVHLPTAT...TFKF..GA------
RDRP_BBMV/271-697-DLSKFDKSQGELHLEFQRLILINLGFPV----PLTNW.WC.DF.......HR.SIL.....S...RWTLRPGV------
RDRP_CCMV/267-697-DLSKFDKSQGELHLEFQREILLSLGFPA----PLTNW.WC.DF.......HRESML.....S...DPHA..GV------
Q66581_EEEV/144-598-DIASFDKSEDDAIAMSALMILEDLGVDQ----ALLNL.IEAAF.......GNITSVHLPTGT...RFKF..GA------
Q9QGG9_9BROM/363-797-DPSTFDKSQQRLHHLTHYHTPTALGAPA----DFIDM.WF.GS.......HEISHI.....R...DGPC..GV------
RDRP_TMOB/1167-1614-DVSKYDKSQNEFHCAVEYEIWKRLGIDE----FLAEV.WK.QG.......HRKTTL.....K...DYTA..GI------
RDRP_BMV/256-688-DLSKFDKSQGELHLEFQREILLALGFPA----PLTNW.WS.DF.......HRDSYL.....S...DPHA..KV------
O40960_9CLOS/62-506-DFSKFDKSQGHVIKLYEELVYKIFKFSP----NLYD..NF.KL.......SEYFCR.....A...SATC..GV------

PF00998

RDRP_TNVA/224-703-DASRFDQHVSVEALEYEHEFYLRDYPNDK...QLKWL-LKQQL-------CNVGTA---------FASD--GI.I----
RDRP_TCV/272-752-DMKRFDQHVSVDALRWEHSVYNAGFNCP....ELAQL-LTWQL-------TNKGVG---------RASD--GF.I----
RDRP_TNVD/224-709-DASRFDQHISKDALEFEHKMWLSMFPKSER.AELARL-LSWQI-------NNRGLA---------RCPD--GE.I----
RDRP_MCMVK/460-941-DASRFDQHVSVEALRWEHSVYSRIYGYPE...LLTQL-LRWQI-------HNRGTA---------YASD--GA.F----
POLG_HCVEU/2430-2941-DTRCFDSTVTERDIRTENDIYQSCQLDPVA.RRVVSS-LTERL-------YVGGPM---------ANSK--GQ..----
POLG_HCVED/2420-2931-DTRCFDSTVTEKDIRVEEEVYQCCDLEPEA.RKVITA-LTDRL-------YVGGPM---------HNSK--GD..----
POLG_HCVJL/2434-2945-DTRCFDSTVTERDIRTEESIYQCCELDPVA.RKAISS-LTERL-------YVGGPM---------YNSQ--GQ..----
POLG_HCVJK/2431-2942-DTRCFDSTVTEQDIRVEESIYQACDLKDEA.RRVITS-LTERL-------YCGGPM---------FNSK--GQ..----
POLG_HCVEV/2426-2937-DTRCFDSTITEHDIMTEESIYQSCDLQPEA.RVAIRS-LTQRL-------YCGGPM---------YNSK--GQ..----
POLG_HCVJ6/2445-2956-DTRCFDSTVTERDIRTEESIYRACSLPEEA.HTAIHS-LTERL-------YVGGPM---------FNSK--GQ..----
Q9IR83_9TOMB/236-712-DMKRFDQHVSVDALRFEHSVYGRSFCSK....ELDRL-LEWQL-------LNSGVG---------HAND--GY.I----
Q87031_9LUTE/24-502-DASRFDQHVGVEALQWEHSIYNGAFK.DP...ILKEL-LHWQT-------ENR.IM---------LFVE--DKIL----
RDRP_POLVP/251-722-DASRFDQHCSRQALEWEHSVYNAIFRDP....YLSEL-LTWQI-------DNVGTA---------YLKD--GF.V----
Q65987_9TOMB/269-750-DMKRFDQHVSVDALKWEHSVYNASFNCP....DLAKM-LTWQL-------KNKGVG---------RASD--GY.I----
P90338_9TOMB/1-480-DMSRFDQHVSVPALQFEHSIYQAIFKGDR...ELQQL-LSWQL-------RNYGTG---------FAHD--GL.I----
RDRP_BYDV1/361-840-DASRFDQHVSEQALKWEHGIYNGVFG.DS...ELALA-LEHQI-------TNN.IK---------MFVE--DKML----
O09796_9HEPC/2422-2933-DTRCFDSTVTENDIRVEESIYQCCDLAPEA.KLAIRS-LTERL-------YIGGPL---------TNSK--GQ..----
O09803_9FLAV/2373-2866-DATCFDSSITEEDVALETELYALASDHPD....WVRA-LG.KY-------YASGTM---------VTPE--GV..----
O37361_9VIRU/252-737-DASRFDLHVSVDALKFTDQIYLSAFTGIDR.SELKEI-LRNRH-------KTTGFA---------TCKE--GT.F----
Q9WJD9_CARMV/267-744-DMSRFDQHVSVAALEFEHSCYLACFEGDA...HLANL-LKMQL-------VNHGVG---------FASN--GM.L----
Q83103_9TOMB/228-711-DASRFDQHISVEALQFEHKMWLEMFPVSQR.KHLKRL-LDLQL-------HNRGLA---------RCPD--GT.A----
Q66127_9VIRU/52-520-DASRFDQHVSVEALKFTHSVYKRFNSSK....EFVDL-LNQMY-------VNRGLG---------TCKD--GL.V----
RDRP_PMVK/447-937-DASRFDQHVSVEALRFEHSIYKSIHGYPE...LLSLL-LKWQI-------HNQGTA---------HTND--GF.F----
POLG_GBVB/2277-2785-DTVCFDSTITPEDIMVETDIYSAAKLSDQH.RAGIHT-IARQL-------YAGGPM---------IAYD--GR..----
Q89801_9TOMB/1-479-DMSRFDQHVSFDALQFEHGVYLQHFGGDR...FLAKL-LSWQL-------NNKGFA---------NLPE--GK.V----
Q9IRA1_9TOMB/266-741-DAKRFDQHVSVDALRFEHSVYNSIFHSP....ELARL-LSYQL-------HNVGVA---------VASD--GF.A----
O12301_9TOMB/231-708-DASRFDQHVSVAALKWEHKLYHHAFNHDK...TLKKL-LKWQI-------HNEGTA---------FASD--GC.I----
Q83424_MNSV/290-772-DMKRFDQHVSSDALKWEHSVYLDAFCHDS...YLAEL-LKWQL-------VNKGVG---------YASD--GM.I----
O41892_9FLAV/2409-2899-DATCFDSSIDEHDMQVEAAIFAAASDDPV....RVHA-LC.RY-------YVEGPM---------VSPD--GV..----
RDRP_OCSVU/235-734-DASRFDQHVSLEALEFEHSVYLKCVRRMVDKRKLGNI-LRHQL-------LNKCYG---------NTPD--GA.V----
Q9IW60_9TOMB/325-800-DASRFDQHCSMEALQYEHSFYRAMYPGN...KLLSKL-LEWQL-------HNKGKG---------YVPD--GT.I----
Q96898_9FLAV/2396-2886-DATCFDSSIDEHDMQVEASVFAAASDNPS....MVHA-LC.KY-------YSGGPM---------VSPD--GV..----
RDRP_RCNMV/260-745-DASRFDQHCSVDALKFEQTFYKACFPGDQ...QLETL-LKWQL-------SNTGSA---------LLPT--GELV----

PF00972

POLG_YEFV1/2758-3406DDTAGWDTRITEADLDDEQEILNYMSPHHK---KLAQA-VMEMT-------YKNKVV-----KVLRPAPGGKAYMD----

PF00078

A0A016RNU0_KLEPN/135-366-DISQFFDRVSHEWL--IR.FTEHRIGDRRVIRLIRKW-L....T---AGTSEEG..---------..QW--RATE----
A0A025GH98_ECO57/115-332-DIRGCFDNISHQWL--IDNTSTDRQILTK...WLKAG-YREKG.---.........---------..QL--FPVN----
D7ZFU1_ECOLX/62-269-DISNFFDNIHRDLV--RS.VFEE..ILHIKDEALEYL-V.....---.........---------..DI--CTKD----
F6BM08_SINMB/72-291-DIKGLFDNLPHDLL--LKAVRKDVKCN......WALL-YIERWL---TAPM.EKN.---------G.EV--IERS----
M7UYJ9_ECOLX/33-239-DLVNFFNKITPELL--FK.ALARQKVD..ISDTNKNL-L.....---.KQFCFWN.---------RTKR--KNGA----
O01419_BOMMO/502-756-DISNAFNTVPWSTI--LE.SLRFHRVPTGLRNLIEDY-LAGRAV---VFPERRGW.---------..GH--KAVS----
O18558_AEDAE/472-725-DIEGAFDNVSFDAI--LE.AARNHGLPTMITNWIHQM-LKNRH.---..LFSTLRQ---------AAIR--KLSV----
O42691_ALTAL/36-202-DVRSGFANLRMAPG--SE.KATAFKTF..........-......---.........---------..FG--SFEY----
O44316_DROMR/394-650-DVSKAFDSVAHDAV--FN.TVTAYGAPKSFVDYVRRW-YSGGGT---YFNGGDWR.---------S.EE--FVPA----
O52231_STREE/68-275-DLEKFFDTVPQDRL--MS.LVHNIIEDGDTESLIRKY-L....H---SGVIING..---------..QR--YKTL----
O62658_CANFA/517-773-DAEKAFDKIQHPFL--IK.TLQSVGIEGTFLDILKAI-YEKPTA---NIIL.NGE.---------ALGA--FPLR----
O64612_ARATH/788-1031-DLSKAFDSVQWPFL--LN.TLAALDIPEKFIHWINLC-ISTAS.---.........---------...F--SVQV----
O65244_ARATH/405-664-DISKAFDSVQWKFL--IN.VLEAMNFPPEFTHWITLC-ITTASF---SVQV.NGE.---------LAGV--FSSA----
O65598_ARATH/489-747-DLRKAFDSVRWEFI--IA.ALLALGVPTKFINWIHQC-ISTPTF---TVSV.NGCC---------G.GF--FKSA----
O81284_ARATH/58-317-DLTKAYDNVNWEFL--IN.ILKALNLPPIFINWIWVC-ISTPSY---SIAY.NGE.---------LIGF--FVGK----
O81454_ARATH/144-304-DLRSGYHQVRMREG--DE.WKTAFKTK..........-......---.........---------..QG--LYEC----
O93520_ORYLA/518-771-DAEKAFDSVRWTFL--YK.VLGKFGFCKSIIETISGL-YNKPTA---RIKI.NGD.---------LTET--ITLE----
O96546_LYMDI/526-780-DVAKAFDKVWHEGL--IY.KLYLLKIPHYLIHIIHDY-LSHRSF---RYRV.EGT.---------LSTS--HPIK----
O99969_PORPU/100-315-DIKGCFDNIDHSKL--LE.KLNTFPLF...RNQINTW-L....K---VGVLSDFQG---------NKTE--IIPQ----
POL_RSVP/769-938-DLKDCFFSIPLAEQ--DR.EAFAFTLPSV........-......---.....NNQ.---------APAR--RFQW----
POL_HTL1A/633-804-DLRDAFFQIPLPKQ--FQ.PYFAFTVPQQ........-......---......CNY---------GPGT--RYAW----
POL_SMRVH/71-240-DLKDCFFTIPLHPE--DR.PYFAFSVPQI........-......---......NFQ---------SPMP--RYQW----
POL_MMTVB/68-237-DLQDCFFNIKLHPE--DC.KRFAFSVPSP........-......---......NFK---------RPYQ--RFQW----
POL_CAMVC/289-452-DCKSGFWQVLLDQE--SR.PLTAFTCP..........-......---.........---------..QG--HYEW----
POL_IPHA/60-229-DIKDCFFSIPLYPR--DR.PRFAFTIPSL........-......---......NHM---------EPDK--RFQW----
POL_HV1MA/655-826-DVGDAYFSVPLDED--FR.KYTAFTIPSI........-......---......NNE---------TPGI--RYQY----
TF21_SCHPO/455-615-DLKSAYHLIRVRKG--DE.HKLAFRCP..........-......---.........---------..RG--VFEY----
POK10_HUMAN/76-245-DLKDCFFTIPLAEQ--DC.EKFAFTIPAI........-......---......NNK---------EPAT--RFQW----
POL4_DROME/357-523-DLMSGFHQIELDEG--SR.DITSFSTS..........-......---.........---------..NG--SYRF----
POLY_DROME/224-390-DLKSGYHQIYLAEH--DR.EKTSFSVN..........-......---.........---------..GG--KYEF----
POL_EIAV9/249-419-DIGDAYFTIPLDPE--FR.PYTAFTIPSI........-......---......NHQ---------EPDK--RYVW----
YTX2_XENLA/513-765-DQEKAFDRVDHQYL--IG.TLQAYSFGPQFVGYLKTM-YASAEC---LVKI.NWS.---------LTAP--LAFG----
POL_SOCMV/246-411-DAKSGYYQLRLHEN--TK.PLTAFSCP..........-......---.........---------.PQK--HYEW----
Y2R2_DROME/498-741-DFKGAFDNVEWSAA--LS.RLADLGCREM..GLWQSF-FSGRRA---VIRSSSG..---------.TVE--VPVT----
POL_BIV29/638-806-DIKDAYFTIPLHED--FR.PFTAFSVVPV........-......---......NRE---------GPIE--RFQW----
RDPO_ACUOB/124-343-DIKGCVDNINHQFI--SQ.VTPFIPKK.....ILWAW-L....K---CGYIERNS.---------N.TL--QPTT----
POL2_DROME/249-414-DLAKGFHQIEMDEE--SI.SKTAFSTK..........-......---.........---------..SG--HYEY----
RT67_ECOLX/48-262-DLKDFFESFNFGRV--RG.YFLS.....NQDFLLNPV-VATTL.---.........---------.AKA--ACYN----
RTJK_DROME/502-757-DIQQAFDRVWHPGL--LY.KAKRLFPPQL.YLVVKSF-LEERTF---HVSV.DGY.---------KSSI--KPIA----
POL_BLVAU/41-212-DLKDAFFQIPVEDR--FR.SYFAFTLPTP........-......---......GGL---------QPHR--RFAW----
POL_RTBVP/1228-1390-DLKAGFHHMKLKDD--FK.DWTTFTCS..........-......---.........---------..EG--LYTW----
POL_CAEVC/210-380-DIGDAYFTIPLYEP--YR.EYTCFTLLSP........-......---......NNL---------GPCK--RYYW----
P91581_CIOIN/483-644-DLRSAYHQIPLKDS--DR.PFTAFEAE..........-......---.........---------..GQ--LYQY----
P95451_PSEAC/119-326-DLEKFFDRVNHDIL--MA.CIERRIKDKCVLRLIRRY-L....E---AGIM.SGG.---------..VV--SPRQ----
Q01379_NEUCS/505-761-DLKGAFDRVNHRWL--LH.TLWEMQLPTWIIRWVASF-VAGRRG---SLFF.DDE.---------TSRP--YAIT----
Q03261_SIV/246-416-DLKDAYYSVPLDKE--FR.PYTAFTVPSI........-......---......NNA---------SPGE--RYQF----
Q04135_DROME/496-743-DVAQAFDRVWLDGL--LF.KIIK.LLPQNTHKLLKSY-LYNRVF---AIRC.DTS.---------TSRD--CAIE----
Q07995_CHITU/509-760-DVEKAFDRVWHPGL--LY.KMLKLRFPLPLIKTVRSF-LSERSF---AVFI.KGQF---------S.EI--KVIK----
Q08724_9CYAN/108-336-DISKCFDKINHEKL--LT.KINTFPTMRR...QIKAW-L....K---AGVL.DNG.---------..HF--SETT----
YRD6_CAEEL/484-644-DLKDAYLQVELDEE--AQ.KLAVINTH..........-......---.........---------..RG--IFKY----
Q17329_CAEEL/1071-1231-DMIAGFWQIPLDEK--SK.EITAFAIG..........-......---.........---------..SE--LFEW----
Q24262_DROME/531-692-DLQNGFFHVAVEEA--SK.PYTAFVTR..........-......---.........---------..EG--LFEF----
Q24690_DROTE/495-742-DFSRAFDRVGVHSI--IH.QLQEWKTGPKIINYIQNF-MINRKI---IVRV.GPH.---------TSSP--LPLS----
Q26816_9TRYP/545-793-VDYKAFDTVDHDKI--AR.EMHRMKVSPHIVKWCVSF-LSNRTG---RVRF.KEK.---------LSRS--RTFE----
Q46666_ECOLX/34-241-DLEDFFNSITPAIF--WR.CIEMSSALTPQFEPQDKF-F....I---EKIL.FWQ.---------PIKH--RKTK----
Q83013_9RETR/68-238-DISDCFFSIPLAER--DS.ERFAFTIPSP........-......---......NLR---------EPAK--RYQW----
Q88285_9RETR/848-1015-DISNGFWSIRLEEE--CQ.YLFAFTFD..........-......---.........---------..TQ--QYTW----
POL_CSVMV/250-413-DCKSGFYHIKLEED--SK.KYTAFTVP..........-......---.........---------..QG--YYQW----
Q93137_BOMMO/515-771-DVAKAFDKVWHNGL--IF.KLFNMGVPDSLVLIIRDF-LSNRSF---RYRV.EGT.---------RSSP--RPLT----
Q93139_BOMMO/469-719-DIEGAFDSAWWPAL--EV.RLAEEKCPEYLRRVISSY-LSDRRV---SVRY.AGA.---------E.YE--RATS----
Q94885_DROME/759-920-DLKNGFFHVHVKKE--SI.KYTSFVTP..........-......---.........---------..LG--QYEW----
YG31B_YEAST/639-797-DLHSGYHQIPMEPK--DR.YKTAFVTP..........-......---.........---------..SG--KYEY----
Q9YGS2_TAKRU/573-830-DLSAAFDTVDHSIL--LQRLEHVIGIKGTALDWFRSY-LSDRYQ---FAHV.HGVP---------S.SY--SRVS----
Q9YW31_MSEPV/161-406-DFKKAFDNVDREIL--WN.IMHLHGYPPHLINAIKSL-YENTR.---......IIV---------KSKV--IKIN----
Q9ZNW4_SORBI/922-1081-DCFSGYHQIWLKKE--DE.GKASFTTP..........-......---.........---------..FG--TYCY----
Q9ZQ67_ARATH/542-701-DAFSGYNQIPMHKD--DQ.EKTSFIID..........-......---.........---------..RG--TYCY----
Q9ZQQ6_ARATH/659-918-DISKAFDSVQWQFL--LN.TLEALKFPEKFRHWIKLC-ISTATF---SVQV.NSE.---------QAGF--FGSK----
Q9ZS84_SOLLC/655-815-DLRAGYWQVRIAEG--DE.PKTTCVTR..........-......---.........---------..YG--SYEF----
Q9ZVK4_ARATH/510-669-DLTSGYHLIPIAEA--DV.RKTAFRTR..........-......---.........---------..YG--HFEF----

PF05919

Q6EH16_9VIRU/1-501-DLSAATDRLPIAFQ--KD-ILNHLG...YPGGPWRRL-L.GIKY..........NS---------PCGF--ISYA----
Q5TMB5_9VIRU/174-658-DLKSATDRFPVELQ--EK-VIQAFYGE.DFARSWRSL-ITDQAF..........AY---------GESE--VRYG----
Q18L80_9VIRU/166-639-DLSAATDRLPLSIQ--IL-ILKHLVSV.PFSEAWGRL-LTGRTY....HL..FYKK---------TSYE--VQYQ----
Q9WJ23_9VIRU/164-642-DLSAATDRFPIDLQ--ER-LLSYLYGS.EISSAWKQL-LIDRTY.........KTP---------EGDE--LHYK----
RDRP_CPMV1/246-745-DLTAATDRLPIDLQ--VD-ILNIIFKN.SPGSSWRSL-L.RIKY..........KS---------PQGF--LTYA----
Q9ZXZ7_THACU/214-754-DLTAATDRLPVILT--AF-ILSTIVGIRTFGGLWRSI-LVKRPFGFNSNVAEKLKV---------SDGP--YFYE----
Q9WJ22_9VIRU/155-622-DLSAATDRFPIFLQ--QK-LISLIFNDYEFGKNWRNL-LVDRNY..........DY---------QGIS--YRYS----
Q6EH19_9VIRU/208-686-DLEAATDRFPIQFQ--KK-VLSLIFNT.TYAQAWAEI-MTQEPF........RVKG---------LSDP--LRWG----
Q9WJ24_9VIRU/163-645-DLSSATDRFPIVFQ--KR-VLQKILGK.QMTDSWERI-MIGSKF.........LAP---------DGDT--VSYN----
Q6GYC2_9VIRU/156-638-DLTAATDRFPISLQ--RR-LLLYIYSDPEIANSWQNL-LVHREY.........ARN---------GLNP--IKYS----
Q18L78_9VIRU/174-654-DLSAATDRLPLTLQ--KD-ILTLLVSP.SFAEAWGTA-LVGRPY....KL..KFGT---------TEDE--LMYS----
Q18L79_9VIRU/168-671-DLSAATDRLPLTIQ--AQ-ILNHIVP..KLGDHWANL-LVNRDYSVPNHT..TLPV---------NPGT--VRYG----
Q3S3F3_9VIRU/120-606-DLSSATDRFPVKLQ--SR-LLTEMYSDPSFGENWMNL-LLNRDYLLP.....EEGL---------SGER--LRYA----
O92614_9VIRU/173-711-DLSSATDRLPMAFQ--KQ-IISVLFGS.KFAKDWATL-LVGRDW..........YL---------KDIP--YRYS----

PF07727

Q7G640_ORYSJ/781-1029-DVKTIFLHGELEEE..IY-MDQPEGFI--------------------------VPG---------KEDD--VCKL----
Q7XLN3_ORYSJ/465-703-DVVTTYLYGSLDSD..IY-MKVLDGID--------------------------IPN---------Q...--....----
Q7XTU6_ORYSJ/940-1185-DVKSAFLNGELEEE..VY-VVQPPGFD--------------------------DKT---------NASK--VLKL----
Q7XKS1_ORYSJ/160-403-DVKNAFLNGELHEE..VY-MRSPQGYS--------------------------VP.---------.EGM--VCCL----
Q9FWI2_ORYSJ/795-1030-DVKSAFLNGYLDEE..IY-VEQPEGFS--------------------------VQG---------GENK--VFRL----
Q94I36_ORYSJ/864-1109-DVKSAFLNGFIHEE..VY-VKQPPGFE--------------------------NSD---------FPNH--VFKL----
Q7G6C9_ORYSJ/1047-1286-DVKSAFLNGPISEL..VY-VEQPPGFE--------------------------DLK---------LPNH--VYEL----
Q94LQ7_ORYSJ/550-793-DVQNAFLHGVLEED..VF-MRQPPGYE--------------------------QK.---------.DGY--VCKL----
Q7XKG6_ORYSJ/514-759-DVKNAFLHGDLQEE..VY-MEIPPGFS--------------------------TSQ---------TKGK--VLRL----
Q7X5X4_ORYSJ/138-383-DVKTAFLNGEPLEE..VY-VEQAPGFT--------------------------TPG---------AGDK--VYHL----
Q84M55_ORYSJ/910-1155-DVKNAFLHGDLHEE..VY-MEIPPGFG--------------------------NSQ---------TVGK--VCKL----
Q7Y173_ORYSJ/398-645-DVKTAFLNGELHED..VY-MAEPEGFV--------------------------MEG---------KDHL--ACKL----
Q8W5F4_ORYSJ/472-717-DVKTAFLNGELDEE..IY-MDQPNGFV--------------------------VEG---------QEGK--VCKL----
Q7XUD9_ORYSJ/916-1161-DVKSAFLNGELAEE..VY-VKQPPGFV--------------------------KEG---------REHQ--VLRL----
Q8LNW7_ORYSJ/880-1128-DVKTAFLHGELEED..IY-MEQPEGFV--------------------------VLG---------KENL--VCRL----
Q94HQ0_ORYSJ/485-718-DVKSAFLNSDLKEE..VY-VHQPPGFV--------------------------IPG---------KEGK--VLRL----
Q7Y1I1_ORYSJ/727-972-DVKSAFLNGELTEE..VY-VVQPPGFV--------------------------VEG---------HEHQ--VLKL----
Q94GR9_ORYSJ/975-1220-DVKSAFLNGEIAEL..VF-VEQPPGFE--------------------------DPK---------NPNH--VYKL----
Q7X7N0_ORYSJ/758-1003-DVKNAFLHGTLDET..VY-CQQSSGFI--------------------------DPA---------APDA--VCLL----
Q7XZY2_ORYSJ/297-542-DVKSAFLNGDLEED..VY-VVQPPGFV--------------------------DEE---------HPDK--VLIL----
Q7XN62_ORYSJ/915-1162-DVKTAFLNGDLEEK..VY-MAQPKGFV--------------------------MKG---------NENM--GCRL----
Q7XLI2_ORYSJ/53-298-DVKNAFLHRTLQET..VY-CTQPAGFV--------------------------DPT---------KPDL--VCRL----
B5RTA2_DEBHA/1170-1414-DISSAYLHADIDYEKSIF-VKPPPGSN--------------------------ID.---------.SGK--CWQL----
B5RTR8_DEBHA/1021-1254-DVDTAFLNGTVEET..LY-MKQPVGFI--------------------------NEN---------EPEK--VCKL----
E7KRB3_YEASL/146-383-DVDTAFLNSTMDEP..VY-VKQPPGFV--------------------------NER---------NPDY--VWEL----
Q2R072_ORYSJ/915-1159-DVKSAFLNGELIEE..VY-VVQPPGFE--------------------------IDG---------QENK--VYRL----
Q59K02_CANAL/999-1236-DVTTAFLNGEISEL..IF-VKQPPGYE--------------------------DKK---------RPNH--VCKL----
Q5AG24_CANAL/888-1133-DIASAYLNASLEDGRVIF-VRPPRGFE--------------------------VK.---------.PGY--SWRL----
Q5AH82_CANAL/122-366-DVESAYLNASITHSNPIY-VFPPKSVP--------------------------LK.---------.KNH--CWLL----
Q7XN23_ORYSJ/31-274-DVQNVFLHGFLQEE..VY-MQQPPGFE--------------------------SSS---------KPNY--VCKL----
Q8S476_MAIZE/836-1081-DVKTAFLNGELDEE..IY-MDQPEGFI--------------------------ADG---------QENK--VCRL----
Q8S479_MAIZE/1073-1313-DVKSAFLNGPIKEE..VY-VEQPPGFE--------------------------DER---------YPDH--VCKL----

PF00680

POLG_HAVHM/1750-2215..HVCGSMPS-----------GSPCT----------ALLNS-------II--------------------NNVNLYY-VF
RDRP_BPPH6/19-638NPDLEVGLSS-----------GQGAT----------DLMGT-------LL--------------------MSITYLV-MQ
POLG_PYFV1/2270-2778..RVPGGGPS-----------GFPMT----------VIFNS-------FI--------------------NLFYLQS-AW
POL1_CPMVS/1186-1687..RVECGIPS-----------GFPMT----------VIVNS-------IF--------------------NEILIRY-HY
POLG_RHDVF/1279-1750..QTKRGLPS-----------GMPFT----------SVINS-------IC--------------------HWLLWSA-AV
POLG_PVYN/2293-2763..KKFRGNNS-----------GQPST----------VVDNS-------LM--------------------VVLAMHY-AL
POLG_EMCVR/1844-2288..LITGGLPS-----------GCAAT----------SMLNT-------IM--------------------NNIIIRA-GL
POLG_FCVUR/1266-1735..KVSSGLPS-----------GMPLT----------SVINS-------LN--------------------HCLYVGC-AI
POLG_NVN68/1301-1766..RVKEGLPS-----------GFPCT----------SQVNS-------IN--------------------HWIITLC-AL
Q9DLK1_FMDVP/1865-2314..VVEGGMPS-----------GCSAT----------SIINT-------IL--------------------NNIYVLY-AL
POLG_VESVA/1379-1848..KVAGGLPS-----------GMPLT----------SIINS-------LN--------------------HCLMVGS-AV
POL1_BAYMY/1634-2098..KKNVGTQR-----------.QPST----------VVDNT-------LV--------------------LMTAFLY-AY

PF02123

Q83093_9VIRU/437-816EQGLPGLMKS...........GSYCT----------SSTNS-------RI--------------------RCLMAEI.IQ
Q66150_9VIRU/22-408TQELPGLMKS...........GSYCT----------SSSNS-------RI--------------------RCLMAEL.IG
Q86519_9VIRU/516-902QQELPGLMKS...........GSYCT----------SSTNS-------RI--------------------RCLMGEL.IG
RDRP_SCPMV/464-849QQELPGIMKS...........GSYCT----------SSTNS-------RI--------------------RCLMAEL.IG
RDRP_SBMVA/490-847EQQLPGIMKS...........GSYCT----------SSTNS-------RI--------------------RCLMAEL.IG
RDRP_PEMVW/733-1124AQTSPGIQKS...........GSFNT----------SSTNS-------RM--------------------RYMLALY.AG
RDRP_PLRVW/609-1004AQTVPGVQKS...........GSYNT----------SSSNS-------RI--------------------RVMAAYH.CG
RDRP_TYYVF/580-974AQIHPGVQKS...........GSYNT----------SSSNS-------RI--------------------RVMAAFH.TG
Q65969_9LUTE/603-996AQRVPGVQKS...........GSYNT----------SSSNS-------RI--------------------RVMAAYH.CG
RDRP_ROTGI/108-803VVASPGSQRPTKIIRYHGVASGEKTT----------KIGNS-------FA--------------------NVALIET.VL
RDRP_ROTHC/109-749...QYGATAS...........GEKQT----------KIMNS-------IA--------------------NKALIQT.VL
O55590_9REOV/104-749LKIQYGAVAS...........GEKQT----------KAANS-------IA--------------------NLALIKT.VL
RDRP_ROTPY/100-748KKIQYGAVAS...........GEKQT----------KAANS-------IA--------------------NLALIKT.VL
Q90153_9VIRU/1025-1530IIKTASGLYS...........GDRDT----------TLINT-------LL--------------------NIAYASV.TD
Q90193_9VIRU/400-785RRFTHGLLS............GWRCT----------AYINN-------LI--------------------NIAQYEV.GR
RDRP_PCVC/362-832HKIWRG.LYS...........GWRGT----------TWINT-------VL--------------------NFCYVHI.AL
RDRP_SCVLB/837-1303TYDVKGTLFS...........GWRLT----------TFFNT-------AL--------------------NYCYLAN.AG
Q87025_SCVLA/177-657WYRLQGTLLS...........GWRLT----------TFMNT-------VL--------------------NWAYMKL.AG
Q90155_TTV1/96-539.RKWTATLPS...........GHRAT----------TFINT-------VL--------------------NWCYTQM.VG
Q9JE94_9VIRU/129-560.THWNSTLPS...........GHRAT----------TFINS-------VL--------------------NRAYLLPFLQ
Q8V615_9VIRU/41-473.QHWLSTLPS...........GHRAT----------TFINS-------VL--------------------NKAYLIPYIG
Q83073_9VIRU/49-523.GRVHGTLMS...........GHRAT----------TFINT-------IL--------------------NTAYLYV.AG
RDRP_LRVLG/155-619.GIMAGTLMS...........GHRAT----------SFINS-------VL--------------------NRAYIIC.AG
Q98XW8_9VIRU/144-622.GRVAGSLMS...........GHRAT----------TYWNS-------VL--------------------NAAYVRY.AI
Q99AT3_9VIRU/99-573.GRVKGTLMS...........GHRGT----------TFINS-------VL--------------------NKAYLLI.VL
Q9YXE4_9VIRU/99-573.GRVLGTLMS...........GRRGT----------TYISS-------VL--------------------NEVYLAIELG
RDRP_HV19S/122-585.RHVLGTLMS...........GHRAT----------TFTNS-------VL--------------------NAAYICYAVG
Q9YXE6_9VIRU/120-589.RPWLGTLPS...........GHRGT----------TIVNS-------VL--------------------NAAYIRMALG

PF04197

RDRP_IBDVU/1-875.PEQPSPTVELDLL-------GWSATYSKDLGIYVPVLDKE-------RL--------------------FCSAAYP-KG
RDRP_IPNVJ/1-842PPIRPGKAVELDLL-------GWSAIYSRQMEMFVPVLENE-------RL--------------------IASAAYP-KG
RDRP_BSNV/1-863PPEKEGPTVDLDLL-------GWSATYSRHMDMWVPVLDKE-------RL--------------------LSSAAYP-KG

PF00978

R1AB_LIYV9/1925-2366DLELGTQRRT..---------GSPNT----------WLSNT...L...VT--------------------LGMMLSS-Y.
R1AB_BYVU/2601-3046SFSVDNQRKS..---------GASNT----------WIGNS...I...ET--------------------LGILSMF-Y.
Q9YPH5_9VIRU/1359-1796QAYLLYQQKS..---------GNCDT----------YGSNT...W...SA--------------------ALALLDC-M.
POLN_EEVVM/2041-2488MM......KS..---------GMFLT----------LFVNT...V...IN--------------------MVIASRV-L.
E0YCR0_9CLOS/53-491VLSVGSQRRS..---------GGANT----------WLGNS...L...VL--------------------CTLLSVV-L.
RDRP_TOMS1/1168-1609KTCLWYQRKS..---------GDVTT----------FIGNT...V...II--------------------ASCLASM-L.
RDRP_PSVJ/295-726SMPISFQRRT..---------GDAFT----------YFGNT...L...VT--------------------MALFSWC-Y.
Q66107_9BROM/228-662GFAVDFQRRT..---------GDANT----------YLGNT...L...VT--------------------LICLARV-Y.
Q87644_SINDV/2053-2501MM......KS..---------GMFLT----------LFVNTVLNV...VI--------------------ASRVLEE-R.
O56790_9VIRU/1323-1760IAHILYQQKS..---------GNCDT----------YGSNT...W...SA--------------------ALALLDA-L.
RDRP_CMVFN/308-738GMPISFQRRT..---------GDALT----------YFGNT...I...VT--------------------MAEFAWC-Y.
Q9WJD8_PEBV/1299-1738TAYIWYQQKS..---------GDADT----------YNANS...D...RT--------------------MCALLSE-L.
Q80875_BSMV/195-630EAYLLYQQKS..---------GNCDT----------YGSNT...W...SA--------------------ALALLDC-L.
RDRP_RBDVR/1234-1674GFKTDFQRRT..---------GDAFT----------FLGNS...L...VT--------------------AAMLAFV-I.
RDRP_SBWMN/1373-1810TAYLLYQQKS..---------GNCDT----------YGSNT...W...SA--------------------ALALLES-M.
POLN_ONNVI/2053-2501MM......KS..---------GMFLT----------LFVNT...L...LN--------------------ITIASRV-L.
RDRP_TAV/313-742SMPISFQRRT..---------GDAFT----------YFGNT...L...VT--------------------MSMFAWC-Y.
POLN_MIDDV/534-981MM......KS..---------GMFLT----------LFVNT...M...LN--------------------MTIASRV-L.
RDRP_TMGMV/1163-1604KTCLWYQRKS..---------GDVTT----------FIGNT...V...II--------------------AACLGSM-L.
RDRP_TOBSV/253-689GFSVDYQRRT..---------GDACT----------YLGNT...L...VT--------------------LSVLSYV-Y.
RDRP_OLV2I/310-732AFSVDYQRRT..---------GNTAT----------YFGNT...L...VT--------------------MIMMAEV-Y.
RDRP_YOMV/1155-1594KTCLWYQRKS..---------GDVTT----------FIGNT...I...II--------------------AACLSSM-I.
RDRP_AMVLE/318-752FFNVDFQRRT..---------GDALT----------YLGNT...I...VT--------------------LACLCHV-Y.
POLN_RRVN/2019-2467MM......KS..---------GMFLT----------LFINT...LLNIVI--------------------ACRVLRE-K.
RDRP_ASPVP/1758-2169SFAIM..RFT..---------GEAST----------FLFNT...M...AN--------------------MLFTFLR-Y.
O56250_9VIRU/1240-1678MAHIWYQQKS..---------GDADT----------YNANS...D...RT--------------------LCALLSE-L.
O90699_9VIRU/1363-1800VAHLLYQQKS..---------GNCDT----------YGSNT...W...SA--------------------ALSLIES-L.
Q9Q6Q3_9CLOS/62-509VLSVGAQRRS..---------GGANT----------WLGNT...L...VL--------------------MTLLAIS-L.
POLN_AURAV/2038-2486MM......KS..---------GMFLT----------LFVNT...V...LN--------------------VVIASRV-L.
RDRP_BBMV/271-697SIPLL..SKTNR---------G.CFH----------LLWEH...F...SD--------------------NAMMAYC-F.
RDRP_CCMV/267-697NMPVSFQRRT..---------GDAFT----------YFGNT...L...VT--------------------MAMMAYC-C.
Q66581_EEEV/144-598MM......KS..---------GMFLT----------LFINT...V...VN--------------------IMIASRV-LR
Q9QGG9_9BROM/363-797GFSVNYQPRT..---------GDACT----------YLANT...I...IT--------------------LSALAYM-Y.
RDRP_TMOB/1167-1614KTCLWYQRKS..---------GDVTT----------FIGNT...V...II--------------------AACMASM-L.
RDRP_BMV/256-688GMSVSFQRRT..---------GDAFT----------YFGNT...L...VT--------------------MAMIAYA-S.
O40960_9CLOS/62-506NLDLYCQRRT..---------GSPNT----------WLSNS...L...AT--------------------LAMLASV-Y.

PF00998

RDRP_TNVA/224-703KYKKKGCRMS-----------GDMNT----------SLGNC-------IL--------------------MCAMVYG-L-
RDRP_TCV/272-752KYQVDGCRMS-----------GDVNT----------ALGNC-------LL--------------------ACSITKY-L-
RDRP_TNVD/224-709RYRVEGCRMS-----------GDMNT----------SSGNC-------YI--------------------MCATVHN-W-
RDRP_MCMVK/460-941NYQVDGKRMS-----------GDMNI----------SLGNC-------IL--------------------ATAITHD-F-
POLG_HCVEU/2430-2941SCGYRRCRAS-----------GVLPT----------SMGNT-------LT--------------------CYLKAQA-A-
POLG_HCVED/2420-2931LCGYRRCRAT-----------GVYTT----------SFGNT-------LT--------------------CYLKATA-A-
POLG_HCVJL/2434-2945SCGYRRCRAS-----------GVLPT----------SMGNT-------LT--------------------CYLKAMA-A-
POLG_HCVJK/2431-2942HCGYRRCRAS-----------GVLPT----------SFGNT-------VT--------------------CYLKAKA-A-
POLG_HCVEV/2426-2937QCGYRRCRAS-----------GVFTT----------SMGNT-------MT--------------------CYIKALA-S-
POLG_HCVJ6/2445-2956TCGYRRCRAS-----------GVLTT----------SMGNT-------IT--------------------CYVKALA-A-
Q9IR83_9TOMB/236-712RYKVDGCRMS-----------GDVNT----------AMGNC-------LL--------------------ACLITKH-L-
Q87031_9LUTE/24-502KFKVKGHRMS-----------GDINT----------SSGNK-------LI--------------------MCGMMHY-Y-
RDRP_POLVP/251-722RYRVDGCRMS-----------GDMNT----------SMGNY-------LI--------------------MSCLVYQ-F-
Q65987_9TOMB/269-750KYQVEGCRMS-----------GDVNT----------AMGNC-------LL--------------------ACSITRY-L-
P90338_9TOMB/1-480RYKVDGCRMS-----------GDMNT----------ALGNC-------IL--------------------ACLITKH-I-
RDRP_BYDV1/361-840RFKVRGHRMS-----------GDINT----------SMGNK-------LI--------------------MCGMMHA-Y-
O09796_9HEPC/2422-2933NCGYRRCRAS-----------GVLTT----------SCGNT-------LT--------------------CYLKASA-A-
O09803_9FLAV/2373-2866PVGERYCRSS-----------GVLTT----------SASNC-------LT--------------------CYIKVKA-A-
O37361_9VIRU/252-737HYEKVGGRCS-----------GDSDT----------SLGNV-------SI--------------------MLAITRV-I-
Q9WJD9_CARMV/267-744RYTKEGCRMS-----------GDMNT----------ALGNC-------LL--------------------ACLITKH-L-
Q83103_9TOMB/228-711RYKVDGCRMS-----------GDMNT----------SSGNC-------FI--------------------MCATVWN-W-
Q66127_9VIRU/52-520KYKVKGCRMS-----------GDMDT----------ALGNC-------VL--------------------MVLMTRN-L-
RDRP_PMVK/447-937KYLVDGKRMS-----------GDMNT----------SLGNC-------IL--------------------ASLIVKD-L-
POLG_GBVB/2277-2785EIGYRRCRSS-----------GVYTT----------SSSNS-------LT--------------------CWLKVNA-A-
Q89801_9TOMB/1-479KYTRRGCRMS-----------GDMNT----------AMGNC-------LL--------------------ACAITWD-L-
Q9IRA1_9TOMB/266-741RYSVDGCRMS-----------GDINT----------ALGNC-------LL--------------------SCAITHF-L-
O12301_9TOMB/231-708KYKKTGCRMS-----------GDMNT----------SLGNC-------LI--------------------MCGMVYD-L-
Q83424_MNSV/290-772KYKVDGCRMS-----------GDMNT----------AMGNC-------LI--------------------ACAITHD-F-
O41892_9FLAV/2409-2899MLGHRACRSS-----------GVLTT----------SSANS-------XT--------------------CYIKXXA-A-
RDRP_OCSVU/235-734SYTIEGTRMS-----------GDMNT----------SLGNC-------VL--------------------MCMMIHA-Y-
Q9IW60_9TOMB/325-800TYRKEGCRMS-----------GDINT----------SLGNY-------LL--------------------MCAMVHG-Y-
Q96898_9FLAV/2396-2886PLGYRQCRSS-----------GVLTT----------SSANS-------IT--------------------CYIKVSA-A-
RDRP_RCNMV/260-745RYRTKGCRMS-----------GDINT----------GLGNK-------IL--------------------MCSMVHA-F-

PF00972

POLG_YEFV1/2758-3406VISRRDQRGS-----------GQVVT----------YALNTITNLKVQLIRMAEAEMVIHHQHVQDCDESVLTRLEA-W-

PF00078

A0A016RNU0_KLEPN/135-366EGTPQGAVIS-----------PLLAN----------IYLHY-------VF--------------------DLWAHQW-R.
A0A025GH98_ECO57/115-332SGTPQGGIIS-----------PVLAN----------IALDG-------LE--------------------ALLASEF-KK
D7ZFU1_ECOLX/62-269DFVVQGALTS-----------SYIAT----------LCLFA-------VE--------------------GDVVRRA-..
F6BM08_SINMB/72-291RGTPQGGVVS-----------PILAN----------LFLHY-------AF--------------------DLWMTRT-..
M7UYJ9_ECOLX/33-239LVLSVGAPSS-----------PFISN----------IVMSS-------FD--------------------EEISSFC-..
O01419_BOMMO/502-756CGVPQGSVLG-----------PLLWD----------VGFDW-------VL--------------------RGANLR.-..
O18558_AEDAE/472-725CGCPQGGVLS-----------PLLWN----------LVADT-------LL--------------------RQLNNC.-..
O42691_ALTAL/36-202TIMPMGLATA-----------PSVFQ----------RFINS-------VL--------------------NPYLG..-..
O44316_DROMR/394-650RGVKQGDPLS-----------PVLFN----------LIIDR-------LL--------------------RSLPKDI-G.
O52231_STREE/68-275VGTPQGGNLS-----------PLLSN----------IMLNE-------LD--------------------KELEKR.-..
O62658_CANFA/517-773SGTRQGCPLS-----------PLLFN----------IVVEV-------LA--------------------SAIRQQK-DF
O64612_ARATH/788-1031NGLRQGCSLS-----------PYLFV----------ICMNV-------LS--------------------AMLDKGA-VE
O65244_ARATH/405-664RELRQGCSLS-----------PYLFV----------ISMDV-------LS--------------------KMLDKAV-GA
O65598_ARATH/489-747KGLRQGDPLS-----------PYLFV----------LAMEV-------FS--------------------KLLNSRF-DS
O81284_ARATH/58-317KGIRQGDPMS-----------SHLFV----------LVMDI-------LA--------------------RSLDLGA-VE
O81454_ARATH/144-304LVMPFGLTNA-----------PSTFM----------RLMNQ-------VL--------------------RSFIG..-..
O93520_ORYLA/518-771RGTRQGCNMS-----------ALLFA----------LYIEP-------LG--------------------QWIRQRA-DI
O96546_LYMDI/526-780AGVPQGSVLS-----------PFLFT----------LYTSD-------MP--------------------KFNRV..-..
O99969_PORPU/100-315SGTPQGGTIS-----------PLLAN----------IALHG-------IE--------------------KLVSKR.-..
POL_RSVP/769-938KVLPQGMTCS-----------PTICQ----------LVVGQ-------VL--------------------EPLRLKH-..
POL_HTL1A/633-804KVLPQGFKNS-----------PTLFE----------MQLAH-------IL--------------------QPIRQAF-..
POL_SMRVH/71-240KVLPQGMANS-----------PTLCQ----------KFVAA-------AI--------------------APVRSQW-..
POL_MMTVB/68-237KVLPQGMKNS-----------PTLCQ----------KFVDK-------AI--------------------LTVRDKY-..
POL_CAMVC/289-452NVVPFGLKQA-----------PSIFQ----------RHMDE-------AF--------------------RVFRK..-..
POL_IPHA/60-229KVLPQGMANS-----------PTICQ----------LYVQE-------AL--------------------EPIRKQF-..
POL_HV1MA/655-826NVLPQGWKGS-----------PAIFQ----------SSMTK-------IL--------------------EPFRTKN-..
TF21_SCHPO/455-615LVMPYGISTA-----------PAHFQ----------YFINT-------IL--------------------GEAKE..-..
POK10_HUMAN/76-245KVLPQGMLNS-----------PTICQ----------TFVGR-------AL--------------------QPVREKF-..
POL4_DROME/357-523TRLPFGLKIA-----------PNSFQ----------RMMTI-------AF--------------------SGIEP..-..
POLY_DROME/224-390CRLPFGLRNA-----------SSIFQ----------RALDD-------VL--------------------REQIG..-..
POL_EIAV9/249-419NCLPQGFVLS-----------PYIYQ----------KTLQE-------IL--------------------QPFRERY-..
YTX2_XENLA/513-765RGVRQGCPLS-----------GQLYS----------LAIEP-------FL--------------------CLLRKRL-TG
POL_SOCMV/246-411NVLSFGLKQA-----------PSIYQ----------RFMDQ-------SL--------------------KGLEH..-..
Y2R2_DROME/498-741RGCPQGSISG-----------PFIWD----------ILMDV-------LL--------------------QRLQPY.-..
POL_BIV29/638-806NVLPQGWVCS-----------PAIYQ----------TTTQK-------II--------------------ENIKKSH-..
RDPO_ACUOB/124-343TGVPQGGIIS-----------PLIMN----------LTLDG-------LE--------------------FHIYKKI-Q.
POL2_DROME/249-414LRMPFGLRNA-----------PATFQ----------RCMNN-------IL--------------------RPLLN..-..
RT67_ECOLX/48-262GTLPQGSPCS-----------PIISN----------LICNI-------MD--------------------MRLAKLA-..
RTJK_DROME/502-757AGVPQGSVLG-----------PTLYS----------VFASD-------MP--------------------THTPVTE-..
POL_BLVAU/41-212RVLPQGFINS-----------PALFE----------RALQE-------PL--------------------RQVSAAF-..
POL_RTBVP/1228-1390NVCPFGIANA-----------PCAFQ----------RFMQE-------SF--------------------GDLK...-..
POL_CAEVC/210-380KVLPQGWKLS-----------PSVYQ----------FTMQE-------IL--------------------EDWIQQH-..
P91581_CIOIN/483-644KRLPFGVTNG-----------VSAFQ----------RIINR-------FI--------------------QDNHL..-..
P95451_PSEAC/119-326EGTPQGGPLS-----------PLLSN----------ILLDE-------LD--------------------RELERR.-..
Q01379_NEUCS/505-761AGVPQGSPLS-----------PILFI----------LFITP-------LY--------------------RKLATIP-..
Q03261_SIV/246-416TVLPQGWKGS-----------PTIFQ----------STINQ-------IL--------------------QPFRKKY-..
Q04135_DROME/496-743AGVPQGSVLG-----------PILYT----------LYTAD-------FP--------------------IDYNL..-..
Q07995_CHITU/509-760FGVPQGAVLS-----------PTLYN----------IFTYD-------VV--------------------RETTN..-..
Q08724_9CYAN/108-336EGTPQGGVIS-----------PLLAN----------IALHG-------LE--------------------KLVKEFA-AS
YRD6_CAEEL/484-644LRMTFGLKPA-----------PASFQ----------KIMDK-------MV--------------------SGLT...-..
Q17329_CAEEL/1071-1231NVLPFGLVIS-----------PALFQ----------GTMEE-------II--------------------GDLLG..-..
Q24262_DROME/531-692NKAPFGFKNS-----------PAAFI----------RFVQF-------IF--------------------QELINS.-..
Q24690_DROTE/495-742NGIPLGSPIS-----------VILFL----------IAFNK-------LS--------------------NIISLYK-..
Q26816_9TRYP/545-793RGVPQGIVLG-----------PIMFI----------IVMNS-------LS--------------------QRLAEVP-..
Q46666_ECOLX/34-241LILSVGAPSS-----------PVISN----------FCMYE-------FD--------------------NRIHAAC-..
Q83013_9RETR/68-238TVLPQGMKNS-----------PYICQ----------QVVAE-------VI--------------------RPIRERF-..
Q88285_9RETR/848-1015TRLPQGFHAS-----------PGIFH----------QALYN-------GL--------------------ASCKTAI-..
POL_CSVMV/250-413KVLPFGYHNS-----------PSIFQ----------QFMDR-------IF--------------------RPYYD..-..
Q93137_BOMMO/515-771AGVPQGSVLS-----------PLLFS----------LFVND-------IP--------------------RSPPT..-..
Q93139_BOMMO/469-719KGCVQGSIGG-----------PILWN----------LLLDP-------LI--------------------HQLQAR.-..
Q94885_DROME/759-920LRMPFGLKNA-----------PSVFQ----------RFVNK-------IF--------------------ADMIRE.-..
YG31B_YEAST/639-797TVMPFGLVNA-----------PSTFA----------RYMAD-------TF--------------------RDLR...-..
Q9YGS2_TAKRU/573-830HGVPQGSVLG-----------PILFT----------LYMLP-------LG--------------------NIIRQH.-..
Q9YW31_MSEPV/161-406KGIKQGCAVS-----------LSLFN----------IYIDH-------IM--------------------NEWKQHN-IK
Q9ZNW4_SORBI/922-1081TRMPEGLKNA-----------GATFS----------RMMGK-------VL--------------------GSQLQ..-..
Q9ZQ67_ARATH/542-701KVMPFGLKNV-----------GARYQ----------RLVNQ-------MF--------------------APQLG..-..
Q9ZQQ6_ARATH/659-918RGLRQGCALS-----------PYLFV----------ICMNV-------LS--------------------HMIDVAA-VH
Q9ZS84_SOLLC/655-815LVMPFGLTNA-----------PATFC----------NLMNN-------VL--------------------FDYLD..-..
Q9ZVK4_ARATH/510-669VVMPFGLTNA-----------PAAFM----------RLMNS-------VF--------------------QEVLD..-..

PF05919

Q6EH16_9VIRU/1-501VGQPMGAYSS-----------FAMLA----------LTHHV-------LV--------------------QVAAQKA---
Q5TMB5_9VIRU/174-658CGQPIGAYSS-----------WATFT----------LCHHM-------IV--------------------QMLCHRY---
Q18L80_9VIRU/166-639VGQPMGALSS-----------WGMLA----------LTHHL-------VV--------------------QYSAYLA---
Q9WJ23_9VIRU/164-642VGQPMGAYSS-----------WAAFT----------LTHHL-------VV--------------------FYSARMA---
RDRP_CPMV1/246-745VGQPMGAYSS-----------FAMLA----------LTHHV-------IV--------------------QVAALNS---
Q9ZXZ7_THACU/214-754VGQPMGALSS-----------WPGLA----------LTHHW-------IV--------------------QVAAFRV---
Q9WJ22_9VIRU/155-622VGQPMGAYTS-----------WAAFT----------LTHHL-------VV--------------------HWAAELA---
Q6EH19_9VIRU/208-686AGQPLGAKSS-----------WAIFT----------LCHHL-------VV--------------------HIAAVRT---
Q9WJ24_9VIRU/163-645CGQPMGAQSS-----------WPMFT----------LAHHV-------IV--------------------RVAANRC---
Q6GYC2_9VIRU/156-638VGQPMGAYSS-----------WPAFT----------LSHHL-------VV--------------------HWCAHLC---
Q18L78_9VIRU/174-654VGQPMGALSS-----------WGMLA----------LTHHT-------IV--------------------QVAASRA---
Q18L79_9VIRU/168-671AGQPMGAYSS-----------WAMLA----------LTHHF-------IV--------------------QYCAFKV---
Q3S3F3_9VIRU/120-606VGQPMGAYSS-----------WAAFT----------LSHHL-------VV--------------------AWCTYKS---
O92614_9VIRU/173-711VGQPMGALSS-----------WAMLA----------LSHHV-------IV--------------------QIAAMRV---

PF07727

Q7G640_ORYSJ/781-1029KRSLYGLKQS-----------PRQWY----------KRFDS-------FM--------------------LSHGFKR-SE
Q7XLN3_ORYSJ/465-703KKSLYGLKQS-----------DRMWY----------NRLSE-------IL--------------------SLKGYTK-ND
Q7XTU6_ORYSJ/940-1185RKALYGLRQA-----------PRAWN----------AKLDN-------TL--------------------LSLKFNK-SA
Q7XKS1_ORYSJ/160-403RCSLYGLKQA-----------PRAWF----------QRFSS-------VV--------------------LEAGFST-SA
Q9FWI2_ORYSJ/795-1030KKALYGLKQA-----------PRAWY----------SQIDQ-------YF--------------------IQKGFAK-SI
Q94I36_ORYSJ/864-1109SKALYGLKQA-----------PMAWY----------DRLKN-------FL--------------------LAKGFTM-GK
Q7G6C9_ORYSJ/1047-1286HKALYGLKQA-----------PRAWY----------ECLRD-------FL--------------------LKNGFEI-GK
Q94LQ7_ORYSJ/550-793DKALYGLKQA-----------PRAWY----------SRLST-------KL--------------------HELGFKS-SK
Q7XKG6_ORYSJ/514-759KKSLYGLKQS-----------PRAWF----------DRFRR-------AM--------------------CGMGYKQ-CN
Q7X5X4_ORYSJ/138-383KHALYSLRQA-----------PRMWN----------AKLDG-------TL--------------------RCLGFKR-SD
Q84M55_ORYSJ/910-1155KKSLYGLKQS-----------PRAWF----------DRFRH-------AV--------------------CDMGYSQ-CN
Q7Y173_ORYSJ/398-645KKSIYELKQA-----------SRQWY----------LKFDE-------II--------------------KRFGFKE-NE
Q8W5F4_ORYSJ/472-717LKSLYGLKQA-----------PKQWH----------EKFDK-------TL--------------------TSAGFAV-NE
Q7XUD9_ORYSJ/916-1161DKALYGLRQA-----------PRAWN----------SKLEA-------TL--------------------LSLGFRR-ND
Q8LNW7_ORYSJ/880-1128KKSLYGLKQS-----------PRQWY----------KRFDS-------FM--------------------LSQKFRR-SN
Q94HQ0_ORYSJ/485-718HKALYGLRQA-----------PRAWN----------AKLDS-------TL--------------------KGMGFEQ-SP
Q7Y1I1_ORYSJ/727-972DKALYGLRQA-----------PRVWN----------AKLDT-------SL--------------------TSLGFRR-CD
Q94GR9_ORYSJ/975-1220SKALYGLKQA-----------PRAWY----------ERLKD-------FL--------------------LSKDFKI-GK
Q7X7N0_ORYSJ/758-1003QRSLYGLKQA-----------PRAWY----------QRFAT-------YI--------------------RQLGFTP-SA
Q7XZY2_ORYSJ/297-542QKTLYGLKQA-----------PRAWN----------AKLDE-------SL--------------------VSLGFRR-SV
Q7XN62_ORYSJ/915-1162KRSIYGLKQA-----------SRQWY----------LKFDG-------TI--------------------KKFGFQE-NV
Q7XLI2_ORYSJ/53-298NKSLYGLKQA-----------PRAWY----------SRFAS-------FL--------------------LTLGFVE-AK
B5RTA2_DEBHA/1170-1414NKSVYGMKQA-----------GYMWY----------QCITK-------VL--------------------MDLNFEP-DT
B5RTR8_DEBHA/1021-1254NKSLYGLKQA-----------PICWN----------TTISD-------FL--------------------AEHRFNR-ID
E7KRB3_YEASL/146-383YGGMYGLKQA-----------PLLWN----------EHINN-------TL--------------------KKIGFCR-HE
Q2R072_ORYSJ/915-1159DKALYGLRQA-----------PRAWN----------TKLDC-------TL--------------------KKLGFKQ-SP
Q59K02_CANAL/999-1236NRSLYGLKQS-----------PLMWN----------IKLND-------VL--------------------IKEGFRR-LG
Q5AG24_CANAL/888-1133HKSVYGLRQS-----------AHNWY----------SHFKN-------VL--------------------EANGLKQ-TL
Q5AH82_CANAL/122-366KRSVYGLKQS-----------GFEWY----------HTIKR-------VL--------------------EDIGFNQ-VL
Q7XN23_ORYSJ/31-274DKALYGLKQA-----------TRAWY----------SRLSK-------KL--------------------VELGFEA-SK
Q8S476_MAIZE/836-1081IKSLYGLKQA-----------PKQWH----------EKFDN-------TL--------------------TAAGFVV-NE
Q8S479_MAIZE/1073-1313SKALYGLMQA-----------PRAWY----------ECLRN-------FL--------------------IANAFKV-GK

PF00680

POLG_HAVHM/1750-2215SKIFGKSPVFF.................CQAL--KILC.YGDDVLI---VFSRDVQIDNLDLIGQK--IVD.........
RDRP_BPPH6/19-638LDHTAPHLNSRIKDMPSACRFLDSYWQGHEEI--RQIS.KSDDAIL---GWTKGRALVGGHRLFEM--LKEGKVNPSPYM
POLG_PYFV1/2270-2778IMLARFNGRQDISH..........PCNFPKYV--RACV.YGDDNIV---AIKMEVLPW...YNLQT--VSE.........
POL1_CPMVS/1186-1687KKLMREQQAPELMV...........QSFDKLI--GLVT.YGDDNLI---SVNAVVTPY...FDGKK--LKQ.........
POLG_RHDVF/1279-1750YKSCAEIGLHCS..............NLYEDA--PFYT.YGDDGVY---AMTPMMVSL.....LPA--IIE.........
POLG_PVYN/2293-2763IKECVEFEEID..................STC--VFFV.NGDDLLI---AVNPEKESI.....LDR--MSQ.........
POLG_EMCVR/1844-2288YLTYKNFEFDD....................V--KVLS.YGDDLLV---ATNYQLDFD.......K--VRA.........
POLG_FCVUR/1266-1735LQSLEARGVPVTW.............NLFSTF--DMMT.YGDDGVY---MFPMMFASV.....SDQ--IFA.........
POLG_NVN68/1301-1766SEATGLSPDVV..................QSM--SYFSFYGDDEIV---STDIDFDPA.......R--LTQ.........
Q9DLK1_FMDVP/1865-2314RRHYEGVELDT....................Y--TMIS.YGDDIVV---ASDYDLDFE.......A--LKP.........
POLG_VESVA/1379-1848VKALEDSGVRVTW.............NIFDSM--DLFT.YGDDGVY---IVPPLISSV.....MPK--VFA.........
POL1_BAYMY/1634-2098IHKTGDRELAL................LNERF--IFVC.NGDDNKF---AISPQFDEE....FGHD--FSP.........

PF02123

Q83093_9VIRU/437-816APW........-------------------CI--AM..-.GDDSVE---GYVEG..............ARE---------
Q66150_9VIRU/22-408SPW........-------------------CI--AM..-.GDDSVE---GWVND..............APR---------
Q86519_9VIRU/516-902SPW........-------------------CI--AM..-.GDDSVE---GWIEG..............GQS---------
RDRP_SCPMV/464-849SPW........-------------------CI--AM..-.GDDSVE---GFVEG..............ARE---------
RDRP_SBMVA/490-847SPW........-------------------CI--AM..-.GDDSVE---GWVDG..............AKD---------
RDRP_PEMVW/733-1124ASW........-------------------AV--TM..-.GDDALE---SVGS...............DLS---------
RDRP_PLRVW/609-1004ADW........-------------------AM--AM..-.GDDALE---APNS...............DLE---------
RDRP_TYYVF/580-974AIW........-------------------AM--AM..-.GDDALE---SNPA...............DLA---------
Q65969_9LUTE/603-996AEW........-------------------AM--AM..-.GDDALE---SACS...............NLE---------
RDRP_ROTGI/108-803DFAKTDIPDLE-------------------IS--HLRV-DGDDNVV---SINTSCTIDRLQRI.....IKE---------
RDRP_ROTHC/109-749GKLMTDYTFDV-------------------KM--IR.V-DGDDNYA---IVRFPIAITEKLLSEFTSKLRS---------
O55590_9REOV/104-749SRLANKYAFKT-------------------KI--IR.V-DGDDNYA---VLQFNSKITPELVIQVSDFIRD---------
RDRP_ROTPY/100-748SRIANKYSFIT-------------------KI--IR.V-DGDDNYA---VLQFNTDVTKQMVQEVSNDVRY---------
Q90153_9VIRU/1025-1530RSMAHKYVDPG-------------------VV--ERLC-HGDDIIT---VHRSLPGAML.........WND---------
Q90193_9VIRU/400-785QQLHEFFGMSS-------------------SY--QFDT-GGDDGCA---DEKDLVTAYS.........LLR---------
RDRP_PCVC/362-832QNVERLFGVRV-------------------VL--YVDH-GGDDIDL---GLSEPAVMPW.........FLE---------
RDRP_SCVLB/837-1303INS....LVPT-------------------SL--HN..-.GDDVFA---GIRTIADGIS.........LIK---------
Q87025_SCVLA/177-657VFD..LDDVQD-------------------SV--HN..-.GDDVMI---SLNRVSTAVR.........IMD---------
Q90155_TTV1/96-539LKF......DS-------------------FM--CA..-.GDDVIL---MSQEPI.............SLA---------
Q9JE94_9VIRU/129-560VAN........-------------------AF--HT..-.GDDVLL---CGKAD..............YAT---------
Q8V615_9VIRU/41-473DTT........-------------------SF--HC..-.GDDVLL---CGKYD..............YQT---------
Q83073_9VIRU/49-523LHT..DF....-------------------SY--HV..-.GDDVIF---STGCAEAAR..........LYD---------
RDRP_LRVLG/155-619GHV......PT-------------------SM--HV..-.GDDILM---SCTLGHADN..........LIA---------
Q98XW8_9VIRU/144-622GRV..AYDTYK-------------------PF--HV..-.GDDVLI---LLDSPADAWN.........VVK---------
Q99AT3_9VIRU/99-573GED..LFERSV-------------------AL--HV..-.GDDVYF---GVRTYAEAGE.........VVT---------
Q9YXE4_9VIRU/99-573ASW...LAERP-------------------SI--HV..-.GDDVYL---GVRTYRDAAY.........VLD---------
RDRP_HV19S/122-585IPA...FKRMI-------------------SL--HA..-.GDDVYL---RLPTLADCAT.........TLN---------
Q9YXE6_9VIRU/120-589GPA...FDKLT-------------------SL--HT..-.GDDVYI---RADTLTSCEW.........ILD---------

PF04197

RDRP_IBDVU/1-875VENKSLKSKVG----------------IEQAY--KVVRYEALRLVG---GWNYPLLNKACKNNASA--ARR---------
RDRP_IPNVJ/1-842LENKALARKPG----------------AEIAY--QIVRYEAIRLVG---GWNNPLLETAAKHMSLD--KRK---------
RDRP_BSNV/1-863LENKDLKGKPG----------------AEIAY--KIVRNEALLMVG---GWNYPLIARSLMANTSA--ARN---------

PF00978

R1AB_LIYV9/1925-2366.D..ID...---------------------DI--DLLLVSGDDSLI...FSRKH..LPNKTQ--EINKNFG---------
R1AB_BYVU/2601-3046.Y..TN...---------------------RF--KALFVSGDDSLI...FSESP..IRNSAD--AMCTELG---------
Q9YPH5_9VIRU/1359-1796.P..LE...---------------------KL--RPMISGGDDSLF...FFKKGITIEDPCR--RLSSLWN---------
POLN_EEVVM/2041-2488.RERLT...---------------------NS--PCAAFIGDDNIV...KGVKS..DKLMAD--RCATWLN---------
E0YCR0_9CLOS/53-491.R..GL...---------------------DY--SYIVVSGDDSLI...FSRQP..LDIDTS--VLSDNFG---------
RDRP_TOMS1/1168-1609.P..ME...---------------------KL--IKGAFCGDDSLL...YFPKGCEYPDIQQ--AANLMWN---------
RDRP_PSVJ/295-726.D..TD...---------------------QF--DRMLFSGDDSLA...FSLNP..IEGKSD--WFTSLFN---------
Q66107_9BROM/228-662.D..LCD.P---------------------KI--TFVIASGDDSLI...GSVEE.LPRAPEH--LFTSLFN---------
Q87644_SINDV/2053-2501....LK...---------------------TS--RCAAFIGDDNIIHGVVSDKE.....MAE--RCATWLN---------
O56790_9VIRU/1323-1760.P..LE...---------------------RA--KFMVFGGDDSLV...FFPKNMNLADPCG--RLASLWN---------
RDRP_CMVFN/308-738.D..TD...---------------------QF--EKLLFSGDDSLG...FSLLP..PVGDPS--KFTTLFN---------
Q9WJD8_PEBV/1299-1738.P..LE...---------------------KC--VLMTYGGDDSLI...VFPKGLKLVDPCE--KLATKWN---------
Q80875_BSMV/195-630.P..LE...---------------------DA--HFCVFGGDDSLI...LFDQGYIISDPCQ--LAGT.WN---------
RDRP_RBDVR/1234-1674.S..DPDRE---------------------KI--RYMLVGGDDSLI...CSYGP..IQVPLE--PLGDIFN---------
RDRP_SBWMN/1373-1810.P..LE...---------------------KA--KFMIFGGDDSLI...LFPKHLTIEDPCR--RLASLWN---------
POLN_ONNVI/2053-2501.EERLT...---------------------TS--ACAAFIGDDNII...HGVVS..DALMAA--RCATWMN---------
RDRP_TAV/313-742.D..TS...---------------------QF--DKLIFSGDDSLG...FSIKA..PVGDPS--LFTSLFN---------
POLN_MIDDV/534-981.EERLT...---------------------NS--KCAAFIGDDNIV...HGVKS..DKLLAE--RCAAWMN---------
RDRP_TMGMV/1163-1604.P..ME...---------------------KV--IKGAFCGDDSVL...YFPKGLDFPDIQS--CANLMWN---------
RDRP_TOBSV/253-689.D..LSN.P---------------------NI--LFVAASGDDSLI...GSIEP.LPREKED--LCVSLFN---------
RDRP_OLV2I/310-732.E..LD..S---------------------LP--FCGLFSGDDNLI...VTDRP..LEGRVS--LFPNMFN---------
RDRP_YOMV/1155-1594.P..MD...---------------------KV--IKAAFCGDDSLI...YIPKGLDLPDIQA--GANLTWN---------
RDRP_AMVLE/318-752.D..LMD.P---------------------NV--KFVVASGDDSLI...GTVEE.LPRDQEF--LFTTLFN---------
POLN_RRVN/2019-2467....LT...---------------------NS--ICAAFIGDDNIV...HGVRS..DPLMAE--RCASWVN---------
RDRP_ASPVP/1758-2169.D..LN...---------------------GR--EAICFAGDDMCA...NSRLK..VTNRFS--NFLDKIK---------
O56250_9VIRU/1240-1678.P..LE...---------------------KA--VMVTYGGDDSLI...AFPRGTQFVDPCP--KLATKWN---------
O90699_9VIRU/1363-1800.P..LE...---------------------KA--RFMIFGGDDSLI...FFPKRMAIPDPCR--RLAAVWN---------
Q9Q6Q3_9CLOS/62-509.K..GF...---------------------EP--DLVVVCGDDSLI...FSKNE..LVINDR--ILEESFG---------
POLN_AURAV/2038-2486.E..QRL.R---------------------DS--KCAAFIGDDNII...HGVVS..DKIMAD--RCATWMN---------
RDRP_BBMV/271-697.D..MS...---------------------TA--ELAMFSGDDSLV...ICGSK..PEFDPG--VFQSLFN---------
RDRP_CCMV/267-697.D..MN...---------------------TV--DCAIFSGDDSLL...ICKSK..PHLDAN--VFQSLFN---------
Q66581_EEEV/144-598ER..LT...---------------------TS--PCAAFIGDDNIV...KGVTS..DALMAE--RCATWLN---------
Q9QGG9_9BROM/363-797.D..LLD.P---------------------NI--TFVIASGDDSLI...GSRVP.LDRDDEF--KFTTLFN---------
RDRP_TMOB/1167-1614.P..ME...---------------------KV--IKAAFCGDDSLV...YLPKGCELPNIQS--CANLMWN---------
RDRP_BMV/256-688.D..LS...---------------------DC--DCAIFSGDDSLI...ISKVK..PVLDTD--MFTSLFN---------
O40960_9CLOS/62-506.D..LD...---------------------DI--DLIIVSGDDSLI...ISRKE..IENKCL--EINNDFG---------

PF00998

RDRP_TNVA/224-703----KEHLN..-------------------IN--LSLANNGDDCVI---VCEKADLKKLTS...SIEPYFK---------
RDRP_TCV/272-752----MKG....-------------------IK--CKLINNGDDCVL---FFEADEVDRVRE...RLHH.WI---------
RDRP_TNVD/224-709----CDNIKHI-------------------KH--FRLANNGDDCML---VVERSDEKKVRN...GLIEYYA---------
RDRP_MCMVK/460-941----VTKLG..-------------------IP--ARLINNGDDNVL---ICPAVEVGRVRQ...ELYRHWL---------
POLG_HCVEU/2430-2941----CRAAN.I-------------------KD--CDMLVCGDDLVV---ICESAGVQEDTASLRAFTDAMT---------
POLG_HCVED/2420-2931----IRAAA.L-------------------RD--CTMLVCGDDLVV---IAESDGVEEDNRALRAFTEAMT---------
POLG_HCVJL/2434-2945----CKAAG.L-------------------KN--FDMLVCGDDLVV---ISESLGVSEDASALRAFTDAMT---------
POLG_HCVJK/2431-2942----TKAAG.I-------------------KD--PSFLVCGDDLVV---IAESAGIDEDKSALRAFTEAMT---------
POLG_HCVEV/2426-2937----CRAAK.L-------------------RD--CTLLVCGDDLVA---ICESQGTHEDEASLRAFTEAMT---------
POLG_HCVJ6/2445-2956----CKAAG.I-------------------IA--PTMLVCGDDLVV---ISESQGTEEDERNLRAFTEAMT---------
Q9IR83_9TOMB/236-712----LKG....-------------------IR--CRLINNGDDCVL---FFNTPDLAAVTE...RLAH.WL---------
Q87031_9LUTE/24-502----FKTLG..-------------------VK--AELCNNGDDCVI---ICERKD.ENKFQ...HMHSWFK---------
RDRP_POLVP/251-722----CKDIG..-------------------ID--ASLANCGDDCVL---YLEKEDLPKLK....ALPDWFG---------
Q65987_9TOMB/269-750----MKG....-------------------IK--SRLINNGDDCVV---FFESGDMHEVRE...RLCR.WI---------
P90338_9TOMB/1-480----CRG....-------------------LD--ARLINNGDDCVL---ICETRDVGRVVD...KLTTAWL---------
RDRP_BYDV1/361-840----FKKLG..-------------------VE--AELCNNGDDCVI---ITDRAN.EKLFD...GMYDHFL---------
O09796_9HEPC/2422-2933----CRAAK.L-------------------QD--CTMLVNGDDLVV---ICESAGTQEDAASLRVFTEAMT---------
O09803_9FLAV/2373-2866----CERVG.L-------------------KN--VSLLIAGDDCLI---ICERPMCDPSD....ALGRALA---------
O37361_9VIRU/252-737----CEELK.G-------------------IH--IEVANDGDDQVL---MVETNQLDNLIK...ELSPTFA---------
Q9WJD9_CARMV/267-744----MK.....-------------------IR--SRLINNGDDCVL---ICERTDIDYVVS...NLTTGWS---------
Q83103_9TOMB/228-711----CTRLN.L-------------------KH--FRLANNGDDCMV---FMERHNEESFRR...GLIDYYT---------
Q66127_9VIRU/52-520----CLDLS..-------------------IP--HELMDNGDDCIV---IFEKEHLQRFNA...AVKPYFA---------
RDRP_PMVK/447-937----VDSLG..-------------------VD--AQLVNNGDDNVL---ICSVDDEEVVVK...ALYDHWM---------
POLG_GBVB/2277-2785----AEQAG.M-------------------KN--PRFLICGDDCTV---IWKSAGADADKQAMRVFASWMK---------
Q89801_9TOMB/1-479----MK..G..-------------------IK--YRLLNNGDDCVV---ITESKNVDFVCK...QLER.FR---------
Q9IRA1_9TOMB/266-741----CRG....-------------------IR--CRLINNGDDCVL---FFESSDLTLVNE...RLTK.WS---------
O12301_9TOMB/231-708----LVTHD..-------------------ID--AELLNNGDDCVL---ICERSEEAHLLE...VIPQYFR---------
Q83424_MNSV/290-772----FRSRG..-------------------IR--ARLMNNGDDCVV---ICEKECAAVVKA...DMVRHWR---------
O41892_9FLAV/2409-2899----XXRAG.V-------------------KE--PTFXIAGDDCLI---IYENDGTDPCA....RLKAALA---------
RDRP_OCSVU/235-734----GLHKS..-------------------VN--IQLANNGDDCVV---FLEQSDLATFSE...GLFEWFL---------
Q9IW60_9TOMB/325-800----MRHLG.I-------------------NE--FSLANCGDDCVL---IVERRNLKQVQR...TLPEYFL---------
Q96898_9FLAV/2396-2886----CRRVG.I-------------------KA--PSFFIAGDDCLI---IYENDGTDPCP....ALKAALA---------
RDRP_RCNMV/260-745----LKETG..-------------------VR--ASLANNGDDCVL---FCEKGDYEQINR...NLEQWFL---------

PF00972

POLG_YEFV1/2758-3406----LTEHGCD-------------------RL--KRMAVSGDDCVV----------RPIDDRFGLALSHLN---------

PF00078

A0A016RNU0_KLEPN/135-366...RRY...AT-------------------GN--VVMVRYADDIVI---GFDK.RYD--------......---------
A0A025GH98_ECO57/115-332.RTVKGR.LVN-------------------PK--VNYVRYADDFII---TGES.KEL--------......---------
D7ZFU1_ECOLX/62-269....Q.....R-------------------KG--LVYTRLVDDITV---SSKISNYD--------......---------
F6BM08_SINMB/72-291..........H-------------------PD--LPWCRYADDGLV---HCQS.EQQ--------......---------
M7UYJ9_ECOLX/33-239....K.....E-------------------NK--ISYSRYADDLTF---STNE.RDV--------......---------
O01419_BOMMO/502-756...........-------------------.G--VQVICYADDTLV---TARGDDYR--------SA....---------
O18558_AEDAE/472-725...........-------------------.G--FPTYGFADEYLA---LIVG.MCI--------STL...---------
O42691_ALTAL/36-202...........-------------------..--IFCHAYLDDVVI---FTKGSLDQ--------......---------
O44316_DROMR/394-650...VHV...GN-------------------AK--VNACAFADDLML---FAST.PKG--------......---------
O52231_STREE/68-275...........-------------------.G--LRFVRYADDCVI---TVGS.EAA--------......---------
O62658_CANFA/517-773..RGIQ..FGK-------------------EE--VKLSLFADEMIL---YIEN.PKV--------......---------
O64612_ARATH/788-1031KRFGYHPRCRN-------------------MG--LTHLCFADDIMV---FSAGSAHS--------......---------
O65244_ARATH/405-664RQFGYHPKCRA-------------------IG--LTHLSFADDLMI---LSDG.KVR--------......---------
O65598_ARATH/489-747GYIRYHPKASD-------------------LS--ISHLMFADDVMI---FFDG.GSS--------......---------
O81284_ARATH/58-317GRFVLHPKCLA-------------------PM--ITHLSFADDILV---FCDGSLSS--------......---------
O81454_ARATH/144-304...........-------------------..--KFVVVYFDDILI---YNKS.YSD--------......---------
O93520_ORYLA/518-771..KGVK..VSG-------------------KE--QKLSLFADDLLL---TISQ.PTK--------......---------
O96546_LYMDI/526-780...........-------------------..--.HKALYADDTAL---FCAG.RSP--------TTV...---------
O99969_PORPU/100-315...........-------------------.G--VYLIRYADDFLV---LCNE.EKE--------......---------
POL_RSVP/769-938...........-------------------PS--LCMLHYMDDLLL---AASS.HDG--------......---------
POL_HTL1A/633-804...........-------------------PQ--CTILQYMDDILL---ASPS.HED--------......---------
POL_SMRVH/71-240...........-------------------PE--AYILHYMDDILL---ACDS.AEA--------......---------
POL_MMTVB/68-237...........-------------------QD--SYIVHYMDDILL---AHPS.RSI--------......---------
POL_CAMVC/289-452...........-------------------..--.FCCVYVDDILV---FSNN.EED--------......---------
POL_IPHA/60-229...........-------------------TS--LIVIHYMDDILI---CHKE.LDV--------......---------
POL_HV1MA/655-826...........-------------------PE--IVIYQYMDDLYV---GSDLEIGQ--------......---------
TF21_SCHPO/455-615...........-------------------..--SHVVCYMDDILI---HSKS.ESE--------......---------
POK10_HUMAN/76-245...........-------------------SD--CYIIHYIDDILC---AAET.KDK--------......---------
POL4_DROME/357-523...........-------------------..--SQAFLYMDDLIV---IGCS.EKH--------......---------
POLY_DROME/224-390...........-------------------..--KICYVYVDDVII---FSEN.ESD--------......---------
POL_EIAV9/249-419...........-------------------PE--VQLYQYMDDLFV---GSNGSKKQ--------......---------
YTX2_XENLA/513-765..LVLK..EPD-------------------MR--VVLSAYADDVIL---VAQD.LVD--------......---------
POL_SOCMV/246-411...........-------------------..--.ICLAYIDDILI---FTKGSKEQ--------......---------
Y2R2_DROME/498-741...........-------------------..--CQLSAYADDLLL---LVEG.NSR--------AVL...---------
POL_BIV29/638-806...........-------------------PD--VMLYQYMDDLLI---GSNR..DD--------......---------
RDPO_ACUOB/124-343..KSSS...QS-------------------KG--NTYCRYADDMVI---LTTT.EET--------......---------
POL2_DROME/249-414...........-------------------..--KHCLVYLDDIII---FSTS.LTE--------......---------
RT67_ECOLX/48-262....K.....K-------------------YG--CTYSRYADDITI---STNK.NTF--------PLEMAT---------
RTJK_DROME/502-757...VD.....E-------------------ED--VLIATYADDTAV---LTKS.KSI--------LAA...---------
POL_BLVAU/41-212...........-------------------SQ--SLLVSYMDDILY---VSPT.EEQ--------......---------
POL_RTBVP/1228-1390...........-------------------..--.FALLYIDDILI---ASNN.EKE--------......---------
POL_CAEVC/210-380...........-------------------PE--IQFGIYMDDIYI---GSDLEIKK--------......---------
P91581_CIOIN/483-644...........-------------------..--NKVYAYLDDITV---TGET.LEE--------......---------
P95451_PSEAC/119-326...........-------------------.G--HRFVRYADDANI---YVRS.PRA--------......---------
Q01379_NEUCS/505-761...........-------------------.N--TITVGFADDTNV---VAVA.RTT--------EEN...---------
Q03261_SIV/246-416...........-------------------SD--LTLIQYMDDLLI---GTDRSEKA--------......---------
Q04135_DROME/496-743...........-------------------..--.TTSTFADDTAI---LSRS.KCP--------IKA...---------
Q07995_CHITU/509-760...........-------------------..--.NIGLFADDTAL---YHSAENSA--------DI....---------
Q08724_9CYAN/108-336.QRGGKV.KNQ-------------------NS--ISLIRYADDFVI---LAPN.KTQ--------......---------
YRD6_CAEEL/484-644...........-------------------..--.GVAVYWDDIII---SASS.IEE--------......---------
Q17329_CAEEL/1071-1231...........-------------------..--VCAFVYVDDLLI---ASKD.MEQ--------......---------
Q24262_DROME/531-692...........-------------------..--NIMQLYMDDIIV---YAAT.PEE--------......---------
Q24690_DROTE/495-742...........-------------------.E--IKFNAYADDFFL---IINF.KKN--------TN....---------
Q26816_9TRYP/545-793...........-------------------.L--LQHGFFADDLTL---FSRH.TER--------NVI...---------
Q46666_ECOLX/34-241....N.....K-------------------LE--ITYTRYADDLTF---SCNI.PNV--------......---------
Q83013_9RETR/68-238...........-------------------RD--AVIIHYMDDILI---AAAE.ERQ--------......---------
Q88285_9RETR/848-1015....E.....S-------------------QG--CKLLQYVDDILL---MSED.RDH--------......---------
POL_CSVMV/250-413...........-------------------..--.FIIVYIDDILV---FSKT.IEE--------......---------
Q93137_BOMMO/515-771...........-------------------..--.HLALFADDTTV---YYSS.RNK--------SLI...---------
Q93139_BOMMO/469-719...........-------------------.G--EYIQAFADDVVL---VFDG.DSA--------LQI...---------
Q94885_DROME/759-920...........-------------------..--NKVVVYMDDILL---ATEN.INE--------......---------
YG31B_YEAST/639-797...........-------------------..--.FVNVYLDDILI---FSES.PEE--------......---------
Q9YGS2_TAKRU/573-830...........-------------------.G--INFHCYADDTQL---YLSMKPEE--------TEK...---------
Q9YW31_MSEPV/161-406..GIEL..NDN-------------------TN--LNYILYADDLVI---ISTN.KND--------......---------
Q9ZNW4_SORBI/922-1081...........-------------------..--RNIIAYVDDVVV---MSKR.KED--------......---------
Q9ZQ67_ARATH/542-701...........-------------------..--KTMEVYIDDMLV---KSTR.SAD--------......---------
Q9ZQQ6_ARATH/659-918RNIGYHPKCKK-------------------LS--LTHLCFADDLMV---FIDG.QQR--------......---------
Q9ZS84_SOLLC/655-815...........-------------------..--DFVVVYLDDIVI---YSRT.LEE--------......---------
Q9ZVK4_ARATH/510-669...........-------------------..--EFVIIFIDDILV---YSKS.LEE--------......---------

PF05919

Q6EH16_9VIRU/1-501------.GFSD-------------------RF--TDYCILGDDIVI---ANSLVAEAYKSLIFD.LGLEIS---------
Q5TMB5_9VIRU/174-658------...RA-------------------PR--SHYIILGDDIVI---AHDKVAEGYCEIMRA.LSVDIS---------
Q18L80_9VIRU/166-639------FGKVN-------------------LF--KDYIVLGDDIVI---GNHEVSIRYHYLMTEILKVKIN---------
Q9WJ23_9VIRU/164-642------..GIK-------------------DF--TNYILLGDDIVI---NNDKVAKYYIRTMKR.LGVELS---------
RDRP_CPMV1/246-745------.GFTT-------------------RF--TDYCILGDDIVI---AHDTVASEYLKLMET.LGLSIS---------
Q9ZXZ7_THACU/214-754------TNSKS-------------------WN--TEYEILGDDIVI---FNELIAQEYLNIMAV.IGCEIN---------
Q9WJ22_9VIRU/155-622------..GLK-------------------NF--KDYIILGDDIVI---KNNKVAQIYINLMTK.WGVDIS---------
Q6EH19_9VIRU/208-686------....N-------------------SD--PYYVILGDDIVL---RGSRLATVYKRIMSE.LGVSIS---------
Q9WJ24_9VIRU/163-645------..GLS-------------------NF--DKYIILGDDIVI---NNDNVALKYMEIMND.FKVEIS---------
Q6GYC2_9VIRU/156-638------..HIN-------------------KF--KDYIILGDDIVI---HNDKVAKKYIEIMGK.LGVGLS---------
Q18L78_9VIRU/174-654------.GYKD-------------------LF--LDYALLGDDICI---ANKAVADNYLLIMHD.LGVEIN---------
Q18L79_9VIRU/168-671------YHTNS-------------------FF--KDYLILGDDLLL---LDAKVAKQYLQVMNQ.LDVGVN---------
Q3S3F3_9VIRU/120-606------.KKVI-------------------RS--SQYIILGDDIVI---KDNDIARKYIGQMSK.LGVAIS---------
O92614_9VIRU/173-711------..GKL-------------------PF--TNYALLGDDIVI---ADKAVATSYHMIMTQILGVEIN---------

PF07727

Q7G640_ORYSJ/781-1029FDSCVYIKFVN-------------------GSH.IYLLLYVDDMLI---AAKSKEQI----------TTLK---------
Q7XLN3_ORYSJ/465-703DFPCVFIKKSP-------------------TGF.CFISVYVDDLNI---IRNTQD.I----------NEAC---------
Q7XTU6_ORYSJ/940-1185TESAVYVRGVG-------------------DSK.LIVGVYVDDLII---TGSQKKEI----------DAFK---------
Q7XKS1_ORYSJ/160-403HDPALFVHTSP-------------------RGC.TVLLLYVDDMLI---TGEDAEFI----------TFVK---------
Q9FWI2_ORYSJ/795-1030..........S-------------------TDI.LIVSLYVDDLIY---TANSEKMM----------QDFK---------
Q94I36_ORYSJ/864-1109VDKTLFVLKHG-------------------DNQ.LFVQIYVDDIIF---GYSTHALV----------VDFA---------
Q7G6C9_ORYSJ/1047-1286ADTTLFTKKFK-------------------SDL.FICQIYVDDIIF---GSTNASFC----------EEFS---------
Q94LQ7_ORYSJ/550-793SDTSLFFYSKG-------------------DVT.IFMLVYVDDIIV---ASSSIVAT----------NALL---------
Q7XKG6_ORYSJ/514-759GDHTLFYRHRG-------------------KKI.AILAVYVDDIII---TGDDTQEI----------AQLK---------
Q7X5X4_ORYSJ/138-383TEHAVYVRAEG-------------------NTH.LIVGMYVDDLVI---TGSTVECI----------RRFK---------
Q84M55_ORYSJ/910-1155GDHTVFYKHRG-------------------THI.TILAVYVDDIVI---TGDDVEEI----------RCLK---------
Q7Y173_ORYSJ/398-645VDNCIYIKTKG-------------------GKF.IILVLYVDDILL---ASSDINML----------HQTK---------
Q8W5F4_ORYSJ/472-717ADKCVYYRHGG-------------------GEG.VILCLYVDDVLI---FGTNLEVI----------NEVK---------
Q7XUD9_ORYSJ/916-1161CEHAVYVRGNT-------------------SAR.LLVGVYVDDLII---TGTKEDEI----------VRFK---------
Q8LNW7_ORYSJ/880-1128YDSCVYLKVVD-------------------GSA.IYLLLYVDDMLI---AAKDKSEI----------AKLK---------
Q94HQ0_ORYSJ/485-718HEAAIYRRGNG-------------------GNA.LLVGVYVDDLVI---TGTKDAEV----------AAFK---------
Q7Y1I1_ORYSJ/727-972FEHAVYAQGQG-------------------THH.LLVGVYVDDLII---TGSDAVEI----------DRFK---------
Q94GR9_ORYSJ/975-1220VDTTLFTKIIG-------------------DDF.FVCQIYVDDIIF---SSTNEVFC----------KEFG---------
Q7X7N0_ORYSJ/758-1003SDTSLFILRDG-------------------DRL.AYLLLYVDDIIL---MASSAELL----------CHIT---------
Q7XZY2_ORYSJ/297-542TEGAVYTRGRG-------------------DAR.LIVGVYVDDLII---TGAKVGEI----------SKFK---------
Q7XN62_ORYSJ/915-1162EDNCIYSKFKN-------------------GRF.IFLILYVDDILL---ASSDVSLL----------QETK---------
Q7XLI2_ORYSJ/53-298SDTSLFIYRRG-------------------SDT.VYLLLYVDDIVL---TASSDALL----------RWTI---------
B5RTA2_DEBHA/1170-1414AISGMFCKYFG-------------------ENKKLIVALYVDDMFL---TSSNITIL----------NDFK---------
B5RTR8_DEBHA/1021-1254TELGIYVRG..-------------------..N.IIIGLYVDDILI---SGKDMKEI----------EDVK---------
E7KRB3_YEASL/146-383GEHGLYFRSTS-------------------DGP.IYIALYVDDLLV---AAPSPKIY----------DRVK---------
Q2R072_ORYSJ/915-1159LEHGLYARGDG-------------------SGR.LLVGVYVDDLVI---VGGDSGMI----------KGFK---------
Q59K02_CANAL/999-1236GDLGIYISKDK-------------------..R.TIMGVYVDDILI---CGPSDSEI----------EQVK---------
Q5AG24_CANAL/888-1133HNDGIFWKNYE-------------------NGDVLYVSVYVDDVFM---IATNEKII----------KEFV---------
Q5AH82_CANAL/122-366HNDGLFHIEYE-------------------EGSVIYLGLYVDDILM---VGSSQKVI----------DNFV---------
Q7XN23_ORYSJ/31-274ADTSLFFLNKG-------------------GII.MFVLVYVDDIIV---ASSTEKAT----------TALL-