Sequence alignment for CL0027

PF05919

Q6EH16_9VIRU/1-501--------------------------------------------------------------------------------
Q5TMB5_9VIRU/174-658--------------------------------------------------------------------------------
Q18L80_9VIRU/166-639--------------------------------------------------------------------------------
Q9WJ23_9VIRU/164-642--------------------------------------------------------------------------------
RDRP_CPMV1/246-745--------------------------------------------------------------------------------
Q9ZXZ7_THACU/214-754--------------------------------------------------------------------------------
Q9WJ22_9VIRU/155-622--------------------------------------------------------------------------------
Q6EH19_9VIRU/208-686--------------------------------------------------------------------------------
Q9WJ24_9VIRU/163-645--------------------------------------------------------------------------------
Q6GYC2_9VIRU/156-638--------------------------------------------------------------------------------
Q18L78_9VIRU/174-654--------------------------------------------------------------------------------
Q18L79_9VIRU/168-671--------------------------------------------------------------------------------
Q3S3F3_9VIRU/120-606--------------------------------------------------------------------------------
O92614_9VIRU/173-711--------------------------------------------------------------------------------

PF00078

POL_WDSV/812-977--------------------------------------------------------------------------------
POL_RSVP/769-938--------------------------------------------------------------------------------
O01419_BOMMO/502-756--------------------------------------------------------------------------------
O13348_MAGGR/497-764--------------------------------------------------------------------------------
O18558_AEDAE/472-725--------------------------------------------------------------------------------
O22148_ARATH/497-727--------------------------------------------------------------------------------
O22220_ARATH/221-456--------------------------------------------------------------------------------
O23410_ARATH/308-553--------------------------------------------------------------------------------
O41894_9RETR/202-360--------------------------------------------------------------------------------
O42691_ALTAL/36-202--------------------------------------------------------------------------------
O44316_DROMR/394-650--------------------------------------------------------------------------------
O47500_VENIN/326-590--------------------------------------------------------------------------------
O52209_9ZZZZ/135-366--------------------------------------------------------------------------------
O52231_STRPN/68-275--------------------------------------------------------------------------------
O62658_CANFA/517-773--------------------------------------------------------------------------------
O64428_CHLVU/554-816--------------------------------------------------------------------------------
O64612_ARATH/788-1031--------------------------------------------------------------------------------
O65244_ARATH/405-664--------------------------------------------------------------------------------
O65598_ARATH/489-747--------------------------------------------------------------------------------
O69788_RHIML/72-291--------------------------------------------------------------------------------
DPOL_WMHBV/364-590--------------------------------------------------------------------------------
O72700_9VIRU/1279-1449--------------------------------------------------------------------------------
O81068_ARATH/814-1073--------------------------------------------------------------------------------
O81284_ARATH/58-317--------------------------------------------------------------------------------
O81454_ARATH/144-304--------------------------------------------------------------------------------
O81517_ARATH/408-666--------------------------------------------------------------------------------
O81630_ARATH/874-1114--------------------------------------------------------------------------------
O82216_ARATH/238-497--------------------------------------------------------------------------------
O82276_ARATH/356-618--------------------------------------------------------------------------------
O82894_ECO57/115-332--------------------------------------------------------------------------------
O85869_SPHAR/89-369--------------------------------------------------------------------------------
O85879_SPHAR/47-327--------------------------------------------------------------------------------
POL_FFV/202-360--------------------------------------------------------------------------------
O93520_ORYLA/518-771--------------------------------------------------------------------------------
O96546_LYMDI/526-780--------------------------------------------------------------------------------
O96849_DICDI/53-215--------------------------------------------------------------------------------
O99479_PAVLU/111-389--------------------------------------------------------------------------------
O99969_PORPU/100-315--------------------------------------------------------------------------------
O99970_PORPU/100-315--------------------------------------------------------------------------------
DPOL_GSHV/413-636--------------------------------------------------------------------------------
POL_MLVAV/221-393--------------------------------------------------------------------------------
POL_HTL1A/633-804--------------------------------------------------------------------------------
POL_HTLV2/631-802--------------------------------------------------------------------------------
POL_SMRVH/71-240--------------------------------------------------------------------------------
POL_MMTVB/68-237--------------------------------------------------------------------------------
POL_CAMVC/289-452--------------------------------------------------------------------------------
AI1M_YEAST/315-577--------------------------------------------------------------------------------
AI2M_YEAST/348-613--------------------------------------------------------------------------------
POL_SRV1/74-243--------------------------------------------------------------------------------
POL_IPHA/60-229--------------------------------------------------------------------------------
POL_HV1MA/655-826--------------------------------------------------------------------------------
POL_CERV/271-436--------------------------------------------------------------------------------
YMC6_SCHPO/300-566--------------------------------------------------------------------------------
LIN1_NYCCO/516-772--------------------------------------------------------------------------------
POL_FMVD/282-445--------------------------------------------------------------------------------
LTRA_LACLM/90-361--------------------------------------------------------------------------------
POK10_HUMAN/76-245--------------------------------------------------------------------------------
POL_BAEVM/219-391--------------------------------------------------------------------------------
POL4_DROME/357-523--------------------------------------------------------------------------------
POLY_DROME/224-390--------------------------------------------------------------------------------
POL_EIAV9/249-419--------------------------------------------------------------------------------
POL_IPMA/71-240--------------------------------------------------------------------------------
POL2_MOUSE/524-780--------------------------------------------------------------------------------
POL_IPMAI/16-159--------------------------------------------------------------------------------
DPOL_WHV3/416-639--------------------------------------------------------------------------------
DPOL_HBVC3/376-600--------------------------------------------------------------------------------
YTX2_XENLA/513-765--------------------------------------------------------------------------------
RTP2_TRYBG/594-780--------------------------------------------------------------------------------
POL_SOCMV/246-411--------------------------------------------------------------------------------
POLR_DROME/403-660--------------------------------------------------------------------------------
Y2R2_DROME/498-741--------------------------------------------------------------------------------
POL_COYMV/1445-1615--------------------------------------------------------------------------------
POL_BIV29/638-806--------------------------------------------------------------------------------
RDPO_SCEOB/124-343--------------------------------------------------------------------------------
POL2_DROME/249-414--------------------------------------------------------------------------------
RT67_ECOLX/48-262--------------------------------------------------------------------------------
RTJK_DROME/502-757--------------------------------------------------------------------------------
RTJK_DROFU/502-757--------------------------------------------------------------------------------
POL_GALV/218-390--------------------------------------------------------------------------------
POL_SIVGB/659-830--------------------------------------------------------------------------------
RT86_ECOLX/53-248--------------------------------------------------------------------------------
RT65_MYXXA/155-366--------------------------------------------------------------------------------
RT16_MYXXA/186-407--------------------------------------------------------------------------------
POL_SFV1/205-363--------------------------------------------------------------------------------
POL_BLVAU/41-212--------------------------------------------------------------------------------
POL_RTBVP/1228-1390--------------------------------------------------------------------------------
POL_SIVV1/677-848--------------------------------------------------------------------------------
DPOL_HPBDC/394-564--------------------------------------------------------------------------------
POL_JSRV/74-243--------------------------------------------------------------------------------
POL_FIVT2/218-388--------------------------------------------------------------------------------
POL_CAEVC/210-380--------------------------------------------------------------------------------
YMF40_MARPO/68-333--------------------------------------------------------------------------------
P71276_ECOLX/62-269--------------------------------------------------------------------------------
P91581_CIOIN/483-644--------------------------------------------------------------------------------
P95451_PSEAC/119-326--------------------------------------------------------------------------------
Q01379_NEUCS/505-761--------------------------------------------------------------------------------
Q02717_PODAN/248-528--------------------------------------------------------------------------------
Q02718_PODAN/260-530--------------------------------------------------------------------------------
POL_SIVG1/672-843--------------------------------------------------------------------------------
Q03261_SIV/246-416--------------------------------------------------------------------------------
Q04135_DROME/496-743--------------------------------------------------------------------------------
RTF21_SCHPO/455-615--------------------------------------------------------------------------------
Q05804_ECOLX/44-235--------------------------------------------------------------------------------
Q07995_9DIPT/509-760--------------------------------------------------------------------------------
Q08525_CHICK/555-775--------------------------------------------------------------------------------
Q08724_9CYAN/108-336--------------------------------------------------------------------------------
YRD6_CAEEL/484-644--------------------------------------------------------------------------------
Q17003_ANOGA/605-832--------------------------------------------------------------------------------
Q17329_CAEEL/1071-1231--------------------------------------------------------------------------------
Q24262_DROME/531-692--------------------------------------------------------------------------------
Q24310_DROME/500-649--------------------------------------------------------------------------------
Q24335_DROME/498-745--------------------------------------------------------------------------------
Q24690_DROTE/495-742--------------------------------------------------------------------------------
Q26106_PANRE/46-203--------------------------------------------------------------------------------
Q26816_9TRYP/545-793--------------------------------------------------------------------------------
Q33759_ALLMA/266-536--------------------------------------------------------------------------------
Q35056_MARPO/399-645--------------------------------------------------------------------------------
Q35057_MARPO/544-811--------------------------------------------------------------------------------
Q35058_MARPO/623-898--------------------------------------------------------------------------------
Q35062_MARPO/369-636--------------------------------------------------------------------------------
Q46666_ECOLX/34-241--------------------------------------------------------------------------------
Q47277_ECOLX/68-288--------------------------------------------------------------------------------
Q47526_ECOLX/33-239--------------------------------------------------------------------------------
YKFC_ECOLI/86-332--------------------------------------------------------------------------------
Q65353_NPVAC/181-346--------------------------------------------------------------------------------
Q66233_9VIRU/1324-1494--------------------------------------------------------------------------------
Q69590_HBV/72-297--------------------------------------------------------------------------------
POL_HV2KR/674-845--------------------------------------------------------------------------------
POL_JEMBR/598-766--------------------------------------------------------------------------------
Q83013_9RETR/68-238--------------------------------------------------------------------------------
Q84682_9VIRU/234-395--------------------------------------------------------------------------------
Q86998_9VIRU/1297-1467--------------------------------------------------------------------------------
Q88285_9RETR/848-1015--------------------------------------------------------------------------------
Q88442_9VIRU/321-485--------------------------------------------------------------------------------
POL_CSVMV/250-413--------------------------------------------------------------------------------
Q93137_BOMMO/515-771--------------------------------------------------------------------------------
Q93139_BOMMO/469-719--------------------------------------------------------------------------------
Q94885_DROME/759-920--------------------------------------------------------------------------------
YG31B_YEAST/639-797--------------------------------------------------------------------------------
Q9YGS2_TAKRU/573-830--------------------------------------------------------------------------------
Q9YW31_MSEPV/161-406--------------------------------------------------------------------------------
Q9ZNW4_SORBI/922-1081--------------------------------------------------------------------------------
Q9ZQ09_ARATH/388-543--------------------------------------------------------------------------------
Q9ZQ67_ARATH/542-701--------------------------------------------------------------------------------
Q9ZQF8_ARATH/439-674--------------------------------------------------------------------------------
Q9ZQM0_ARATH/323-569--------------------------------------------------------------------------------
Q9ZQQ3_ARATH/508-668--------------------------------------------------------------------------------
Q9ZQQ6_ARATH/659-918--------------------------------------------------------------------------------
Q9ZS84_SOLLC/655-815--------------------------------------------------------------------------------
Q9ZTP2_MAIZE/356-516--------------------------------------------------------------------------------
Q9ZUF0_ARATH/664-923--------------------------------------------------------------------------------
Q9ZVK4_ARATH/510-669--------------------------------------------------------------------------------

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XEA3_ORYSJ/1145-1390--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
O24438_ORYLO/963-1208--------------------------------------------------------------------------------
O81903_ARATH/849-1098--------------------------------------------------------------------------------
O81506_ARATH/471-718--------------------------------------------------------------------------------
O24587_MAIZE/586-830--------------------------------------------------------------------------------
Q94KV0_ARATH/912-1157--------------------------------------------------------------------------------
O96968_BOMMO/855-1082--------------------------------------------------------------------------------
Q7XBD8_MAIZE/827-1072--------------------------------------------------------------------------------
Q9ZPU5_ARATH/845-1094--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q9FLR2_ARATH/13-261--------------------------------------------------------------------------------
Q9SIM3_ARATH/973-1222--------------------------------------------------------------------------------
Q9MAR7_ARATH/666-912--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FIC5_ARATH/965-1209--------------------------------------------------------------------------------
O23864_9ORYZ/824-1071--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
O13308_CANAX/1056-1303--------------------------------------------------------------------------------
Q9ZQE9_ARATH/863-1108--------------------------------------------------------------------------------
O23529_ARATH/992-1236--------------------------------------------------------------------------------
Q8TFJ9_DEBHN/1015-1251--------------------------------------------------------------------------------
Q8TFJ1_PICAN/942-1182--------------------------------------------------------------------------------
Q9LH44_ARATH/867-1112--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q02902_ARATH/100-349--------------------------------------------------------------------------------
Q8MRT6_DROME/232-479--------------------------------------------------------------------------------
Q967L5_AEDAE/816-1061--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q9FJV3_ARATH/986-1235--------------------------------------------------------------------------------
Q9M1C6_ARATH/853-1098--------------------------------------------------------------------------------
Q06035_VOLCA/983-1228--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q9LH08_ARATH/636-888--------------------------------------------------------------------------------
Q9ZQK0_ARATH/918-1163--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q9LVQ2_ARATH/1008-1252--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
COPIA_DROME/920-1165--------------------------------------------------------------------------------
Q9ZQE4_ARATH/762-1011--------------------------------------------------------------------------------
Q9SH77_ARATH/866-1115--------------------------------------------------------------------------------
Q9C5V1_ARATH/1163-1408--------------------------------------------------------------------------------
O82196_ARATH/663-912--------------------------------------------------------------------------------
O81617_ARATH/965-1214--------------------------------------------------------------------------------
Q8TFK0_DEBHN/833-1080--------------------------------------------------------------------------------
O81824_ARATH/740-985--------------------------------------------------------------------------------
Q94EV3_MAIZE/796-1042--------------------------------------------------------------------------------
O74246_CANAX/39-286--------------------------------------------------------------------------------
Q9ZPG3_ARATH/915-1164--------------------------------------------------------------------------------
Q9S9A8_HORVU/828-1073--------------------------------------------------------------------------------
Q9ZRJ0_TOBAC/841-1089--------------------------------------------------------------------------------
Q8W0U0_SORBI/619-868--------------------------------------------------------------------------------
Q9FZK7_ARATH/1051-1296--------------------------------------------------------------------------------
Q94IU9_ARATH/904-1149--------------------------------------------------------------------------------
O74218_CANAX/999-1239--------------------------------------------------------------------------------
Q9FLA4_ARATH/947-1191--------------------------------------------------------------------------------
Q9C7Y1_ARATH/852-1097--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q9SHT5_ARATH/807-1052--------------------------------------------------------------------------------
O22452_VOLCA/568-813--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q9FFM0_ARATH/852-1101--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q9SZY0_ARATH/766-1015--------------------------------------------------------------------------------
Q8WRX5_ANOGA/458-703--------------------------------------------------------------------------------
Q7XE22_ORYSJ/452-697--------------------------------------------------------------------------------
O23588_ARATH/943-1192--------------------------------------------------------------------------------
O65452_ARATH/626-870--------------------------------------------------------------------------------
Q9ZUJ1_ARATH/925-1170--------------------------------------------------------------------------------
O49140_ARATH/968-1213--------------------------------------------------------------------------------
Q9FWZ5_ARATH/918-1163--------------------------------------------------------------------------------
Q94HW2_ARATH/982-1228--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q9C536_ARATH/832-1077--------------------------------------------------------------------------------
O22175_ARATH/1013-1257--------------------------------------------------------------------------------
O42838_SACPA/1146-1386--------------------------------------------------------------------------------
Q9MAK6_ARATH/832-1077--------------------------------------------------------------------------------
Q9M1F5_ARATH/873-1122--------------------------------------------------------------------------------
Q9FJA1_ARATH/460-702--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
O82493_ARATH/823-1068--------------------------------------------------------------------------------
O04543_ARATH/827-1076--------------------------------------------------------------------------------
O65147_SOYBN/1068-1313--------------------------------------------------------------------------------
Q9SLF0_ARATH/850-1094--------------------------------------------------------------------------------
Q9XII7_ARATH/966-1215--------------------------------------------------------------------------------
Q9M5J7_PICGL/100-347--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q9LJ55_ARATH/735-980--------------------------------------------------------------------------------
Q9FX79_ARATH/941-1190--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q949J4_SOLLC/397-647--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q8TFI1_SACEX/864-1104--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
POLX_TOBAC/840-1088--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------

PF02123

RDRP_SCPMV/464-849A-----DAVTAATKV--FPELSE.LGWP-ERGSGAEIGSLLLQAGKFVPTKAP.........SNLEQAYNNL........
RDRP_SBMVA/490-847H-----SLLLQAGKF--NPTGIP...RN-LEGACQNLLE............RY.........PASKSCYCLR........
RDRP_SCVLB/833-1303R-----KWIRDNFTY--NYNMEKEKYRI-TQYHHTHVRLKDLFPSRKIVKLEG.........YEALLAMMLDRFNN....
RDRP_PLRVW/609-1004G-----QKLCQVHPE--LADKTAGFGWP-KAGFEAELQSLNLQAARWLQRAES.........ATIPGAEARKRVIEKT..
Q9JE94_9VIRU/129-560H-----SLRNLTKEQ--EITLFPIKDIV-QANRRVNAYA........RNLLDA.........SPLPDFALQQMLLPNT..
RDRP_PEMVW/733-1124G-----ERVARTSAF--LQACTEKYSWP-ETGAEAELSSLRYQAARRQSAQTT.........AVIPPKDVREDLIKRT..
RDRP_HV19S/122-585G-----HLVCNDKAF--RERYFPKKKHA-AAAIKTNIRLGPLARAWAARYGLA.........ALGSHLAYMVGM......
O55590_9REOV/25-748P-----IYYSSNSDL--ESRCVEFHERA-VNLSKNNESIKQLYEEYKDVINKA..............TLLSVLSYSYGKY
RDRP_ROTHC/32-749N-----NYFATDK..--FKKDIEQYLKS-IHDGEK.ITQSKIDEKEKILLDRV.........PAEERCLISKLVFAYGKH
Q90155_9VIRU/96-539K-----NPRLLTSET--ELQLFPLKENS-AARTKANFYARTLWNETTSDKSAF.........KPGT..............
Q90193_9VIRU/400-785H-----KSLTIVLLI--GRRRGSGLMEC-LSEEEYNIRFNNAILNCYSHMTTG.........YSAKFGRL..........
Q83093_9VIRU/433-816L-----ETLSSRQVK--SSQSSNSTAGL-SEVVGQKEDPSSSKPDGFDRPAPP.........PTSPSQS...........
RDRP_ROTGI/37-803P-----SENAKLWRS--KELNTDSPNEL-LLTLKKTLDECSTLDEKIETLLRIRYFTVYVGDKSDKRNIIRSWLSTTINR
RDRP_TYYVF/580-974G-----KTLVGNHPA--LGEKTSGFGWP-KFGPEAELKSLRLQASRWLERAQS.........AEIPSDAERERVIQKT..
Q99AT3_9VIRU/99-573S-----FRWLCDPKA--SYAAFPPKQHP-GAMNKVNVYLNEVASSLLSLDPAA.........YSSASQALWPHKGKI...
Q98XW8_9VIRU/144-622R-----NGRSPSKEW--LLGYWPRKSHP-LAGKKANLFLDCVIADFLQNYKCL.........GPVLEGWMKRTHLLGI..
Q66150_9VIRU/22-408H-----RDVRAAESE--FPE.LKELAWP-SRGSKAEIGSLLFQAGRFERVEAP.........ANLQLAITNL........
Q86519_9VIRU/516-902S-----AQLSKTQSQ--YSQILKDLSVL-RGEVKQSLTSLILQAGRFNRTVCP.........SGLAQAVQSL........
RDRP_PCVC/362-832H-----TFDILSMPD--AKEIASYHVGE-GHTLVTNLLANWKGITQFTTVSHL.........VFPWFKVCERDWSDKMK.
Q90153_9VIRU/1024-1530S-----KKNNLQVKD--ICKIIIQKLKN-PKTMKPNARFGCAAAWLLRSQGQA.........AEFVTSVAAWVVSNR...
Q87025_SCVLA/177-657D-----RNIRPKHFK--GLRLYT.SSKV-TAQHHTHLRPDELVEAAAKVSPRR.........KYYLMCVVELLANLQV..
Q9YXE6_9VIRU/120-589F-----ARLLNDHSF--RRSCFPTKKML-PAEVKPNLALAPLIRSFSTCAGPT.........LAGHFLRHLAGHV.....
Q83073_9VIRU/49-523D-----SLILSLEGV--LGHKYKLKQHI-GASTKVNIHASEVIAGSRKYARTV.........YRQYVQMSSLFSGM....
Q9YXE4_9VIRU/99-573Q-----AGWSYSDRA--TLAEFGLKSNP-AASNKVNVYLCEVMRSLSDYSTSW.........AWLAEDALSRAPPM....
Q8V615_9VIRU/41-473V-----NLKFLNKEM--ELELFPLKKAP-QADLKVNCYA........RNVLAS.........TELTDDLLKQSLPIGL..
RDRP_LRVLG/155-619S-----DPNISQNKI--PRHYYQLKVHV-GAQKKVNLTAIEVIRGCQHECSVV.........YCEFVRYSAYFAGL....
Q65969_9LUTE/603-996G-----DKICKQHPE--MGDLTKGFGWP-QFGAKAELKSLRLQAARWLERAQS.........VKIPSSEEREHVIERC..
RDRP_ROTPY/25-748P-----IYYSSNSEL--EKRCIDFHAKC-VDNSKKGLSLSSLFEEYKDVIDNA..............TLLSILSYSYDKY

PF00680

POLG_HAVHM/1750-2215M.....NVVSKTLFR--KSPIYHHIDKT-MI...NFPAAMPFSKAEIDPMA.............VMLSKYSLPIVEE---
RDRP_BPPH6/19-638FA...NNIKAQQASK--RSFKEGAIETY-EGLLSVDPRFLSFKN.ELSRYLTDHFPANVDEYGRVYGNGVRTNFFGM---
POLG_PYFV1/2270-2778P.....KSITKSTIV--PSLIQPYMPRK-PL...TEPAILDPRDVRLGENR...YDPMIDGIKKYEEQARPIKISWR---
POL1_BAYMG/1634-2107I.....GQMNKGLID--KHVIVGENDDV-YDFMREHP.TFTWLKDFMNEYA.......PSVLSYSAYYKDLCKYNRA---
POL1_CPMVS/1186-1687I.....PLPTKTALV--ETPSEWHLDTP-CD...KVPSILVPTDPRIPAQH.EGYDPAKSGVSKYSQPMSALDPELL---
POLG_FCVC6/1262-1736I.....PKGTRLHVS--PAHLEDFEECS-.....HQPASLGSGDPRCPKSL.............TAIVVDSLKPYCV---
POL1_RCMV/1182-1684I.....PLPKKTSLV--KTPEEWHLGTP-CD...KVPSILVKGDPRLADTVHADYDPCLSGLTKYSTPMSPLDSVLL---
POL1_GCMV/1454-1960P.....TMPKKTNSV--QVPQALRVPCD-LPI..KEPSIISKNDPRCPANV...DPPKAAMKKKFQQPMLDLDQKCL---
POLG_WMV2U/237-705C.....GQADSALVT--KHVVKGKCPYF-AQYLSLHDGAXQFFEPLMGAYQ.......PSRLNKDAFKKDFFKYNKP---
POLG_LORDV/1209-1676P.....KLSTKTKFW--RSSTAPLPPGT-.....YEPAYLGGKDPRVKGGP...........SLQQVMRDQLKPFTE---
POL1_BRSV/1468-1975P.....TLPKKTNMV--PVPQSLRVPCD-VPI..KEPAVLTNADKRCPAGV...NPPVTALKKKFEHPMKELEQEIL---
POLG_HE701/1750-2193I.....NAPAKTKLE--PSVFHEVFEGV-.....KEPAVLHSKDKRLKVDF...........EEAIFSKYVGNK..T---
POL1_CPSMV/1177-1679V.....PLPTKTNLV--ETPKEWHLGTE-KT...KEPSILSSTDLRLGDKQ...YDPFVGGIQKYAEPMGILDDEVL---
Q94M06_9VIRU/64-655F.....ANARQTGTQ--LVAPRKAREIL-TGIYSFEPTVLAFQREFVKRANAVAQPDLNS..DGFSLNGLHTTFDSI---
Q9MC15_9VIRU/40-607I.....RTAFGPSIN--RAPSFKDVTQL-VVVTRTGVKHYKANDPQYLRFQKELADALQQFEPSKQLTLGVTGLGLT---
POLG_TUMVQ/2376-2844I.....AHCPSQLVT--KHTVKGKCQMF-DLYLKLHDEAREYFQPMLGQYQ.......KSKLNREAYAKDLLKYATP---
POLG_OMV/383-852V.....AVLPNQLVT--KHVVKGPCQCF-IQYLNESPEASAFFKPLMGQYG.......KSILSKEAFVKDIMKYSKP---
POLG_RHDVF/1279-1750P.....VSGTRYAKV--PGVPDEYKTG.-.....YRPANLGRSDPDSDKSL.............MNIAVKNLQVYQQ---
POLG_PVYHU/2293-2761V.....ATMKSQLVT--KHVVKGECRHF-KEFLTVDSEAEAFFRPLMDAYG.......KSLLNREAYIKDIMKYSKP---
POLG_PSBMV/2413-2881V.....ARCPGQLVT--KHVVKGPCAMF-QLYLELHEDAKSFFTPRMGSYG.......KSRLSKGAFIKDIMKYSSN---
POLG_SMSV1/1376-1852I.....MKGTRLHVS--PAHTDDYEECT-.....HQPASLGAGDPRCPMSL.............TGIMVNNLQPYTE---
POLG_TEV/2297-2761V.....AECPSQLVT--KHVVKGKCPLF-ELYLQLNPEKEAYFKPMMGAYK.......PSRLNREAFLKDILKYASE---
POLG_HRV8A/1721-2162V.....HVSSKTRLQ--PSVFHDVFPGT-.....KEPAVLSSNDPRLETDF...........DSALFSKYKGNP..A---
POLG_PEMVC/2294-2762I.....AYMKSQLVT--KHVVKGECMMF-KQYLQENPRANEFFQPKMWAYG.......KSMLNKEAYIKDIMKYSKV---
POLG_TMEVB/1854-2301V.....HVPRKTKLR--RTVAHDVFQPK-.....FEPAVLSRYDPRTDKDV...........DVVAFSKHTTN...M---
POLG_BOVEV/1731-2174I.....NAPTQTKLE--PSVFFDVFPGV-.....KEPAVLHKKDKRLETNF...........EEALFSKYIGNV..Q---
POL1_APMV/57-557V.....SCPTKTSFE--RTPESYHLGLP-CE...KEPSILSSHDPRIPEHV.EGYCPFRAGIQKYANPMGHLDHDLM---
POLG_CXA21/1762-2205I.....NAPSKTKLE--PSAFHYVFEGV-.....KEPAVLTKNDPRLKTDF...........EEAIFSKYVGNK..I---
POLG_PPVD/2311-2779V.....GACPGQLVT--KHVVKGKCTLF-ETYLLTHPEEHEFFRPLMGAYQ.......KSALNKDAYVKDLMKYSKP---
POLG_EMCV/1842-2288I.....HVPRKTALR--PTVARQVFQPA-.....YAPAVLSKFDPRTEADV...........DEVAFSKHTSN...Q---
POLG_TVMV/2260-2728V.....AHLQSQLVT--KHIVKGRCKMF-ALYLQENADARDFFKSFMGAYG.......PSHLNKEAYIKDIMKYSKQ---
POLG_SOUV3/1299-1766P.....ALSTKTKFW--KSSPEPLPPGV-.....YEPAYLGGRDPRVTVGP...........SLQQVLRDQLKPFAE---
POLG_CXA9/1756-2200I.....NTPSKTKLE--PSVFHQVFEGV-.....KEPAVLRNGDPRLKANF...........EEAIFSKYIGNV..N---
POLG_FMDV1/1875-2327V.....HVMRKTKLA--PTVAYGVFNPE-.....FGPAALSNKDPRLNEGV.........VLDDVIFSKHKGDAKMT---
POLG_HRV14/1736-2178V.....NTPTKSKLH--PSVFYDVFPGD-.....KEPAVLSDNDPRLEVKL...........TESLFSKYKGNV..N---
POLG_HRV1B/1714-2156I.....HTPSKTKLQ--PSVFYDVFPGS-.....KEPAVSRDNDPRLKVNF...........KEALFSKYKGNT..E---
POLG_PRSVH/2537-3005V.....SSAPSNLVT--KHVVKGICPLF-RNYLECDEEAKAFFSPLMGHYM.......KSVLSKEAYIKDLLKYSSD---
Q9FZT2_9VIRU/64-684FRANNNNSAAKRNRE--APFREGPIETM-RDRMSWDESNLRVMD.RLSTKLTDRFPASTDKLGRVGPNAIRANFLGL---
POL1_GFLV/1488-1974P.....HVPSKTSFM--KVPDELCFPYP-DP...KQPAILSAEDERLKGTIHEGYTPLRDGMKKFAEPMYLLEEKLL---

PF00998

RDRP_TNVA/224-703L-----VVIPSGRP.--..EKQRQLLRY-SG.IGGHLLIGIHNNSLSNLRR-----------------------------
RDRP_TCV/272-752M-----RVFPLANP.--..PKVRRIFHI-CG.MGNGLDFGVHNNSLNNLRR-----------------------------
RDRP_TNVD/224-709M-----LVTKGPPL.--..AKPRKLYRF-TG.MGTHIRYGVHDHSLGNVRR-----------------------------
RDRP_MCMVK/460-941L-----RSHFKDTR.--..HKTRRVFRI-AG.LGNLYEFGVHNNSAVNLER-----------------------------
POLG_HCVEU/2430-2941S-----YSWTGALIT--PCAAEEEKLPI-N..PLSNSLVRHHNMVYSTTSR-----------------------------
POLG_HCVED/2420-2931S-----YSWTGALVT--PCAAEESKLPI-S..PLSNSLLRHHNMVYATTTR-----------------------------
POLG_HCVJL/2434-2945S-----YSWTGALIT--PCAAEEEKLPI-S..PLSNTLIRHHNMVYSTTSR-----------------------------
POLG_HCVJK/2431-2942S-----YSWTGALIT--PCAAEEEKLPI-S..PLSNSLLRHHNLVYSTSSR-----------------------------
POLG_HCVEV/2426-2937S-----YTWTGALIT--PCSAEEEKLPI-N..PLSNTLLRHHNLVYSTSSR-----------------------------
POLG_HCVJ6/2445-2956S-----YSWTGALIT--PCSPEEEKLPI-N..PLSNSLLRYHNKVYCTTSK-----------------------------
Q9IR83_9TOMB/236-712M-----AVFPREGI.--..SKPRRIFQV-CG.MGNGTTFGVHNNSLTNLRR-----------------------------
Q87031_9LUTE/24-502I-----VVRSGAAP.--.RKSRSVISFL-SQ.FTLGLDYQCPNPSLHNALV-----------------------------
RDRP_POLVP/251-722M-----VVRKGAPI.--..TTERKWYSF-AG.YASTYEYIVHNSSLVNVCR-----------------------------
Q65987_9TOMB/269-750M-----RVFPLAQP.--..PKIRRIFHI-CG.MGNGLDFGVHNNSLNNLRR-----------------------------
P90338_9TOMB/1-480M-----IEVRRNAL.--..VRPRRLYYQ-QE.IGTGLQYRVHNASYANLRR-----------------------------
RDRP_BYDV1/361-840I-----AVTDGARL.--.RKVSCNIRYL-SQ.THLGLVYKAPNASLHNALV-----------------------------
O09796_9HEPC/2422-2933S-----YTWTGALIT--PCAAEESKLPI-N..PLSNSLLRHHNMVYATTSR-----------------------------
O09803_9FLAV/2373-2866S-----YIWSGVPL.--.TRATPAKPPV-VR.PVGSLLVADTTKVYVTNPD-----------------------------
O37361_9VIRU/252-737A-----TNLGDSRP.--..LTDTNIRRV-VGPFSSDYDIVFYTNSRNNLMR-----------------------------
Q9WJD9_CARMV/267-744V-----IEVDGQCP.--..LKERKLYVQ-NA.ITTGYEYRVHNHSYANLRR-----------------------------
Q83103_9TOMB/228-711L-----SVVKGPPL.--..SKPRKLYRF-TG.FGANIRYGVHDHSLGNVRR-----------------------------
Q66127_9VIRU/52-520L-----HIRPSARP.--.RPVKRVSYQI-DA.VRPSADFGVHNNSLVNLVR-----------------------------
RDRP_PMVK/447-937L-----RCHFKDRD.--..PKVRSIYRI-AG.LGDQYEFGLHNNSAANLER-----------------------------
POLG_GBVB/2277-2785S-----YTWTDVIS.--.FKTASKVLSA-TR.AITSGFLKQRSLVYVTEPR-----------------------------
Q89801_9TOMB/1-479M-----LITPRTGS.--..HKVRKMGHV-NF.MGNGKLFGVHNASLVNLRR-----------------------------
Q9IRA1_9TOMB/266-741L-----TVSREKPA.--..SKVRRIYQI-TG.LDSGINFGVHNNSLNNLRR-----------------------------
O12301_9TOMB/231-708L-----VVKPSGRP.--..EKQRQLSAI-VD.SWGRKPLVFTITRLANLRR-----------------------------
Q83424_MNSV/290-772M-----TEFPQDRP.--..IKTRKLYCL-GG.VGTSVKFNVHNNSLANLRR-----------------------------
O41892_9FLAV/2409-2899S-----YVWSGQPL.--.GCGRVIPPPI-TR.PVGTHLTCDTTKVYATDPD-----------------------------
RDRP_OCSVU/235-734L-----RVKRLLGV.--..TKNRTCMRV-SG.VSPNIQIIPFNNDITTLER-----------------------------
Q9IW60_9TOMB/325-800L-----EVRTGPPN.--..AKDRNIFMV-AG.CPSQARFLVHNHCLKNLKR-----------------------------
Q96898_9FLAV/2396-2886S-----YIWSGAPL.--.GTGRSVPQPM-TR.PIGTHLTCDTTKVYVTDPD-----------------------------
RDRP_RCNMV/260-745V-----AEKRASRV.--.MKSKRVVG.L-PA.VSAGLKVCVHQTSLHNMIV-----------------------------

PF00978

R1AB_LIYV9/1925-2366Y-----SDYYLPPCE..DLRITLSKSKP-YH.......PGAYVVSKILGKG-----------------------------
R1AB_BYVU/2601-3046T-----QVFESG.AD..NVVIRDSAPVN-KSTD.....HDPQRVSSIRSQA-----------------------------
Q9YPH5_9VIRU/1359-1796T-----GGLDIE.LS..DCKIYPNRPMK-VW.E.....ERRYLSPVLRTAM-----------------------------
POLN_EEVVM/2041-2488M-----VDGASCCLD..TASFCPAKLRS-FP.K.....KHAYLEPTIRSAV-----------------------------
E0YCR0_9CLOS/53-491T-----SDQSFL.IE..DVRISESFSHF-TSKI.....ED.RFYSFIRSSV-----------------------------
RDRP_TOMS1/1168-1609L-----TDISLN.VK..DCILDMSKSVA-APKD.....AKPTLIPMVRTAA-----------------------------
RDRP_PSVJ/295-726N-----SDFTTD.ID..HLTLKQSDLIP-KA.D.....GGNYLKPVLTTGS-----------------------------
Q66107_9BROM/228-662T-----QDISLE.VS..KCWLDASNFKD-FTKG.....QQTYAVPAYQSGA-----------------------------
Q87644_SINDV/2053-2501M-----VDGTVACLD..TATFCPAKLRS-YPKK.....HE.YRAPNIRSAV-----------------------------
O56790_9VIRU/1323-1760T-----GGLEID.IA..NIKYYPNKQKR-MWQE.....VR.GLTPALRTAM-----------------------------
RDRP_CMVFN/308-738S-----ADYSID.LD..HVRLRQSDLIA-KI.P.....DSGHMIPVLNTGS-----------------------------
Q9WJD8_PEBV/1299-1738T-----EDCNLR.LT..DVTLKSGNWKD-KFVE....EKETCLVPVLRTAM-----------------------------
Q80875_BSMV/195-630T-----EDINMD.VQ..DCRLKFGKTFR-PYEF.....KE.SLKPVLRTAM-----------------------------
RDRP_RBDVR/1234-1674V-----GPMSLQ.VG..SIRWDVSKISP-RLFT.....NNKFAVPHLPTGA-----------------------------
RDRP_SBWMN/1373-1810T-----SDISIE.LE..NCTVQPNKNVK-VWQD.....KR.GLVPVLRTAM-----------------------------
POLN_ONNVI/2053-2501M-----VDGSESCLD..RATFNPSKLRS-YP.K.....QHSYHAPTIRSAV-----------------------------
RDRP_TAV/313-742N-----ADYSVD.ID..RVRLKQSDLLA-KV.I.....DEGHLKPVLNTGS-----------------------------
POLN_MIDDV/534-981M-----VDGSESCLD..RAAFCPSKLRS-FP.K.....KHSYHRAEIRSAV-----------------------------
RDRP_TMGMV/1163-1604L-----RDNSLN.VK..DCVLDFSKSIP-MPKE.....VKPCLEPVLRTAA-----------------------------
RDRP_TOBSV/253-689T-----HDIDLE.VT..SCDLDMSTFND-WTKG.....VDTRLVPNMSVGG-----------------------------
RDRP_OLV2I/310-732S-----DDFTVDFPT..QVRLRERDEDW-FRRK.....PD.FAVSSIRTGL-----------------------------
RDRP_YOMV/1155-1594L-----RDISLN.VK..DCRIDFSKSVQ-VPKE.....RPVFMKPKLRTAA-----------------------------
RDRP_AMVLE/318-752T-----SDKSLD.VD..PCRIDLSVFNN-WQ.S.....SENCYEPRFKTGA-----------------------------
POLN_RRVN/2019-2467M-----VDGSESCLD..RATFCPAKLRC-YP.K.....HHAYHQPQVRSAV-----------------------------
RDRP_ASPVP/1758-2169I-----GDITTE.........QFTDDHS-KNRG.....QE......LTNAA-----------------------------
O56250_9VIRU/1240-1678T-----TDCNLR.LD..NVTIKSGNWKD-KFAE.....KEAFLKPVIRTAM-----------------------------
O90699_9VIRU/1363-1800T-----GGIHVE.ID..DLTYYPNKQTK-VW.S.....EVKGLTPVLRTAM-----------------------------
Q9Q6Q3_9CLOS/62-509E-----DDFETSGLE..TLVETATISDN-FPKYK..ITDRPRSQYVVRSAI-----------------------------
POLN_AURAV/2038-2486M-----VEGSVSCLD..TATFCPAKLRS-FPKT.....HS.YLEPTLRSAV-----------------------------
RDRP_BBMV/271-697S-----ADFSSD.FQ..RLKIKQSHVDW-YK.D.....PDKFFEPVLNFGA-----------------------------
RDRP_CCMV/267-697L-----GDYNVD.IS..KLSVRQSDVDW-YR.D.....PEKYYEPELSIGS-----------------------------
Q66581_EEEV/144-598E-----YDAYLDMVDGASCCLDTATFCP-AK.LRSFPKKHSYLRPEIRSAV-----------------------------
Q9QGG9_9BROM/363-797T-----SDIALE.LD..RATLDTSVFND-WTKS.....SGPKLNGLFRTGN-----------------------------
RDRP_TMOB/1167-1614C-----SDISLN.VK..DCVLDFSKSVP-LPRD....NTKVPMTPVIRTAA-----------------------------
RDRP_BMV/256-688N-----GDYSMD.FD..RIRLKQSDVDW-YR.D.....PDKYFQPKMNIGS-----------------------------
O40960_9CLOS/62-506Y-----SDIELPCLE..DLLLTPTKSKP-YQ.......AVNCKVPILIGKG-----------------------------

PF00972

Q67483_9FLAV/252-900T-----VVPDLIYPT--GTRSVASEAGP.LDLEKVKARINRLKEEQESTWFVDSDHPYRTWHYHGSYVAKQSGTAASMI-
POLG_DEN4D/2738-3383T-----YEKDVDLGA--GTRSVSTETEK.PDMTIIGRRLQRLQEEHKETWHYDQENPYRTWAYHGSYEAPSTGSASSMV-
O09234_DEN26/2742-3387T-----YEPDVDLGS--GTRNIGIESEI.PNLDIIGKRIEKIKQEHETSWHYDQDHPYKTWAYHGSYETKQTGSASSMV-
POLG_YEFV1/2758-3406T-----LEADVILPI--GTRSVETDKGP.LDKEAIEERVERIKSEYMTSWFYDNDNPYRTWHYCGSYVTKTSGSAASMV-
POLG_LIV/2763-3408T-----KVPEADLGV--GTRCVVLAEDK.VKEQDVQERIRALRKQYSETWHMDEEHPYRTWQYWGTSRTAPTGSAASLI-
O36764_9FLAV/2780-3428K-----YEEDVNLGS--GTRAVGKGEVH.SNQEKIKKRIQKLKEEFATTWHKDPEHPYRTWTYHGSYEVKATGSASSLV-
POLG_MCFA/2693-3341V-----VLPSPVLPK--GTRADPAASVASMNTSDMMDRVERLMNENRGTWFEDQQHPYKSFKYFGSFVTDDVKVGGQAV-

PF05919

Q6EH16_9VIRU/1-501--------------------------------------------------------------------------------
Q5TMB5_9VIRU/174-658--------------------------------------------------------------------------------
Q18L80_9VIRU/166-639--------------------------------------------------------------------------------
Q9WJ23_9VIRU/164-642--------------------------------------------------------------------------------
RDRP_CPMV1/246-745--------------------------------------------------------------------------------
Q9ZXZ7_THACU/214-754--------------------------------------------------------------------------------
Q9WJ22_9VIRU/155-622--------------------------------------------------------------------------------
Q6EH19_9VIRU/208-686--------------------------------------------------------------------------------
Q9WJ24_9VIRU/163-645--------------------------------------------------------------------------------
Q6GYC2_9VIRU/156-638--------------------------------------------------------------------------------
Q18L78_9VIRU/174-654--------------------------------------------------------------------------------
Q18L79_9VIRU/168-671--------------------------------------------------------------------------------
Q3S3F3_9VIRU/120-606--------------------------------------------------------------------------------
O92614_9VIRU/173-711--------------------------------------------------------------------------------

PF00078

POL_WDSV/812-977--------------------------------------------------------------------------------
POL_RSVP/769-938--------------------------------------------------------------------------------
O01419_BOMMO/502-756--------------------------------------------------------------------------------
O13348_MAGGR/497-764--------------------------------------------------------------------------------
O18558_AEDAE/472-725--------------------------------------------------------------------------------
O22148_ARATH/497-727--------------------------------------------------------------------------------
O22220_ARATH/221-456--------------------------------------------------------------------------------
O23410_ARATH/308-553--------------------------------------------------------------------------------
O41894_9RETR/202-360--------------------------------------------------------------------------------
O42691_ALTAL/36-202--------------------------------------------------------------------------------
O44316_DROMR/394-650--------------------------------------------------------------------------------
O47500_VENIN/326-590--------------------------------------------------------------------------------
O52209_9ZZZZ/135-366--------------------------------------------------------------------------------
O52231_STRPN/68-275--------------------------------------------------------------------------------
O62658_CANFA/517-773--------------------------------------------------------------------------------
O64428_CHLVU/554-816--------------------------------------------------------------------------------
O64612_ARATH/788-1031--------------------------------------------------------------------------------
O65244_ARATH/405-664--------------------------------------------------------------------------------
O65598_ARATH/489-747--------------------------------------------------------------------------------
O69788_RHIML/72-291--------------------------------------------------------------------------------
DPOL_WMHBV/364-590--------------------------------------------------------------------------------
O72700_9VIRU/1279-1449--------------------------------------------------------------------------------
O81068_ARATH/814-1073--------------------------------------------------------------------------------
O81284_ARATH/58-317--------------------------------------------------------------------------------
O81454_ARATH/144-304--------------------------------------------------------------------------------
O81517_ARATH/408-666--------------------------------------------------------------------------------
O81630_ARATH/874-1114--------------------------------------------------------------------------------
O82216_ARATH/238-497--------------------------------------------------------------------------------
O82276_ARATH/356-618--------------------------------------------------------------------------------
O82894_ECO57/115-332--------------------------------------------------------------------------------
O85869_SPHAR/89-369--------------------------------------------------------------------------------
O85879_SPHAR/47-327--------------------------------------------------------------------------------
POL_FFV/202-360--------------------------------------------------------------------------------
O93520_ORYLA/518-771--------------------------------------------------------------------------------
O96546_LYMDI/526-780--------------------------------------------------------------------------------
O96849_DICDI/53-215--------------------------------------------------------------------------------
O99479_PAVLU/111-389--------------------------------------------------------------------------------
O99969_PORPU/100-315--------------------------------------------------------------------------------
O99970_PORPU/100-315--------------------------------------------------------------------------------
DPOL_GSHV/413-636--------------------------------------------------------------------------------
POL_MLVAV/221-393--------------------------------------------------------------------------------
POL_HTL1A/633-804--------------------------------------------------------------------------------
POL_HTLV2/631-802--------------------------------------------------------------------------------
POL_SMRVH/71-240--------------------------------------------------------------------------------
POL_MMTVB/68-237--------------------------------------------------------------------------------
POL_CAMVC/289-452--------------------------------------------------------------------------------
AI1M_YEAST/315-577--------------------------------------------------------------------------------
AI2M_YEAST/348-613--------------------------------------------------------------------------------
POL_SRV1/74-243--------------------------------------------------------------------------------
POL_IPHA/60-229--------------------------------------------------------------------------------
POL_HV1MA/655-826--------------------------------------------------------------------------------
POL_CERV/271-436--------------------------------------------------------------------------------
YMC6_SCHPO/300-566--------------------------------------------------------------------------------
LIN1_NYCCO/516-772--------------------------------------------------------------------------------
POL_FMVD/282-445--------------------------------------------------------------------------------
LTRA_LACLM/90-361--------------------------------------------------------------------------------
POK10_HUMAN/76-245--------------------------------------------------------------------------------
POL_BAEVM/219-391--------------------------------------------------------------------------------
POL4_DROME/357-523--------------------------------------------------------------------------------
POLY_DROME/224-390--------------------------------------------------------------------------------
POL_EIAV9/249-419--------------------------------------------------------------------------------
POL_IPMA/71-240--------------------------------------------------------------------------------
POL2_MOUSE/524-780--------------------------------------------------------------------------------
POL_IPMAI/16-159--------------------------------------------------------------------------------
DPOL_WHV3/416-639--------------------------------------------------------------------------------
DPOL_HBVC3/376-600--------------------------------------------------------------------------------
YTX2_XENLA/513-765--------------------------------------------------------------------------------
RTP2_TRYBG/594-780--------------------------------------------------------------------------------
POL_SOCMV/246-411--------------------------------------------------------------------------------
POLR_DROME/403-660--------------------------------------------------------------------------------
Y2R2_DROME/498-741--------------------------------------------------------------------------------
POL_COYMV/1445-1615--------------------------------------------------------------------------------
POL_BIV29/638-806--------------------------------------------------------------------------------
RDPO_SCEOB/124-343--------------------------------------------------------------------------------
POL2_DROME/249-414--------------------------------------------------------------------------------
RT67_ECOLX/48-262--------------------------------------------------------------------------------
RTJK_DROME/502-757--------------------------------------------------------------------------------
RTJK_DROFU/502-757--------------------------------------------------------------------------------
POL_GALV/218-390--------------------------------------------------------------------------------
POL_SIVGB/659-830--------------------------------------------------------------------------------
RT86_ECOLX/53-248--------------------------------------------------------------------------------
RT65_MYXXA/155-366--------------------------------------------------------------------------------
RT16_MYXXA/186-407--------------------------------------------------------------------------------
POL_SFV1/205-363--------------------------------------------------------------------------------
POL_BLVAU/41-212--------------------------------------------------------------------------------
POL_RTBVP/1228-1390--------------------------------------------------------------------------------
POL_SIVV1/677-848--------------------------------------------------------------------------------
DPOL_HPBDC/394-564--------------------------------------------------------------------------------
POL_JSRV/74-243--------------------------------------------------------------------------------
POL_FIVT2/218-388--------------------------------------------------------------------------------
POL_CAEVC/210-380--------------------------------------------------------------------------------
YMF40_MARPO/68-333--------------------------------------------------------------------------------
P71276_ECOLX/62-269--------------------------------------------------------------------------------
P91581_CIOIN/483-644--------------------------------------------------------------------------------
P95451_PSEAC/119-326--------------------------------------------------------------------------------
Q01379_NEUCS/505-761--------------------------------------------------------------------------------
Q02717_PODAN/248-528--------------------------------------------------------------------------------
Q02718_PODAN/260-530--------------------------------------------------------------------------------
POL_SIVG1/672-843--------------------------------------------------------------------------------
Q03261_SIV/246-416--------------------------------------------------------------------------------
Q04135_DROME/496-743--------------------------------------------------------------------------------
RTF21_SCHPO/455-615--------------------------------------------------------------------------------
Q05804_ECOLX/44-235--------------------------------------------------------------------------------
Q07995_9DIPT/509-760--------------------------------------------------------------------------------
Q08525_CHICK/555-775--------------------------------------------------------------------------------
Q08724_9CYAN/108-336--------------------------------------------------------------------------------
YRD6_CAEEL/484-644--------------------------------------------------------------------------------
Q17003_ANOGA/605-832--------------------------------------------------------------------------------
Q17329_CAEEL/1071-1231--------------------------------------------------------------------------------
Q24262_DROME/531-692--------------------------------------------------------------------------------
Q24310_DROME/500-649--------------------------------------------------------------------------------
Q24335_DROME/498-745--------------------------------------------------------------------------------
Q24690_DROTE/495-742--------------------------------------------------------------------------------
Q26106_PANRE/46-203--------------------------------------------------------------------------------
Q26816_9TRYP/545-793--------------------------------------------------------------------------------
Q33759_ALLMA/266-536--------------------------------------------------------------------------------
Q35056_MARPO/399-645--------------------------------------------------------------------------------
Q35057_MARPO/544-811--------------------------------------------------------------------------------
Q35058_MARPO/623-898--------------------------------------------------------------------------------
Q35062_MARPO/369-636--------------------------------------------------------------------------------
Q46666_ECOLX/34-241--------------------------------------------------------------------------------
Q47277_ECOLX/68-288--------------------------------------------------------------------------------
Q47526_ECOLX/33-239--------------------------------------------------------------------------------
YKFC_ECOLI/86-332--------------------------------------------------------------------------------
Q65353_NPVAC/181-346--------------------------------------------------------------------------------
Q66233_9VIRU/1324-1494--------------------------------------------------------------------------------
Q69590_HBV/72-297--------------------------------------------------------------------------------
POL_HV2KR/674-845--------------------------------------------------------------------------------
POL_JEMBR/598-766--------------------------------------------------------------------------------
Q83013_9RETR/68-238--------------------------------------------------------------------------------
Q84682_9VIRU/234-395--------------------------------------------------------------------------------
Q86998_9VIRU/1297-1467--------------------------------------------------------------------------------
Q88285_9RETR/848-1015--------------------------------------------------------------------------------
Q88442_9VIRU/321-485--------------------------------------------------------------------------------
POL_CSVMV/250-413--------------------------------------------------------------------------------
Q93137_BOMMO/515-771--------------------------------------------------------------------------------
Q93139_BOMMO/469-719--------------------------------------------------------------------------------
Q94885_DROME/759-920--------------------------------------------------------------------------------
YG31B_YEAST/639-797--------------------------------------------------------------------------------
Q9YGS2_TAKRU/573-830--------------------------------------------------------------------------------
Q9YW31_MSEPV/161-406--------------------------------------------------------------------------------
Q9ZNW4_SORBI/922-1081--------------------------------------------------------------------------------
Q9ZQ09_ARATH/388-543--------------------------------------------------------------------------------
Q9ZQ67_ARATH/542-701--------------------------------------------------------------------------------
Q9ZQF8_ARATH/439-674--------------------------------------------------------------------------------
Q9ZQM0_ARATH/323-569--------------------------------------------------------------------------------
Q9ZQQ3_ARATH/508-668--------------------------------------------------------------------------------
Q9ZQQ6_ARATH/659-918--------------------------------------------------------------------------------
Q9ZS84_SOLLC/655-815--------------------------------------------------------------------------------
Q9ZTP2_MAIZE/356-516--------------------------------------------------------------------------------
Q9ZUF0_ARATH/664-923--------------------------------------------------------------------------------
Q9ZVK4_ARATH/510-669--------------------------------------------------------------------------------

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XEA3_ORYSJ/1145-1390--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
O24438_ORYLO/963-1208--------------------------------------------------------------------------------
O81903_ARATH/849-1098--------------------------------------------------------------------------------
O81506_ARATH/471-718--------------------------------------------------------------------------------
O24587_MAIZE/586-830--------------------------------------------------------------------------------
Q94KV0_ARATH/912-1157--------------------------------------------------------------------------------
O96968_BOMMO/855-1082--------------------------------------------------------------------------------
Q7XBD8_MAIZE/827-1072--------------------------------------------------------------------------------
Q9ZPU5_ARATH/845-1094--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q9FLR2_ARATH/13-261--------------------------------------------------------------------------------
Q9SIM3_ARATH/973-1222--------------------------------------------------------------------------------
Q9MAR7_ARATH/666-912--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FIC5_ARATH/965-1209--------------------------------------------------------------------------------
O23864_9ORYZ/824-1071--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
O13308_CANAX/1056-1303--------------------------------------------------------------------------------
Q9ZQE9_ARATH/863-1108--------------------------------------------------------------------------------
O23529_ARATH/992-1236--------------------------------------------------------------------------------
Q8TFJ9_DEBHN/1015-1251--------------------------------------------------------------------------------
Q8TFJ1_PICAN/942-1182--------------------------------------------------------------------------------
Q9LH44_ARATH/867-1112--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q02902_ARATH/100-349--------------------------------------------------------------------------------
Q8MRT6_DROME/232-479--------------------------------------------------------------------------------
Q967L5_AEDAE/816-1061--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q9FJV3_ARATH/986-1235--------------------------------------------------------------------------------
Q9M1C6_ARATH/853-1098--------------------------------------------------------------------------------
Q06035_VOLCA/983-1228--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q9LH08_ARATH/636-888--------------------------------------------------------------------------------
Q9ZQK0_ARATH/918-1163--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q9LVQ2_ARATH/1008-1252--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
COPIA_DROME/920-1165--------------------------------------------------------------------------------
Q9ZQE4_ARATH/762-1011--------------------------------------------------------------------------------
Q9SH77_ARATH/866-1115--------------------------------------------------------------------------------
Q9C5V1_ARATH/1163-1408--------------------------------------------------------------------------------
O82196_ARATH/663-912--------------------------------------------------------------------------------
O81617_ARATH/965-1214--------------------------------------------------------------------------------
Q8TFK0_DEBHN/833-1080--------------------------------------------------------------------------------
O81824_ARATH/740-985--------------------------------------------------------------------------------
Q94EV3_MAIZE/796-1042--------------------------------------------------------------------------------
O74246_CANAX/39-286--------------------------------------------------------------------------------
Q9ZPG3_ARATH/915-1164--------------------------------------------------------------------------------
Q9S9A8_HORVU/828-1073--------------------------------------------------------------------------------
Q9ZRJ0_TOBAC/841-1089--------------------------------------------------------------------------------
Q8W0U0_SORBI/619-868--------------------------------------------------------------------------------
Q9FZK7_ARATH/1051-1296--------------------------------------------------------------------------------
Q94IU9_ARATH/904-1149--------------------------------------------------------------------------------
O74218_CANAX/999-1239--------------------------------------------------------------------------------
Q9FLA4_ARATH/947-1191--------------------------------------------------------------------------------
Q9C7Y1_ARATH/852-1097--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q9SHT5_ARATH/807-1052--------------------------------------------------------------------------------
O22452_VOLCA/568-813--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q9FFM0_ARATH/852-1101--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q9SZY0_ARATH/766-1015--------------------------------------------------------------------------------
Q8WRX5_ANOGA/458-703--------------------------------------------------------------------------------
Q7XE22_ORYSJ/452-697--------------------------------------------------------------------------------
O23588_ARATH/943-1192--------------------------------------------------------------------------------
O65452_ARATH/626-870--------------------------------------------------------------------------------
Q9ZUJ1_ARATH/925-1170--------------------------------------------------------------------------------
O49140_ARATH/968-1213--------------------------------------------------------------------------------
Q9FWZ5_ARATH/918-1163--------------------------------------------------------------------------------
Q94HW2_ARATH/982-1228--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q9C536_ARATH/832-1077--------------------------------------------------------------------------------
O22175_ARATH/1013-1257--------------------------------------------------------------------------------
O42838_SACPA/1146-1386--------------------------------------------------------------------------------
Q9MAK6_ARATH/832-1077--------------------------------------------------------------------------------
Q9M1F5_ARATH/873-1122--------------------------------------------------------------------------------
Q9FJA1_ARATH/460-702--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
O82493_ARATH/823-1068--------------------------------------------------------------------------------
O04543_ARATH/827-1076--------------------------------------------------------------------------------
O65147_SOYBN/1068-1313--------------------------------------------------------------------------------
Q9SLF0_ARATH/850-1094--------------------------------------------------------------------------------
Q9XII7_ARATH/966-1215--------------------------------------------------------------------------------
Q9M5J7_PICGL/100-347--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q9LJ55_ARATH/735-980--------------------------------------------------------------------------------
Q9FX79_ARATH/941-1190--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q949J4_SOLLC/397-647--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q8TFI1_SACEX/864-1104--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
POLX_TOBAC/840-1088--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------

PF02123

RDRP_SCPMV/464-849................................................................................
RDRP_SBMVA/490-847................................................................................
RDRP_SCVLB/833-1303.......................................................IESTHVTFF..............TY
RDRP_PLRVW/609-1004................................................................................
Q9JE94_9VIRU/129-560.......................................................ANDVVCAIL..............LL
RDRP_PEMVW/733-1124................................................................................
RDRP_HV19S/122-585.......................................................PNDRACATL..............LL
O55590_9REOV/25-748GNVESKIKEYATVAPLVAEFINDLD..YENNKLTSELFNEESYTDSLMDPAILTSLSSNLNAAM..............FW
RDRP_ROTHC/32-749GNVENKLVKYGVKDALSHAPQKDAKPYENNIITSEIFKEKSEYTDIYMDPSINTSCQSNCQAMM..............FT
Q90155_9VIRU/96-539.......................................................YNDTVAGLL..............MW
Q90193_9VIRU/400-785................................................................................
Q83093_9VIRU/433-816................................................................................
RDRP_ROTGI/37-803LNVEEYASIQEIELQAKQWRAENAKSLRPYHYNIPINEYLRDNEIEVLDTGDNRWKSDTLQGLLPNFYHRTHTLIGAILF
RDRP_TYYVF/580-974................................................................................
Q99AT3_9VIRU/99-573.......................................................ANDQASAII..............LY
Q98XW8_9VIRU/144-622.......................................................YEDQACNII..............VY
Q66150_9VIRU/22-408................................................................................
Q86519_9VIRU/516-902................................................................................
RDRP_PCVC/362-832......................................................TLHSLVRCSK..............FF
Q90153_9VIRU/1024-1530.......................................................IGPAAWKWL..............WV
Q87025_SCVLA/177-657......................................................DLEAAVATIL..............AY
Q9YXE6_9VIRU/120-589.......................................................TEDVAMAAM..............VY
Q83073_9VIRU/49-523.......................................................YDDHVAGIL..............LY
Q9YXE4_9VIRU/99-573.......................................................FNDQASALV..............LY
Q8V615_9VIRU/41-473.......................................................NNDSVCGIV..............IV
RDRP_LRVLG/155-619.......................................................YDDQVAAIL..............LY
Q65969_9LUTE/603-996................................................................................
RDRP_ROTPY/25-748NAVERKLINYAKGKPLEADLTANELDYENNKITSELFKSAEEYTDSLMDPAILTSISSNLNAVM..............FW

PF00680

POLG_HAVHM/1750-2215--------------------------------------------------------------------------------
RDRP_BPPH6/19-638--------------------------------------------------------------------------------
POLG_PYFV1/2270-2778--------------------------------------------------------------------------------
POL1_BAYMG/1634-2107--------------------------------------------------------------------------------
POL1_CPMVS/1186-1687--------------------------------------------------------------------------------
POLG_FCVC6/1262-1736--------------------------------------------------------------------------------
POL1_RCMV/1182-1684--------------------------------------------------------------------------------
POL1_GCMV/1454-1960--------------------------------------------------------------------------------
POLG_WMV2U/237-705--------------------------------------------------------------------------------
POLG_LORDV/1209-1676--------------------------------------------------------------------------------
POL1_BRSV/1468-1975--------------------------------------------------------------------------------
POLG_HE701/1750-2193--------------------------------------------------------------------------------
POL1_CPSMV/1177-1679--------------------------------------------------------------------------------
Q94M06_9VIRU/64-655--------------------------------------------------------------------------------
Q9MC15_9VIRU/40-607--------------------------------------------------------------------------------
POLG_TUMVQ/2376-2844--------------------------------------------------------------------------------
POLG_OMV/383-852--------------------------------------------------------------------------------
POLG_RHDVF/1279-1750--------------------------------------------------------------------------------
POLG_PVYHU/2293-2761--------------------------------------------------------------------------------
POLG_PSBMV/2413-2881--------------------------------------------------------------------------------
POLG_SMSV1/1376-1852--------------------------------------------------------------------------------
POLG_TEV/2297-2761--------------------------------------------------------------------------------
POLG_HRV8A/1721-2162--------------------------------------------------------------------------------
POLG_PEMVC/2294-2762--------------------------------------------------------------------------------
POLG_TMEVB/1854-2301--------------------------------------------------------------------------------
POLG_BOVEV/1731-2174--------------------------------------------------------------------------------
POL1_APMV/57-557--------------------------------------------------------------------------------
POLG_CXA21/1762-2205--------------------------------------------------------------------------------
POLG_PPVD/2311-2779--------------------------------------------------------------------------------
POLG_EMCV/1842-2288--------------------------------------------------------------------------------
POLG_TVMV/2260-2728--------------------------------------------------------------------------------
POLG_SOUV3/1299-1766--------------------------------------------------------------------------------
POLG_CXA9/1756-2200--------------------------------------------------------------------------------
POLG_FMDV1/1875-2327--------------------------------------------------------------------------------
POLG_HRV14/1736-2178--------------------------------------------------------------------------------
POLG_HRV1B/1714-2156--------------------------------------------------------------------------------
POLG_PRSVH/2537-3005--------------------------------------------------------------------------------
Q9FZT2_9VIRU/64-684--------------------------------------------------------------------------------
POL1_GFLV/1488-1974--------------------------------------------------------------------------------

PF00998

RDRP_TNVA/224-703--------------------------------------------------------------------------------
RDRP_TCV/272-752--------------------------------------------------------------------------------
RDRP_TNVD/224-709--------------------------------------------------------------------------------
RDRP_MCMVK/460-941--------------------------------------------------------------------------------
POLG_HCVEU/2430-2941--------------------------------------------------------------------------------
POLG_HCVED/2420-2931--------------------------------------------------------------------------------
POLG_HCVJL/2434-2945--------------------------------------------------------------------------------
POLG_HCVJK/2431-2942--------------------------------------------------------------------------------
POLG_HCVEV/2426-2937--------------------------------------------------------------------------------
POLG_HCVJ6/2445-2956--------------------------------------------------------------------------------
Q9IR83_9TOMB/236-712--------------------------------------------------------------------------------
Q87031_9LUTE/24-502--------------------------------------------------------------------------------
RDRP_POLVP/251-722--------------------------------------------------------------------------------
Q65987_9TOMB/269-750--------------------------------------------------------------------------------
P90338_9TOMB/1-480--------------------------------------------------------------------------------
RDRP_BYDV1/361-840--------------------------------------------------------------------------------
O09796_9HEPC/2422-2933--------------------------------------------------------------------------------
O09803_9FLAV/2373-2866--------------------------------------------------------------------------------
O37361_9VIRU/252-737--------------------------------------------------------------------------------
Q9WJD9_CARMV/267-744--------------------------------------------------------------------------------
Q83103_9TOMB/228-711--------------------------------------------------------------------------------
Q66127_9VIRU/52-520--------------------------------------------------------------------------------
RDRP_PMVK/447-937--------------------------------------------------------------------------------
POLG_GBVB/2277-2785--------------------------------------------------------------------------------
Q89801_9TOMB/1-479--------------------------------------------------------------------------------
Q9IRA1_9TOMB/266-741--------------------------------------------------------------------------------
O12301_9TOMB/231-708--------------------------------------------------------------------------------
Q83424_MNSV/290-772--------------------------------------------------------------------------------
O41892_9FLAV/2409-2899--------------------------------------------------------------------------------
RDRP_OCSVU/235-734--------------------------------------------------------------------------------
Q9IW60_9TOMB/325-800--------------------------------------------------------------------------------
Q96898_9FLAV/2396-2886--------------------------------------------------------------------------------
RDRP_RCNMV/260-745--------------------------------------------------------------------------------

PF00978

R1AB_LIYV9/1925-2366--------------------------------------------------------------------------------
R1AB_BYVU/2601-3046--------------------------------------------------------------------------------
Q9YPH5_9VIRU/1359-1796--------------------------------------------------------------------------------
POLN_EEVVM/2041-2488--------------------------------------------------------------------------------
E0YCR0_9CLOS/53-491--------------------------------------------------------------------------------
RDRP_TOMS1/1168-1609--------------------------------------------------------------------------------
RDRP_PSVJ/295-726--------------------------------------------------------------------------------
Q66107_9BROM/228-662--------------------------------------------------------------------------------
Q87644_SINDV/2053-2501--------------------------------------------------------------------------------
O56790_9VIRU/1323-1760--------------------------------------------------------------------------------
RDRP_CMVFN/308-738--------------------------------------------------------------------------------
Q9WJD8_PEBV/1299-1738--------------------------------------------------------------------------------
Q80875_BSMV/195-630--------------------------------------------------------------------------------
RDRP_RBDVR/1234-1674--------------------------------------------------------------------------------
RDRP_SBWMN/1373-1810--------------------------------------------------------------------------------
POLN_ONNVI/2053-2501--------------------------------------------------------------------------------
RDRP_TAV/313-742--------------------------------------------------------------------------------
POLN_MIDDV/534-981--------------------------------------------------------------------------------
RDRP_TMGMV/1163-1604--------------------------------------------------------------------------------
RDRP_TOBSV/253-689--------------------------------------------------------------------------------
RDRP_OLV2I/310-732--------------------------------------------------------------------------------
RDRP_YOMV/1155-1594--------------------------------------------------------------------------------
RDRP_AMVLE/318-752--------------------------------------------------------------------------------
POLN_RRVN/2019-2467--------------------------------------------------------------------------------
RDRP_ASPVP/1758-2169--------------------------------------------------------------------------------
O56250_9VIRU/1240-1678--------------------------------------------------------------------------------
O90699_9VIRU/1363-1800--------------------------------------------------------------------------------
Q9Q6Q3_9CLOS/62-509--------------------------------------------------------------------------------
POLN_AURAV/2038-2486--------------------------------------------------------------------------------
RDRP_BBMV/271-697--------------------------------------------------------------------------------
RDRP_CCMV/267-697--------------------------------------------------------------------------------
Q66581_EEEV/144-598--------------------------------------------------------------------------------
Q9QGG9_9BROM/363-797--------------------------------------------------------------------------------
RDRP_TMOB/1167-1614--------------------------------------------------------------------------------
RDRP_BMV/256-688--------------------------------------------------------------------------------
O40960_9CLOS/62-506--------------------------------------------------------------------------------

PF00972

Q67483_9FLAV/252-900--------------------------------------------------------------------------------
POLG_DEN4D/2738-3383--------------------------------------------------------------------------------
O09234_DEN26/2742-3387--------------------------------------------------------------------------------
POLG_YEFV1/2758-3406--------------------------------------------------------------------------------
POLG_LIV/2763-3408--------------------------------------------------------------------------------
O36764_9FLAV/2780-3428--------------------------------------------------------------------------------
POLG_MCFA/2693-3341--------------------------------------------------------------------------------

PF05919

Q6EH16_9VIRU/1-501--------------------------------------------------------------------------------
Q5TMB5_9VIRU/174-658--------------------------------------------------------------------------------
Q18L80_9VIRU/166-639--------------------------------------------------------------------------------
Q9WJ23_9VIRU/164-642--------------------------------------------------------------------------------
RDRP_CPMV1/246-745--------------------------------------------------------------------------------
Q9ZXZ7_THACU/214-754--------------------------------------------------------------------------------
Q9WJ22_9VIRU/155-622--------------------------------------------------------------------------------
Q6EH19_9VIRU/208-686--------------------------------------------------------------------------------
Q9WJ24_9VIRU/163-645--------------------------------------------------------------------------------
Q6GYC2_9VIRU/156-638--------------------------------------------------------------------------------
Q18L78_9VIRU/174-654--------------------------------------------------------------------------------
Q18L79_9VIRU/168-671--------------------------------------------------------------------------------
Q3S3F3_9VIRU/120-606--------------------------------------------------------------------------------
O92614_9VIRU/173-711--------------------------------------------------------------------------------

PF00078

POL_WDSV/812-977--------------------------------------------------------------------------------
POL_RSVP/769-938--------------------------------------------------------------------------------
O01419_BOMMO/502-756--------------------------------------------------------------------------------
O13348_MAGGR/497-764--------------------------------------------------------------------------------
O18558_AEDAE/472-725--------------------------------------------------------------------------------
O22148_ARATH/497-727--------------------------------------------------------------------------------
O22220_ARATH/221-456--------------------------------------------------------------------------------
O23410_ARATH/308-553--------------------------------------------------------------------------------
O41894_9RETR/202-360--------------------------------------------------------------------------------
O42691_ALTAL/36-202--------------------------------------------------------------------------------
O44316_DROMR/394-650--------------------------------------------------------------------------------
O47500_VENIN/326-590--------------------------------------------------------------------------------
O52209_9ZZZZ/135-366--------------------------------------------------------------------------------
O52231_STRPN/68-275--------------------------------------------------------------------------------
O62658_CANFA/517-773--------------------------------------------------------------------------------
O64428_CHLVU/554-816--------------------------------------------------------------------------------
O64612_ARATH/788-1031--------------------------------------------------------------------------------
O65244_ARATH/405-664--------------------------------------------------------------------------------
O65598_ARATH/489-747--------------------------------------------------------------------------------
O69788_RHIML/72-291--------------------------------------------------------------------------------
DPOL_WMHBV/364-590--------------------------------------------------------------------------------
O72700_9VIRU/1279-1449--------------------------------------------------------------------------------
O81068_ARATH/814-1073--------------------------------------------------------------------------------
O81284_ARATH/58-317--------------------------------------------------------------------------------
O81454_ARATH/144-304--------------------------------------------------------------------------------
O81517_ARATH/408-666--------------------------------------------------------------------------------
O81630_ARATH/874-1114--------------------------------------------------------------------------------
O82216_ARATH/238-497--------------------------------------------------------------------------------
O82276_ARATH/356-618--------------------------------------------------------------------------------
O82894_ECO57/115-332--------------------------------------------------------------------------------
O85869_SPHAR/89-369--------------------------------------------------------------------------------
O85879_SPHAR/47-327--------------------------------------------------------------------------------
POL_FFV/202-360--------------------------------------------------------------------------------
O93520_ORYLA/518-771--------------------------------------------------------------------------------
O96546_LYMDI/526-780--------------------------------------------------------------------------------
O96849_DICDI/53-215--------------------------------------------------------------------------------
O99479_PAVLU/111-389--------------------------------------------------------------------------------
O99969_PORPU/100-315--------------------------------------------------------------------------------
O99970_PORPU/100-315--------------------------------------------------------------------------------
DPOL_GSHV/413-636--------------------------------------------------------------------------------
POL_MLVAV/221-393--------------------------------------------------------------------------------
POL_HTL1A/633-804--------------------------------------------------------------------------------
POL_HTLV2/631-802--------------------------------------------------------------------------------
POL_SMRVH/71-240--------------------------------------------------------------------------------
POL_MMTVB/68-237--------------------------------------------------------------------------------
POL_CAMVC/289-452--------------------------------------------------------------------------------
AI1M_YEAST/315-577--------------------------------------------------------------------------------
AI2M_YEAST/348-613--------------------------------------------------------------------------------
POL_SRV1/74-243--------------------------------------------------------------------------------
POL_IPHA/60-229--------------------------------------------------------------------------------
POL_HV1MA/655-826--------------------------------------------------------------------------------
POL_CERV/271-436--------------------------------------------------------------------------------
YMC6_SCHPO/300-566--------------------------------------------------------------------------------
LIN1_NYCCO/516-772--------------------------------------------------------------------------------
POL_FMVD/282-445--------------------------------------------------------------------------------
LTRA_LACLM/90-361--------------------------------------------------------------------------------
POK10_HUMAN/76-245--------------------------------------------------------------------------------
POL_BAEVM/219-391--------------------------------------------------------------------------------
POL4_DROME/357-523--------------------------------------------------------------------------------
POLY_DROME/224-390--------------------------------------------------------------------------------
POL_EIAV9/249-419--------------------------------------------------------------------------------
POL_IPMA/71-240--------------------------------------------------------------------------------
POL2_MOUSE/524-780--------------------------------------------------------------------------------
POL_IPMAI/16-159--------------------------------------------------------------------------------
DPOL_WHV3/416-639--------------------------------------------------------------------------------
DPOL_HBVC3/376-600--------------------------------------------------------------------------------
YTX2_XENLA/513-765--------------------------------------------------------------------------------
RTP2_TRYBG/594-780--------------------------------------------------------------------------------
POL_SOCMV/246-411--------------------------------------------------------------------------------
POLR_DROME/403-660--------------------------------------------------------------------------------
Y2R2_DROME/498-741--------------------------------------------------------------------------------
POL_COYMV/1445-1615--------------------------------------------------------------------------------
POL_BIV29/638-806--------------------------------------------------------------------------------
RDPO_SCEOB/124-343--------------------------------------------------------------------------------
POL2_DROME/249-414--------------------------------------------------------------------------------
RT67_ECOLX/48-262--------------------------------------------------------------------------------
RTJK_DROME/502-757--------------------------------------------------------------------------------
RTJK_DROFU/502-757--------------------------------------------------------------------------------
POL_GALV/218-390--------------------------------------------------------------------------------
POL_SIVGB/659-830--------------------------------------------------------------------------------
RT86_ECOLX/53-248--------------------------------------------------------------------------------
RT65_MYXXA/155-366--------------------------------------------------------------------------------
RT16_MYXXA/186-407--------------------------------------------------------------------------------
POL_SFV1/205-363--------------------------------------------------------------------------------
POL_BLVAU/41-212--------------------------------------------------------------------------------
POL_RTBVP/1228-1390--------------------------------------------------------------------------------
POL_SIVV1/677-848--------------------------------------------------------------------------------
DPOL_HPBDC/394-564--------------------------------------------------------------------------------
POL_JSRV/74-243--------------------------------------------------------------------------------
POL_FIVT2/218-388--------------------------------------------------------------------------------
POL_CAEVC/210-380--------------------------------------------------------------------------------
YMF40_MARPO/68-333--------------------------------------------------------------------------------
P71276_ECOLX/62-269--------------------------------------------------------------------------------
P91581_CIOIN/483-644--------------------------------------------------------------------------------
P95451_PSEAC/119-326--------------------------------------------------------------------------------
Q01379_NEUCS/505-761--------------------------------------------------------------------------------
Q02717_PODAN/248-528--------------------------------------------------------------------------------
Q02718_PODAN/260-530--------------------------------------------------------------------------------
POL_SIVG1/672-843--------------------------------------------------------------------------------
Q03261_SIV/246-416--------------------------------------------------------------------------------
Q04135_DROME/496-743--------------------------------------------------------------------------------
RTF21_SCHPO/455-615--------------------------------------------------------------------------------
Q05804_ECOLX/44-235--------------------------------------------------------------------------------
Q07995_9DIPT/509-760--------------------------------------------------------------------------------
Q08525_CHICK/555-775--------------------------------------------------------------------------------
Q08724_9CYAN/108-336--------------------------------------------------------------------------------
YRD6_CAEEL/484-644--------------------------------------------------------------------------------
Q17003_ANOGA/605-832--------------------------------------------------------------------------------
Q17329_CAEEL/1071-1231--------------------------------------------------------------------------------
Q24262_DROME/531-692--------------------------------------------------------------------------------
Q24310_DROME/500-649--------------------------------------------------------------------------------
Q24335_DROME/498-745--------------------------------------------------------------------------------
Q24690_DROTE/495-742--------------------------------------------------------------------------------
Q26106_PANRE/46-203--------------------------------------------------------------------------------
Q26816_9TRYP/545-793--------------------------------------------------------------------------------
Q33759_ALLMA/266-536--------------------------------------------------------------------------------
Q35056_MARPO/399-645--------------------------------------------------------------------------------
Q35057_MARPO/544-811--------------------------------------------------------------------------------
Q35058_MARPO/623-898--------------------------------------------------------------------------------
Q35062_MARPO/369-636--------------------------------------------------------------------------------
Q46666_ECOLX/34-241--------------------------------------------------------------------------------
Q47277_ECOLX/68-288--------------------------------------------------------------------------------
Q47526_ECOLX/33-239--------------------------------------------------------------------------------
YKFC_ECOLI/86-332--------------------------------------------------------------------------------
Q65353_NPVAC/181-346--------------------------------------------------------------------------------
Q66233_9VIRU/1324-1494--------------------------------------------------------------------------------
Q69590_HBV/72-297--------------------------------------------------------------------------------
POL_HV2KR/674-845--------------------------------------------------------------------------------
POL_JEMBR/598-766--------------------------------------------------------------------------------
Q83013_9RETR/68-238--------------------------------------------------------------------------------
Q84682_9VIRU/234-395--------------------------------------------------------------------------------
Q86998_9VIRU/1297-1467--------------------------------------------------------------------------------
Q88285_9RETR/848-1015--------------------------------------------------------------------------------
Q88442_9VIRU/321-485--------------------------------------------------------------------------------
POL_CSVMV/250-413--------------------------------------------------------------------------------
Q93137_BOMMO/515-771--------------------------------------------------------------------------------
Q93139_BOMMO/469-719--------------------------------------------------------------------------------
Q94885_DROME/759-920--------------------------------------------------------------------------------
YG31B_YEAST/639-797--------------------------------------------------------------------------------
Q9YGS2_TAKRU/573-830--------------------------------------------------------------------------------
Q9YW31_MSEPV/161-406--------------------------------------------------------------------------------
Q9ZNW4_SORBI/922-1081--------------------------------------------------------------------------------
Q9ZQ09_ARATH/388-543--------------------------------------------------------------------------------
Q9ZQ67_ARATH/542-701--------------------------------------------------------------------------------
Q9ZQF8_ARATH/439-674--------------------------------------------------------------------------------
Q9ZQM0_ARATH/323-569--------------------------------------------------------------------------------
Q9ZQQ3_ARATH/508-668--------------------------------------------------------------------------------
Q9ZQQ6_ARATH/659-918--------------------------------------------------------------------------------
Q9ZS84_SOLLC/655-815--------------------------------------------------------------------------------
Q9ZTP2_MAIZE/356-516--------------------------------------------------------------------------------
Q9ZUF0_ARATH/664-923--------------------------------------------------------------------------------
Q9ZVK4_ARATH/510-669--------------------------------------------------------------------------------

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XEA3_ORYSJ/1145-1390--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
O24438_ORYLO/963-1208--------------------------------------------------------------------------------
O81903_ARATH/849-1098--------------------------------------------------------------------------------
O81506_ARATH/471-718--------------------------------------------------------------------------------
O24587_MAIZE/586-830--------------------------------------------------------------------------------
Q94KV0_ARATH/912-1157--------------------------------------------------------------------------------
O96968_BOMMO/855-1082--------------------------------------------------------------------------------
Q7XBD8_MAIZE/827-1072--------------------------------------------------------------------------------
Q9ZPU5_ARATH/845-1094--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q9FLR2_ARATH/13-261--------------------------------------------------------------------------------
Q9SIM3_ARATH/973-1222--------------------------------------------------------------------------------
Q9MAR7_ARATH/666-912--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FIC5_ARATH/965-1209--------------------------------------------------------------------------------
O23864_9ORYZ/824-1071--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
O13308_CANAX/1056-1303--------------------------------------------------------------------------------
Q9ZQE9_ARATH/863-1108--------------------------------------------------------------------------------
O23529_ARATH/992-1236--------------------------------------------------------------------------------
Q8TFJ9_DEBHN/1015-1251--------------------------------------------------------------------------------
Q8TFJ1_PICAN/942-1182--------------------------------------------------------------------------------
Q9LH44_ARATH/867-1112--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q02902_ARATH/100-349--------------------------------------------------------------------------------
Q8MRT6_DROME/232-479--------------------------------------------------------------------------------
Q967L5_AEDAE/816-1061--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q9FJV3_ARATH/986-1235--------------------------------------------------------------------------------
Q9M1C6_ARATH/853-1098--------------------------------------------------------------------------------
Q06035_VOLCA/983-1228--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q9LH08_ARATH/636-888--------------------------------------------------------------------------------
Q9ZQK0_ARATH/918-1163--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q9LVQ2_ARATH/1008-1252--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
COPIA_DROME/920-1165--------------------------------------------------------------------------------
Q9ZQE4_ARATH/762-1011--------------------------------------------------------------------------------
Q9SH77_ARATH/866-1115--------------------------------------------------------------------------------
Q9C5V1_ARATH/1163-1408--------------------------------------------------------------------------------
O82196_ARATH/663-912--------------------------------------------------------------------------------
O81617_ARATH/965-1214--------------------------------------------------------------------------------
Q8TFK0_DEBHN/833-1080--------------------------------------------------------------------------------
O81824_ARATH/740-985--------------------------------------------------------------------------------
Q94EV3_MAIZE/796-1042--------------------------------------------------------------------------------
O74246_CANAX/39-286--------------------------------------------------------------------------------
Q9ZPG3_ARATH/915-1164--------------------------------------------------------------------------------
Q9S9A8_HORVU/828-1073--------------------------------------------------------------------------------
Q9ZRJ0_TOBAC/841-1089--------------------------------------------------------------------------------
Q8W0U0_SORBI/619-868--------------------------------------------------------------------------------
Q9FZK7_ARATH/1051-1296--------------------------------------------------------------------------------
Q94IU9_ARATH/904-1149--------------------------------------------------------------------------------
O74218_CANAX/999-1239--------------------------------------------------------------------------------
Q9FLA4_ARATH/947-1191--------------------------------------------------------------------------------
Q9C7Y1_ARATH/852-1097--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q9SHT5_ARATH/807-1052--------------------------------------------------------------------------------
O22452_VOLCA/568-813--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q9FFM0_ARATH/852-1101--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q9SZY0_ARATH/766-1015--------------------------------------------------------------------------------
Q8WRX5_ANOGA/458-703--------------------------------------------------------------------------------
Q7XE22_ORYSJ/452-697--------------------------------------------------------------------------------
O23588_ARATH/943-1192--------------------------------------------------------------------------------
O65452_ARATH/626-870--------------------------------------------------------------------------------
Q9ZUJ1_ARATH/925-1170--------------------------------------------------------------------------------
O49140_ARATH/968-1213--------------------------------------------------------------------------------
Q9FWZ5_ARATH/918-1163--------------------------------------------------------------------------------
Q94HW2_ARATH/982-1228--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q9C536_ARATH/832-1077--------------------------------------------------------------------------------
O22175_ARATH/1013-1257--------------------------------------------------------------------------------
O42838_SACPA/1146-1386--------------------------------------------------------------------------------
Q9MAK6_ARATH/832-1077--------------------------------------------------------------------------------
Q9M1F5_ARATH/873-1122--------------------------------------------------------------------------------
Q9FJA1_ARATH/460-702--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
O82493_ARATH/823-1068--------------------------------------------------------------------------------
O04543_ARATH/827-1076--------------------------------------------------------------------------------
O65147_SOYBN/1068-1313--------------------------------------------------------------------------------
Q9SLF0_ARATH/850-1094--------------------------------------------------------------------------------
Q9XII7_ARATH/966-1215--------------------------------------------------------------------------------
Q9M5J7_PICGL/100-347--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q9LJ55_ARATH/735-980--------------------------------------------------------------------------------
Q9FX79_ARATH/941-1190--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q949J4_SOLLC/397-647--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q8TFI1_SACEX/864-1104--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
POLX_TOBAC/840-1088--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------

PF02123

RDRP_SCPMV/464-849................................................................................
RDRP_SBMVA/490-847................................................................................
RDRP_SCVLB/833-1303LRALPD................REKEVFISLVLNYNGLGREWLKSEGVRAKQAQ..........................
RDRP_PLRVW/609-1004................................................................................
Q9JE94_9VIRU/129-560GEVL....................WMLRCPISIIVNISRAICRNDSFLKDLSDFN.........................
RDRP_PEMVW/733-1124................................................................................
RDRP_HV19S/122-585AQTY......................KARFGSEGVAWAIASVRQPENAKGLSNAL.........................
O55590_9REOV/25-748FHNNKSKTKTDQE.FAKLYRRESLFRIVASTVNKYGVPRHDQKYRYTYDVMKDKPYYLVTWANSSIEILMSVHDHNDYLI
RDRP_ROTHC/32-749ISEMKLNNIKN......AARLEKLFTIIAATINKYGMPRHNTRYRYEWETMKNKPYHLAAWINSSIEMIACVVDHHTYMI
Q90155_9VIRU/96-539QQCALMW..............SLPKLIINKIISGVCDALTEKVSLTLLKRISDWL.........................
Q90193_9VIRU/400-785................................................................................
Q83093_9VIRU/433-816................................................................................
RDRP_ROTGI/37-803AVTSRLEIYSYEQKKALRYLLRTIEKCYNEGYLEMSRDRKWSHTLPELRTLTFRLYNSKVIHAACAMISLVHANPIDYEF
RDRP_TYYVF/580-974................................................................................
Q99AT3_9VIRU/99-573GYGL......................RAQAVPDAMHVAATLATTPDLAKALTNFL.........................
Q98XW8_9VIRU/144-622AQAV.....................MLEFGFEESLYLATWAVLRAKQAKALSDVL.........................
Q66150_9VIRU/22-408................................................................................
Q86519_9VIRU/516-902................................................................................
RDRP_PCVC/362-832MNT.............................................................................
Q90153_9VIRU/1024-1530GKGL.......................YQTNEDDWVAKAKSIHDDLRKHGYPPHV.........................
Q87025_SCVLA/177-657VLTLSE................KFVPIFLDSRAIWVGEPGPDALTARLKASSGQI.........................
Q9YXE6_9VIRU/120-589AHGL......................VACYGQKGYDIAAWLVLRPAAAKGISTAI.........................
Q83073_9VIRU/49-523SIST...................LKHCDVHVAMAYAIAAVRDLTQSVIADLSDVL.........................
Q9YXE4_9VIRU/99-573GTAL......................QAKGVQNGYHAATALIANPEYAKDMTTVL.........................
Q8V615_9VIRU/41-473LELL....................RIAGVPSKLLPIIGQAIANKDPFIKELSDFN.........................
RDRP_LRVLG/155-619AVAA...................HNVQGFGARFCVLWALMCVRIAGFADDINIYI.........................
Q65969_9LUTE/603-996................................................................................
RDRP_ROTPY/25-748LERHSNDVGDAN...KVYRRRLDLFIIVASTINKYGVPRHNEKYRYEYEVMKDKPYYLVTWANSAIEMLMSVFSHEDYLI

PF00680

POLG_HAVHM/1750-2215--------------------------------------------------------------------------------
RDRP_BPPH6/19-638--------------------------------------------------------------------------------
POLG_PYFV1/2270-2778--------------------------------------------------------------------------------
POL1_BAYMG/1634-2107--------------------------------------------------------------------------------
POL1_CPMVS/1186-1687--------------------------------------------------------------------------------
POLG_FCVC6/1262-1736--------------------------------------------------------------------------------
POL1_RCMV/1182-1684--------------------------------------------------------------------------------
POL1_GCMV/1454-1960--------------------------------------------------------------------------------
POLG_WMV2U/237-705--------------------------------------------------------------------------------
POLG_LORDV/1209-1676--------------------------------------------------------------------------------
POL1_BRSV/1468-1975--------------------------------------------------------------------------------
POLG_HE701/1750-2193--------------------------------------------------------------------------------
POL1_CPSMV/1177-1679--------------------------------------------------------------------------------
Q94M06_9VIRU/64-655--------------------------------------------------------------------------------
Q9MC15_9VIRU/40-607--------------------------------------------------------------------------------
POLG_TUMVQ/2376-2844--------------------------------------------------------------------------------
POLG_OMV/383-852--------------------------------------------------------------------------------
POLG_RHDVF/1279-1750--------------------------------------------------------------------------------
POLG_PVYHU/2293-2761--------------------------------------------------------------------------------
POLG_PSBMV/2413-2881--------------------------------------------------------------------------------
POLG_SMSV1/1376-1852--------------------------------------------------------------------------------
POLG_TEV/2297-2761--------------------------------------------------------------------------------
POLG_HRV8A/1721-2162--------------------------------------------------------------------------------
POLG_PEMVC/2294-2762--------------------------------------------------------------------------------
POLG_TMEVB/1854-2301--------------------------------------------------------------------------------
POLG_BOVEV/1731-2174--------------------------------------------------------------------------------
POL1_APMV/57-557--------------------------------------------------------------------------------
POLG_CXA21/1762-2205--------------------------------------------------------------------------------
POLG_PPVD/2311-2779--------------------------------------------------------------------------------
POLG_EMCV/1842-2288--------------------------------------------------------------------------------
POLG_TVMV/2260-2728--------------------------------------------------------------------------------
POLG_SOUV3/1299-1766--------------------------------------------------------------------------------
POLG_CXA9/1756-2200--------------------------------------------------------------------------------
POLG_FMDV1/1875-2327--------------------------------------------------------------------------------
POLG_HRV14/1736-2178--------------------------------------------------------------------------------
POLG_HRV1B/1714-2156--------------------------------------------------------------------------------
POLG_PRSVH/2537-3005--------------------------------------------------------------------------------
Q9FZT2_9VIRU/64-684--------------------------------------------------------------------------------
POL1_GFLV/1488-1974--------------------------------------------------------------------------------

PF00998

RDRP_TNVA/224-703--------------------------------------------------------------------------------
RDRP_TCV/272-752--------------------------------------------------------------------------------
RDRP_TNVD/224-709--------------------------------------------------------------------------------
RDRP_MCMVK/460-941--------------------------------------------------------------------------------
POLG_HCVEU/2430-2941--------------------------------------------------------------------------------
POLG_HCVED/2420-2931--------------------------------------------------------------------------------
POLG_HCVJL/2434-2945--------------------------------------------------------------------------------
POLG_HCVJK/2431-2942--------------------------------------------------------------------------------
POLG_HCVEV/2426-2937--------------------------------------------------------------------------------
POLG_HCVJ6/2445-2956--------------------------------------------------------------------------------
Q9IR83_9TOMB/236-712--------------------------------------------------------------------------------
Q87031_9LUTE/24-502--------------------------------------------------------------------------------
RDRP_POLVP/251-722--------------------------------------------------------------------------------
Q65987_9TOMB/269-750--------------------------------------------------------------------------------
P90338_9TOMB/1-480--------------------------------------------------------------------------------
RDRP_BYDV1/361-840--------------------------------------------------------------------------------
O09796_9HEPC/2422-2933--------------------------------------------------------------------------------
O09803_9FLAV/2373-2866--------------------------------------------------------------------------------
O37361_9VIRU/252-737--------------------------------------------------------------------------------
Q9WJD9_CARMV/267-744--------------------------------------------------------------------------------
Q83103_9TOMB/228-711--------------------------------------------------------------------------------
Q66127_9VIRU/52-520--------------------------------------------------------------------------------
RDRP_PMVK/447-937--------------------------------------------------------------------------------
POLG_GBVB/2277-2785--------------------------------------------------------------------------------
Q89801_9TOMB/1-479--------------------------------------------------------------------------------
Q9IRA1_9TOMB/266-741--------------------------------------------------------------------------------
O12301_9TOMB/231-708--------------------------------------------------------------------------------
Q83424_MNSV/290-772--------------------------------------------------------------------------------
O41892_9FLAV/2409-2899--------------------------------------------------------------------------------
RDRP_OCSVU/235-734--------------------------------------------------------------------------------
Q9IW60_9TOMB/325-800--------------------------------------------------------------------------------
Q96898_9FLAV/2396-2886--------------------------------------------------------------------------------
RDRP_RCNMV/260-745--------------------------------------------------------------------------------

PF00978

R1AB_LIYV9/1925-2366--------------------------------------------------------------------------------
R1AB_BYVU/2601-3046--------------------------------------------------------------------------------
Q9YPH5_9VIRU/1359-1796--------------------------------------------------------------------------------
POLN_EEVVM/2041-2488--------------------------------------------------------------------------------
E0YCR0_9CLOS/53-491--------------------------------------------------------------------------------
RDRP_TOMS1/1168-1609--------------------------------------------------------------------------------
RDRP_PSVJ/295-726--------------------------------------------------------------------------------
Q66107_9BROM/228-662--------------------------------------------------------------------------------
Q87644_SINDV/2053-2501--------------------------------------------------------------------------------
O56790_9VIRU/1323-1760--------------------------------------------------------------------------------
RDRP_CMVFN/308-738--------------------------------------------------------------------------------
Q9WJD8_PEBV/1299-1738--------------------------------------------------------------------------------
Q80875_BSMV/195-630--------------------------------------------------------------------------------
RDRP_RBDVR/1234-1674--------------------------------------------------------------------------------
RDRP_SBWMN/1373-1810--------------------------------------------------------------------------------
POLN_ONNVI/2053-2501--------------------------------------------------------------------------------
RDRP_TAV/313-742--------------------------------------------------------------------------------
POLN_MIDDV/534-981--------------------------------------------------------------------------------
RDRP_TMGMV/1163-1604--------------------------------------------------------------------------------
RDRP_TOBSV/253-689--------------------------------------------------------------------------------
RDRP_OLV2I/310-732--------------------------------------------------------------------------------
RDRP_YOMV/1155-1594--------------------------------------------------------------------------------
RDRP_AMVLE/318-752--------------------------------------------------------------------------------
POLN_RRVN/2019-2467--------------------------------------------------------------------------------
RDRP_ASPVP/1758-2169--------------------------------------------------------------------------------
O56250_9VIRU/1240-1678--------------------------------------------------------------------------------
O90699_9VIRU/1363-1800--------------------------------------------------------------------------------
Q9Q6Q3_9CLOS/62-509--------------------------------------------------------------------------------
POLN_AURAV/2038-2486--------------------------------------------------------------------------------
RDRP_BBMV/271-697--------------------------------------------------------------------------------
RDRP_CCMV/267-697--------------------------------------------------------------------------------
Q66581_EEEV/144-598--------------------------------------------------------------------------------
Q9QGG9_9BROM/363-797--------------------------------------------------------------------------------
RDRP_TMOB/1167-1614--------------------------------------------------------------------------------
RDRP_BMV/256-688--------------------------------------------------------------------------------
O40960_9CLOS/62-506--------------------------------------------------------------------------------

PF00972

Q67483_9FLAV/252-900--------------------------------------------------------------------------------
POLG_DEN4D/2738-3383--------------------------------------------------------------------------------
O09234_DEN26/2742-3387--------------------------------------------------------------------------------
POLG_YEFV1/2758-3406--------------------------------------------------------------------------------
POLG_LIV/2763-3408--------------------------------------------------------------------------------
O36764_9FLAV/2780-3428--------------------------------------------------------------------------------
POLG_MCFA/2693-3341--------------------------------------------------------------------------------

PF05919

Q6EH16_9VIRU/1-501------------------MKLRLKGSL..........KAGP..-------....NGKISLLT----------SLLDALAF
Q5TMB5_9VIRU/174-658------------------TPLEFKKYHFST.......HREP..-------.....NGHAISS----------VLNDALSY
Q18L80_9VIRU/166-639------------------LDFKISSTMAPW....LIQSSGPCS-------KKGCNNTEGWLT----------AIRRLKHL
Q9WJ23_9VIRU/164-642------------------LQWSRDDHYLSF.......KSSP..-------.....NGQSTLH----------SSYGLFSM
RDRP_CPMV1/246-745------------------LKLKITGSM..........KAGP..-------....NGKISLLT----------SSVDALSF
Q9ZXZ7_THACU/214-754------------------FNKLDKKSLAPT.KFIMSRSASP..-------....SNKVSWFG----------ILTDTRLL
Q9WJ22_9VIRU/155-622------------------PIYTDNDHYLSI.......KGSP..-------.....NGKASMS----------SLYSIISF
Q6EH19_9VIRU/208-686------------------FEPTDWKFRWVV.......TAGP..-------.....NGPSISS----------CLQDLPKF
Q9WJ24_9VIRU/163-645------------------VQWDVKNFKLLT.......KAGP..-------.....HGPQSLT----------WYHTIKLY
Q6GYC2_9VIRU/156-638------------------SEFDDSNHFVSV.......KSSP..-------.....TGPSTLT----------ALWGLWNH
Q18L78_9VIRU/174-654------------------FKKEDINDPYSVNRLMDITKAGP..-------....NGGVSLRN----------VIIDAYAL
Q18L79_9VIRU/168-671------------------VPFKISDLLNPF....LIYSSGPCS-------PKGMNNTAGWIL----------AFRRLKAL
Q3S3F3_9VIRU/120-606------------------PTYDLSKHYLSP.......KGGP..-------.....MGKSTWS----------SIWSMYAL
O92614_9VIRU/173-711------------------PKGRSKHLLTLSNPIIYLLSAGP..-------....NHSISMMG----------IWKDIYAW

PF00078

POL_WDSV/812-977------------------IKKAG.......-----...RDE--------------YRM..I.----------........
POL_RSVP/769-938------------------IRKAS.......-----....GS--------------YRL..L.----------........
O01419_BOMMO/502-756------------------IPKEGRP.....-----RDQPSG--------------YRP..IV----------VL......
O13348_MAGGR/497-764------------------LPKTGKKD....-----RSSVRS--------------WRP..IA----------LL......
O18558_AEDAE/472-725------------------IPKGGRAS....-----YEEAKS--------------FRP..IS----------LT......
O22148_ARATH/497-727------------------KAEKM.......-----....TD--------------FRP..IS----------LC......
O22220_ARATH/221-456------------------IPKITKP.....-----.ARMAD--------------IRP..IS----------LC......
O23410_ARATH/308-553------------------LAKVAKP.....-----.ERITQ--------------FRP..VS----------LC......
O41894_9RETR/202-360------------------VPKAD.......-----....GR--------------WRMVL..----------........
O42691_ALTAL/36-202------------------VRDPTTG.....-----.GRSGQ--------------LRLVI..----------........
O44316_DROMR/394-650------------------IPKTVRA.....-----.NRPQD--------------FRP..IS----------VP......
O47500_VENIN/326-590------------------IPKAS.......-----....GG--------------SRP..LS----------IA......
O52209_9ZZZZ/135-366------------------IPKAD.......-----....GK--------------QRP..LG----------IA......
O52231_STRPN/68-275------------------IPKPD.......-----....GG--------------IRQ..LG----------IP......
O62658_CANFA/517-773------------------IPKPDKD.....-----PTKKEN--------------YRP..IS----------LM......
O64428_CHLVU/554-816------------------LYKGKGAD....-----RESLAS--------------YRP..IT----------LL......
O64612_ARATH/788-1031------------------YAKEM.......-----....KD--------------YRP..IS----------CC......
O65244_ARATH/405-664------------------IPKKKEA.....-----.KEMKD--------------YRP..IS----------CC......
O65598_ARATH/489-747------------------IPKFPNA.....-----.SCTSD--------------FRP..IS----------CM......
O69788_RHIML/72-291------------------IPKKA.......-----....GG--------------ERV..LG----------VP......
DPOL_WMHBV/364-590------------------VDKNPH......-----..NATE--------------SRLVV..----------........
O72700_9VIRU/1279-1449------------------VESGTEVDPMTG-----KERRGK--------------ERLVF..----------........
O81068_ARATH/814-1073------------------IPKKDEA.....-----.IEMKD--------------YRP..IS----------CC......
O81284_ARATH/58-317------------------IPKVPGA.....-----.DQLNL--------------FRP..VA----------CC......
O81454_ARATH/144-304------------------VPKKD.......-----....GT--------------WRMCL..----------........
O81517_ARATH/408-666------------------IPKITNA.....-----.SSMSD--------------FRP..IS----------CL......
O81630_ARATH/874-1114------------------IPKITNP.....-----.ETLSD--------------YRP..IA----------LC......
O82216_ARATH/238-497------------------IPKKKEA.....-----.REIKD--------------YRP..IS----------CC......
O82276_ARATH/356-618------------------IAKVAKP.....-----.ERIQQ--------------FRP..VS----------LC......
O82894_ECO57/115-332------------------IPKSN.......-----....GK--------------SRP..LG----------IP......
O85869_SPHAR/89-369------------------IPKAN.......-----....GQ--------------KRP..LG----------VP......
O85879_SPHAR/47-327------------------IPKGK.......-----....GK--------------RRP..LG----------IP......
POL_FFV/202-360------------------VPKPN.......-----....GR--------------WRMVL..----------........
O93520_ORYLA/518-771------------------IPKEGKD.....-----RLDCAN--------------YRP..VS----------VL......
O96546_LYMDI/526-780------------------IHKPGKR.....-----RTEPSS--------------YRP..IS----------LL......
O96849_DICDI/53-215------------------KPGT........-----....NL--------------HRPVL..----------........
O99479_PAVLU/111-389------------------IPKPN.......-----....GG--------------IRY..LG----------IS......
O99969_PORPU/100-315------------------IPKPN.......-----....GS--------------VRN..LG----------IP......
O99970_PORPU/100-315------------------ILKPN.......-----....GK--------------ERH..LG----------IP......
DPOL_GSHV/413-636------------------LVDKNP......-----.YNSSE--------------SRLVV..----------........
POL_MLVAV/221-393------------------VKKPG.......-----...TND--------------YRPVQ..----------........
POL_HTL1A/633-804------------------VKKAN.......-----....GT--------------WRFIH..----------........
POL_HTLV2/631-802------------------VKKPN.......-----....GK--------------WRFIH..----------........
POL_SMRVH/71-240------------------IKKKS.......-----....GS--------------WRLLQ..----------........
POL_MMTVB/68-237------------------IKKKS.......-----....GK--------------WRLLQ..----------........
POL_CAMVC/289-452------------------VNNEAE......-----.KRRGK--------------KRMVV..----------........
AI1M_YEAST/315-577------------------IPKPK.......-----....GG--------------MRP..LS----------VG......
AI2M_YEAST/348-613------------------IPKTS.......-----....GG--------------FRP..LS----------VG......
POL_SRV1/74-243------------------IKKKS.......-----....GK--------------WRLLQ..----------........
POL_IPHA/60-229------------------IKKKS.......-----....GK--------------WRLLH..----------........
POL_HV1MA/655-826------------------IKKKD.......-----...STK--------------WRKLV..----------........
POL_CERV/271-436------------------VENEAE......-----.RRRGK--------------KRMVV..----------........
YMC6_SCHPO/300-566------------------IDKAS.......-----....GG--------------KRP..LT----------IG......
LIN1_NYCCO/516-772------------------IPKPGKD.....-----PTRKEN--------------YRP..IS----------LM......
POL_FMVD/282-445------------------VENEAE......-----.RRRGK--------------KRMVV..----------........
LTRA_LACLM/90-361------------------AKKNS.......-----....KK--------------MRP..LG----------IP......
POK10_HUMAN/76-245------------------IQKKS.......-----....GK--------------WHTLT..----------........
POL_BAEVM/219-391------------------VKKPG.......-----...TQD--------------YRPVQ..----------........
POL4_DROME/357-523------------------VPKKSSP.....-----NSDKKK--------------WRLVI..----------........
POLY_DROME/224-390------------------VDKKGTD.....-----AFGNPN--------------KRLVI..----------........
POL_EIAV9/249-419------------------IKKRS.......-----....GK--------------WRLLQ..----------........
POL_IPMA/71-240------------------IKKKS.......-----....GK--------------WRLLH..----------........
POL2_MOUSE/524-780------------------IPKPQKD.....-----PTKIEN--------------FRP..IS----------LM......
POL_IPMAI/16-159------------------LPNM........-----....GK--------------Y.L....----------........
DPOL_WHV3/416-639------------------LVDKNP......-----.NNSSE--------------SRLVV..----------........
DPOL_HBVC3/376-600------------------VDKNPH......-----..NTTE--------------SRL..V.----------........
YTX2_XENLA/513-765------------------LPKKGDL.....-----.RLIKN--------------WRP..VS----------LL......
RTP2_TRYBG/594-780------------------VWAK........-----....LA--------------SHI.A..----------........
POL_SOCMV/246-411------------------VENHNE......-----.IKRGK--------------RRMVI..----------........
POLR_DROME/403-660------------------IPKTVTA.....-----.KRPQD--------------FRP..IS----------VP......
Y2R2_DROME/498-741------------------LLKGPDKD....-----KCEPSS--------------YRG..IC----------LL......
POL_COYMV/1445-1615------------------VRSGTEIDPITG-----KEKKGK--------------ERMVF..----------........
POL_BIV29/638-806------------------IKKKG.......-----...TGR--------------WRMLM..----------........
RDPO_SCEOB/124-343------------------IPKRD.......-----....GS--------------ARP..LS----------IP......
POL2_DROME/249-414------------------VPKKPDA.....-----.SGANK--------------YRVVI..----------........
RT67_ECOLX/48-262------------------IPKKG.......-----....KG--------------VRT..IS----------AP......
RTJK_DROME/502-757------------------IHKTGKT.....-----PTDVDS--------------YRP..TS----------LL......
RTJK_DROFU/502-757------------------ILKPGKQ.....-----PLDVDS--------------YRP..TS----------LL......
POL_GALV/218-390------------------VKKPG.......-----...TND--------------YRPVQ..----------........
POL_SIVGB/659-830------------------IKKKD.......-----...KNE--------------WRKLI..----------........
RT86_ECOLX/53-248------------------VEKKG.......-----....PE--------------KRMRTIY----------QP......
RT65_MYXXA/155-366------------------VPKRS.......-----....GG--------------VRL..LH----------AP......
RT16_MYXXA/186-407------------------IPKRD.......-----....GS--------------KRT..IT----------SP......
POL_SFV1/205-363------------------VPKPD.......-----....GK--------------WRMVL..----------........
POL_BLVAU/41-212------------------VRKPN.......-----....GA--------------WRFVH..----------........
POL_RTBVP/1228-1390------------------VRNHSE......-----.EVAQK--------------PRIVY..----------........
POL_SIVV1/677-848------------------IRKKD.......-----...KSQ--------------WRMLV..----------........
DPOL_HPBDC/394-564------------------VDKNSR......-----..NTTE--------------ARLVV..----------........
POL_JSRV/74-243------------------IKKKS.......-----....GK--------------WRLLQ..----------........
POL_FIVT2/218-388------------------IKKKS.......-----....GK--------------WRMLI..----------........
POL_CAEVC/210-380------------------IKKKS.......-----....GK--------------WRMLI..----------........
YMF40_MARPO/68-333------------------IPKAD.......-----....GK--------------LRS..LG----------IP......
P71276_ECOLX/62-269------------------IPKID.......-----....GS--------------KRI..VY----------SL......
P91581_CIOIN/483-644------------------AREGS.......-----....KK--------------PRMVI..----------........
P95451_PSEAC/119-326------------------IPKPQ.......-----....GG--------------TRQ..LG----------IP......
Q01379_NEUCS/505-761------------------LKKPGKSAA..Q-----QKLAGA--------------WRP..IS----------LL......
Q02717_PODAN/248-528------------------IPKAN.......-----....GK--------------MRP..LG----------IA......
Q02718_PODAN/260-530------------------IPKAN.......-----....GK--------------TRP..LG----------IP......
POL_SIVG1/672-843------------------IKKKD.......-----...KTQ--------------WRMLV..----------........
Q03261_SIV/246-416------------------IRKKD.......-----...KKK--------------WRMLI..----------........
Q04135_DROME/496-743------------------IPKPGKD.....-----KTQPSS--------------YRP..IS----------LL......
RTF21_SCHPO/455-615------------------VPKKE.......-----....GT--------------LRMVV..----------........
Q05804_ECOLX/44-235------------------LSKRH.......-----....GG--------------QRLVL..----------AP......
Q07995_9DIPT/509-760------------------IPKHGKP.....-----ASELSS--------------YRP..IS----------LL......
Q08525_CHICK/555-775------------------IYKKGSK.....-----.EDPGN--------------YRP..VS----------LT......
Q08724_9CYAN/108-336------------------IPKPG.......-----...NVE--------------KRP..LG----------IP......
YRD6_CAEEL/484-644------------------IKKKG.......-----...TGK--------------IRVCA..----------........
Q17003_ANOGA/605-832------------------IYKKGDR.....-----.TDAIN--------------YRG..IT----------SL......
Q17329_CAEEL/1071-1231------------------VKKKD.......-----....GS--------------IRMCI..----------........
Q24262_DROME/531-692------------------VRKKD.......-----....GT--------------LRVCV..----------........
Q24310_DROME/500-649------------------VKKKN.......-----....GT--------------DRLCV..----------........
Q24335_DROME/498-745------------------IPKPGKN.....-----HTVASS--------------YRP..IS----------LL......
Q24690_DROTE/495-742------------------ILKPNTD.....-----KTKTTS--------------YRP..IS----------LN......
Q26106_PANRE/46-203------------------KCRLV.......-----....MD--------------LTT.V..----------........
Q26816_9TRYP/545-793------------------ILKAGKK.....-----AEDLDS--------------YRP..VT----------LT......
Q33759_ALLMA/266-536------------------KKKTN.......-----....GK--------------MRP..LG----------IP......
Q35056_MARPO/399-645------------------KPGKRE......-----..KISL--------------GIPCF..----------........
Q35057_MARPO/544-811------------------KTGK........-----....AE--------------KRP..LT----------IA......
Q35058_MARPO/623-898------------------ITSPRD......-----.KIIQQ--------------AFKRI..----------........
Q35062_MARPO/369-636------------------KPGK........-----....KE--------------KRP..LG----------INSPVKQK
Q46666_ECOLX/34-241------------------IPKRT.......-----....TG--------------FRV..IA----------QP......
Q47277_ECOLX/68-288------------------IPKKL.......-----....GG--------------ERI..LG----------IP......
Q47526_ECOLX/33-239------------------IPKRT.......-----....IG--------------YRI..IA----------QP......
YKFC_ECOLI/86-332------------------IPKSN.......-----....GK--------------LRP..LG----------IP......
Q65353_NPVAC/181-346------------------VPKKIDA.....-----.SGKQK--------------WRLVV..----------........
Q66233_9VIRU/1324-1494------------------VESGTVIDPVTK-----KTIHGK--------------ERLVF..----------........
Q69590_HBV/72-297------------------LVDKNP......-----.HNTAE--------------SRLVV..----------........
POL_HV2KR/674-845------------------IKKKD.......-----...KNK--------------WRMLI..----------........
POL_JEMBR/598-766------------------IKKKG.......-----...GSK--------------WRMLM..----------........
Q83013_9RETR/68-238------------------IQKKD.......-----...KSK--------------FRMLH..----------........
Q84682_9VIRU/234-395------------------VENHNE......-----.IKRGK--------------RRL.V..----------........
Q86998_9VIRU/1297-1467------------------VESGTSIDPKTG-----KEIRGK--------------PRLVF..----------........
Q88285_9RETR/848-1015------------------VGKPD.......-----....GS--------------WRLTI..----------........
Q88442_9VIRU/321-485------------------VRNHAE......-----.IKRGK--------------ARMVI..----------........
POL_CSVMV/250-413------------------VNKHSE......-----.QKRGK--------------TRMVI..----------........
Q93137_BOMMO/515-771------------------KPKND.......-----...PTS--------------YRP..IS----------LL......
Q93139_BOMMO/469-719------------------LRKSGKDS....-----YTEPKS--------------HRP..IG----------LL......
Q94885_DROME/759-920------------------VKKKT.......-----....GD--------------LRMCV..----------........
YG31B_YEAST/639-797------------------VPKKD.......-----....GT--------------FRLCV..----------........
Q9YGS2_TAKRU/573-830------------------LLKKPSLD....-----PDVLAN--------------YRP..IS----------NL......
Q9YW31_MSEPV/161-406------------------IHKNGDK.....-----.NICNN--------------YRG..IN----------LI......
Q9ZNW4_SORBI/922-1081------------------PKKN........-----....GK--------------MRMCI..----------........
Q9ZQ09_ARATH/388-543------------------LMSA........-----....EK--------------KTNRF..----------........
Q9ZQ67_ARATH/542-701------------------KKKN........-----....DK--------------WRVCI..----------........
Q9ZQF8_ARATH/439-674------------------IPKTERP.....-----.RKMAE--------------FRP..IS----------LC......
Q9ZQM0_ARATH/323-569------------------SLKRM.......-----....VD--------------YRP..IA----------LC......
Q9ZQQ3_ARATH/508-668------------------VKKKN.......-----....GK--------------DRVCI..----------........
Q9ZQQ6_ARATH/659-918------------------IPKKDEA.....-----.TLMRD--------------YRP..IS----------CC......
Q9ZS84_SOLLC/655-815------------------QKKQD.......-----....GT--------------MRMCV..----------........
Q9ZTP2_MAIZE/356-516------------------VKKAN.......-----....GK--------------WRMCI..----------........
Q9ZUF0_ARATH/664-923------------------ISKKHEV.....-----.SGMKD--------------YRP..IS----------CC......
Q9ZVK4_ARATH/510-669------------------KKKD........-----....GS--------------FRLCI..----------........

PF07727

Q7G640_ORYSJ/781-1029------------NGTWELVHLLK----------------QK--------------.KPVHCK----------WIFKRKEG
Q7XEA3_ORYSJ/1145-1390------------NKTWRLVDLPS----------------GH--------------.RPIGLK----------WVYKLKKD
Q7XLN3_ORYSJ/465-703------------RDVFLPVMPTC----------------RG--------------FFPVGYK----------WVFVRKRN
O24438_ORYLO/963-1208------------NDTWHLVPYEK----------------GQ--------------.NIIGCK----------WVYKIKRK
O81903_ARATH/849-1098------------NGTWDIVEWPK----------------EQ--------------.KVISCR----------WLFKLKPG
O81506_ARATH/471-718------------NKVWTLVDLPD----------------GV--------------.KPIECK----------WIFKKKID
O24587_MAIZE/586-830------------NEVWTLVPRPK----------------.Q--------------.NVVGTK----------WVFRNKQD
Q94KV0_ARATH/912-1157------------LHTWSLVQPTE----------------DM--------------.NILGCR----------WVFKTKLK
O96968_BOMMO/855-1082------------LETWEEATLPM----------------GS--------------.KAIDTK----------WVFRTKQN
Q7XBD8_MAIZE/827-1072------------NGTWEITDLPA----------------GC--------------.KPVGCK----------WIFRRKRR
Q9ZPU5_ARATH/845-1094------------NHTWDLVTKPE----------------KV--------------.KLIGCR----------WVFTRKAG
Q7XTU6_ORYSJ/940-1185------------NQTWSLAELPA----------------GH--------------.KAIGLK----------WVYKLKKD
Q9FLR2_ARATH/13-261------------NKTWSVVSLPP----------------NK--------------.NVVGCK----------WVYTIEYN
Q9SIM3_ARATH/973-1222------------TDTWEITSLPP----------------GK--------------.KAVGCK----------WVFTVKFH
Q9MAR7_ARATH/666-912------------NDTWNLMELPL----------------GI--------------.KPIGLK----------WVFKIKRN
Q7XKS1_ORYSJ/160-403------------TCTWDLVPLPS----------------HA--------------.RPITCK----------WIYKIKTR
Q9FIC5_ARATH/965-1209------------LGTWTVEDLPP----------------GK--------------.KALGCK----------WVFRLKYK
O23864_9ORYZ/824-1071------------NQVWNLVDPPD----------------GV--------------.KTIECK----------WLFKKKAD
Q9FWI2_ORYSJ/795-1030------------NNTWELVDRPR----------------DR--------------.KVIGVK----------WVYKTKLN
O13308_CANAX/1056-1303------------KDVYEEVPIPT----------------GV--------------.KPISMG----------WVHTEKID
Q9ZQE9_ARATH/863-1108------------NRTWKLVDKPE----------------KK--------------.NVISVK----------WIYKIKTD
O23529_ARATH/992-1236------------NHTWDLVP.HE----------------SQ--------------.LLVGCK----------WVFKLKYL
Q8TFJ9_DEBHN/1015-1251------------NNTWDLVSLPK----------------DR--------------.KAIGNR----------WVFTKK..
Q8TFJ1_PICAN/942-1182------------NKTWSLVPLPK----------------GR--------------.RALGCR----------WVFTEKL.
Q9LH44_ARATH/867-1112------------NKTWEVVARPK----------------DK--------------.NVISVK----------WIFRLKTD
Q94I36_ORYSJ/864-1109------------NKDWTLVEPPS----------------GH--------------.NIIGTK----------WVFKNKQN
Q02902_ARATH/100-349------------NGTWVLVDKPK----------------DR--------------.KIIGCR----------WLFKMKSG
Q8MRT6_DROME/232-479------------NETWKLADLPR----------------NR--------------.RCVACK----------WVYSLKRD
Q967L5_AEDAE/816-1061------------NGTWELVPLPP----------------GR--------------.KPVGSK----------WIFKVKRN
Q7G6C9_ORYSJ/1047-1286------------NQVWTLVERPK----------------.Q--------------.NVIGTK----------WIFRNKQD
Q94LQ7_ORYSJ/550-793------------NKTWHRVPSKK----------------GQ--------------.NIIDCK----------WVYKVKRK
Q9FJV3_ARATH/986-1235------------TNTWSVCSLPQ----------------GK--------------.KPIGCK----------WVFKVKLN
Q9M1C6_ARATH/853-1098------------NNTWELTTLPK----------------GF--------------.TPIGVK----------WVYKTKLN
Q06035_VOLCA/983-1228------------NEVWRLEIPPK----------------SV--------------.RPLPVK----------WVFSLKKD
Q7XKG6_ORYSJ/514-759------------NKTWELVPFPT----------------GK--------------.KVVSCK----------WVNAVKQD
Q9LH08_ARATH/636-888------------RDVFGPILRTP----------------SN--------------IKPVGHK----------WVFVRKRN
Q9ZQK0_ARATH/918-1163------------NHTWDEDELPR----------------GK--------------.KVVTSK----------WVFAIKYK
Q7X5X4_ORYSJ/138-383------------NGTWELVPRHA----------------GH--------------.CPIGLK----------WVFKVKCD
Q9LVQ2_ARATH/1008-1252------------NKTWDIVDLPT----------------GK--------------.VAIGSQ----------WVYKTKFN
Q84M55_ORYSJ/910-1155------------NKTWELVKLPP----------------EK--------------.RAVGCK----------WVFTVKQT
COPIA_DROME/920-1165------------NNTWTITKRPE----------------NK--------------.NIVDSR----------WVFSVKYN
Q9ZQE4_ARATH/762-1011------------SHTWDLIEKPE----------------KQ--------------.KLIGCK----------WIFKLKPG
Q9SH77_ARATH/866-1115------------NNTWTIVTRPE----------------NQ--------------.RIIGCR----------WIFKYKLG
Q9C5V1_ARATH/1163-1408------------HQVWDLVPRPP----------------QV--------------.NVIGTK----------WIFKNKFD
O82196_ARATH/663-912------------NNTWVLVNRDQ----------------FQ--------------.KPIGCK----------WVFKRKSG
O81617_ARATH/965-1214------------NKTWIVESLTE----------------GK--------------.NVVGCK----------WVFTIKYN
Q8TFK0_DEBHN/833-1080------------YEVYTVVKNPK----------------NV--------------.KPIPTT----------WVHTHKIN
O81824_ARATH/740-985------------TQTWSLVPYKS----------------DM--------------.HVLGSK----------WVFRTKLH
Q94EV3_MAIZE/796-1042------------NGTWEVVDRPY----------------GC--------------.QPIGCK----------WIFKKKLR
O74246_CANAX/39-286------------NQVYTVEKTPK----------------NV--------------.VPLKTM----------WVHTYKTN
Q9ZPG3_ARATH/915-1164------------TSTREICSLHD----------------GK--------------.RAIGCK----------WVFKIKYK
Q9S9A8_HORVU/828-1073------------NKVWTLEVLPE----------------GC--------------.KAIQNK----------WIFKKKTG
Q9ZRJ0_TOBAC/841-1089------------NKTFELVKLPK----------------GK--------------.RALKNK----------WVFKMKHD
Q8W0U0_SORBI/619-868------------RQVFSQVIPTP----------------PQ--------------VFPVGFK----------WVFVRKRN
Q9FZK7_ARATH/1051-1296------------NNTFELVPPKP----------------NQ--------------.NVISTK----------WIFTLKYL
Q94IU9_ARATH/904-1149------------LNTWSLVPATE----------------DM--------------.NILTSK----------WVFKTKLK
O74218_CANAX/999-1239------------NNTWSLEPLPE----------------GR--------------.KAIGIK----------WVYTIK..
Q9FLA4_ARATH/947-1191------------NHTWDLVSPEE----------------AK--------------.HVISCK----------WIFTLKYN
Q9C7Y1_ARATH/852-1097------------NNTWELVELPE----------------EA--------------.KVIGLK----------WIFKTKFN
Q7Y173_ORYSJ/398-645------------NGVWDLVEIPK----------------GS--------------.KTVGCK----------WVYKTKLD
Q9SHT5_ARATH/807-1052------------NKTWSLIDLPV----------------RR--------------.KVIGLK----------WVFKIKRN
O22452_VOLCA/568-813------------NKTWELGTPPP----------------GA--------------.RILDCR----------WVYKIKQE
Q8W5F4_ORYSJ/472-717------------NGTWEVTERPC----------------GC--------------.KPVGCK----------WVFKKKLR
Q9FFM0_ARATH/852-1101------------NDTWDVIDKPE----------------GK--------------.RVIGCK----------WIFKRKAG
Q7XUD9_ORYSJ/916-1161------------NNTWRLVDLPS----------------GH--------------.RAIGLK----------WVFKLKKD
Q9SZY0_ARATH/766-1015------------NHTWTVVKKPV----------------GE--------------.RVIGCK----------WIFKRKPG
Q8WRX5_ANOGA/458-703------------NATWEIASLPK----------------DR--------------.KAVGSK----------WVFKRKMD
Q7XE22_ORYSJ/452-697------------NKTWHLVPPTQ----------------GK--------------.NIIDCK----------WMYKIKRK
O23588_ARATH/943-1192------------TNTWSVVSLPP----------------NK--------------.KAIGCK----------WVFTIKHN
O65452_ARATH/626-870------------NQTFSIVNLPP----------------GK--------------.RALGNK----------WVYKIKYR
Q9ZUJ1_ARATH/925-1170------------NSTYDLVPPKP----------------HQ--------------.NFVGTR----------WIFTIKYN
O49140_ARATH/968-1213------------NGTFDLVPPAP----------------NQ--------------.NVVGCK----------WVFTLKYL
Q9FWZ5_ARATH/918-1163------------NHTWDEDDLPK----------------GK--------------.KTVSSR----------WVFTIKYK
Q94HW2_ARATH/982-1228------------NHTWDLVPPPP----------------SH--------------VTIVGCR----------WIFTKKYN
Q8LNW7_ORYSJ/880-1128------------NHTWEFVKLPK----------------EK--------------.KPIRCK----------WIFKRKEG
Q9C536_ARATH/832-1077------------NDTWELTSLPN----------------GH--------------.KAIGVK----------WVYKAKKN
O22175_ARATH/1013-1257------------NHTWDITDLPH----------------GK--------------.KAISSK----------WVYKLKYN
O42838_SACPA/1146-1386------------HNTYKLVSLPK----------------QR--------------.RALGSR----------WVFTIK..
Q9MAK6_ARATH/832-1077------------AETWSLVPYTP----------------DM--------------.LVLGSK----------WIFRTKLN
Q9M1F5_ARATH/873-1122------------NDTWTTVTRPE----------------KQ--------------.RIIGSR----------WIYKYKQG
Q9FJA1_ARATH/460-702------------NKNWMVESLPE----------------GK--------------.NVVGYK----------WVFTIKYN
Q94HQ0_ORYSJ/485-718------------NRTWELADLPR----------------GH--------------.RAVTLK----------WVFKLKRD
O82493_ARATH/823-1068------------TDTWDLVPPEM----------------VD--------------.RLLGCK----------WVFKTKLN
O04543_ARATH/827-1076------------THTWEVCSLPA----------------DK--------------.RCIGCR----------WIFKIKYN
O65147_SOYBN/1068-1313------------NEVWELVPRPE----------------GT--------------.NVIGTK----------WIFKNKTN
Q9SLF0_ARATH/850-1094------------NHTWTIEDLPP----------------GK--------------.RAIGSQ----------WVYKVKHN
Q9XII7_ARATH/966-1215------------TNTWEITTLPK----------------GK--------------.KAVGCK----------WVFTLKFL
Q9M5J7_PICGL/100-347------------NESWDIVELLA----------------RR--------------.KSVGRK----------WLFKKKFN
Q7Y1I1_ORYSJ/727-972------------NKTWRLVDLPR----------------GH--------------.HAIGLK----------WVFKVKKD
Q9LJ55_ARATH/735-980------------NKTWDLVELPQ----------------GA--------------.KPIGLK----------WVFKLKKN
Q9FX79_ARATH/941-1190------------NGTWVVCSLPV----------------GK--------------.KAVGCK----------WVYKIKLN
Q94GR9_ORYSJ/975-1220------------NKVWTLIERPR----------------DH--------------.NVIGTK----------WIFRNKQD
Q949J4_SOLLC/397-647------------RESFGPIIRTP----------------EG--------------IKPVGYK----------WIFVRKRN
Q7X7N0_ORYSJ/758-1003------------NGTWRLVPRPP----------------GA--------------.NVVTGK----------WIFKHKFH
Q8TFI1_SACEX/864-1104------------HHTYELIPPPD----------------DV--------------.RVLGSR----------WVLTVK..
Q7XZY2_ORYSJ/297-542------------NSTWCLTNLPP----------------RH--------------.KPIGLK----------WVFKVKRD
POLX_TOBAC/840-1088------------NGTYKLVELPK----------------GK--------------.RPLKCK----------WVFKLKKD
Q7XN62_ORYSJ/915-1162------------NDVWDLEEIPK----------------GA--------------.KTVGCK----------WVYKTKYD
Q7XLI2_ORYSJ/53-298------------NRTWDLVPRPN----------------GA--------------.NVVTGK----------WIFRYKFQ

PF02123

RDRP_SCPMV/464-849................LSRYPRSKPLAC--FRQGTWSFDAIFEQVV.SKATSAEINQKASPG-VPLSRLA--TTNKDLMA
RDRP_SBMVA/490-847................GEAWSFDAVYEE--VCK........KA.......QSAEINEKASPG-VPLSRLA--STNKDLLK
RDRP_SCVLB/833-1303................GTVKYDMSKLFE--LNVLENGVDEEVD.......WEKEKRNRSDIK-TVNISYA--KV......
RDRP_PLRVW/609-1004................VEAYRNCITNAP--LCSLKSKLDWAGFQQD.IREAVQSLELDAGVG-IPYIAY.--GLPTHRGW
Q9JE94_9VIRU/129-560............KMLGLTKIPIANCLTE--LNTLQGRGVTSSD.......AKRDLTHRIA.D-VNP.HEA--KISRENL.
RDRP_PEMVW/733-1124................TEAYRSTALPAP--MWAH..NFDESHMRFE.FWECVRKLKGQAGSG-VPYAAFS--GRKTNDKW
RDRP_HV19S/122-585............KALGSNTSEPGALFVE--ANTLQGRYDRTLD.......MDHEVESRCSPA-AIA.DQV--IPYTDEL.
O55590_9REOV/25-748AEELIINSYSNRSTLAKIVSSPMSILVA--LLDINGTFITTEE.......LELEFSNKYVKA-IVPQKTL--DELNDMLI
RDRP_ROTHC/32-749ARELIVKSFTNRTSLAKLVSSPMTVLTA--MLPIRGTFITTEN.......LELEYSNKSINY-LISKEMA--EDFMQAIK
Q90155_9VIRU/96-539............KQLGLAYSPIFRLFIE--LPTLLGRGAIPGD.......AALDMKHRLTYN-PLM..TV--DVPKTQL.
Q90193_9VIRU/400-785................ANDVESFKSFMQ--LRK.PGHSQVPGNRCTKVIIRLTEHMAELDAD-PSAGELL--TDPIDRI.
Q83093_9VIRU/433-816................ESSPQNTQPQQS--TESSGGQSGVKKKSQRRRGKSERQKSTQKPPQ-VPLSVLG--QSNAEVLS
RDRP_ROTGI/37-803LCQVVAVYQIIPANAAKLLSTPMTLYVG--VATFSSNQVASTG......NASECAPLQIENN-IYVSEAQ--KKEWAESF
RDRP_TYYVF/580-974................ADVYHPCQTNGP--AATRGGTLTWNNFMID.FKQAVFSLEFDAGIE-LPYIAY.--GKPTHRGW
Q99AT3_9VIRU/99-573............KATGANGSRLGALLCE--SNVLLGRAAGPAD.......LSEEARYRTSSD-VES.HLA--IFSDADL.
Q98XW8_9VIRU/144-622............KAMGQNMCAVGRHLCE--LAVLQGRGVNRLD.......LLEDAERRVSAT-FNC.PIV--HVPADAL.
Q66150_9VIRU/22-408................QAQYPRSRPRSC--FRREPWCREDFVAEIE.KIAHSGEINLKASPG-VPLAEIG--VSNQQVID
Q86519_9VIRU/516-902................QERYPKVPPRRC--LRDE.WRFDDIFDEVERILCETGEVNSASSPG-VPLAGLA--NSNGEVRG
RDRP_PCVC/362-832................RITEKDRQALMY--MDLLVGRGEYTVD.......EMAEVELRTDDT-YNTKHLS--YDPNRQVF
Q90153_9VIRU/1024-1530................QATEEDWSQSLY--LQALYGRGGVLVN.......WAEDFANKASHP-DPIQAWD--GRCYSQKL
Q87025_SCVLA/177-657............KSIHTADYEPLTELFE--LAVLMNRGVGHVS.......WQAEKDHRLNPD-VAVVDQA--RL......
Q9YXE6_9VIRU/120-589............KALGANAHDFGAVLCE--AQTLLGRAVSTID.......LAHEAEYRCDPD-LVA.KQV--IEPGEEL.
Q83073_9VIRU/49-523............KL..RALAAWCPNYVE--LKCLRGRGIAELD.......VIAEAKQRLKKP-THP..YA--YADNEELL
Q9YXE4_9VIRU/99-573............KAVGANSNHLGACLVE--AQTLQGRAVQPAD.......MHSEAISRTTTA-VAD.IVV--DYPDDVL.
Q8V615_9VIRU/41-473............KMIGATTSRIANILTE--CNTLIGRGVKSSD.......PSADLYHRVAPE-GNR.HEA--KIPRHIL.
RDRP_LRVLG/155-619............KH..RGMSGLLPQLVE--MKCLLGRGVNEID.......VETEARRRLDVG-SLS..MQ--RLDENEL.
Q65969_9LUTE/603-996................CRAYQAAKTNGP--MATRGDRLSWDNFLQD.FKQAVLSLEMDAGIG-VPYIAY.--GKPTHRGW
RDRP_ROTPY/25-748AKELIILSYSNRSTLAKLVSSPMSILVA--LIDINGTFITNEE.......LELEFSDKYVKA-IVPDQTF--NELQEMID

PF00680

POLG_HAVHM/1750-2215------------PEDYKEASIFYQNKIV--GKTQLVDDF....-------LDLDMAITGAPG-......I--DAIN....
RDRP_BPPH6/19-638------------RHMNGFPMIPATWPLA--SNLKKRADADLAD-------GPVSERDNLLFR-AAVRLMF--SDLEPVPL
POLG_PYFV1/2270-2778------------NQIIESMAAQMQDWET--FMVRE..GYMTMD-------LPMSVVINGIDG-...VEYY--EPLN....
POL1_BAYMG/1634-2107------------KHVLTYNPEELHCATK--GLIKMLEDAGLTQ-------GS.VRTPQQV..-......V--SDIQ....
POL1_CPMVS/1186-1687------------GEVANDVLELWHDCAV--D......WDDFGE-------VSLEEALNGCEG-...VEYM--ERIP....
POLG_FCVC6/1262-1736------------VVNGPP.HDILHRVQK--MLIDHLSGFVPMN-------ISSDTSMLSA..-......F--HKLN....
POL1_RCMV/1182-1684------------GETCQEILDEWFDCLP--E......GFELGE-------VTINEALNGVDG-...VDYM--DRIP....
POL1_GCMV/1454-1960------------DEIAGDMLETWYDCE.--.......DSILSD-------IPLATAINGIPA-GCEDAEL--ENFV....
POLG_WMV2U/237-705------------VVLNEVDFNAFEKAVE--GVITMMVDFEFAE-------CLFVTDPDEI..-......Y--GSLN....
POLG_LORDV/1209-1676------------PRGKPPKPSVLEAAKR--TIINVLEQTIDPP-------QKWSFTQA....-......C--ASLD....
POL1_BRSV/1468-1975------------DEVATDILETWYDCE.--.......DHVLND-------IPLVVAINGIPA-DSEEAEL--ENFV....
POLG_HE701/1750-2193------------MLMDEYMEEAVDHYVG--CLEPL..DISTEP-------IKLEEAMYGMDG-......L--EALD....
POL1_CPSMV/1177-1679------------RHVATDIVEEWFDCVD--PQ.....EDTFEE-------VDLQVAINGLEG-...MEYM--ERVP....
Q94M06_9VIRU/64-655------------RSVSGYPQWPVSALPK--SNVGLLRDLKLQE-------RMTARQVVIARE-IWKRVWG--.HMKPTAI
Q9MC15_9VIRU/40-607------------RDFGTMYTHGAVFMNP--TLSPRVDRLGETG-------GELPSDYMLALS-IMSEIYF--EEFKPAKV
POLG_TUMVQ/2376-2844------------IEAGNIDCDLFEKTVE--IVISDLRGYGFET-------CNYVTDENDI..-......F--EALN....
POLG_OMV/383-852------------IVLGEVDFIKFEEGYN--NVLRMFHDIGFEK-------CEYVTDSMEV..-......Y--KNLN....
POLG_RHDVF/1279-1750------------EPKLDKVDEFIERAAA--DVLGYLRFLTKGE-------RQANLNFKAA..-......F--NTLD....
POLG_PVYHU/2293-2761------------IDVGIVDCDAFEEAIN--RVIIYLQVHGFQK-------CNYITDEQEI..-......F--KALN....
POLG_PSBMV/2413-2881------------TVVGNVDCDVFENAID--NVEKILWKAGMMQ-------CEYVTDAEAI..-......F--QSLN....
POLG_SMSV1/1376-1852------------APRTDT..ATLNRVTK--MLISHMEGYVPKI-------HKTEEDMISA..-......F--YMLN....
POLG_TEV/2297-2761------------IEIGNVDCDLLELAIS--MLVTKLKALGFPT-------VNYITDPEEI..-......F--SALN....
POLG_HRV8A/1721-2162------------CQVTPHMKIAVAHYAA--QLSTL..DINPQP-------LSLEESVFGIEG-......L--EALD....
POLG_PEMVC/2294-2762------------IDVGVVDCDRHLRKLS--LELLYTQIHGFRK-------CSYITDEEEI..-......F--KALN....
POLG_TMEVB/1854-2301------------ESLPPIFDVVCGEYAN--RVFTIL.GKENGL-------LTVEQAVLGLPG-......M--DPME....
POLG_BOVEV/1731-2174------------RDMPEELLIAIDHYSE--QLKML..NIDPRP-------ISMEDAIYGTEG-......L--EALD....
POL1_APMV/57-557------------YEVAHDMQESWHDCVQ--.......DFTFPE-------VDLETAINGIDM-...VEYM--ECIP....
POLG_CXA21/1762-2205------------TEVDEYMKEAVDHYAG--QLMSL..DINTEQ-------MCLEDAMYGTDG-......L--EALD....
POLG_PPVD/2311-2779------------IVVGAVDCDQFERAVD--VVISMLISKGFEE-------CNYVTDPDDI..-......F--SALN....
POLG_EMCV/1842-2288------------ESLPPVFRMVAKEYAN--RVFTLL.GKDNGR-------LTVKQALEGLEG-......M--DPMD....
POLG_TVMV/2260-2728------------IVVGSVDCDTFESSLK--VLSRKMKEWGFEN-------LEYVTDEQTI..-......K--NALN....
POLG_SOUV3/1299-1766------------PRGRMPEPGLLEAAVE--TVTSSLEQVMDTP-------VPWSYSDA....-......C--QSLD....
POLG_CXA9/1756-2200------------THVDEYMLEAVDHYAG--QLATL..DISTEP-------MKLEDAVYGTEG-......L--EALD....
POLG_FMDV1/1875-2327------------EEDKALFRRCAADYAS--RLHSVL.GTANAP-------LSIYEAIKGVDG-......L--DAME....
POLG_HRV14/1736-2178------------TEPTENMLVAVDHYAG--QLLSL..DIPTSE-------LTLKEALYGVDG-......L--EPID....
POLG_HRV1B/1714-2156------------CSLNQHMEIAIAHYSA--QLITL..DIDSKP-------IALEDSVFGIEG-......L--EALD....
POLG_PRSVH/2537-3005------------IVVGEVNHDVFEDSVA--QVIELLNDHECPE-------LEYITDSEVI..-......I--QALN....
Q9FZT2_9VIRU/64-684------------RHVPGLPMIPATFPLT--DNTKKRNDAGLAD-------GPINKQHELIFR-ATIRLFF--SSLENQGL
POL1_GFLV/1488-1974------------DEVAGDMVQTWYDP..--.......GEFLED-------ISLDQAINGDMD-...EEYF--DPLV....

PF00998

RDRP_TNVA/224-703------------GLMERVFYVEG..PNG--....LQD......-------..APKPVKGAFR-T.LDKFR--DLYTKNSW
RDRP_TCV/272-752------------GLMERVFYVED.AQKQ--....LKP......-------..APQPIPGIFG-K.LSGIR--RRLVRLAG
RDRP_TNVD/224-709------------GLVERLYMVEV..KGE--....LQP......-------..TPKPTPGAFN-Q.MSRFS--DRLSIHLP
RDRP_MCMVK/460-941------------GLMERVFYVKD.DKGE--....LVS......-------..CPEPISGIFW-KNLKGFR--NSIVHHVG
POLG_HCVEU/2430-2941------------SASLRQKKVTFDRV.Q--....VFD......-------....QHYQDVLK-E.IKLRA--STVQAKLL
POLG_HCVED/2420-2931------------SAVTRQKKVTFDRL.Q--....VVD......-------....STYNEVLK-E.IKARA--SRVKPRLL
POLG_HCVJL/2434-2945------------SAALRQKKVTFDRQ.Q--....VVD......-------....QHYYDTLK-E.MKARA--STVSAKLL
POLG_HCVJK/2431-2942------------SAAQRQKKVTFDRL.Q--....VLD......-------....DHYNTTLK-E.IKELA--SGVKAELL
POLG_HCVEV/2426-2937------------SAGLRQKKVTFDRL.Q--....VLD......-------....DHYREVVD-E.MKRLA--SKVKARLL
POLG_HCVJ6/2445-2956------------SASLRAKKVTFDRMQA--....LDA......-------.....HYDSVLK-D.IKLAA--SKVTARLL
Q9IR83_9TOMB/236-712------------GLVERVFYVED.ACKN--....LVP......-------..TPQPLPGKFQ-E.LKYLA--RRVARIAG
Q87031_9LUTE/24-502------------AVERRVFTVG.KGNEV--....VLP......-------...YKNKPGIFS-N.LDYFR--DSIVNKV.
RDRP_POLVP/251-722------------GLVERVFCVVR..DGK--....LQR......-------..PLRPKNNVFE-RKLGNVG--RRISSIVG
Q65987_9TOMB/269-750------------GLMERVFYVED.AQKE--....LKP......-------..APQPLPDAFA-K.LSGIR--RKLVKLAG
P90338_9TOMB/1-480------------GLLERVFYVEDKVNKT--....LVP......-------..CPEPDRNAFK-E.LAYLK--RRLVRIVG
RDRP_BYDV1/361-840------------AVERRVYTVG.KGDKA--....IYP......-------...PRPEHDIFT-DTMDYFQ--KSIIEEV.
O09796_9HEPC/2422-2933------------SAGLRQKKVTFDRL.Q--....VLD......-------....DHYRDVLK-E.MKAKA--STVKAKLL
O09803_9FLAV/2373-2866------------NVGRRVDKVTFWRAPR--....VHD......-------....KFLVDSIE-R.AKRAA--QACLSMGY
O37361_9VIRU/252-737------------GLVNRVLTYK...GGP--....VLE......-------.....PSPGAWK-S.LRGLA--TSLGNRC.
Q9WJD9_CARMV/267-744------------GLLERVFYVER..NKE--....LVS......-------..CPQPEPGSFK-E.MGYLR--RRFHRVCG
Q83103_9TOMB/228-711------------GLVERVFMVEK..SGK--....LEY......-------..TPKPTPGAFN-.QLSRFT--RALLPFLT
Q66127_9VIRU/52-520------------GINERVFYTDNRGSLP--....VRP......-------......TPGRFD-R....LT--VDIKHFK.
RDRP_PMVK/447-937------------GLAERVYMVKN.YKTD--....FVASLDPAF-------CPAPEPVRGIFK-R.LDKYK--KEIVRRVG
POLG_GBVB/2277-2785------------DAELRKQKVTINRQ.P--....LFP......-------....PSYHKQVR-L.AKEKA--SKVVGVMW
Q89801_9TOMB/1-479------------GLLERVFYVER.EGK.--....LVP......-------..PPEPIPGIFS-R.LAGFK--SKLKKIVG
Q9IRA1_9TOMB/266-741------------GLIERVYYVE..SNGV--....LQP......-------..PLKPKVHQFR-K.LKYFA--RRLVNIVG
O12301_9TOMB/231-708------------GMIERMYYVER..DKN--....LVE......-------..PPAPS.VDFR-..LPHFS--SAFKKVIG
Q83424_MNSV/290-772------------GLVERVFFVEN.DKKE--....LEP......-------..APKPLSGAFD-R.LTWFR--RKLHSIVG
O41892_9FLAV/2409-2899------------RAAERAEKVTIWRGQR--....KYD......-------....KEYYSVVD-E.ALKKA--RATKSPGW
RDRP_OCSVU/235-734------------AIKERVFFVKNLDKGS--PTKFVSP......-------...PRPAPGVFA-QRLSNTL--GLLVPFLP
Q9IW60_9TOMB/325-800------------GLVERVFCVER..NGK--....LTR......-------..TPQPTKGAFG-.RLSPFR--KAVCEKVG
Q96898_9FLAV/2396-2886------------RAAERAEKVTIWRGDR--....KYD......-------....KHYEAVVE-A.VLKKA--AATKSHGW
RDRP_RCNMV/260-745------------SLERRVFRVKNSAGEL--....VVP......-------...PKPIQNAFD-S.ISYFR--EEWLRKLS

PF00978

R1AB_LIYV9/1925-2366------------ER.....NRPNTWKQV..IQSLSHRNFNAPI-------INHKLDVKRSAQ.ILYDSVV..KSLRQDRL
R1AB_BYVU/2601-3046------------IP.....KRKPSLQEN..LYSYESRNYNF.T-------VCERFSGPQEFG.QAMAMVMLERSFDLEKV
Q9YPH5_9VIRU/1359-1796------------PN.....KRQSSQAES..LLALKKRNMAAPR-------LQESVNEFEIIE.NTISKAK..RVFLNEDL
POLN_EEVVM/2041-2488------------PS.....AIQNTLQNV..LAAATKRNCNVTQ-------MRELP.VLDSAA.FNVECFK..KYACNNEY
E0YCR0_9CLOS/53-491------------GL.....PKRNTLKCN..LVTFENRNFNADR-------GCNVGCDDSVAH.ELKEIFF..EEVVNKAR
RDRP_TOMS1/1168-1609------------EM.....PRQTGLLEN..LVAMIKRNFNSPE-------LSGVVDIENTAS.LVVDKFF..DSYLLKEK
RDRP_PSVJ/295-726------------GS.....KRLGTTKEV..LTAIKKRNADVPE-------LSGSVDLTRISK.AVARRFK..ESYFNTN.
Q66107_9BROM/228-662------------TS.....KRVNTQRET..LLAVKKRNMNIPE-------LQSTFDLDAEVA.TCFKRFC..THVVDIPR
Q87644_SINDV/2053-2501------------PS.....AMQNTLQNV..LIAATKRNCNVTQ-------MRELP.TLDSAT.FNVECFR..KYACNDEY
O56790_9VIRU/1323-1760------------PE.....KRQSGLIES..VLALNKRNMAAPR-------LQESVNEFEIIE.NVISKAK..AVFFDEKF
RDRP_CMVFN/308-738------------GH.....KRVGTTKEV..LTAIKKRNADVPE-------LGDSVNLSRLSK.AVAERFF..ISYINGN.
Q9WJD8_PEBV/1299-1738------------PD.....KRKTTQLEG..LLALQKRNQAAPD-------LQQNVHSTLLVE.DTIKRLK..EVVYDVEK
Q80875_BSMV/195-630------------PE.....KRQGSLIES..VLAFRKRNLAAPR-------LQGALNEWHTIE.NVLTKAL..KVFFFEDL
RDRP_RBDVR/1234-1674------------LL.....RRNTSSRQV..GLAIEKRNANVMN-------SQKYFDLENLAN.KAVERFF..DFFIDMEK
RDRP_SBWMN/1373-1810------------PP.....KRQNLPVEA..MLALKKRNMAAPK-------LQEAVNEFEVIE.RTVNRAK..EIFFDTSL
POLN_ONNVI/2053-2501------------PS.....PFQNTLQNV..LAAATKRNCNVTQ-------MRELPTMDSAVF.NV.ECFK..KYACNQEY
RDRP_TAV/313-742------------GQ.....KRIGTTREV..LCAIKKRNADVPE-------LCGSVNLKRLSD.DVAECFM..LSFMNGDK
POLN_MIDDV/534-981------------PS.....PFQNTLQNV..LAAATKRNCNVTQ-------MRELPTLDSAVF.NV.ECFK..KYACNNDY
RDRP_TMGMV/1163-1604------------EP.....PRAAGLLEN..LVAMIKRNFNAPD-------LTGTIDIESTAS.VVVDKFF..DSYFIKKE
RDRP_TOBSV/253-689------------LS.....HRVPTQREA..LLAIKKRNMNVPE-------LQSNFDHDDVLN.RCVTRFI..THVVDKTR
RDRP_OLV2I/310-732------------EM.....PRIATKKEM..LMAFSKRNVGAPQ-------MVEVP.QEIHVK.RLADRFF..RTFLKEGG
RDRP_YOMV/1155-1594------------EM.....PRTAGLLEN..LVAMIKRNMNAPD-------LTGTIDIEDTAS.LVVEKFW..DAYVVKEF
RDRP_AMVLE/318-752------------LS.....TRKGTQTEA..LLAIKKRNMNVPN-------LGQIYDVNSVAN.SVVNKLL..TTVIDPDK
POLN_RRVN/2019-2467------------PS.....PFQNTLQNV..LAAATKRNCNVTQ-------MRELPTLDSAVF.NV.ECFK..KFACNGEY
RDRP_ASPVP/1758-2169------------ERYEAIYPRHKGTDTATFLMAVKKR......-------LSFSSPAAEHAKLRRAKPFG..KFLLDTFL
O56250_9VIRU/1240-1678------------PD.....KRKTTQLES..LLALQKRNQAAPD-------LQENVHATVLIE.ETMKKLK..SVVYDVGK
O90699_9VIRU/1363-1800------------PE.....KRQGGLVES..PLALNKRNMAAPQ-------LQESVNEFEIIE.KTVTRAR..DIFFDVDR
Q9Q6Q3_9CLOS/62-509------------RR.....PKRNSLKCN..LVTFESRNFNADR-------GCDVSSDPVAAA.ELASLFF..NTWVDGSK
POLN_AURAV/2038-2486------------PS.....AFQNTLQNV..LSAATKRNCNVTQ-------MRELP.VLDSAV.FNVECFK..KYACNTDY
RDRP_BBMV/271-697------------SS.....RRVGSQKTV..LTALKKRNADVPE-------LSDVVD....AT.EVPICLR..QSYLNIYG
RDRP_CCMV/267-697------------FQ.....RRIGTQKTV..LTALKKRNADVPE-------LADSVDIKRVAC.EVAEKFK..RAYLNHSG
Q66581_EEEV/144-598------------PS.....PIQNTLQDV..LAAATKRNCNVTQ-------MRELP.VLDSAA.FNVECFK..KYACNDEY
Q9QGG9_9BROM/363-797------------MS.....KRIPTQREA..ALAIKKRNLNVPD-------LQQVLFEDDEAR.KIANRFI..NTVIDPNK
RDRP_TMOB/1167-1614------------ER.....PRSQGLLEN..LVAMIKRNFNSPE-------LSGTVDMENTAS.VVADRFF..DSYFLKDK
RDRP_BMV/256-688------------AQ.....RRVGTQKEV..LTALKKRNADVPE-------MGDAINMKDTAK.AIAKRFR..STFLNVDG
O40960_9CLOS/62-506------------ER.....SRPDTWKQV..ILSLSKRNFAAPR-------LNEDISIDETAN.RLLTSLM..RCMEPSRL

PF00972

Q67483_9FLAV/252-900------------NGVVKLLSGPWDRIEEVTNMAMTDTTPFGQQRVFKEKVDTRAPEPPQGTR-EIMKVVN--QWLFDYLG
POLG_DEN4D/2738-3383------------NGVVKLLTKPWDVIPMVTQLAMTDTTPFGQQRVFKEKVDTRTPQPKPGTR-MVMTTTA--NWLWALLG
O09234_DEN26/2742-3387------------NGVVRLLTKPWDVVPMVTQMAMTDTTPFGQQRVFKEKVDTRTQEPKEGTK-KLMKITA--EWLWKELG
POLG_YEFV1/2758-3406------------NGVIKILTYPWDRIEEVTRMAMTDTTPFGQQRVFKEKVDTRAKDPPAGTR-KIMKVVN--RWLFRHLA
POLG_LIV/2763-3408------------NGVVKLLSWPWNAREDVVRMAMTDTTAFGQQRVFKEKVDTKAQEPQPGTR-VITRAVN--DWILERLA
O36764_9FLAV/2780-3428------------NGVVKLMSKPWDAIANVTTMAMTDTTPFGQQRVFKEKVDTKAPEPPAGAK-EVLNETT--NWLWAYLS
POLG_MCFA/2693-3341------------NPLVRKIMWPWETLTSVVGFSMTDVSTYSQQKVLREKVDTVIPPHPQHIR-RVNRTIT--KHFIRLFK

PF05919

Q6EH16_9VIRU/1-501WSDP..LRVIHFIWFNIRCYGYFWGLIWSMWLIFIMIISLPY......YLIAL...................CLGARAPV
Q5TMB5_9VIRU/174-658DEKS..SNALLGVS.........PEVHKRMMNFLKLNEIVPLRHKL...CRAL...................FLDKIISK
Q18L80_9VIRU/166-639FTWG..E.ITSILD..........................PYKEGK..WEKSD...................FYSFWASI
Q9WJ23_9VIRU/164-642IFVG..HTILENIL.............KIVGEKQYHEIIGNHIKKLYHDHRLF...................IPGKIDYL
RDRP_CPMV1/246-745ITQP..TKIFTYLDFSVRVYK.FRGLLLWMWMMCILLITLPY......AIVSF...................MLGALIPI
Q9ZXZ7_THACU/214-754REGS..PRLWENIQ...........AYLTMVGADQFRFDLDYACSLADRLKSFDDKVDSQGQWIRQVSKSGQVLTQVDSM
Q9WJ22_9VIRU/155-622NSSN..IRYLFNIV..................GDYQLVLNKFYQDLSQFYTKY...................INRDKLG.
Q6EH19_9VIRU/208-686NGLF..RSQVEVIL......................PELLPIIDTLLTWEKSF...................KLSTLMGL
Q9WJ24_9VIRU/163-645DFNQ..WLGIIGIL.....................PKSVLDLFTETLSYASKL...................VLPEIKSN
Q6GYC2_9VIRU/156-638SYES..FNWLFKIT.....................SLSGVDYLTKIMNWTWLK...................DLGNKNNN
Q18L78_9VIRU/174-654MKHP..KVYASLLELSNVMSPYLGLLLRNQTTI..IRAITDFDPIKWERIKPF...................MAPVYQSI
Q18L79_9VIRU/168-671FLDK..EFFLTLLD..........................PYKERRQWWESSP...................FIKYFNAI
Q3S3F3_9VIRU/120-606KHEL..HLSLSYFL................GEAYKTLFYLPYLKNMALSYGHD...................VPPKQWP.
O92614_9VIRU/173-711YVSPLFPTLLSFIG..........RMNRGNVLIDLLRAEVSY......WEATG...................VKPSVSPL

PF00078

POL_WDSV/812-977..HD--LRAINNIV----------------------------AP.....L...---------------------------
POL_RSVP/769-938..HD--LRAVNAKL----------------------------VP.........---------------------------
O01419_BOMMO/502-756.SEA--GKLLERVV----------------------------AGRLVRHLE..---------------------------
O13348_MAGGR/497-764.SCI--GKGLERLV----------------------------ARRIAWAIHDN---------------------------
O18558_AEDAE/472-725.SFL--LKCLERII----------------------------DHHIRDVYL..---------------------------
O22148_ARATH/497-727.NVI--YKVIGKLM----------------------------ANRLKKILPSL---------------------------
O22220_ARATH/221-456.SVM--YKIISKIL----------------------------SARLKKYLPVI---------------------------
O23410_ARATH/308-553.NVL--FKIITKMM----------------------------VIRLKNVI...---------------------------
O41894_9RETR/202-360...D--YREVNKVT----------------------------PL.........---------------------------
O42691_ALTAL/36-202...D--YRDLNSKI----------------------------VL.........---------------------------
O44316_DROMR/394-650.SIV--VRQLNAIL----------------------------ASRLTAA....---------------------------
O47500_VENIN/326-590.SPM--DKIVQEAM----------------------------RLVLEAIY...---------------------------
O52209_9ZZZZ/135-366.SLE--DKIVQYAL----------------------------VKILNAVY...---------------------------
O52231_STRPN/68-275.TVM--DRMIQQAI----------------------------VQVMSPIC...---------------------------
O62658_CANFA/517-773.NMD--AKILNKIL----------------------------ANRIQQYI...---------------------------
O64428_CHLVU/554-816.NTD--YKLAARAI----------------------------ASRIGPLL...---------------------------
O64612_ARATH/788-1031.NVL--YKAISKLL----------------------------ANRLKCLL...---------------------------
O65244_ARATH/405-664.NVL--YKVISKII----------------------------ANRLKLVL...---------------------------
O65598_ARATH/489-747.NTL--YKVIARLL----------------------------TDRLQKLL...---------------------------
O69788_RHIML/72-291.TVS--DRIAQMVV----------------------------KQMIEPDL...---------------------------
DPOL_WMHBV/364-590...D--FSQFSRGN----------------------------TS.........---------------------------
O72700_9VIRU/1279-1449...N--YKRLNDNT----------------------------EK.........---------------------------
O81068_ARATH/814-1073.NVL--YKVISKIL----------------------------ANRLKLLL...---------------------------
O81284_ARATH/58-317.TTI--YKVITRLI----------------------------SKRLNLFI...---------------------------
O81454_ARATH/144-304...D--CRAINNIT----------------------------IK.........---------------------------
O81517_ARATH/408-666.NTV--YKVISKLL----------------------------TDRLKDFL...---------------------------
O81630_ARATH/874-1114.NVL--YKIISKCL----------------------------VERLKGHLDAI---------------------------
O82216_ARATH/238-497.NVL--YKAISKIL----------------------------ANRLKRIL...---------------------------
O82276_ARATH/356-618.NVL--FKIITKMM----------------------------VTRLKNVI...---------------------------
O82894_ECO57/115-332.TMK--DRAMQALY----------------------------LLALEPVA...---------------------------
O85869_SPHAR/89-369.TTE--DKLVQEVV----------------------------RTILEQIY...---------------------------
O85879_SPHAR/47-327.TRD--DRLVQEVA----------------------------RQLLERIY...---------------------------
POL_FFV/202-360...D--YRAVNKVT----------------------------PL.........---------------------------
O93520_ORYLA/518-771.NID--YKLFTSII----------------------------SRRLETIL...---------------------------
O96546_LYMDI/526-780.RGL--GKIYERIV----------------------------LSRLRTFAE..---------------------------
O96849_DICDI/53-215...D--LKRLNTYI----------------------------NN.........---------------------------
O99479_PAVLU/111-389.SQR--DKIVQASI----------------------------QNALQSKY...---------------------------
O99969_PORPU/100-315.TIR--DRAKQCLV----------------------------KFALEPQY...---------------------------
O99970_PORPU/100-315.TIR--DRAKQCLV----------------------------KFALEPQY...---------------------------
DPOL_GSHV/413-636...D--FSQFSRGH----------------------------SR.........---------------------------
POL_MLVAV/221-393...D--LREVNKRV----------------------------ED.........---------------------------
POL_HTL1A/633-804...D--LRATNSLT----------------------------ID.........---------------------------
POL_HTLV2/631-802...D--LRATNAIT----------------------------TT.........---------------------------
POL_SMRVH/71-240...D--LRAVNKVM----------------------------VP.........---------------------------
POL_MMTVB/68-237...D--LRAVNATM----------------------------HD.........---------------------------
POL_CAMVC/289-452...N--YKAMNKAT----------------------------IG.........---------------------------
AI1M_YEAST/315-577.NPR--DKIVQEVM----------------------------RMILDTIF...---------------------------
AI2M_YEAST/348-613.NPR--EKIVQESM----------------------------RMMLEIIY...---------------------------
POL_SRV1/74-243...D--LRAVNATM----------------------------VL.........---------------------------
POL_IPHA/60-229...D--LRAINNQM----------------------------HL.........---------------------------
POL_HV1MA/655-826...N--FRELNKRT----------------------------QD.........---------------------------
POL_CERV/271-436...N--YKAMNKAT----------------------------KG.........---------------------------
YMC6_SCHPO/300-566.SPR--DKLVQEIL----------------------------RIVLEAIY...---------------------------
LIN1_NYCCO/516-772.NID--AKILNKIL----------------------------TNRIQQHI...---------------------------
POL_FMVD/282-445...N--YKAINQAT----------------------------IG.........---------------------------
LTRA_LACLM/90-361.TFT--DKLIQEAV----------------------------RIILESIY...---------------------------
POK10_HUMAN/76-245...D--LRAVNAVI----------------------------QP.........---------------------------
POL_BAEVM/219-391...D--LREINKRT----------------------------VD.........---------------------------
POL4_DROME/357-523...D--YRQINKKL----------------------------LA.........---------------------------
POLY_DROME/224-390...D--FRKLNEKT----------------------------IP.........---------------------------
POL_EIAV9/249-419...D--LRELNKTV----------------------------QV.........---------------------------
POL_IPMA/71-240...D--LRPINEQM----------------------------NL.........---------------------------
POL2_MOUSE/524-780.NID--AKILNKIL----------------------------ANRIQEHI...---------------------------
POL_IPMAI/16-159...E--WRSLWREA----------------------------AQ.........---------------------------
DPOL_WHV3/416-639...D--FSQFSRGH----------------------------TR.........---------------------------
DPOL_HBVC3/376-600..VD--FSQFSRGS----------------------------TH.........---------------------------
YTX2_XENLA/513-765.STD--YKIVAKAI----------------------------SLRLKSVL...---------------------------
RTP2_TRYBG/594-780...I--SRVMKTAE----------------------------KK.........---------------------------
POL_SOCMV/246-411...N--YKKMNEAT----------------------------IG.........---------------------------
POLR_DROME/403-660.SVL--VRQLNAIL----------------------------ATRLNSS....---------------------------
Y2R2_DROME/498-741.PVF--GKVLEAIM----------------------------VNRVREV....---------------------------
POL_COYMV/1445-1615...N--YKLLNENT----------------------------ES.........---------------------------
POL_BIV29/638-806...D--FRELNKIT----------------------------VK.........---------------------------
RDPO_SCEOB/124-343.SYT--DRCLQALY----------------------------KLAIEPMA...---------------------------
POL2_DROME/249-414...D--YRKLNEIT----------------------------IP.........---------------------------
RT67_ECOLX/48-262.TDR--LKDIQRRI----------------------------CDLLSDCRDEI---------------------------
RTJK_DROME/502-757.PSL--GKIMERLI----------------------------LNRLLTCKD..---------------------------
RTJK_DROFU/502-757.PSL--GKMLERLI----------------------------LNRILTSEE..---------------------------
POL_GALV/218-390...D--LREINKRV----------------------------QD.........---------------------------
POL_SIVGB/659-830...D--FRELNKLT----------------------------QD.........---------------------------
RT86_ECOLX/53-248.SRE--LKALQGWV----------------------------LRNILDK....---------------------------
RT65_MYXXA/155-366.KRR--LKALQRRM----------------------------LALLVSK....---------------------------
RT16_MYXXA/186-407.KPE--LKAAQRWV----------------------------LSNVVER....---------------------------
POL_SFV1/205-363...D--YREVNKTI----------------------------PL.........---------------------------
POL_BLVAU/41-212...D--LRVTNALT----------------------------KP.........---------------------------
POL_RTBVP/1228-1390...N--YKRLNDNM----------------------------HT.........---------------------------
POL_SIVV1/677-848...D--FRELNKAT----------------------------QD.........---------------------------
DPOL_HPBDC/394-564...D--FSQFSKGK----------------------------NA.........---------------------------
POL_JSRV/74-243...D--LRKVNETM----------------------------MH.........---------------------------
POL_FIVT2/218-388...D--FRVLNKLT----------------------------DK.........---------------------------
POL_CAEVC/210-380...D--FRELNKQT----------------------------ED.........---------------------------
YMF40_MARPO/68-333.SPR--DKIVQEVM----------------------------RRILEPVF...---------------------------
P71276_ECOLX/62-269.HPK--MRLLQSRI----------------------------NKRIFKE....---------------------------
P91581_CIOIN/483-644..DY--SQTVNVFT----------------------------EL.........---------------------------
P95451_PSEAC/119-326.SVV--DRLIQQAL----------------------------QQQLTPIF...---------------------------
Q01379_NEUCS/505-761.SNV--GKILEALV----------------------------AKRLTQAAE..---------------------------
Q02717_PODAN/248-528.SPR--DKIVQEVF----------------------------RAILEQVL...---------------------------
Q02718_PODAN/260-530.TSK--DKIVQEAM----------------------------KILLELIY...---------------------------
POL_SIVG1/672-843...D--FRELNKAT----------------------------QD.........---------------------------
Q03261_SIV/246-416...D--FRKLNEAT----------------------------QD.........---------------------------
Q04135_DROME/496-743.TCL--SKLFEKML----------------------------LLRISPHLR..---------------------------
RTF21_SCHPO/455-615...D--YKPLNKYV----------------------------KP.........---------------------------
Q05804_ECOLX/44-235.DYL--LKTVQRNI----------------------------LKNVLSQ....---------------------------
Q07995_9DIPT/509-760.SSI--SKILERVL----------------------------LNRINDHLE..---------------------------
Q08525_CHICK/555-775.SVP--GKIMEQIL----------------------------LDDMLDHMR..---------------------------
Q08724_9CYAN/108-336.TMQ--DRATQSLV----------------------------KLALEPEW...---------------------------
YRD6_CAEEL/484-644.DFK--CSGLNAAL----------------------------KD.........---------------------------
Q17003_ANOGA/605-832.CAI--AKVFELVI----------------------------YKNLLHAC...---------------------------
Q17329_CAEEL/1071-1231...D--YRKVNKVV----------------------------KN.........---------------------------
Q24262_DROME/531-692...D--YRKLNTMV----------------------------LM.........---------------------------
Q24310_DROME/500-649...D--FRELNSNT----------------------------IS.........---------------------------
Q24335_DROME/498-745.SCI--SKLFEKCL----------------------------LIRLNQHQT..---------------------------
Q24690_DROTE/495-742.CCI--AKKLDKII----------------------------AKRLWWLVT..---------------------------
Q26106_PANRE/46-203...N--PYITANKI----------------------------KL.........---------------------------
Q26816_9TRYP/545-793.SCL--CKVMERII----------------------------AARLRDTV...---------------------------
Q33759_ALLMA/266-536.APR--DKIVQEAM----------------------------RILLEFIF...---------------------------
Q35056_MARPO/399-645...Q--DRIVQEVL----------------------------KMLLEPIY...---------------------------
Q35057_MARPO/544-811.NPR--DKIIQEAF----------------------------RMVLEIIY...---------------------------
Q35058_MARPO/623-898...L--EPIFEGYV----------------------------VG..VTVPRNQ---------------------------
Q35062_MARPO/369-636KCYG--EKIVQKAL----------------------------QLVLEAIY...---------------------------
Q46666_ECOLX/34-241.AKG--LKDIQRAF----------------------------VQ.LYNF....---------------------------
Q47277_ECOLX/68-288.TVS--DRIAQTVV----------------------------KLAFEPQV...---------------------------
Q47526_ECOLX/33-239.TPR--VKAIQRDI----------------------------IEILKQH....---------------------------
YKFC_ECOLI/86-332.ALR--DRIVQRAM----------------------------LMAMEPIW...---------------------------
Q65353_NPVAC/181-346...D--FRKLNEKT----------------------------ID.........---------------------------
Q66233_9VIRU/1324-1494...N--YKRLNDNT----------------------------EK.........---------------------------
Q69590_HBV/72-297...D--FSQFSRGS----------------------------SR.........---------------------------
POL_HV2KR/674-845...D--FRELNKVT----------------------------QE.........---------------------------
POL_JEMBR/598-766...D--FRALNKVT----------------------------NK.........---------------------------
Q83013_9RETR/68-238...D--LRAVNALI----------------------------KD.........---------------------------
Q84682_9VIRU/234-395...I--NYKMNKAT----------------------------KG.........---------------------------
Q86998_9VIRU/1297-1467...N--YKRLNDNT----------------------------WP.........---------------------------
Q88285_9RETR/848-1015...D--YRPLNSAV----------------------------SC...P.....---------------------------
Q88442_9VIRU/321-485...N--YKKLNDHT----------------------------KG.........---------------------------
POL_CSVMV/250-413...D--YKDLNKKA----------------------------KV.........---------------------------
Q93137_BOMMO/515-771.MSL--GKLYERLL----------------------------YKRLRDFVS..---------------------------
Q93139_BOMMO/469-719.PVL--GKLYEKML----------------------------VARLKYHL...---------------------------
Q94885_DROME/759-920...D--FRKLNKMT----------------------------MK.........---------------------------
YG31B_YEAST/639-797...D--YRTLNKAT----------------------------IS.........---------------------------
Q9YGS2_TAKRU/573-830.PFI--SKVLEKVV----------------------------VTQLLEHLQ..---------------------------
Q9YW31_MSEPV/161-406.NWA--CKLYSKIL----------------------------NNRLKPIM...---------------------------
Q9ZNW4_SORBI/922-1081...D--FTDLNKAC----------------------------VK.........---------------------------
Q9ZQ09_ARATH/388-543...R--QKAINKIT----------------------------IK.........---------------------------
Q9ZQ67_ARATH/542-701...D--FTDLNKAC----------------------------PK.........---------------------------
Q9ZQF8_ARATH/439-674.NVS--YKVISKVL----------------------------SSRLKRLLPEL---------------------------
Q9ZQM0_ARATH/323-569.TVF--YKIISKLL----------------------------SRRLQPILQEI---------------------------
Q9ZQQ3_ARATH/508-668...D--FTDLNKAC----------------------------PK.........---------------------------
Q9ZQQ6_ARATH/659-918.NVI--YKVISKII----------------------------ANRLKVMLPT.---------------------------
Q9ZS84_SOLLC/655-815...D--YRALNKAT----------------------------IK.........---------------------------
Q9ZTP2_MAIZE/356-516...D--FTDLNKAC----------------------------PK.........---------------------------
Q9ZUF0_ARATH/664-923.NVL--YKIVSKLM----------------------------ANRLKEIL...---------------------------
Q9ZVK4_ARATH/510-669...D--YRGLNWVT----------------------------VK.........---------------------------

PF07727

Q7G640_ORYSJ/781-1029LSPSGPPRFNARLV----------------------------AK------------------------------------
Q7XEA3_ORYSJ/1145-1390AQG.VVVKHKARLV----------------------------AK------------------------------------
Q7XLN3_ORYSJ/465-703ENN.EVVRYKARLV----------------------------AQ------------------------------------
O24438_ORYLO/963-1208ADG.TLDRYKARLV----------------------------AK------------------------------------
O81903_ARATH/849-1098IPGVEAQRYKARLV----------------------------AR------------------------------------
O81506_ARATH/471-718MDG.NIQIYKAGLV----------------------------AK------------------------------------
O24587_MAIZE/586-830ERG.VVTRNKARLV----------------------------AK------------------------------------
Q94KV0_ARATH/912-1157PDG.SVDKLKARLV----------------------------AK------------------------------------
O96968_BOMMO/855-1082GTK......RARLV----------------------------AK------------------------------------
Q7XBD8_MAIZE/827-1072PDG.TIEKYKARLV----------------------------AK------------------------------------
Q9ZPU5_ARATH/845-1094IPGVEAPRFIARLV----------------------------AK------------------------------------
Q7XTU6_ORYSJ/940-1185PSG.AIVKHKARLV----------------------------AK------------------------------------
Q9FLR2_ARATH/13-261ADG.SIERYKARLV----------------------------AK------------------------------------
Q9SIM3_ARATH/973-1222ADG.SLERFKARIV----------------------------AK------------------------------------
Q9MAR7_ARATH/666-912SDG.SINKYMARLV----------------------------AK------------------------------------
Q7XKS1_ORYSJ/160-403SDG.TLERYKARLV----------------------------AC------------------------------------
Q9FIC5_ARATH/965-1209SDG.TLERHKARLV----------------------------VL------------------------------------
O23864_9ORYZ/824-1071MDG.NVHIYKARLV----------------------------AK------------------------------------
Q9FWI2_ORYSJ/795-1030PDG.SVQKYKARLV----------------------------AK------------------------------------
O13308_CANAX/1056-1303SL..KGVVRKSRCV----------------------------VH------------------------------------
Q9ZQE9_ARATH/863-1108ASG.NHVKHKARLV----------------------------AR------------------------------------
O23529_ARATH/992-1236PNG.AIDKYKARLV----------------------------AK------------------------------------
Q8TFJ9_DEBHN/1015-1251....DDGRYKARLV----------------------------AQ------------------------------------
Q8TFJ1_PICAN/942-1182....PSHLPKARLV----------------------------VQ------------------------------------
Q9LH44_ARATH/867-1112ASG.EAIKRKARLV----------------------------AR------------------------------------
Q94I36_ORYSJ/864-1109EDG.LIVRNKARLV----------------------------AQ------------------------------------
Q02902_ARATH/100-349IPGVEPVRYKARLV----------------------------AK------------------------------------
Q8MRT6_DROME/232-479VSG.RIERFKARLV----------------------------AK------------------------------------
Q967L5_AEDAE/816-1061QEE.QVVKFKARVV----------------------------AQ------------------------------------
Q7G6C9_ORYSJ/1047-1286EYG.VVVRNKARLV----------------------------AQ------------------------------------
Q94LQ7_ORYSJ/550-793ADG.SLDRYKARLV----------------------------AK------------------------------------
Q9FJV3_ARATH/986-1235ADG.SLERFKARLV----------------------------AK------------------------------------
Q9M1C6_ARATH/853-1098EDG.EVDKYKARLV----------------------------AK------------------------------------
Q06035_VOLCA/983-1228EHG.EIVRYKARLV----------------------------AK------------------------------------
Q7XKG6_ORYSJ/514-759PFG.KVERYKARLV----------------------------AK------------------------------------
Q9LH08_ARATH/636-888EKN.EIVRHKARLV----------------------------AQ------------------------------------
Q9ZQK0_ARATH/918-1163SDG.EIERYKARLV----------------------------AR------------------------------------
Q7X5X4_ORYSJ/138-383EHG.EIVRHKARLI----------------------------TK------------------------------------
Q9LVQ2_ARATH/1008-1252ADG.TVERYKARLV----------------------------VQ------------------------------------
Q84M55_ORYSJ/910-1155PEG.KVDRYKARLV----------------------------AK------------------------------------
COPIA_DROME/920-1165ELG.NPIRYKARLV----------------------------AR------------------------------------
Q9ZQE4_ARATH/762-1011IPGVEKQRYKARLV----------------------------AK------------------------------------
Q9SH77_ARATH/866-1115ILGVEEPRFKARLV----------------------------AK------------------------------------
Q9C5V1_ARATH/1163-1408EVG.NITRNKARLV----------------------------AQ------------------------------------
O82196_ARATH/663-912IVGVEKPRFKARLV----------------------------VK------------------------------------
O81617_ARATH/965-1214PDG.SIERYKARLV----------------------------AQ------------------------------------
Q8TFK0_DEBHN/833-1080DL..KEVQYKSRCV----------------------------VQ------------------------------------
O81824_ARATH/740-985ADG.TLNKLKARIV----------------------------AK------------------------------------
Q94EV3_MAIZE/796-1042PDG.TIERYKARLV----------------------------AK------------------------------------
O74246_CANAX/39-286DL..KNHNYKSRCV----------------------------VM------------------------------------
Q9ZPG3_ARATH/915-1164SDG.TIERYKARLV----------------------------AN------------------------------------
Q9S9A8_HORVU/828-1073ADS.NVTVYKA.LV----------------------------AK------------------------------------
Q9ZRJ0_TOBAC/841-1089EHN.SLPRFKARLV----------------------------VK------------------------------------
Q8W0U0_SORBI/619-868ENN.EVVRHKARLV----------------------------AQ------------------------------------
Q9FZK7_ARATH/1051-1296PNG.TLDRYKARLV----------------------------AR------------------------------------
Q94IU9_ARATH/904-1149PDG.TIDKLKARLV----------------------------AK------------------------------------
O74218_CANAX/999-1239....DTGRYKARLV----------------------------AL------------------------------------
Q9FLA4_ARATH/947-1191VDG.SIARYKARLV----------------------------AR------------------------------------
Q9C7Y1_ARATH/852-1097EKG.EVDKFKARLV----------------------------AK------------------------------------
Q7Y173_ORYSJ/398-645SKG.KIERFKARLV----------------------------AK------------------------------------
Q9SHT5_ARATH/807-1052SDG.SINKYKARLV----------------------------AK------------------------------------
O22452_VOLCA/568-813PGG.E.VRYKSRLV----------------------------VK------------------------------------
Q8W5F4_ORYSJ/472-717PDG.TIKKYKARLV----------------------------AK------------------------------------
Q9FFM0_ARATH/852-1101IPGVEPPRYKARLV----------------------------AK------------------------------------
Q7XUD9_ORYSJ/916-1161AEG.RVAKHKARLI----------------------------AK------------------------------------
Q9SZY0_ARATH/766-1015TPGIEQPRFKARLV----------------------------SK------------------------------------
Q8WRX5_ANOGA/458-703GDG.KIVQYKARLV----------------------------AK------------------------------------
Q7XE22_ORYSJ/452-697ADG.SIDRYKARLV----------------------------AK------------------------------------
O23588_ARATH/943-1192ADG.SIERYKARLV----------------------------AK------------------------------------
O65452_ARATH/626-870SDG.AIERYKARLV----------------------------VL------------------------------------
Q9ZUJ1_ARATH/925-1170PDG.SINRYKARFL----------------------------AK------------------------------------
O49140_ARATH/968-1213SNG.VLDRYKARLV----------------------------AK------------------------------------
Q9FWZ5_ARATH/918-1163SNG.DIERYKTRLV----------------------------AR------------------------------------
Q94HW2_ARATH/982-1228SDG.SLNRYKARLV----------------------------AK------------------------------------
Q8LNW7_ORYSJ/880-1128MSPSDEARYKARLV----------------------------AK------------------------------------
Q9C536_ARATH/832-1077SKG.EVERYKARLV----------------------------AK------------------------------------
O22175_ARATH/1013-1257SDG.TLERHKARLV----------------------------VM------------------------------------
O42838_SACPA/1146-1386....DSGTYKARLV----------------------------AQ------------------------------------
Q9MAK6_ARATH/832-1077ADG.SLQKLKARLV----------------------------TQ------------------------------------
Q9M1F5_ARATH/873-1122IPGVEEPRFKARLV----------------------------AK------------------------------------
Q9FJA1_ARATH/460-702PDG.TIERYKARLV----------------------------AQ------------------------------------
Q94HQ0_ORYSJ/485-718EAG.AIVKHKARLV----------------------------AR------------------------------------
O82493_ARATH/823-1068SDG.SLDRLKARLV----------------------------AR------------------------------------
O04543_ARATH/827-1076SDG.SVERYKARLV----------------------------AQ------------------------------------
O65147_SOYBN/1068-1313EEG.VITRNKARLV----------------------------AQ------------------------------------
Q9SLF0_ARATH/850-1094SDG.SVERYKARLV----------------------------AL------------------------------------
Q9XII7_ARATH/966-1215ADG.NLERYKARLV----------------------------AK------------------------------------
Q9M5J7_PICGL/100-347VEG.KVEKYKARLV----------------------------EK------------------------------------
Q7Y1I1_ORYSJ/727-972ARG.EVTKFKARLV----------------------------AK------------------------------------
Q9LJ55_ARATH/735-980AEG.NINKYKARLV----------------------------AK------------------------------------
Q9FX79_ARATH/941-1190ADG.SLERYKARLV----------------------------AK------------------------------------
Q94GR9_ORYSJ/975-1220ENG.LVVRNKTRLV----------------------------AQ------------------------------------
Q949J4_SOLLC/397-647EKG.EVMRYKARLV----------------------------AQ------------------------------------
Q7X7N0_ORYSJ/758-1003SDG.SLARHKARWV----------------------------VH------------------------------------
Q8TFI1_SACEX/864-1104....GTHTAKARLV----------------------------AQ------------------------------------
Q7XZY2_ORYSJ/297-542ASG.KILKHKARLV----------------------------AK------------------------------------
POLX_TOBAC/840-1088GDC.KLVRYKARLV----------------------------VK------------------------------------
Q7XN62_ORYSJ/915-1162SRG.NIEKFKARLV----------------------------AK------------------------------------
Q7XLI2_ORYSJ/53-298SDG.SLDRYKARWV----------------------------LR------------------------------------

PF02123

RDRP_SCPMV/464-849QH....MQFVAACVTGRV.............................................................P
RDRP_SBMVA/490-847RH....LELVALCVTERL.............................................................F
RDRP_SCVLB/833-1303......LEHCRELFIMAR.....................AEGKRPMRMKWQEYWRQRAVIMPGGS.............VH
RDRP_PLRVW/609-1004VEDHKLLPVLTQLTFDRL.............................................................Q
Q9JE94_9VIRU/129-560......REAINQIYKEEI.......................TRKEVPDTFKQHVFTSPLWVKKGA...............
RDRP_PEMVW/733-1124VFDHESTEDLWETVRDRL.............................................................F
RDRP_HV19S/122-585......GACIDFILDTEL......................GGDTIELPDEDEWWTSRWLWCVNGS..............Q
O55590_9REOV/25-748AMEKANLYNIPKLIRNWIDAPTLSGFKLMAKIYSFSFHVGFRKQKMIDAALDQLSTEYSDDVDDEM.........YQEYS
RDRP_ROTHC/32-749QLRDEGLEYIPDYYEKWFKSPDPLTFPNIALIYSFSFHVGYRKQALSDAVYDQITVTYSDNVNMEM.........YKEYS
Q90155_9VIRU/96-539......HDLIYRLLSRNY........................NNTKISSFEHHLEERLLWSRSGS...............
Q90193_9VIRU/400-785................................................................................
Q83093_9VIRU/433-816RH....GDLVYIAVAERL.............................................................I
RDRP_ROTGI/37-803KSDPLNKSRMLKLMNENLNTTLDKFSLI.FNCFSSTFHVGHRIDNAQDAITDQVTATYTSNVNREMYD.....SYYYKLK
RDRP_TYYVF/580-974VEDQKLLPILAQLTFFRL.............................................................Q
Q99AT3_9VIRU/99-573......GAAIDAILDEEIKR..................VEGSQHIEFDSYQEHWNDRWAWAVNGAH..........SGHV
Q98XW8_9VIRU/144-622......RQCVRDVLRREL.......................RTRVVLPPSDDFFRRRYAWCVGGAHN........LNGND
Q66150_9VIRU/22-408VA....WPLVCEAVVERL.............................................................H
Q86519_9VIRU/516-902LA....RDLVCLAVVERL.............................................................N
RDRP_PCVC/362-832TNQQYKKDFITSVEEAYVRL..................KIEPKPVNVDGFIDFYHRRASWLTKGGLVYNKLPPEMKKFGG
Q90153_9VIRU/1024-1530ATEII.NETVNSVVETAY........................PKAVPQSFDRFMDNAYEWLVSGSSAG.....IPSPLKN
Q87025_SCVLA/177-657......YSCVRDMFEGSK......................QTYKYPFMTWDDYTANRWEWVPGGS.............VH
Q9YXE6_9VIRU/120-589......RSHIRAVLAMEL......................AGRDLSLPDLDSWWSSRWLWCVNGSQ.........NDASS
Q83073_9VIRU/49-523......RNAIRRVFDEEL......................PRDKVVLRPKDDFWSSRWLWAANGG............HSR
Q9YXE4_9VIRU/99-573......RSHIRTVLEREIQR..................VGDSHAIEYPTLQEHWDSRWLWAVNGSQ..........SGLL
Q8V615_9VIRU/41-473......IEAINKIYKNEM.......................TDMPPPGDFKLHLITSPLWCKAGS...............
RDRP_LRVLG/155-619......RAAVRLIYSEEL.......................RRPVTYPLICDFWSSRWLWAANGS............HSR
Q65969_9LUTE/603-996VEDKKLLPILARLTFNRL.............................................................Q
RDRP_ROTPY/25-748NMKKAGLVDIPRMIQEWLVDCSLEKFTLMSKIYSWSFHVGFRKQKMIDAALDQLKTEYTEDVDNEM.........YNEYT

PF00680

POLG_HAVHM/1750-2215...MDSSPGFPYVQE...-------------------...KLTKRDLIWLDENG..........................
RDRP_BPPH6/19-638KIRKGSSTCIPYFSNDMG-------------------TKIEIAERALEKAEEAGNLMLQGKFDDAYQLHQMGGAYYVVYR
POLG_PYFV1/2270-2778...MSTSEGYPLILNRPK-------------------DA.HGKEYLFETMESGE..........................
POL1_BAYMG/1634-2107...WNTSAGPSY......-------------------...QGKKRDLCAHLSDD..........................
POL1_CPMVS/1186-1687...LATSEGFPHILSRNG-------------------KE.KGKRRFVQGDDCVV..........................
POLG_FCVC6/1262-1736...HDTSCG.PYL.....-------------------...GGRKKDHMVNGEPD..........................
POL1_RCMV/1182-1684...LATSEGFPHVMSREQ-------------------GE.KGKQRFVQGDGHIV..........................
POL1_GCMV/1454-1960...MKTSPGYPYFKNKGL-------------------G..KGKHPYFEECEDGS..........................
POLG_WMV2U/237-705...MKAAVGAQY......-------------------...KGKKQDYFSGMDSF..........................
POLG_LORDV/1209-1676...KTTSSGHPH......-------------------...HMRKNDCWNGESFT..........................
POL1_BRSV/1468-1975...MKTSPGYPYFKNNRA-------------------EKLKGKSAYFEEAEDGT..........................
POLG_HE701/1750-2193...LTTSAGYPYLLQ...-------------------...GKKKRDIFNRQTRD..........................
POL1_CPSMV/1177-1679...MATSEGFPHILTRKS-------------------GE.KGKGRFVYGDGEIF..........................
Q94M06_9VIRU/64-655KIPKMSTSGPPRNVNDA.-------------------...EMKLQYALALFSGN..........................
Q9MC15_9VIRU/40-607RTNGKSKTGLPNNTKDA.-------------------...REKKKFFMSLMDHG..........................
POLG_TUMVQ/2376-2844...MKSAVGALY......-------------------...KGKKKDYFAEFTPE..........................
POLG_OMV/383-852...LKAAVGAMY......-------------------...TGKKQQYFEGMSED..........................
POLG_RHDVF/1279-1750...LSTSCG.PFV.....-------------------...PGKKIDHVKDGVMD..........................
POLG_PVYHU/2293-2761...MKAAVGAMY......-------------------...GGKKKDYFEHFTEA..........................
POLG_PSBMV/2413-2881...MNAAVGAMY......-------------------...QGKKKDYFEDFTAA..........................
POLG_SMSV1/1376-1852...HDTSCG.PYI.....-------------------...GGRKKDHVKDGVLD..........................
POLG_TEV/2297-2761...MKAAMGALY......-------------------...KGKKKEALSELTLD..........................
POLG_HRV8A/1721-2162...LNTSAGFPYVSL...-------------------...GIKKKDLIDKKTKD..........................
POLG_PEMVC/2294-2762...ITTAVGAMY......-------------------...GGKKKEYFEKFTTE..........................
POLG_TMEVB/1854-2301...KDTSPGLPYTQQ...-------------------...GLRRTDLLNFITAK..........................
POLG_BOVEV/1731-2174...LGTSASYPYVAM...-------------------...GIKKRDILNKETRD..........................
POL1_APMV/57-557...KSTSEGFPHVLSRAP-------------------GE.KGKMRFLEGDGEKF..........................
POLG_CXA21/1762-2205...LSTSAGYPYVAM...-------------------...GKKKRDILDKQTRD..........................
POLG_PPVD/2311-2779...MKAAVGALY......-------------------...SGKKRDYFKNVSDQ..........................
POLG_EMCV/1842-2288...RNTSPGLPYTAL...-------------------...GMRRTDVVDWESAT..........................
POLG_TVMV/2260-2728...MDAAVGALY......-------------------...SGKKKQYFEDLSDD..........................
POLG_SOUV3/1299-1766...KTTSSGFPY......-------------------...HRRKNDDWNGTTFV..........................
POLG_CXA9/1756-2200...LTTSAGYPYVAL...-------------------...GIKKRDILSKKTRD..........................
POLG_FMDV1/1875-2327...PDTAPGLPWALQ...-------------------...GKRRGALIDFENGT..........................
POLG_HRV14/1736-2178...ITTSAGFPYVSL...-------------------...GIKKRDILNKETQD..........................
POLG_HRV1B/1714-2156...LNTSAGFPYVTM...-------------------...GIKKRDLINNKTKD..........................
POLG_PRSVH/2537-3005...MDAAVGALY......-------------------...TGKKRKYFEGSTVE..........................
Q9FZT2_9VIRU/64-684KIARGSSTGCPDFQKTMS-------------------AKVMTATRALANAEAAGKLYLKGAYREAFLLYDFGGCYYVVYR
POL1_GFLV/1488-1974...MDTSEGYPDVLDRKP-------------------GE.KGKARFFVGEPGNR..........................

PF00998

RDRP_TNVA/224-703...RHTPVTSEQFLMNYT----------------------GRKLTIYREAVDS.--------------------------
RDRP_TCV/272-752...NHTPVPREKYPSFYK----------------------GRRATIYQKALDS.--------------------------
RDRP_TNVD/224-709...KTTRLTPREFLGFYT----------------------GRKLERYQKAVES.--------------------------
RDRP_MCMVK/460-941...HRHPVSRETFLAYYT----------------------GPKRTMYEKAVNS.--------------------------
POLG_HCVEU/2430-2941SIEEACDLTPSHSARSKY----------------------GYGAQ.DVRSRAS.--------------------------
POLG_HCVED/2420-2931TTEEACDLTPPHSARSKF----------------------GYGKK.DVRSHSR.--------------------------
POLG_HCVJL/2434-2945SVEEACDLTPAHSARSKF----------------------GYGAK.DVRGRTS.--------------------------
POLG_HCVJK/2431-2942SVEEACRLVPSHSARSKF----------------------GYGAK.EVRSLSS.--------------------------
POLG_HCVEV/2426-2937PLEEACGLTPPHSARSKY----------------------GYGAK.EVRSLDK.--------------------------
POLG_HCVJ6/2445-2956TLEEACQLTPPHSARSKY----------------------GFGAK.EVRSLSG.--------------------------
Q9IR83_9TOMB/236-712...HHTPIPREHYPGLYK----------------------GRRYQIYADAVNS.--------------------------
Q87031_9LUTE/24-502..GCPRTHTPEELAATYH----------------------SGKRSLYNAAVQS.--------------------------
RDRP_POLVP/251-722...YCPAMTRSEFCESYS----------------------GTRRATYERARLS.--------------------------
Q65987_9TOMB/269-750...NHTPILREDYSKLYK----------------------GRRATIYQNACES.--------------------------
P90338_9TOMB/1-480...LHTRISAAQVVDCYQ----------------------GRKRTVYHNARLS.--------------------------
RDRP_BYDV1/361-840..GYCKTYPAQLLANSYS----------------------AGKRAMYHKAIAS.--------------------------
O09796_9HEPC/2422-2933SIEEACKLTPPHSAKSKY----------------------GYGAK.DVRNLSS.--------------------------
O09803_9FLAV/2373-2866TYEEAIRTVRPHAA...M----------------------GWGSKVSVKDLATP--------------------------
O37361_9VIRU/252-737...LTTPLSPEEFLACYV----------------------GRKRTIYTKAMES.--------------------------
Q9WJD9_CARMV/267-744...NHTRISANDLVDCYQ----------------------GRKRTIYENAAAS.--------------------------
Q83103_9TOMB/228-711...KTTRLTTKEFLGFYT----------------------GRKLERYTKASES.--------------------------
Q66127_9VIRU/52-520....INAWSMEDVVNSYT----------------------GRQRARYEQAMLS.--------------------------
RDRP_PMVK/447-937...RKSPITDEMFLSYYD----------------------GPQLTTYSKAVIS.--------------------------
POLG_GBVB/2277-2785DYDEVAAHTPSKSAKSHI----------------------TGLRGTDVRSGAAR--------------------------
Q89801_9TOMB/1-479...THSRISDDAFVALYH----------------------GRRNTIYQNAVDS.--------------------------
Q9IRA1_9TOMB/266-741...PYTPIEREEYPLLYQ----------------------GRRKAIYQKALES.--------------------------
O12301_9TOMB/231-708...RHTPVTRQAFVEFYR----------------------GRKRTIYEKAVES.--------------------------
Q83424_MNSV/290-772...THSSISPGQFLDFYT----------------------GRRRTIYEGAVKS.--------------------------
O41892_9FLAV/2409-2899TYEQAISKVRRRAA...A----------------------GWGSKVTASTLDK.--------------------------
RDRP_OCSVU/235-734...STAPMSHQQFVDSTP----------------------SRKRKVYQQALED.--------------------------
Q9IW60_9TOMB/325-800...VAHRYGYDGFLSYYS----------------------GAKLRTYTRAVES.--------------------------
Q96898_9FLAV/2396-2886TYSQAIAKVRRRAA...A----------------------GYGSKVTASTLAT.--------------------------
RDRP_RCNMV/260-745HKGQILKSSLADVVACYS----------------------SEKRKLYQKAADS.--------------------------

PF00978

R1AB_LIYV9/1925-2366TE......WYEPILPD------------------------LFKIGKWLDDRDGS--------------------------
R1AB_BYVU/2601-3046AK.....VRSDVIAIT------------------------EKGVRTWMSKREPS--------------------------
Q9YPH5_9VIRU/1359-1796ID.......CSPISNI------------------------.EASQRWWQNQSEQ--------------------------
POLN_EEVVM/2041-2488WET....YKKNPIRLT------------------------EENVVNYITKLKGP--------------------------
E0YCR0_9CLOS/53-491LAE....VTESHLSSN------------------------TMLLSDWLDKRAPN--------------------------
RDRP_TOMS1/1168-1609RK.....PNKNFSLFS------------------------RESLNRWIAKQEQV--------------------------
RDRP_PSVJ/295-726AL......AQSNFLNV------------------------...VGNFHAYMQKW--------------------------
Q66107_9BROM/228-662SK......RLPQMLGT------------------------..EIQFFSDYLAGK--------------------------
Q87644_SINDV/2053-2501WEE....FARKPIRIT------------------------TEFVTAYVARLKGP--------------------------
O56790_9VIRU/1323-1760ID........ASPMNS------------------------VSNCQKWWDKQSVT--------------------------
RDRP_CMVFN/308-738SL......ASSNFVNV------------------------...VSNFHDYMEKW--------------------------
Q9WJD8_PEBV/1299-1738IR........SDPINN------------------------KAHMQKWWRNQSTA--------------------------
Q80875_BSMV/195-630ID........RTDHCT------------------------YESALRWWDKQSVT--------------------------
RDRP_RBDVR/1234-1674FS..........KLPT------------------------GVLGSSAEQIQTYQ--------------------------
RDRP_SBWMN/1373-1810ID........DSEVST------------------------RESNLRWWKRQSTT--------------------------
POLN_ONNVI/2053-2501WRE....FASSPIRVT------------------------TENLTMYVTKLKGP--------------------------
RDRP_TAV/313-742LC.......SSNFINI------------------------...VSDFHAYMSKW--------------------------
POLN_MIDDV/534-981WDE....FAQKPIRLT------------------------TENITSYVTRLKGP--------------------------
RDRP_TMGMV/1163-1604KY.....TKNIAGVMT------------------------KDSMMRWLENRKEV--------------------------
RDRP_TOBSV/253-689LS......KLNPISGE------------------------..ELHYFNQYLENK--------------------------
RDRP_OLV2I/310-732WD.........KGD..------------------------...GHYWDDFFHRK--------------------------
RDRP_YOMV/1155-1594SG.......TDGMAMT------------------------RESFSRWLSKQESS--------------------------
RDRP_AMVLE/318-752LC......MFPDFISE------------------------.GEVSYFQDYIVGK--------------------------
POLN_RRVN/2019-2467WQE....FKDDPIRIT------------------------TENITTYVTRLKGP--------------------------
RDRP_ASPVP/1758-2169KRVP.LNSSHDEKMMQ------------------------.EAVHAFEEKKLSK--------------------------
O56250_9VIRU/1240-1678IR........ADPIVN------------------------RAQMERWWRNQSTA--------------------------
O90699_9VIRU/1363-1800ID........ASVMNT------------------------VENAARWWGKQSFT--------------------------
Q9Q6Q3_9CLOS/62-509LAS....CVGDTISQN------------------------AVAASSWLDSRSSM--------------------------
POLN_AURAV/2038-2486WEE....FKEKPIRIT------------------------TECVTSYVARLKGP--------------------------
RDRP_BBMV/271-697AD......CLFESFNI------------------------...MAKGLDYHKRW--------------------------
RDRP_CCMV/267-697IG......LLGQSMDV------------------------...MSRGLEYHKKW--------------------------
Q66581_EEEV/144-598WDF....YKTNPIRLT------------------------AENVTQYVTKLKGP--------------------------
Q9QGG9_9BROM/363-797LA......QFPGYISE------------------------.GEMGYFNKYLSGK--------------------------
RDRP_TMOB/1167-1614LSGCSLGDSGGKNIID------------------------RQALIRWMEKQEKS--------------------------
RDRP_BMV/256-688ED......CLRASMDV------------------------...MTKCLEYHKKW--------------------------
O40960_9CLOS/62-506AE......YFDVVEPD------------------------VNKINSWLLTRDRR--------------------------

PF00972

Q67483_9FLAV/252-900.RTKQPRICTKEEFINKVRS--------------------HAALGGILTEQEGW--------------------------
POLG_DEN4D/2738-3383.KKKNPRLCTREEFISKVRS--------------------NAAIGAVFQEEQGW--------------------------
O09234_DEN26/2742-3387.KKKTPRMCTREEFTRKVRS--------------------NAALGAIFTDENKW--------------------------
POLG_YEFV1/2758-3406.REKNPRLCTKEEFIAKVRS--------------------HAAIGAYLEEQEQW--------------------------
POLG_LIV/2763-3408.QKSKPRMCSREEFIAKVRS--------------------NAALGAWSDEQNRW--------------------------
O36764_9FLAV/2780-3428.REKRPRLCTKEEFIKKVNS--------------------NAALGAVFAEQNQW--------------------------
POLG_MCFA/2693-3341NRNLRPRILSKEEFVANVRN--------------------DAAVGSWSRDVP.W--------------------------

PF05919

Q6EH16_9VIRU/1-501................MGQLATVYDQAGKARIVASTNSWIQCSLFGL---------------------------------
Q5TMB5_9VIRU/174-658PA..............FARLVCIPAPEGKSRIIGEMNFWAQCALKPL---------------------------------
Q18L80_9VIRU/166-639QP.LTDNVP.......IGKLAAKEEP.GKVRIFAMVDAVTQWLLKPL---------------------------------
Q9WJ23_9VIRU/164-642................FGKISIVKDPELKMRVIAMVDYHSQFVLKKI---------------------------------
RDRP_CPMV1/246-745................MGKLSVVYDQAGKARIVAITNSWIQTAFYSL---------------------------------
Q9ZXZ7_THACU/214-754KSKDSIRGHGIGPGLGLSQFALKEEAAGKIRLFALMDSITQSVMSPL---------------------------------
Q9WJ22_9VIRU/155-622................LGKLSIVHDPELKERVIAMVDYTTQFALRPI---------------------------------
Q6EH19_9VIRU/208-686AGFKDDS.........LRKIAIKDDREGKSRPFAIFDYWSQTVLSPL---------------------------------
Q9WJ24_9VIRU/163-645IKSTKL..........IRRLSIVHDPECKERVIAIFDYGSQMVLKPI---------------------------------
Q6GYC2_9VIRU/156-638KWSKQF..........LGSLSLIYDPECKVRIVAMLDYTTQLFLRPI---------------------------------
Q18L78_9VIRU/174-654KDQTLNLIPDLSC...IGKLSTKEEAAGKVRVFAMVDIWTQSILNPL---------------------------------
Q18L79_9VIRU/168-671LPDFDDNVS.......LGKLAFKEEP.GKVRVFAMADCITQWVLHPL---------------------------------
Q3S3F3_9VIRU/120-606................SGKLGIVKDPEGKRRIIAMVDYHSQLVLRSI---------------------------------
O92614_9VIRU/173-711DLK.............LGKLAIKEEAAGKARVFAMADSITQSVMAPL---------------------------------

PF00078

POL_WDSV/812-977----------------.................TAVVASPTTVLSNL---------------------------------
POL_RSVP/769-938----------------....................FGAVQQGAPVL---------------------------------
O01419_BOMMO/502-756----------------...............NVGPNLADSQYGFRRG---------------------------------
O13348_MAGGR/497-764----------------GLLSCT.HGGALPKRSATDLVCALAHDIEQA---------------------------------
O18558_AEDAE/472-725----------------................ANMPLHVNQHAYQSG---------------------------------
O22148_ARATH/497-727----------------ISETQAAFVKGRLISDNILIAHELLHALSSN---------------------------------
O22220_ARATH/221-456----------------VSPTQSAFVAERLVSDNIILAHEIVHNLRTN---------------------------------
O23410_ARATH/308-553----------------.................SKLIGPAQASFIPG---------------------------------
O41894_9RETR/202-360----------------....................VATQNCHSASI---------------------------------
O42691_ALTAL/36-202----------------....................DEYPIPLSRTL---------------------------------
O44316_DROMR/394-650----------------..................VSWDPRQRGFLPT---------------------------------
O47500_VENIN/326-590----------------.................DPVFLDCSHGFRPN---------------------------------
O52209_9ZZZZ/135-366----------------.................ENDFMGFSYGFRPG---------------------------------
O52231_STRPN/68-275----------------.................EPHFSDTSYGFRPN---------------------------------
O62658_CANFA/517-773----------------.................KKIIHHDQVGFIPG---------------------------------
O64428_CHLVU/554-816----------------.................NQVVDATQTGFLPK---------------------------------
O64612_ARATH/788-1031----------------.................PEFIAPNQSAFISD---------------------------------
O65244_ARATH/405-664----------------.................PKFIVGNQSAFVKD---------------------------------
O65598_ARATH/489-747----------------.................SCVISPSQSAFLPG---------------------------------
O69788_RHIML/72-291----------------.................DSLFLPDSYGYRPG---------------------------------
DPOL_WMHBV/364-590----------------....................VSWPKFAVPNL---------------------------------
O72700_9VIRU/1279-1449----------------....................DQYSLPGINTI---------------------------------
O81068_ARATH/814-1073----------------.................PSFILQNQSAFVKE---------------------------------
O81284_ARATH/58-317----------------.................DQAVQSNQVGFIKG---------------------------------
O81454_ARATH/144-304----------------....................YRHPIPRLYDM---------------------------------
O81517_ARATH/408-666----------------.................PAAISHSQSAFMPG---------------------------------
O81630_ARATH/874-1114----------------VSDS......QAAFIPGRLVNDNVMIAHEMM---------------------------------
O82216_ARATH/238-497----------------.................PKFIVGNQSAFVKD---------------------------------
O82276_ARATH/356-618----------------.................SKLIGPAQASFIPG---------------------------------
O82894_ECO57/115-332----------------.................EVTADQRSFGFRTG---------------------------------
O85869_SPHAR/89-369----------------.................EPLFSRHSHGFRPK---------------------------------
O85879_SPHAR/47-327----------------.................EPVFSKASHGFRPG---------------------------------
POL_FFV/202-360----------------....................IAVQNQHSYGI---------------------------------
O93520_ORYLA/518-771----------------.................PMLMHKDQTGFIKQ---------------------------------
O96546_LYMDI/526-780----------------................ANNLVPDAQFGFRAK---------------------------------
O96849_DICDI/53-215----------------....................QSFKMEGIKNL---------------------------------
O99479_PAVLU/111-389----------------.................GKHFSPDSFGFRPG---------------------------------
O99969_PORPU/100-315----------------.................EAIFEPNSYGFRPG---------------------------------
O99970_PORPU/100-315----------------.................EAIFEPNSYGFRPG---------------------------------
DPOL_GSHV/413-636----------------....................VHWPKFAVPNL---------------------------------
POL_MLVAV/221-393----------------....................IH...PTVPNP---------------------------------
POL_HTL1A/633-804----------------....................LSSSSPGPPDL---------------------------------
POL_HTLV2/631-802----------------....................LTSPSPGPPDL---------------------------------
POL_SMRVH/71-240----------------....................MGALQPGLPSP---------------------------------
POL_MMTVB/68-237----------------....................MGALQPGLPSP---------------------------------
POL_CAMVC/289-452----------------....................DAYNLPNKDEL---------------------------------
AI1M_YEAST/315-577----------------.................DKKMSTHSHGFRKN---------------------------------
AI2M_YEAST/348-613----------------.................NNSFSYYSHGFRPN---------------------------------
POL_SRV1/74-243----------------....................MGALQPGLPSP---------------------------------
POL_IPHA/60-229----------------....................FGPVQRGLPLL---------------------------------
POL_HV1MA/655-826----------------....................FWEVQLGIPHP---------------------------------
POL_CERV/271-436----------------....................DAHNLPNKDEL---------------------------------
YMC6_SCHPO/300-566----------------.................EPLFNTASHGFRPG---------------------------------
LIN1_NYCCO/516-772----------------.................KKIIHHDQVGFIPG---------------------------------
POL_FMVD/282-445----------------....................DSHNLPNMQEL---------------------------------
LTRA_LACLM/90-361----------------.................EPVFEDVSHGFRPQ---------------------------------
POK10_HUMAN/76-245----------------....................MGPLQPGLPSP---------------------------------
POL_BAEVM/219-391----------------....................IH...PTVPNP---------------------------------
POL4_DROME/357-523----------------....................DKFPLPRIDDI---------------------------------
POLY_DROME/224-390----------------....................DRYPMPSIPMI---------------------------------
POL_EIAV9/249-419----------------....................GTEISRGLPHP---------------------------------
POL_IPMA/71-240----------------....................FGPVQRGLPVL---------------------------------
POL2_MOUSE/524-780----------------.................KAIIHPDQVGFIPG---------------------------------
POL_IPMAI/16-159----------------....................AQ....A.RAN---------------------------------
DPOL_WHV3/416-639----------------....................VHWPKFAVPNL---------------------------------
DPOL_HBVC3/376-600----------------....................VSWPKFAVPNL---------------------------------
YTX2_XENLA/513-765----------------.................AEVIHPDQSYTVPG---------------------------------
RTP2_TRYBG/594-780----------------....................FSGIQFGVGGH---------------------------------
POL_SOCMV/246-411----------------....................DSYKLPRKDFI---------------------------------
POLR_DROME/403-660----------------..................INWDPRQRGFLPT---------------------------------
Y2R2_DROME/498-741----------------.................LPEGCRWQFGFRQG---------------------------------
POL_COYMV/1445-1615----------------....................DQYSLPGINTI---------------------------------
POL_BIV29/638-806----------------....................GQEFSTGLPYP---------------------------------
RDPO_SCEOB/124-343----------------.................EEVADLSSYGFRPM---------------------------------
POL2_DROME/249-414----------------....................DRYPIPNMDEI---------------------------------
RT67_ECOLX/48-262----------------..............FAIRKISNNYSFGFERG---------------------------------
RTJK_DROME/502-757----------------................VTKAIPKFQFGFRLQ---------------------------------
RTJK_DROFU/502-757----------------................VTRAIPKFQFGFRLQ---------------------------------
POL_GALV/218-390----------------....................IH...PTVPNP---------------------------------
POL_SIVGB/659-830----------------....................FHELQLGIPHP---------------------------------
RT86_ECOLX/53-248----------------..................LSSSPFSIGFEKH---------------------------------
RT65_MYXXA/155-366----------------..................LPVSPQAHGFVPG---------------------------------
RT16_MYXXA/186-407----------------..................LPVHGAAHGFVAG---------------------------------
POL_SFV1/205-363----------------....................IAAQNQHSAGI---------------------------------
POL_BLVAU/41-212----------------....................IPALSPGPPDL---------------------------------
POL_RTBVP/1228-1390----------------....................DPFNIPHKISM---------------------------------
POL_SIVV1/677-848----------------....................FFEVQLGIPHP---------------------------------
DPOL_HPBDC/394-564----------------....................MRFPRYWSPNL---------------------------------
POL_JSRV/74-243----------------....................MGALQPGLPTP---------------------------------
POL_FIVT2/218-388----------------....................GAEVQLGLPHP---------------------------------
POL_CAEVC/210-380----------------....................LTEAQLGLPHP---------------------------------
YMF40_MARPO/68-333----------------.................EPRFLDSSHGFRPH---------------------------------
P71276_ECOLX/62-269----------------.................LVVFPSFLFGSVPS---------------------------------
P91581_CIOIN/483-644----------------....................DAYPLPSIESI---------------------------------
P95451_PSEAC/119-326----------------.................DPLFSDYSYGFRPG---------------------------------
Q01379_NEUCS/505-761----------------................EFNLLPEGQMGNRAG---------------------------------
Q02717_PODAN/248-528----------------.................EPRFHSSSHGFRPG---------------------------------
Q02718_PODAN/260-530----------------.................EPIFLDVSHGFRPK---------------------------------
POL_SIVG1/672-843----------------....................FFEVQLGIPHP---------------------------------
Q03261_SIV/246-416----------------....................FFEVQLGIPHP---------------------------------
Q04135_DROME/496-743----------------................INNTLPTHQFGFREK---------------------------------
RTF21_SCHPO/455-615----------------....................NIYPLPLIEQL---------------------------------
Q05804_ECOLX/44-235----------------..................FPLSPFATAYRPG---------------------------------
Q07995_9DIPT/509-760----------------................DNNIIPNQQCGFRTG---------------------------------
Q08525_CHICK/555-775----------------................NERVIRDSQHGFTRG---------------------------------
Q08724_9CYAN/108-336----------------.................EAKFEPNSYGFRPG---------------------------------
YRD6_CAEEL/484-644----------------....................EFHPLPTSEDI---------------------------------
Q17003_ANOGA/605-832----------------.................RSYLSPYQHGFVPK---------------------------------
Q17329_CAEEL/1071-1231----------------....................NAHPLPNIEAT---------------------------------
Q24262_DROME/531-692----------------....................DCFPVPIMEEV---------------------------------
Q24310_DROME/500-649----------------....................DK...YPLPLI---------------------------------
Q24335_DROME/498-745----------------................YHNIIPAHQFGFRES---------------------------------
Q24690_DROTE/495-742----------------................HSNLLSENQFGFKKG---------------------------------
Q26106_PANRE/46-203----------------....................EN.VAIAKSLI---------------------------------
Q26816_9TRYP/545-793----------------.................ESQLTPQQSAFRPG---------------------------------
Q33759_ALLMA/266-536----------------.................EPIFSDFSHGFRPQ---------------------------------
Q35056_MARPO/399-645----------------.................ESIFSRRSHGWRPG---------------------------------
Q35057_MARPO/544-811----------------.................EPRFKDISHGFRRN---------------------------------
Q35058_MARPO/623-898----------------GND.......MVKHWILPVVFSNLSHGFRPG---------------------------------
Q35062_MARPO/369-636----------------.................EPIFLDCSHGFRIH---------------------------------
Q46666_ECOLX/34-241----------------...................PVHDASMAYMKG---------------------------------
Q47277_ECOLX/68-288----------------.................EPHFLADSYGYRPN---------------------------------
Q47526_ECOLX/33-239----------------..................THIHDAATAYVDG---------------------------------
YKFC_ECOLI/86-332----------------.................ESDFHTLSYGFRPE---------------------------------
Q65353_NPVAC/181-346----------------....................DKYPIPNISDV---------------------------------
Q66233_9VIRU/1324-1494----------------....................DQYSLPGIQTI---------------------------------
Q69590_HBV/72-297----------------....................VSWPKFAVPNL---------------------------------
POL_HV2KR/674-845----------------....................FTEIQLGIPHP---------------------------------
POL_JEMBR/598-766----------------....................GQEFQIGLPYP---------------------------------
Q83013_9RETR/68-238----------------....................WGALQPGTPWP---------------------------------
Q84682_9VIRU/234-395----------------....................DA...YNLDRL---------------------------------
Q86998_9VIRU/1297-1467----------------....................DQYSLPGINAL---------------------------------
Q88285_9RETR/848-1015----------------....................YPTVASTPELF---------------------------------
Q88442_9VIRU/321-485----------------....................DGYLLPNKEQL---------------------------------
POL_CSVMV/250-413----------------....................VKYPIPNKDTL---------------------------------
Q93137_BOMMO/515-771----------------................SKGILIDEQFGFRTN---------------------------------
Q93139_BOMMO/469-719----------------.................LPRMSTRQFGFMPQ---------------------------------
Q94885_DROME/759-920----------------....................DNYPLPLIDDL---------------------------------
YG31B_YEAST/639-797----------------....................DPFPLPRIDNL---------------------------------
Q9YGS2_TAKRU/573-830----------------................RNSLFEMFQSGFRAH---------------------------------
Q9YW31_MSEPV/161-406----------------.................ENLISEEQSGFRKN---------------------------------
Q9ZNW4_SORBI/922-1081----------------....................DSFPLPRIDTS---------------------------------
Q9ZQ09_ARATH/388-543----------------....................YRFPIPQLDDM---------------------------------
Q9ZQ67_ARATH/542-701----------------....................DSFPLPHIDRM---------------------------------
Q9ZQF8_ARATH/439-674----------------ISETQSAFVAERLITDNILIAQENFHALRTN---------------------------------
Q9ZQM0_ARATH/323-569----------------ISENQSAFVPKRASNDNVLITHEALHYLKSL---------------------------------
Q9ZQQ3_ARATH/508-668----------------....................DSFPLPHIDRL---------------------------------
Q9ZQQ6_ARATH/659-918----------------...............FILQNQSAFVRERLLM---------------------------------
Q9ZS84_SOLLC/655-815----------------....................NKYSVPLVQDL---------------------------------
Q9ZTP2_MAIZE/356-516----------------....................DEFPLPRIDSL---------------------------------
Q9ZUF0_ARATH/664-923----------------.................PASIAPNQSAFIKD---------------------------------
Q9ZVK4_ARATH/510-669----------------....................NKYPLPRIDEL---------------------------------

PF07727

Q7G640_ORYSJ/781-1029------------------------------------GFSQIAGVDYN---------------------------------
Q7XEA3_ORYSJ/1145-1390------------------------------------GYVQRAGIDFD---------------------------------
Q7XLN3_ORYSJ/465-703------------------------------------GFTQKSGDDFN---------------------------------
O24438_ORYLO/963-1208------------------------------------GFKQRYGIDYE---------------------------------
O81903_ARATH/849-1098------------------------------------GFTQQKGIDYE---------------------------------
O81506_ARATH/471-718------------------------------------GYKQVHGIDYD---------------------------------
O24587_MAIZE/586-830------------------------------------GYAQVAGLDFE---------------------------------
Q94KV0_ARATH/912-1157------------------------------------GFHQEEGLDYL---------------------------------
O96968_BOMMO/855-1082------------------------------------GFQQQNNDNH.---------------------------------
Q7XBD8_MAIZE/827-1072------------------------------------GFTQKKEEDYF---------------------------------
Q9ZPU5_ARATH/845-1094------------------------------------GFTQKEGVDYN---------------------------------
Q7XTU6_ORYSJ/940-1185------------------------------------GYVQQQGVDFD---------------------------------
Q9FLR2_ARATH/13-261------------------------------------GFTQQEGVDYF---------------------------------
Q9SIM3_ARATH/973-1222------------------------------------GYTQKEGLDYT---------------------------------
Q9MAR7_ARATH/666-912------------------------------------GYVQKYGVDFQ---------------------------------
Q7XKS1_ORYSJ/160-403------------------------------------GFQQEHGRDYD---------------------------------
Q9FIC5_ARATH/965-1209------------------------------------GNKQTEGIDYS---------------------------------
O23864_9ORYZ/824-1071------------------------------------GFKQIQGVDYD---------------------------------
Q9FWI2_ORYSJ/795-1030------------------------------------GFKQKPGIDYY---------------------------------
O13308_CANAX/1056-1303------------------------------------GNRQKEKLDYD---------------------------------
Q9ZQE9_ARATH/863-1108------------------------------------GFSQEYGIDYL---------------------------------
O23529_ARATH/992-1236------------------------------------GFNQQYGVDYA---------------------------------
Q8TFJ9_DEBHN/1015-1251------------------------------------GFSQVPGEDYL---------------------------------
Q8TFJ1_PICAN/942-1182------------------------------------GFRQIEGIDYT---------------------------------
Q9LH44_ARATH/867-1112------------------------------------GFTQEYGVDYL---------------------------------
Q94I36_ORYSJ/864-1109------------------------------------GFTQVEGLYFD---------------------------------
Q02902_ARATH/100-349------------------------------------GYTQREGVDYQ---------------------------------
Q8MRT6_DROME/232-479------------------------------------GCSQKFGVDYF---------------------------------
Q967L5_AEDAE/816-1061------------------------------------GYSQKDGIDFD---------------------------------
Q7G6C9_ORYSJ/1047-1286------------------------------------GFTQVEGLDFG---------------------------------
Q94LQ7_ORYSJ/550-793------------------------------------GFKQRYGIDYE---------------------------------
Q9FJV3_ARATH/986-1235------------------------------------GYTQREGLDYY---------------------------------
Q9M1C6_ARATH/853-1098------------------------------------GYAQCYGIDYT---------------------------------
Q06035_VOLCA/983-1228------------------------------------GFAQVEGRDYE---------------------------------
Q7XKG6_ORYSJ/514-759------------------------------------GYSQTYGIDYD---------------------------------
Q9LH08_ARATH/636-888------------------------------------GFSQRPGVDYE---------------------------------
Q9ZQK0_ARATH/918-1163------------------------------------GFTQTYGEDYL---------------------------------
Q7X5X4_ORYSJ/138-383------------------------------------GYVQRQGIDFE---------------------------------
Q9LVQ2_ARATH/1008-1252------------------------------------GNNQIEGEDYT---------------------------------
Q84M55_ORYSJ/910-1155------------------------------------GYSQTYGIDYD---------------------------------
COPIA_DROME/920-1165------------------------------------GFTQKYQIDYE---------------------------------
Q9ZQE4_ARATH/762-1011------------------------------------GFSQQEGIDYN---------------------------------
Q9SH77_ARATH/866-1115------------------------------------GYAQKEGIDYH---------------------------------
Q9C5V1_ARATH/1163-1408------------------------------------GYTQVEGLDFD---------------------------------
O82196_ARATH/663-912------------------------------------GYSQKEGIDYQ---------------------------------
O81617_ARATH/965-1214------------------------------------GFTQQEGIDYM---------------------------------
Q8TFK0_DEBHN/833-1080------------------------------------GFRQIANEHYD---------------------------------
O81824_ARATH/740-985------------------------------------GFLQEEGIDYL---------------------------------
Q94EV3_MAIZE/796-1042------------------------------------GYTQKEGEDFF---------------------------------
O74246_CANAX/39-286------------------------------------GNYMVENRDFD---------------------------------
Q9ZPG3_ARATH/915-1164------------------------------------GYTQQEGVDYI---------------------------------
Q9S9A8_HORVU/828-1073------------------------------------GFSQVQGIDYD---------------------------------
Q9ZRJ0_TOBAC/841-1089------------------------------------GFNQRKGIDFD---------------------------------
Q8W0U0_SORBI/619-868------------------------------------GFTQRPGIDFN---------------------------------
Q9FZK7_ARATH/1051-1296------------------------------------GFRQQYGLHYS---------------------------------
Q94IU9_ARATH/904-1149------------------------------------GFDQEEGVDYL---------------------------------
O74218_CANAX/999-1239------------------------------------GYRQQAGVDFV---------------------------------
Q9FLA4_ARATH/947-1191------------------------------------GFNQQYGIDYS---------------------------------
Q9C7Y1_ARATH/852-1097------------------------------------GYHQRYGVDFY---------------------------------
Q7Y173_ORYSJ/398-645------------------------------------GFSQREGIDYN---------------------------------
Q9SHT5_ARATH/807-1052------------------------------------GYVQRHGIDYD---------------------------------
O22452_VOLCA/568-813------------------------------------GFEQRAGIDYG---------------------------------
Q8W5F4_ORYSJ/472-717------------------------------------GYTQKEGEDFF---------------------------------
Q9FFM0_ARATH/852-1101------------------------------------GFSQREGIDYQ---------------------------------
Q7XUD9_ORYSJ/916-1161------------------------------------GYVQQPGIDFE---------------------------------
Q9SZY0_ARATH/766-1015------------------------------------GYAQREGIDYT---------------------------------
Q8WRX5_ANOGA/458-703------------------------------------GFSQVYGADYD---------------------------------
Q7XE22_ORYSJ/452-697------------------------------------GFKQRYGIDYE---------------------------------
O23588_ARATH/943-1192------------------------------------GYTQEEGLDYE---------------------------------
O65452_ARATH/626-870------------------------------------GNCQKEGVDYD---------------------------------
Q9ZUJ1_ARATH/925-1170------------------------------------GFHQQHGLDYS---------------------------------
O49140_ARATH/968-1213------------------------------------GFHQQYGHDFK---------------------------------
Q9FWZ5_ARATH/918-1163------------------------------------GFTQTYGSDYM---------------------------------
Q94HW2_ARATH/982-1228------------------------------------GYNQRPGLDYA---------------------------------
Q8LNW7_ORYSJ/880-1128------------------------------------GYSQIPGIDFN---------------------------------
Q9C536_ARATH/832-1077------------------------------------GYSQRAGIDYD---------------------------------
O22175_ARATH/1013-1257------------------------------------GNHQKEGVDFK---------------------------------
O42838_SACPA/1146-1386------------------------------------GHTQKAGIDYQ---------------------------------
Q9MAK6_ARATH/832-1077------------------------------------GYNQAEGIDYL---------------------------------
Q9M1F5_ARATH/873-1122------------------------------------GYAQREGVDYH---------------------------------
Q9FJA1_ARATH/460-702------------------------------------GFTQQESIDYL---------------------------------
Q94HQ0_ORYSJ/485-718------------------------------------GFVQQEGIDYD---------------------------------
O82493_ARATH/823-1068------------------------------------GYEQEEGVDYV---------------------------------
O04543_ARATH/827-1076------------------------------------GYTQKEGIDYN---------------------------------
O65147_SOYBN/1068-1313------------------------------------GYTQIEGVDFD---------------------------------
Q9SLF0_ARATH/850-1094------------------------------------GNKQKEGEDYG---------------------------------
Q9XII7_ARATH/966-1215------------------------------------GYTQKEGLDYT---------------------------------
Q9M5J7_PICGL/100-347------------------------------------GYSQVEGIEFG---------------------------------
Q7Y1I1_ORYSJ/727-972------------------------------------GYVQQPGVDFN---------------------------------
Q9LJ55_ARATH/735-980------------------------------------GYVQRHGIDFD---------------------------------
Q9FX79_ARATH/941-1190------------------------------------GYTQTEGLDYV---------------------------------
Q94GR9_ORYSJ/975-1220------------------------------------GFTQVEGLDFG---------------------------------
Q949J4_SOLLC/397-647------------------------------------GFSQRPGIDYM---------------------------------
Q7X7N0_ORYSJ/758-1003------------------------------------GYSQQHGIDYD---------------------------------
Q8TFI1_SACEX/864-1104------------------------------------GHRQIQGLDYT---------------------------------
Q7XZY2_ORYSJ/297-542------------------------------------GYVQQHGVDYD---------------------------------
POLX_TOBAC/840-1088------------------------------------GFEQKKGIDFD---------------------------------
Q7XN62_ORYSJ/915-1162------------------------------------GFTQREGIDYN---------------------------------
Q7XLI2_ORYSJ/53-298------------------------------------GFTQRPGIDFD---------------------------------

PF02123

RDRP_SCPMV/464-849LLASFE.DIHALSPTEMVEMGLCDP....---..VRLF.VKQEPHPS............RKL.KE...............
RDRP_SBMVA/490-847LLSEAE.DLLDESPVDLVRRGLCDP....---..VRLF.VKQEPHAS............RKV.RE...............
RDRP_SCVLB/833-1303SQHPVEQDVIRVLPREIRSKKGVASVMPY---KEQKYF.TSRRPEIH........AYTSTKY.EW...............
RDRP_PLRVW/609-1004KMSEAS..FEDMSAEELVQEGLCDP....---..IRLF.VKGEPHKQ............SKL.DE...............
Q9JE94_9VIRU/129-560.......HHHPLFGSYDNRLEFVENVD..---..LDRV.LKSHPAVY........ITQAPKL.EH...............
RDRP_PEMVW/733-1124RLLNQD..FID..PVQAVKDGLVDP....---..IRLF.VKLEPHKM............EKIRNK...............
RDRP_HV19S/122-585NALSDKALGIKNKSGQRYRRMAAEEVN..---..NNPV.PAWNGHTS........VSPSVKL.EN...............
O55590_9REOV/25-748MLIRDEVVKMLQESVIHDDHLLVDSELA.---GLLSMS.SASNGESRQLKFGKKTIFSTKKN.MHVMDDMYNGKYNPELV
RDRP_ROTHC/32-749ERIENEIFTILKDKIIHEDKRLEEYELS.---ALLSMS.SASNGILREINFGGQKVRSTKKN.MHVIDDIYHKKYTTDIP
Q90155_9VIRU/96-539.HYYPDEQIDQLLPPQPTRKEFLDIVT..---..IDYI.KQCKPQVF........IRQSRKL.EH...............
Q90193_9VIRU/400-785.............QLRLNKSTLLNFLPVV---EAVEAAWRNYDPNSFT......GVFWKHEVGKN...............
Q83093_9VIRU/433-816ALSEADLEAHP.KPSDLVRLGLCDP....---..VRLF.VKNEPHPA............NKVREG...............
RDRP_ROTGI/37-803QMLKEEIVQYVEDHVAKQYKDVTAES...---..LSALANSSNGFSKEVKFIDRNIKTTKKI.LHLDNDLITNDYSDLS.
RDRP_TYYVF/580-974KMLEVN..FEDMGPEELVRNGLCDP....---..IRLF.VKGEPHKQ............AKLDEG...............
Q99AT3_9VIRU/99-573SRLYPR.VPKPPGMLREHRRAWLESVT..---..EDPR.TDWDGKTF........VSASPKL.EA...............
Q98XW8_9VIRU/144-622HWLPRSLLPQFPAALLWNRRAALNCVE..---..RNPL.KRWSGHVR........VSVAEKV.EQ...............
Q66150_9VIRU/22-408ALASVDPRQHDWSPEELVKRGLCDP....---..VRLF.VKQEPHSR............QKIEQG...............
Q86519_9VIRU/516-902PLPSVDPPQHNWTPRELVEKGLCDP....---..VRLF.VKNEPHPR............KKLLER...............
RDRP_PCVC/362-832QVFDAIYNTCREIQGRHNKKSLFEVYELA---EVLQGA..NENNFNL........TKTQIKY.EV...............
Q90153_9VIRU/1024-1530SPMRDLVLKEYGLSPRPTKRSVMEAIPRD---KVLKIL.TETSPKIV........AKAHMKLNET...............
Q87025_SCVLA/177-657SQYEEDNDYIYPGQYTRNKFITVNKMPKH---KISRMI..ASPPEVR........AWTSTKY.EW...............
Q9YXE6_9VIRU/120-589RLLGIDTARFREFHTREYRRMASEALT..---..HEPI.TSWDGYTN........ISASPKL.EH...............
Q83073_9VIRU/49-523ALEHAHPELRTRKEVRAYRKCVLEQWR..---..NNPM.DAWDGQVY........VTPSQKL.EH...............
Q9YXE4_9VIRU/99-573SREHLEAAPRPPGAAREYRAVMARESE..---..QDPR.PAWDGHTY........VSGSPKL.EH...............
Q8V615_9VIRU/41-473.......HHHPHFAKYSSRLDFVMDVP..---..ADKI.AAVPPSVF........ITQAEKL.EH...............
RDRP_LRVLG/155-619ALEHAHPELATRKEGQAYRKAVMEQWQ..---..HNPM.DRWDGTVY........VTPSAKL.EH...............
Q65969_9LUTE/603-996KMLEVR..YVDLSPAELVRRGLCDP....---..IRVF.VKGEPHKQ............AKLDEG...............
RDRP_ROTPY/25-748MLIRDEIVKMLEVPVKHDDHLLRDSELA.---GLLSMS.SASNGESRQLKFGRKTIFSTKKN.MHVMDDIAHGRYTPGVI

PF00680

POLG_HAVHM/1750-2215........LLLGVHPRLAQRILFNTVMME---NC.SDLDVVFTTCPK------DELRPLEKV..................
RDRP_BPPH6/19-638AQSTDAITLDPKTGKFVSKDRMVADFEYA---VT.GGEQGSLFAASK------DASRLKEQY.......GIDV.......
POLG_PYFV1/2270-2778..........RRIKSAKLEAHYESYGHAL---QSTEPFPLICIECPK------DERRALDKI..................
POL1_BAYMG/1634-2107..............EVLHLAEVCRQQFLE---GKSTG...VWNGSLK------AELRTIEKV..................
POL1_CPMVS/1186-1687..........SLIPGTTVAKAYEELEASA---HR.FVPALVGIECPK------DEKLPMRKV..................
POLG_FCVC6/1262-1736..............KALLDLLSSKWKLAT---QG.IALPHEYTIGLK------DELRPIEKV..................
POL1_RCMV/1182-1684..........SLIPGTSVHEAYETLSRTI---AT.EVPTLVGIECPK------DEKLPFRKV..................
POL1_GCMV/1454-1960.........LKLKEGSQAAELYENMAQFA---KE.EVPELVVIECPK------DELLPARKI..................
POLG_WMV2U/237-705..............DKERLLYLSCERLFN---GE.KG...IWNGSLK------AELRPIEKV..................
POLG_LORDV/1209-1676..............GKLADQASKANLMFE---EG.KNMTPVYTGALK------DELVKTDKI..................
POL1_BRSV/1468-1975.........LKLKEGGMAAKLHENLVEFT---KN.EVPELVVIECTK------DELLPERKI..................
POLG_HE701/1750-2193.....................TTEMTKML---DK.YGVDLPFVTFVK------DELRSREKV..................
POL1_CPSMV/1177-1679..........DLIPGTSVHEAYLTLEETC---AD.TVPALVGIECPK------DEKLPLRKI..................
Q94M06_9VIRU/64-655...........RYNGYLDAFKSGDLSRFY---RD.YEAAVIMGTNVR------WQVDNPGKKRDYWAQADIERELAPSKR
Q9MC15_9VIRU/40-607..............TGWSSALAKGDYSYS---AKYYGSAPITLPTYR------DQLEKPGKKRDGYDFLGNAVVAADKSI
POLG_TUMVQ/2376-2844..............VKEEILKQSCERLFL---GK.MG...VWNGSLK------AELRPLEKV..................
POLG_OMV/383-852..............EIHQLVIASCFRLWS---GK.FG...VWNGSLK------AELRPLEKV..................
POLG_RHDVF/1279-1750..............QVLAKHLYKCWSVAN---SG.KALHHIYACGLK------DELRPLDKV..................
POLG_PVYHU/2293-2761..............DKEEIVMQSCPRLYK---GS.LG...IWNGSLK------AELRCKEKI..................
POLG_PSBMV/2413-2881..............DRELIVKQSCERLFL---GK.KG...VWNGSLK------AELRPIEKV..................
POLG_SMSV1/1376-1852..............KNLLDLLSSKWNRAK---CG.LALPHEYALGLK------DELRPKDKV..................
POLG_TEV/2297-2761..............EQEAMLKASCLRLYT---GK.LG...IWNGSLK------AELRPIEKV..................
POLG_HRV8A/1721-2162.....................ITKLRKAI---DE.YGIDLPMVTFLK------DELRKKEKI..................
POLG_PEMVC/2294-2762..............DKAEILRQSCLRLYT---GK.LG...VWEWALK------AELRSKEKI..................
POLG_TMEVB/1854-2301................MTPQLDYAHSKLV---IG.VYDDVVYQSFLK------DEIRPIEKI..................
POLG_BOVEV/1731-2174.....................VTKMQECI---DK.YGLNLPMVTYVK------DELRAPDKI..................
POL1_APMV/57-557..........SLREGTSVKKAYDLLQEEI---DR.SVPTLVAIECPK------DEKLPLRKI..................
POLG_CXA21/1762-2205.....................TKEMQRLL---DT.YGINLPLVTYVK------DELRSKTKV..................
POLG_PPVD/2311-2779..............DKESFVRASCKRLFM---GK.KG...VWNGSLK------AELRPKEKV..................
POLG_EMCV/1842-2288................LIPFAAERLRKMN---EG.DFSEVVYQTFLK------DELRPIEKV..................
POLG_TVMV/2260-2728..............AVANLVQKSCLRLFK---NK.LG...VWNGSLK------AELRPFEKL..................
POLG_SOUV3/1299-1766..............RELGEQAAHANNMYE---QA.KSMKPMYTGALK------DELVKPEKV..................
POLG_CXA9/1756-2200.....................LTKLKECM---DK.YGLNLPMITYVK------DQLRSAEKV..................
POLG_FMDV1/1875-2327................VGPEVEAALKLME---KR..EYKFACQTFLK------DEIRPMEKV..................
POLG_HRV14/1736-2178.....................TEKMKFYL---DK.YGIDLPLVTYIK------DELRSVDKV..................
POLG_HRV1B/1714-2156.....................ISRLKEAL---DK.YGVDLPMITFLK------DELRKKEKI..................
POLG_PRSVH/2537-3005..............HRQALVRKSCERLYE---GR.MG...VWNGSLK------AELRPAEKV..................
Q9FZT2_9VIRU/64-684EQMSDAVTVD.EAGDFVAKVRQVATEEYA---VS.GGHKGKMIEASK------DPSRLRDA........GYYV.......
POL1_GFLV/1488-1974..........AFVAGCNPEKAYYQLEEDS---KT.KIPSLVSIETPK------DERLKRSKI..................

PF00998

RDRP_TNVA/224-703------------LSHQPLSSR.DAKLKTF---VKAEKLNLSKKPDPA--------PR...VI------------------
RDRP_TCV/272-752------------LHDRPVSRK.DAELKTF---VKAEKINFTAKKDPA--------PR...VI------------------
RDRP_TNVD/224-709------------LEMHPVREK.DAWLSTF---VKAEKLNITAKPDPA--------PR...VI------------------
RDRP_MCMVK/460-941------------LYEMPVSYD.DAKLKTF---VKAEKINLTKKADPV--------PR...VI------------------
POLG_HCVEU/2430-2941------------KAVDHIPSVWEGLLEDS---DTPIPTTIMAKNEVF--------CVDPSKG------------------
POLG_HCVED/2420-2931------------KAINHISSVWKDLLDDN---NTPIPTTIMAKNEVF--------AVNPAKG------------------
POLG_HCVJL/2434-2945------------KALNHINSVWEDLLEDN---VTPIPTTIMAKNEVF--------CVDVSKG------------------
POLG_HCVJK/2431-2942------------KAINHINSVWEDLLEDN---TTPIPTTIMAKNEVF--------AVAPHKG------------------
POLG_HCVEV/2426-2937------------KALKHIEGVWQDLLDDS---DTPLPTTIMAKNEVF--------AVEPSKG------------------
POLG_HCVJ6/2445-2956------------RAVNHIKSVWKDLLEDT---QTPIPTTIMAKNEVF--------CVDPTKG------------------
Q9IR83_9TOMB/236-712------------LASNPVHRR.DSFLKTF---VKAEKINFSAKPDPA--------PR...VI------------------
Q87031_9LUTE/24-502------------LKKKAVERS.DANVTAF---LKMEK.HLMSK.KIA--------PR...LI------------------
RDRP_POLVP/251-722------------LDVLPCTRK.DAYLKTF---VKAEKINITLKPDPA--------PR...VI------------------
Q65987_9TOMB/269-750------------LADRACTQGGSAELKTF---VKAEKINFTAKKDPA--------PR...VI------------------
P90338_9TOMB/1-480------------LDEIPLDRR.DSHLRTF---TKAEKFCVDLKPDPA--------PR...VI------------------
RDRP_BYDV1/361-840------------LRTIPYHQK.DANVQAF---LKKEK.HWMTK.DIA--------PR...LI------------------
O09796_9HEPC/2422-2933------------RAVNHIRSVWEDLLEDT---ETPIDTTIMAKSEVF--------CVQPEKG------------------
O09803_9FLAV/2373-2866------------AGKMAVHDRLQEILEG.---.TPVPFTLTVKKEVF--------FK..DRK------------------
O37361_9VIRU/252-737------------FKTKPWDARKDMIVKAF---IKKEK.DKLVDESCD--------PR...II------------------
Q9WJD9_CARMV/267-744------------LLDRAIERK.DGDLKTF---IKAEKFNVNLKSDPA--------PR...VI------------------
Q83103_9TOMB/228-711------------LEVISFQEK.DSWLSTF---VKAEKINITAKPDPA--------PR...VI------------------
Q66127_9VIRU/52-520------------IMERPLERR.DARVSTF---IKAEKINFSAKPDPA--------PR...VI------------------
RDRP_PMVK/447-937------------LSERPVAVQ.DSYLKTF---IKAEKLNLTLKTDPC--------PR...VI------------------
POLG_GBVB/2277-2785------------KAVLDLQKCVEAGEIPS---.HYRQTVIVPKEEVF--------VKTPQKP------------------
Q89801_9TOMB/1-479------------LRIGGVQRK.DSYLSTF---IKAEKIPIYRKPDPA--------PR...VI------------------
Q9IRA1_9TOMB/266-741------------LSERPCTRK.DAKLRTF---VKAEKINFTSKGDPA--------PR...VI------------------
O12301_9TOMB/231-708------------LSAAPVTHR.DARLKTF---VKAEKLVLSRKPDPA--------PR...II------------------
Q83424_MNSV/290-772------------LEGLSVQRR.DAYLKTF---VKAEKINTTKKPDPA--------PR...VI------------------
O41892_9FLAV/2409-2899------------.GWPHVKEMLDKIAFH.---.KEVPFTFVTKXEVF--------FS...KT------------------
RDRP_OCSVU/235-734------------ISCHGLNLETDSKVKVF---VKYEKTDHTSKADPV--------PR...VI------------------
Q9IW60_9TOMB/325-800------------LHITPVSER.DSHLTTF---VKAEKIS.TAKSDPA--------PR...VI------------------
Q96898_9FLAV/2396-2886------------.GWPHVEEMLDKIARG.---.QEVPFTFVTKREVF--------FS...KT------------------
RDRP_RCNMV/260-745------------LEKKPVQWR.DSKVQAF---IKVEKLECDTK.DPV--------PR...TI------------------

PF00978

R1AB_LIYV9/1925-2366----------KYRML...NRRLDFAS.LA...DKFKTLNLMVKGETK--------PKMDLST------------------
R1AB_BYVU/2601-3046----------QLRAL...SSDLQKPLNLE...EEITTFKLMVKRDAK--------VKLDSSC------------------
Q9YPH5_9VIRU/1359-1796----------AKKQL...IA.ETKIL.SE...IDVGVYNFMIKRDVK--------PKLDLSP------------------
POLN_EEVVM/2041-2488----------KAAALY.AKTHNLDML.QD...IPMDRFIMDLKRDVK--------..VTPGT------------------
E0YCR0_9CLOS/53-491----------AYKSLK.RAL.GSFVF.HP...SMLTSYTLMVKADVK--------PKLDNTP------------------
RDRP_TOMS1/1168-1609----------TIGQL...ADFDFVDL.PA...VD..QYRHMIKAQPK--------QKLDLSI------------------
RDRP_PSVJ/295-726----------AASGL...TYDDLPDL.HA...ENLQLYEHMVKSDVK--------PVVADTL------------------
Q66107_9BROM/228-662----------NP..P...LSEYQGPL.TL...QSLDKYMHMVKTIVK--------PVEDNSL------------------
Q87644_SINDV/2053-2501----------KAAALF.AKTYNLVPL.QE...VPMDRFVMDMKRDVK--------..VTPGT------------------
O56790_9VIRU/1323-1760----------AQKQM...LA.DTRII.SE...IDLCTYNFMIKNDVK--------PKLDLSP------------------
RDRP_CMVFN/308-738----------KSSGL...SYDDLPDL.HA...ENLQFYDHMIKSDVK--------PVVSDTL------------------
Q9WJD8_PEBV/1299-1738----------VQAKV...MQ.DVREL.HE...IDFSSYMFMIKSDVK--------PKMDSTP------------------
Q80875_BSMV/195-630----------ARAQL...VA.DQRRL.CD...VDFTTYNFMIKNDVK--------PKLDLTP------------------
RDRP_RBDVR/1234-1674----------NKTGN...KVTDPVCV.AL...SPIQKYKHMIKRDVK--------FNLTDGA------------------
RDRP_SBWMN/1373-1810----------AKAQL...KK.ETRLL.HE...LDLCYYNYCIKGDEK--------PKMDRSP------------------
POLN_ONNVI/2053-2501----------KAAALF.AKTHNLLPL.QE...VPMDRFTMDMKRDVK--------..VTPGT------------------
RDRP_TAV/313-742----------QS.VL...SYDDLPDL.NA...ENLQFYEHMVKSDVK--------PSVTDTL------------------
POLN_MIDDV/534-981----------KAAALF.AKTYDLKPL.QE...VPMDRFVVDMKRDVK--------..VTPGT------------------
RDRP_TMGMV/1163-1604----------LLDDL...ANYNFTDL.PA...ID..QYKHMIKAQPK--------QKLDLSI------------------
RDRP_TOBSV/253-689----------NP..P...LSEYKGPV.PL...VALDKYMHMIKTTLK--------PVEEDNL------------------
RDRP_OLV2I/310-732----------GRKVF...SLENCYDD.PL...SS...YLVMLKSAGK--------FSLDLNF------------------
RDRP_YOMV/1155-1594----------TVGQL...ADFNFVDL.PA...VD..EYKHMIKSQPK--------QKLDLSI------------------
RDRP_AMVLE/318-752----------NP..D...PELYSDPL.GV...RSIDSYKHMIKSVLK--------PVEDNSL------------------
POLN_RRVN/2019-2467----------KAAALF.AKTHNLVPL.QE...VPMDRFVVDMKRDVK--------..VTPGT------------------
RDRP_ASPVP/1758-2169----------SMATI...EN.HSGRS.CEDWPVD.KALIFM.KSQLC--------TKFDNRF------------------
O56250_9VIRU/1240-1678----------IQAKV...VA.DVREL.HE...IDYSSYMYMIKSDVK--------PKTDLTP------------------
O90699_9VIRU/1363-1800----------AQKQM...IA.DTRVV.HE...IDVCTYNFMIKNDVK--------PKLDLSP------------------
Q9Q6Q3_9CLOS/62-509----------AKQSLWVRLRSFVYDL.AA...MT..RYQLMVKADAK--------PKLDSTP------------------
POLN_AURAV/2038-2486----------EAAALF.AKTHQLVPL.QE...VPMDRFVMDMKRDVK--------..VTPGT------------------
RDRP_BBMV/271-697----------KS.HK...ELQGVTLL.CE...TNLQRYQHMIKSDVK--------PTVTDTL------------------
RDRP_CCMV/267-697----------KD.HK...DLTGVTVL.SE...INLQRYQHMIKSDIK--------PVVSDTL------------------
Q66581_EEEV/144-598----------KAAALF.AKTHNLQPL.HE...IPMDRFVMDLKRDVK--------..VTPGT------------------
Q9QGG9_9BROM/363-797----------NI..P...EDAFVDPC.AL...VSMDKYRHMIKTQLK--------PVEDCSQ------------------
RDRP_TMOB/1167-1614----------TIGQL...ADYDFVDL.PA...ID..QYRHIIKSQPK--------QKLDLSI------------------
RDRP_BMV/256-688----------GK.HM...DLQGVNVA.AE...TDLCRYQHMLKSDVK--------PVVTDTL------------------
O40960_9CLOS/62-506----------KYGNV...LRGFDGND.WT...TKLFNLKLMVKGDMK--------PKLDMSG------------------

PF00972

Q67483_9FLAV/252-900-----SSAAEAVADPRFWSLVDKERQAHLEGRCETCIYNMMGKREKK--------PSEFGRA------------------
POLG_DEN4D/2738-3383-----TSASEAVNDSRFWELVDKERALHQEGKCESCVYNMMGKREKK--------LGEFGRA------------------
O09234_DEN26/2742-3387-----KSAREAVEDSRFWELVDKERNLHLEGKCETCVYNMMGKREKK--------LGEFGKA------------------
POLG_YEFV1/2758-3406-----KTANEAVQDPKFWELVDEERKLHQQGRCRTCVYNMMGKREKK--------LSEFGKA------------------
POLG_LIV/2763-3408-----ASAREAVVVPAFWALVDEVRERHLVGWCAHCVYIMMGMREKK--------LGEFGVA------------------
O36764_9FLAV/2780-3428-----STAREAVDDPRFWEMVDEERENHLRGECHTCIYNMMGKREKK--------PGEFGKA------------------
POLG_MCFA/2693-3341-----RDVQEAIQDQCFWDLVGKERALHLQGKCEMCIYNTMGKKEKK--------PSLAGEA------------------

PF05919

Q6EH16_9VIRU/1-501----------------HNKIFSILR----SIPQ.DGTFDQNKPF-DLLLESLQPGY.M...LYGFDLSAATDRLPI-AFQ
Q5TMB5_9VIRU/174-658----------------HDKEMKALR----SIRQ.DLTFYQGIGP-QVLKLHPGSK......YYSFDLKSATDRFPV-ELQ
Q18L80_9VIRU/166-639----------------HEAIFKLLN----IFAF.DGTFDQIGQL-EKFMDRMKDKAPY...YYSFDLSAATDRLPL-SIQ
Q9WJ23_9VIRU/164-642----------------HNSLFNKLK----LIKS.DRTFTQDPIF-TTPTMGHR........FWSMDLSAATDRFPI-DLQ
RDRP_CPMV1/246-745----------------HLHVFKLLK----NIDQ.DGTFDQERPF-KLLIKWLNEPTQK...FYGFDLTAATDRLPI-DLQ
Q9ZXZ7_THACU/214-754----------------HDYMFAILR----NIPN.DGTFDQEASI-ARSQEKAVTAG.K...AFSYDLTAATDRLPV-ILT
Q9WJ22_9VIRU/155-622----------------HNILLNNLS----KLPC.DRTFTQDPFH-KW.NDDHKER......YHSLDLSAATDRFPI-FLQ
Q6EH19_9VIRU/208-686----------------HDWAYATLR----SIPQ.DCTFNQAEGL-SKVTARPSQKY.....FYSYDLEAATDRFPI-QFQ
Q9WJ24_9VIRU/163-645----------------ADVLFDLLR----NIPS.DRTFTQSPFF-THTDLDNKSK......FWSIDLSSATDRFPI-VFQ
Q6GYC2_9VIRU/156-638----------------HNDLFKLLK----KLPQ.DRTFTQNPLN-DWENNEHS........FWSIDLTAATDRFPI-SLQ
Q18L78_9VIRU/174-654----------------HKKIFSIIR----ELPT.DGTFDQLKPL-DRLHELSTQD......RFSFDLSAATDRLPL-TLQ
Q18L79_9VIRU/168-671----------------HQYLFSILK----QISIVDATFDQEEGV-KTLSAKIKAGKRV...VFSLDLSAATDRLPL-TIQ
Q3S3F3_9VIRU/120-606----------------HDGLLNKLR----NLPQ.DRTYNQDPNN-AWEENKEC........FHSLDLSSATDRFPV-KLQ
O92614_9VIRU/173-711----------------NSWVFSKLK----DLPM.DGTFNQQAPL-NRLVQLYQDGLLHDVEFYSYDLSSATDRLPM-AFQ

PF00078

POL_WDSV/812-977----------------.........----...........APSL.HW--------------FTVIDLSNAFFSVPI-HKD
POL_RSVP/769-938----------------SAL......----............PRG.WP--------------LMVLDLKDCFFSIPL-AEQ
O01419_BOMMO/502-756----------------RSTLDAVQR----.VRDLSDQACSRGGV.LL--------------AVSIDISNAFNTVPW-STI
O13348_MAGGR/497-764----------------LAR......----............GEE.VT--------------LVACDVQGAFDALLH-GRL
O18558_AEDAE/472-725----------------KSTVTLLHK----.VVYDIEKAFAQKQS.CL--------------GVFLDIEGAFDNVSF-DAI
O22148_ARATH/497-727----------------.........----.........NKCSEE.FI--------------AIKTDISKAYDRVEW-PFL
O22220_ARATH/221-456----------------.........----.........EKISKD.FM--------------VFKTDMSKAYDRVEW-PFL
O23410_ARATH/308-553----------------RLSFDNIVV----VQEAVHSMRRKKGRKGWM--------------LLKLDLEKAYDRIRW-DFL
O41894_9RETR/202-360----------------.........----........LNTLYRG.PY--------------KSTLDLANGFWAHPI-KPE
O42691_ALTAL/36-202----------------.........----........MNDLAGA.DW--------------ITAMDVRSGFANLRM-APG
O44316_DROMR/394-650----------------DGCADNATI----VDLVLRDH..HKRYASCY--------------IATLDVSKAFDSVAH-DAV
O47500_VENIN/326-590----------------KSCHTA...----...LKSVS.QEFQPV.QW--------------VIEGDLAKFFDSISH-SKL
O52209_9ZZZZ/135-366----------------RSQHDAL..----..DALATG..LVRTNVNW--------------VLDADISQFFDRVSH-EWL
O52231_STRPN/68-275----------------RSCEKAI..----..MKLLEY..LNDGY.EW--------------IVDIDLEKFFDTVPQ-DRL
O62658_CANFA/517-773----------------TQGWFNTRK----TINVIHHISKRKTKN.HM--------------ILSLDAEKAFDKIQH-PFL
O64428_CHLVU/554-816----------------RWAGDNVLA----.HLEEISYLEATHQP.GV--------------QVFLDFEKAFDRLDR-AWI
O64612_ARATH/788-1031----------------RLLMENLLL----.ASELVKDYHKDGLSPRC--------------AMKIDLSKAFDSVQW-PFL
O65244_ARATH/405-664----------------RLLIENVLL----ATEIVKDYHKDSVSS.RC--------------ALKIDISKAFDSVQW-KFL
O65598_ARATH/489-747----------------RLLAENVLL----ATEMVHGYNWRNISL.RG--------------MLKVDLRKAFDSVRW-EFI
O69788_RHIML/72-291----------------KSALDAVG.----..VTRQRC....WKY.DW--------------VLEFDIKGLFDNLPH-DLL
DPOL_WMHBV/364-590----------------QSL......----........TNLLSTD.LS--------------WVSLDVFAAFYHLPL-HPA
O72700_9VIRU/1279-1449----------------.........----........IKRIGNA.KI--------------YSKFDLKSGFHQVAM-DPE
O81068_ARATH/814-1073----------------RLLMENVLL----ATELVKDYHKESVTP.RC--------------AMKIDISKAFDSVQW-QFL
O81284_ARATH/58-317----------------RLLCENVLL----ASELVDNFQAEGDTS.RG--------------CLQVDLTKAYDNVNW-EFL
O81454_ARATH/144-304----------------.........----........LDELSGA.II--------------FSKVDLRSGYHQVRM-REG
O81517_ARATH/408-666----------------RLFLENVLL----ATELVHGYNKKNIAP.SS--------------MLKVDLRKAFDSVRW-DFI
O81630_ARATH/874-1114----------------HSLK.....----.......TRKRVSQS.YM--------------AVKTDVSKAYDRVEW-NFL
O82216_ARATH/238-497----------------RLLIENVLL----ATELVKDYHKDSIST.RC--------------AMKIDISKAFDSLQW-SFL
O82276_ARATH/356-618----------------RLSIDNIVL----VQEAVHSMRRKKGRKGWM--------------LLKLDLEKAYDRVRW-DFL
O82894_ECO57/115-332----------------RSTADAI..----..AQCFCVLAQKTSA.EW--------------VLEGDIRGCFDNISH-QWL
O85869_SPHAR/89-369----------------RSCHTAL..----..ESIRAI...WTGV.KW--------------LIDVDVVGFFDNIDH-DVL
O85879_SPHAR/47-327----------------RSCHTAL..----..EHVKAV...WTGV.KW--------------LVDVDVAGFFENIDH-DIL
POL_FFV/202-360----------------.........----........LGSLFKG.RY--------------KTTIDLSNGFWAHPI-VPE
O93520_ORYLA/518-771----------------RQTQDSIRK----.VLNIIHQVVQQKQE.TL--------------VISLDAEKAFDSVRW-TFL
O96546_LYMDI/526-780----------------HSCVQQVHR----.LVEYTSSQFIMNRY.TG--------------VLFLDVAKAFDKVWH-EGL
O96849_DICDI/53-215----------------PSM......----...........VKQG.YY--------------MVKLDIKKAYLHVLV-DPQ
O99479_PAVLU/111-389----------------LGCHDAL..----...KHVRN..TWQNI.TW--------------IISIDIEKCFDTINH-TIL
O99969_PORPU/100-315----------------RSANDAR..----..KAIVKC..LQRKP.KH--------------ILDADIKGCFDNIDH-SKL
O99970_PORPU/100-315----------------RSSNDAR..----..QAIVKC..LQQLP.KH--------------VLDADIERCFDNIDH-SKL
DPOL_GSHV/413-636----------------QTL......----........ANLLSTN.LQ--------------WLSLDVSAAFYHIPV-SPA
POL_MLVAV/221-393----------------YNL......----........LSGLPPSHRW--------------YTVLDLKDAFFCLRL-HPT
POL_HTL1A/633-804----------------SSL......----............PTTLAH--------------LQTIDLRDAFFQIPL-PKQ
POL_HTLV2/631-802----------------TSL......----............PTALPH--------------LQTIDLTDAFFQIPL-PKQ
POL_SMRVH/71-240----------------VAI......----............PLN.YH--------------KIVIDLKDCFFTIPL-HPE
POL_MMTVB/68-237----------------VAV......----............PKG.WE--------------IIIIDLQDCFFNIKL-HPE
POL_CAMVC/289-452----------------.........----........LTLIRGK.KI--------------FSSFDCKSGFWQVLL-DQE
AI1M_YEAST/315-577----------------MSCQTAI..----..WEVRNM...FGGS.NW--------------FIEVDLKKCFDTISH-DLI
AI2M_YEAST/348-613----------------LSCLTAI..----..IQCKNY...MQYC.NW--------------FIKVDLNKCFDTIPH-NML
POL_SRV1/74-243----------------VAI......----............PQG.YL--------------KIIIDLKDCFFSIPL-HPS
POL_IPHA/60-229----------------SAL......----............PQD.WK--------------LIIIDIKDCFFSIPL-YPR
POL_HV1MA/655-826----------------AGL......----............KKK.KS--------------VTVLDVGDAYFSVPL-DED
POL_CERV/271-436----------------.........----........LTLVRGK.KI--------------YSSFDCKSGLWQVLL-DKE
YMC6_SCHPO/300-566----------------RSCHSA...----....LRSIFTNFKGC.TW--------------WIEGDIKACFDSIPH-DKL
LIN1_NYCCO/516-772----------------SQGWFNIRK----SINVIQHINKLKNKD.HM--------------ILSIDAEKAFDNIQH-PFM
POL_FMVD/282-445----------------.........----........LTLLRGK.SI--------------FSSFDCKSGFWQVVL-DEE
LTRA_LACLM/90-361----------------RSCHTAL..----...KTIKR..EFGGA.RW--------------FVEGDIKGCFDNIDH-VTL
POK10_HUMAN/76-245----------------AMI......----............PKD.WP--------------LIIIDLKDCFFTIPL-AEQ
POL_BAEVM/219-391----------------YNL......----........LSTLKPDYSW--------------YTVLDLKDAFFCLPL-APQ
POL4_DROME/357-523----------------.........----........LDQLGRA.KY--------------FSCLDLMSGFHQIEL-DEG
POLY_DROME/224-390----------------.........----........LANLGKA.KF--------------FTTLDLKSGYHQIYL-AEH
POL_EIAV9/249-419----------------GGL......----............IKC.KH--------------MTVLDIGDAYFTIPL-DPE
POL_IPMA/71-240----------------SAL......----............PRG.WN--------------LIIIDIKDCFFSIPL-CPR
POL2_MOUSE/524-780----------------MQGWFNIRK----.SINVIHYINKLKDKNHM--------------IISLDAEKAFDKIQH-PFM
POL_IPMAI/16-159----------------.........----..............A.AA--------------LTPEQRDWTFDLLTG-QRA
DPOL_WHV3/416-639----------------QTL......----........ANLLSTN.LQ--------------WLSLDVSAAFYHIPI-SPA
DPOL_HBVC3/376-600----------------QSL......----........TNLLSSN.LS--------------WLSLDVSAAFYHIPL-HPA
YTX2_XENLA/513-765----------------RTIFDNVFL----.IRDLLHFARRTGLS.LA--------------FLSLDQEKAFDRVDH-QYL
RTP2_TRYBG/594-780----------------..IEEAI..----...AKIRK..DFATK.GS--------------LAMLDGRNAYNAISR-RAI
POL_SOCMV/246-411----------------.........----........LEKIKGS.LW--------------FSSLDAKSGYYQLRL-HEN
POLR_DROME/403-660----------------DGCADNATI----.VDLVLRHSHKHFRS.CY--------------IANLDVSKAFDSLSH-ASI
Y2R2_DROME/498-741----------------RCVEDAWRH----.VKSSVGA..SAAQY.VL--------------GTFVDFKGAFDNVEW-SAA
POL_COYMV/1445-1615----------------.........----........ISKVGRS.KI--------------YSKFDLKSGFWQVAM-EEE
POL_BIV29/638-806----------------PGI......----............KEC.EH--------------LTAIDIKDAYFTIPL-HED
RDPO_SCEOB/124-343----------------RNVSWAVG.----..RVLNGLNNPLANY.QY--------------VVEIDIKGCVDNINH-QFI
POL2_DROME/249-414----------------.........----........LGKLGKC.QY--------------FTTIDLAKGFHQIEM-DEE
RT67_ECOLX/48-262----------------KSIIL....----.....NAY..KHRGK.QI--------------ILNIDLKDFFESFNF-GRV
RTJK_DROME/502-757----------------HGTPEQLHR----VVNFALEA.MENKEY.AV--------------GAFLDIQQAFDRVWH-PGL
RTJK_DROFU/502-757----------------HGTPEQLHR----VVNFALEA.LEKKEY.AG--------------SCFLDIQQAFDRVWH-PGL
POL_GALV/218-390----------------YNL......----........LSSLPPSYTW--------------YSVLDLKDAFFCLRL-HPN
POL_SIVGB/659-830----------------AGI......----............KKC.KR--------------ITVLDIGDAYFSIPL-DPD
RT86_ECOLX/53-248----------------QSILN....----.....NAT..PHIGA.NF--------------ILNIDLEDFFPSLTA-NKV
RT65_MYXXA/155-366----------------RSIKT....----.....GAA..PHVGR.RV--------------VLKLDLKDFFPSVTF-ARV
RT16_MYXXA/186-407----------------RSILT....----.....NAL..AHQGA.DV--------------VVKVDLKDFFPSVTW-RRV
POL_SFV1/205-363----------------.........----........LSSIYRG.KY--------------KTTLDLTNGFWAHPI-TPE
POL_BLVAU/41-212----------------TAI......----............PTHLPH--------------IICLDLKDAFFQIPV-EDR
POL_RTBVP/1228-1390----------------.........----........INLIQKA.NI--------------FSKFDLKAGFHHMKL-KDD
POL_SIVV1/677-848----------------AGL......----............KKM.KQ--------------ITIIDVGDAYYSIPL-DPE
DPOL_HPBDC/394-564----------------STL......----........RRILPVG.MP--------------RISLDLSQAFYHLPL-NPA
POL_JSRV/74-243----------------SAI......----............PDK.SY--------------IIVIDLKDCFYTIPL-APQ
POL_FIVT2/218-388----------------AGL......----............QMK.KQ--------------VTVLDIGDAYFTIPL-DPD
POL_CAEVC/210-380----------------GGL......----............QKK.KH--------------VTILDIGDAYFTIPL-YEP
YMF40_MARPO/68-333----------------RSPHTAL..----...RQIRR...WTGT.SW--------------MIEGDIKGYFDNIDH-HLL
P71276_ECOLX/62-269----------------KNDVLNSNV----.KRDYVSCAKAHCGA.KT--------------VLKVDISNFFDNIHR-DLV
P91581_CIOIN/483-644----------------.........----........VNKVTQD.KV--------------YSSLDLRSAYHQIPL-KDS
P95451_PSEAC/119-326----------------RSTHQAI..----..EMARAH..VTAGH.RW--------------CVELDLEKFFDRVNH-DIL
Q01379_NEUCS/505-761----------------RSTEFAVRV----.VTDAVHTAWKLGAV.TS--------------LMLLDLKGAFDRVNH-RWL
Q02717_PODAN/248-528----------------RGCHSAL..----...ATIRY...WNGI.KW--------------FIEGDIKGFFDNIDH-HIL
Q02718_PODAN/260-530----------------RSCHTAL..----...HQISK...WNGT.TW--------------MLEGDIKGFFNEVDH-QVL
POL_SIVG1/672-843----------------AGL......----............QKK.KQ--------------ITVIDIGDAYYSIPL-CKE
Q03261_SIV/246-416----------------GGL......----.............KR.QK--------------LTIIDLKDAYYSVPL-DKE
Q04135_DROME/496-743----------------HGTIEQVNR----.ITSEIRTAFEHREY.CT--------------AIFLDVAQAFDRVWL-DGL
RTF21_SCHPO/455-615----------------.........----........LAKIQGS.TI--------------FTKLDLKSAYHLIRV-RKG
Q05804_ECOLX/44-235----------------.CPIV....----......SNAQPHCQQ.PQ--------------ILKLDIENFFDSISW-LQV
Q07995_9DIPT/509-760----------------RSTSHQLIK----.VIKSAKENLNNKKS.TG--------------MIFLDVEKAFDRVWH-PGL
Q08525_CHICK/555-775----------------RSCLTNLVA----.FYDGVTALVDEGKA.TD--------------VIYLDLTKAFDMVPH-HIL
Q08724_9CYAN/108-336----------------RNAHDAREA----IFNSIRYS......N.KW--------------VLDADISKCFDKINH-EKL
YRD6_CAEEL/484-644----------------FSR......----............LKG.TV--------------YSQIDLKDAYLQVEL-DEE
Q17003_ANOGA/605-832----------------KSTTTNLVE----.FVTYCTSQIDAGAQ.VD--------------AIYTDLKAAFDSLPH-AIL
Q17329_CAEEL/1071-1231----------------.........----........LQSLAGK.KL--------------YTVFDMIAGFWQIPL-DEK
Q24262_DROME/531-692----------------.........----........LEKLQSA.KW--------------FTTMDLQNGFFHVAV-EEA
Q24310_DROME/500-649----------------.........----..............S.DQ--------------IARLRGANYFTCLDM-ASG
Q24335_DROME/498-745----------------HGTIEQVNR----.ITTEIRTAFEYREY.CT--------------AVFLDVSQAFDKVWL-DGL
Q24690_DROTE/495-742----------------KSTSDCLLY----VDYLITKS....KMH.TS--------------LVTLDFSRAFDRVGV-HSI
Q26106_PANRE/46-203----------------.........----............PKS.GF--------------MLTFDMKSGYHQARM-ADS
Q26816_9TRYP/545-793----------------CSTLEQLL.----..HVRAALCRPTHQS.RT--------------GAVFVDYKAFDTVDH-DKI
Q33759_ALLMA/266-536----------------RSCHT....----....ALKEVSKWNGM.TW--------------CIEGDIKSFFDNVDH-KIL
Q35056_MARPO/399-645----------------RSAHTAL..----...RTIRS..DFKKT.NW--------------IVPGNINKLFDIVNH-GIL
Q35057_MARPO/544-811----------------KGTHSAL..----...RDIKM..RWKNP.SW--------------WLEFDIRKCFDTINK-KIL
Q35058_MARPO/623-898----------------KNAHSAL..----..QQMQFG...WRDV.HW--------------LLDYDVRKAFDNVNH-HVL
Q35062_MARPO/369-636----------------RSCHTAL..----...KRLCL...EGGHYPW--------------VVEGNIRKFFDSIPH-KVI
Q46666_ECOLX/34-241----------------KGIRD....----.....NAA..AHAGN.QY--------------LLKADLEDFFNSITP-AIF
Q47277_ECOLX/68-288----------------KSALDAIG.----..VTRKRC....WYY.DW--------------VLEFDIKGLFDNIPH-ELI
Q47526_ECOLX/33-239----------------KNILD....----......NA.KIHQSS.VY--------------LLKLDLVNFFNKITP-ELL
YKFC_ECOLI/86-332----------------RSVHHAIRT----VKLQLTDC..GETRG.RW--------------VIEGDLSSYFDTVHH-RLL
Q65353_NPVAC/181-346----------------.........----........LDKLGKC.QY--------------FTTLDLASGFYQVEM-DPQ
Q66233_9VIRU/1324-1494----------------.........----........LKRVGNK.KV--------------FSKFDLKSGFHQVAM-AEE
Q69590_HBV/72-297----------------QSL......----........TNLLSSN.LS--------------WLSLDVSAAFYHLPL-HPA
POL_HV2KR/674-845----------------AGL......----............AKK.RR--------------ITVLDIGDAYFSIPL-HED
POL_JEMBR/598-766----------------PGI......----............QQC.EH--------------ITAIDIKDAYFTIPL-DEN
Q83013_9RETR/68-238----------------GAI......----............PSE.WP--------------VIAMDISDCFFSIPL-AER
Q84682_9VIRU/234-395----------------.........----........YLTDRES.NW--------------FSTLDAKSGFLQLRL-DEE
Q86998_9VIRU/1297-1467----------------.........----........LKNVARA.KI--------------FSKFDLKSGFHQVAM-DEE
Q88285_9RETR/848-1015----------------.........----........AKLEKKY.QV--------------YSSLDISNGFWSIRL-EEE
Q88442_9VIRU/321-485----------------.........----........LQRIGGK.TF--------------YSSFDCKSGFWQVRL-APE
POL_CSVMV/250-413----------------.........----........IHRSIQA.RY--------------YSKFDCKSGFYHIKL-EED
Q93137_BOMMO/515-771----------------HSCVQQVHR----LTEHILVGLNRPKPLYTG--------------ALFFDVAKAFDKVWH-NGL
Q93139_BOMMO/469-719----------------RSTEDSLYT----.LMQHVKEKLKEKRI.IT--------------IVSLDIEGAFDSAWW-PAL
Q94885_DROME/759-920----------------.........----........LDRMNEK.TV--------------FTKLDLKNGFFHVHV-KKE
YG31B_YEAST/639-797----------------.........----........LSRIGNA.QI--------------FTTLDLHSGYHQIPM-EPK
Q9YGS2_TAKRU/573-830----------------HSTETALLK----.VTNDLLIASDHGLV.SM--------------LVLLDLSAAFDTVDH-SIL
Q9YW31_MSEPV/161-406----------------RSIKDNI..----..YILHEIIRNRKKE.TY--------------FAFIDFKKAFDNVDR-EIL
Q9ZNW4_SORBI/922-1081----------------.........----........VDKAAGC.QR--------------FSLLDCFSGYHQIWL-KKE
Q9ZQ09_ARATH/388-543----------------.........----........LDELSGS.KV--------------FSKIDLRSGYHQIRI-RPG
Q9ZQ67_ARATH/542-701----------------.........----........VEATTGN.EL--------------LSFMDAFSGYNQIPM-HKD
Q9ZQF8_ARATH/439-674----------------PAC......----............KKK.YM--------------AIKTDMSKAYDRVEW-SFL
Q9ZQM0_ARATH/323-569----------------GAE......----............KRC.FM--------------AVKTNMSKAYDRIEW-DFI
Q9ZQQ3_ARATH/508-668----------------.........----........VESTAGN.EL--------------LSFMDAFSGYNQIMM-NPE
Q9ZQQ6_ARATH/659-918----------------ENVLLATEL----VKDYHKDS....ISP.RC--------------AMKIDISKAFDSVQW-QFL
Q9ZS84_SOLLC/655-815----------------.........----........MDRLSKA.CW--------------FTKLDLRAGYWQVRI-AEG
Q9ZTP2_MAIZE/356-516----------------.........----........VDATASS.EL--------------MSLLDCYSGYHQIWM-KRE
Q9ZUF0_ARATH/664-923----------------RLMMENLLL----ASELVKDYHKESISS.RS--------------ALKIDISKAFDFVQW-PFL
Q9ZVK4_ARATH/510-669----------------.........----........LDQLRGA.TC--------------FSKIDLTSGYHLIPI-AEA

PF07727

Q7G640_ORYSJ/781-1029----------------..DVFSPVV----KHSSIRTFFCIVAMH-DLE-------------LEQLDVKTIFLHGEL-EEE
Q7XEA3_ORYSJ/1145-1390----------------..EVFAPVA----RLDSVRLLLALAAQE-GWM-------------VHHMDVKSAFLNGEL-IEE
Q7XLN3_ORYSJ/465-703----------------..ETYSPVM----SGITFRYLISLAVQN-RIV-------------MQLMDVVTTYLYGSL-DSD
O24438_ORYLO/963-1208----------------..DTFSPVV----KAATIRIILSIAVSR-GWS-------------LRQLDVQNAFLHGFL-EEE
O81903_ARATH/849-1098----------------..EVFAPVV----KHISIRILMSAVVKD-DME-------------LEQMDVKTTFLHGEL-DQV
O81506_ARATH/471-718----------------..ETYSPVA----MLKSIRILLATAAHY-DYE-------------IWQMDVKTAFLNGNL-EEH
O24587_MAIZE/586-830----------------..ETFAPVA----RLESIRILLAYAAHH-SFR-------------LYQMDVKSAFLNGPI-KEE
Q94KV0_ARATH/912-1157----------------..ETFSPVV----RTATIRLVLDVATAK-GWN-------------IKQLDVSNAFLHGEL-KEP
O96968_BOMMO/855-1082----------------....YAPVA----KLSTIRLMMSLAVQL-DLS-------------LKQLDVPTAFLNGKL-NDN
Q7XBD8_MAIZE/827-1072----------------..DTYSPVA----RLPTIRVLLALAAAY-KLL-------------VHQMDVKTAFLNGEL-EEE
Q9ZPU5_ARATH/845-1094----------------..EIFSPVV----KHVSIRYLLSMVVHY-NME-------------LQQMDVKTAFLHGFL-EEE
Q7XTU6_ORYSJ/940-1185----------------..EVFAPVA----RMETVRLLVALAAQK-GWE-------------IHHMDVKSAFLNGEL-EEE
Q9FLR2_ARATH/13-261----------------..DTFSPVA----KLASVKLVLGLVARK-GWS-------------TTQMDVTNAFLHSDL-EEE
Q9SIM3_ARATH/973-1222----------------..ETFSPVA----KMATVKLLLKVSASK-KWY-------------LNQLDISNAFLNGDL-EET
Q9MAR7_ARATH/666-912----------------..EVFAPVA----RIETRCLLVNLVASN-GWE-------------IHHLDVKIAFLHGEL-KET
Q7XKS1_ORYSJ/160-403----------------..ETFAPVA----HMTTVRTLLAIASAR-HWN-------------ISQLDVKNAFLNGEL-HEE
Q9FIC5_ARATH/965-1209----------------..ETFAPVA----KMVTVRAFLQQVASL-DWE-------------VHQMDVHNAFLHGDL-DEE
O23864_9ORYZ/824-1071----------------..ETFSPVA----MLKSIRIILAIAAYF-DYE-------------IWQMDVKTAFLNGNL-SED
Q9FWI2_ORYSJ/795-1030----------------..ETYAPVA----RLETIRTIIALAAQK-RWK-------------IYQLDVKSAFLNGYL-DEE
O13308_CANAX/1056-1303----------------PFSVSSPVI----DLVTIRLLTIIGCEL-GMT-------------IQHLDVESAYLNASI-THS
Q9ZQE9_ARATH/863-1108----------------..ETFAPVS----RYDTIRALLAYAAQM-KWR-------------LYQMDVKSAFLNGEL-EEE
O23529_ARATH/992-1236----------------..ETFSPVI----KSTTIRLVLDVAVKK-DWE-------------IKQLDVNNAFLQGTL-TEE
Q8TFJ9_DEBHN/1015-1251----------------..DTFSPVI----RYESVKLLLAFSAVD-NRV-------------VHQMDVDTAFLNGTV-EET
Q8TFJ1_PICAN/942-1182----------------..ETFSPVV----RYESVRTLLALAAQK-HMV-------------IHQMDVTTAFLNGDL-AEE
Q9LH44_ARATH/867-1112----------------..ETFAPVS----RYDTIRTIMAIAAQQ-GWK-------------LFQMDVKSAFLNGDL-EEE
Q94I36_ORYSJ/864-1109----------------..ETFAPVA----RIEAIRLLLAFAASK-GFK-------------LYQMDVKSAFLNGFI-HEE
Q02902_ARATH/100-349----------------..EIFAPVA----KHTSIRILMSVVVDQ-DLE-------------LEQMDVKTAFLHGEL-EEE
Q8MRT6_DROME/232-479----------------..ETFSPVC----RLESVRLILALAAEM-QLY-------------LHHMDVCTAYLNSEL-KDT
Q967L5_AEDAE/816-1061----------------..QVFAPVT----RQATLRLFLTIATKQ-KLI-------------VQHLDIRTAYLNGVL-EEE
Q7G6C9_ORYSJ/1047-1286----------------..ETFAPVA----RFESIRILLAYAAHH-DFR-------------LFQMDVKSAFLNGPI-SEL
Q94LQ7_ORYSJ/550-793----------------..DTFRPVV----KAATIRTILSIAISR-GWT-------------LRQLDVQNAFLHGVL-EED
Q9FJV3_ARATH/986-1235----------------..DTFSPVA----KMTTVKTLLSVAAIK-EWS-------------LHQLDISNAFLNGDL-KEE
Q9M1C6_ARATH/853-1098----------------..EVFAPVA----RLDTVRTILAISSQF-NWE-------------IFQLDVKSAFLHGEL-KEE
Q06035_VOLCA/983-1228----------------..EVWAPVS----KHTTLRALLSVAAR.-DLE-------------LHQLDVKTAFLNGEL-EET
Q7XKG6_ORYSJ/514-759----------------..ETFAPVA----KMSTVRTLISCAANF-DWP-------------LYQLDVKNAFLHGDL-QEE
Q9LH08_ARATH/636-888----------------..ETYSPVV----DATTFRYLISLAIRE-NLD-------------LRLMDVVTAYLYGPL-DNE
Q9ZQK0_ARATH/918-1163----------------..DTFAPVA----KLHTVRVVLSLTTNL-EWD-------------LWQMDVKNAFLQGEL-EEK
Q7X5X4_ORYSJ/138-383----------------..EVFSPIV----RIESVRLLLAVTACE-GWE-------------VHHMDVKTAFLNGEP-LEE
Q9LVQ2_ARATH/1008-1252----------------..ETFAPVV----KMTTVRTLLRLVAAN-QWE-------------VYQMDVHNAFLHGDL-EEE
Q84M55_ORYSJ/910-1155----------------..ETFAPVA----KMGTVRALVSCAVNF-GWP-------------LHQLDVKNAFLHGDL-HEE
COPIA_DROME/920-1165----------------..ETFAPVA----RISSFRFILSLVIQY-NLK-------------VHQMDVKTAFLNGTL-KEE
Q9ZQE4_ARATH/762-1011----------------..EVFSLVV----KHVSIRLMLSLMVNM-DYE-------------LEQMDVKTAFLHGNL-EER
Q9SH77_ARATH/866-1115----------------..EIFAPVV----KHVSIRVLLSIVAQE-DLE-------------LEQLDVKTAFLHGEL-KEK
Q9C5V1_ARATH/1163-1408----------------..ETFAPVA----RLECIRFLLGTACGM-GFK-------------LHQMDVKCAFLNGII-EEE
O82196_ARATH/663-912----------------..EIFSPVV----KHVSIRLLLSMVTHC-DME-------------LQQMDVKTAFLHGYL-DET
O81617_ARATH/965-1214----------------..ETFSPVA----KFGSVKLLLGLAAAT-GWS-------------LTQMDVSNAFLHGEL-DEE
Q8TFK0_DEBHN/833-1080----------------TSKVSSPVI----ELSIIRLLTAIAVEY-EWP-------------IHHLDISSAYLHADI-DYE
O81824_ARATH/740-985----------------..ETYSPVV----RTPTVRLVLHLATAL-NWD-------------IKQMDVKNAFLHGDL-KET
Q94EV3_MAIZE/796-1042----------------..DTYSPVA----RLTTIRTLIAVAASY-GLI-------------IHQMDVKTAFLNGEL-DEE
O74246_CANAX/39-286----------------PHAISSPVV----DLTSIRLLSAIAVEN-NLV-------------MHQLDIASAYLNASL-EDG
Q9ZPG3_ARATH/915-1164----------------..DTFSPIA----KLTSVRLILALAAIH-NWS-------------ISQMDVTNAFLHGDF-EEE
Q9S9A8_HORVU/828-1073----------------..ETFSPVA----MLKSVRIMLAIAAFF-DYE-------------IWQMDVKAAFLNGLL-KEE
Q9ZRJ0_TOBAC/841-1089----------------..EIFSPVV----KMTSIRTVLGLAASL-NLE-------------VEQMDVKTAFLHGDL-EEE
Q8W0U0_SORBI/619-868----------------..ETYSPVM----GGITFRYLISLAVQN-RLS-------------MQLMDVVTAYLYGSL-DSD
Q9FZK7_ARATH/1051-1296----------------..ETFSPVV----KSLTIRLVLQLAVSR-SWT-------------IKQLDVNNAFLQGTL-TDE
Q94IU9_ARATH/904-1149----------------..ETFSPVV----RTATIRLVLDTATAN-EWP-------------LKQLDVSNAFLHGEL-QEP
O74218_CANAX/999-1239----------------..RNYAPVI----RGESIKLIFALASKS-KLK-------------IHSIDVTTAFLDGEI-SEL
Q9FLA4_ARATH/947-1191----------------..ETFSPVI----KSTTIRTVLEVAVKR-NWS-------------IHQVDINNAFLQGTL-NEE
Q9C7Y1_ARATH/852-1097----------------..EVFAPVA----KWDTIRLILGLAAEK-GWS-------------VFQLDVKSAFLHGDL-KED
Q7Y173_ORYSJ/398-645----------------..ETFSPVS----KKDSFRIVMALVAHY-DLE-------------LHQMDVKTAFLNGEL-HED
Q9SHT5_ARATH/807-1052----------------..EVFAHVA----RIETIRVIIALAASN-GWE-------------VHHLDVKTAFLHGEL-RED
O22452_VOLCA/568-813----------------..ELFAPTT----RAALLRALLAVAAAR-GMT-------------VHQMDVKTAFLNGDL-AEE
Q8W5F4_ORYSJ/472-717----------------..DTYSPIA----GLTTIRVLLSLAASH-GLL-------------VHQMDVKTAFLNGEL-DEE
Q9FFM0_ARATH/852-1101----------------..EIFSPVV----KHVSIRYLLSIVVQF-DME-------------LEQLDVKTAFLHGNL-DEY
Q7XUD9_ORYSJ/916-1161----------------..EVFTPVA----RLESVRLLLAQAAQA-GWT-------------VHHMDVKSAFLNGEL-AEE
Q9SZY0_ARATH/766-1015----------------..DIFSPVV----KHVSIRILLAIVAEE-NYE-------------LEQLDVKTAFLHGDL-EEK
Q8WRX5_ANOGA/458-703----------------..EVFAPVA----KQTTFRTLLSIAARR-KLI-------------VKHVDVKSAYLYGDL-AET
Q7XE22_ORYSJ/452-697----------------..DTFSLVV----KAATIRLILSIAVSK-GWS-------------LRQLDVQNAFLHGYL-EEE
O23588_ARATH/943-1192----------------..ETFSPVA----KLTSVRMMLLLAAKM-KWS-------------VHQLDISNAFLNGDL-DEE
O65452_ARATH/626-870----------------..ETFAPVA----KMSTVRLFLGVAAAR-DWH-------------VHQMDVHNAFLHGDL-KEE
Q9ZUJ1_ARATH/925-1170----------------..NTFSPVI----KSTTVQTVLDIAVSR-SWD-------------IRQLDINNAFLQGRL-TED
O49140_ARATH/968-1213----------------..ETFSPVI----KSTTVRSVLHIAVSK-GWS-------------IRQIDVNNAFLQGTL-SDE
Q9FWZ5_ARATH/918-1163----------------..ETFAPVA----KLHTVRVVLALATNL-SWG-------------LWQMDVKNAFLQGEL-EDD
Q94HW2_ARATH/982-1228----------------..ETFSPVI----KSTSIRIVLGVAVDR-SWP-------------IRQLDVNNAFLQGTL-TDD
Q8LNW7_ORYSJ/880-1128----------------..DVFSPIM----KHSSIRTLLGIVAMH-DYE-------------LEQMDVKTAFLHGEL-EED
Q9C536_ARATH/832-1077----------------..EVFAPVA----RLETVRLIISLAAQN-KWK-------------IHQMDVKSAFLNGDL-EEE
O22175_ARATH/1013-1257----------------..ETFAPVA----KLTTVRTILAVAAAK-DWE-------------VHQMDVHNAFLHGDL-EEE
O42838_SACPA/1146-1386----------------..ETFAPVI----RYDSVRLFLALASCL-KLI-------------VYQMDVDTAFLNSKM-NEP
Q9MAK6_ARATH/832-1077----------------..ETYSPVV----RTATVRGVLHLATIM-EWD-------------IKQMDVQNAFLHGDL-TET
Q9M1F5_ARATH/873-1122----------------..EIFAPVV----KHVSIRILLSIVAQE-NLE-------------LEQLDVKTAFLHGEL-KEK
Q9FJA1_ARATH/460-702----------------..DTFSLVA----KLTSVKMILGLAAAT-GWT-------------LTQMDVSNAFLHGEL-IE.
Q94HQ0_ORYSJ/485-718----------------..DAFAPVA----RMESVRLLLALAAQE-GRG-------------IHHMDVKSAFLNSDL-KEE
O82493_ARATH/823-1068----------------..ETYSPVV----RSATVRSILHVATIN-KWS-------------LKQLDVKNAFLHDEL-KET
O04543_ARATH/827-1076----------------..ETFSPVA----KLNSVKLLLGVAARF-KLS-------------LTQLDISNAFLNGDL-DEE
O65147_SOYBN/1068-1313----------------..ETFAPGA----RLESIRLLLGVACIL-KFK-------------LYQMDVKSAFLNGYL-NEE
Q9SLF0_ARATH/850-1094----------------..ETFAPVA----KMATVRLFLDVAVKR-NWE-------------IHQMDVHNAFLHGDL-REE
Q9XII7_ARATH/966-1215----------------..DTFSPVA----KMTTIKLLLKVSASK-KWF-------------LKQLDVSNAFLNGEL-EEE
Q9M5J7_PICGL/100-347----------------..EIFSPVA----KLTSIRFLLSIVVAF-DLE-------------VEQMDVKTTFLHGDL-EEE
Q7Y1I1_ORYSJ/727-972----------------..EVFAPMA----RLESVRMLLALAAQA-GWF-------------VHHMDVKSAFLNGEL-TEE
Q9LJ55_ARATH/735-980----------------..EVFAPVA----RIETVRFIIALAASN-GWE-------------VHHLDVKTAFLHGEL-KEI
Q9FX79_ARATH/941-1190----------------..DTFSPVA----KLTTVKLLIAVAAAK-GWS-------------LSQLDISNAFLNGSL-DEE
Q94GR9_ORYSJ/975-1220----------------..EIFAPMA----RLEAIRILFAFASCF-DIK-------------LFQMDVKSAFLNGEI-AEL
Q949J4_SOLLC/397-647----------------..ETYSPVV----DAITFRYLINLAVYE-KLE-------------MRLMDVVTAYLYGSL-DHN
Q7X7N0_ORYSJ/758-1003----------------..ETFSPVV----KPSTIRVVLSIATSR-SWP-------------IHQLDVKNAFLHGTL-DET
Q8TFI1_SACEX/864-1104----------------..ETFAPVV----RYDSVRIFLALAACH-RLQ-------------VHQMDVDTAFLNSPM-DEP
Q7XZY2_ORYSJ/297-542----------------..EVFAPVA----RMETVRLLVAMAAQE-GWE-------------IHHMDVKSAFLNGDL-EED
POLX_TOBAC/840-1088----------------..EIFSPVV----KMTSIRTILSLAASL-DLE-------------VEQLDVKTAFLHGDL-EEE
Q7XN62_ORYSJ/915-1162----------------..ETFSPVS----CKDSFRIIMALVAHY-DLE-------------LHQMDVKTAFLNGDL-EEK
Q7XLI2_ORYSJ/53-298----------------..EIFSPVI----KPATVRTVLSLAVSR-DWP-------------VHQLDVKNAFLHRTL-QET

PF02123

RDRP_SCPMV/464-849.................G.RYRLIS....SVSIVDQLVERMLFGAQNE...LEIAEWQSIPSKPGMGLSVIHQADA-IFR
RDRP_SBMVA/490-847.................G.RFRLIS....SVSLVDQLVERMLFGPQNQ...LEIAEWEHIPSKPGMGLSLRQQAKS-LFD
RDRP_SCVLB/833-1303.................G.KVRALY....GCDFSSHTMADFGLLQCED............TFPGFVPTGSYANEDY-VRT
RDRP_PLRVW/609-1004.................G.RYRLIM....SVSLVDQLVARVLFQNQNK...REISLWRSVPSKPGFGLSTDTQTAE-FLE
Q9JE94_9VIRU/129-560.................G.KTRFIY....NCDTVSYIYFDYILNYIES.........VWSNKHVLLN.PDYMNPVI-FST
RDRP_PEMVW/733-1124...................RYRLIA....SVSIVDQLVARMLFRDQNE...EELLQHMAIPSKPGLGFSQDHQVLA-FTE
RDRP_HV19S/122-585.................G.KDRAIF....ACDTRSYFAFTYWLTPIEK.........KWRGARVILN.PGEGGLYG-TAR
O55590_9REOV/25-748PKVDQTHPIPLGRRDVPGRRTRIIFILPYEYFLAQHAVVEKMLQYAKH...TREYAEFYSQSNQLLSYGDVTRFLS-DDA
RDRP_ROTHC/32-749.PVDARNPIPLGRRDVPGRRTRAIFILPYQYFIAQHSFAEIMLNYAKR...EREYSEFYSQANQVLSYGDVTRYLD-SNS
Q90155_9VIRU/96-539.................G.KERFIY....NCDTISYVYFDFVLKLFES.........GWQDSEAILS.PGDYSSEC-LHA
Q90193_9VIRU/400-785...................ASRSLW....PAHLVHYVLVSMILHLIDK................SGEIPGSRNNAP-SDR
Q83093_9VIRU/433-816...................RFRLIS....SVSLVDQLVERLLFGPQNK...AEIALWQSVPSKPGMGLSQKWQFEA-LWK
RDRP_ROTGI/37-803..KALSHGIPMGTRNVPARQTRGIFILPWQVAAVQHTIAESLYKRAKKGAYQGSFAEAYTAKTASLTYGVLAEDTS-KAT
RDRP_TYYVF/580-974...................RYRLIM....SVSLVDQLVARVLFQNQNK...REIALWRAIPSKPGFGLSTDEQVLD-FVE
Q99AT3_9VIRU/99-573.................G.KTRAIF....ACDTVNYLAFEHLLAPVEK.........RWRNSKVILD.PGRGGHLG-MIF
Q98XW8_9VIRU/144-622.................G.KGRAIY....SCDTLSYTAFSWLLEAVEK.........EWASRSVILN.PGKGGTLG-MMN
Q66150_9VIRU/22-408...................RFRLIS....SVSLVDQLVERMLFGPQNT...TEIALWHSNPSKPGMGLSKASQVAL-LWE
Q86519_9VIRU/516-902...................RFRLIS....SVSLVDQLVERMLFGPQNN...TEISTWWQWPSKPGMGLLTPEQIRL-VWD
RDRP_PCVC/362-832.................GKKDRTLL....PGTLVHFVVFTYVLYLAEK.........QGQIGSVRLNTDSEVDIRY-FDK
Q90153_9VIRU/1024-1530.................GGKARAIY....GVTLWHYIFSNWLMAPVEK.........HLNHRSVDINLDGSAMLTA-TLH
Q87025_SCVLA/177-657.................G.KQRAIY....GTDLRSTLITNFAMFRCED............VLTHKFPVGDQAEAAK-VHK
Q9YXE6_9VIRU/120-589.................G.KTRAIF....ACDTRSYFAFEWLLGATQK.........AWRNHRVLLD.PGGGGHLG-ISR
Q83073_9VIRU/49-523.................G.KSRLLL....ACDTLSYLWFEYYLKPVET.........AWLNKRTLLN.PGVVNHYS-MAK
Q9YXE4_9VIRU/99-573.................G.KTRAIF....ACDTLNYLAFEHLLASVES.........RWRGERVVLN.PGRGGNVG-MSF
Q8V615_9VIRU/41-473.................G.KTRYIY....NCDTXSYLFFDYILHYVEC.........VWSNESVLLN.PAAMSVER-FSV
RDRP_LRVLG/155-619.................G.KTRLLL....ACDTLSYMWFEYALRPVER.........IWENSNVILD.PGSMGNCG-IAT
Q65969_9LUTE/603-996...................RYRLIM....SVSLVDQLVARVLFQNQNK...REIALWRVVPSKPGFGLSTDEQVAE-FMQ
RDRP_ROTPY/25-748PPVNVDRPIPLGRRDVPGRRTRIIFILPYEYNSAQHAVVEKMLSYAKH...TREYAEFYSQSNQLLSYGDVTRFLS-SNS

PF00680

POLG_HAVHM/1750-2215................LESKTRAID----ACPLDYSILCRMYWGPAIS-------YFHLNPGFHTGVAIGIDP.DR-QWD
RDRP_BPPH6/19-638.......PDG.....FFCERRRTAM----GGPFALNAPIMAVAQPVRN-------KIYSKYAYTFHHTTRLNKEEK-VKE
POLG_PYFV1/2270-2778...............YEKPKTRLFS----ILPVEFNMHARRLFLDFNV-------FVMAN.RHKHGIMVGINPHSR-EWS
POL1_BAYMG/1634-2107................EAEKTRVFT----ASPITSLFAMKFYVDDFNK-------KFYAT.NLKAPHTVGINKFGR-GWE
POL1_CPMVS/1186-1687...............FDKPKTRCFT----ILPMEYNLVVRRKFLNFVR-------FIMAN.RHRLSCQVGINPYSM-EWS
POLG_FCVC6/1262-1736................QEGKRRMIW----GCDVGVATVCAAAFKGVSD-------AITAN.HQYGPIQVGINMDSP-SVE
POL1_RCMV/1182-1684...............FTKPKTRNFT----ILPMEYNILVRQYFLNFVR-------FIMKK.RDVLPCQVGINPYSM-EWS
POL1_GCMV/1454-1960................KVGPCRLFE----IMPLHYNLLLRVKTCAFTA-------FLQHN.RHRLPCQVGTNPYSR-EWG
POLG_WMV2U/237-705................QANKTRTFT----AAPLDTLLGAKVCVDDFNN-------QFYSF.NLKCPWTVGMTKFYG-GWD
POLG_LORDV/1209-1676...............YGKIKKRLLW----GSDLATMIRCARAFGGLMD-------ELKAH.CVTLPIRVGMNM.NE-DGP
POL1_BRSV/1468-1975................KVGACRLFE----IMPLHYNLFLRQKTCAFTQ-------FLQHN.RHVLPCQVGTNPYSR-EWG
POLG_HE701/1750-2193................EKGKSRLIE----ASSLNDSVAMRVAFGNLYA-------TFHKNPGVATGSAVGCDP.DL-FWS
POL1_CPSMV/1177-1679...............YEKPKTRCFT----VLPMEYNLVVRRKFLKFVV-------FIMKN.RHRLSCQVGINPYGM-EWS
Q94M06_9VIRU/64-655PITTKVEINGTVYDDFAAMRTRLVN----AGPWTINVALQPFATGCMN-------AMFELYRATW.........HP-DED
Q9MC15_9VIRU/40-607PSKYSQGVDGL.....HALRRRTAY----AVSYAAATPMQCFVAGCRH-------IALERYGETWH........EH-DAE
POLG_TUMVQ/2376-2844................EANKTRTFT----AAPLDTLLGGKVCVDDFNN-------QFYDH.NLRAPWDVGMTKFYC-GWD
POLG_OMV/383-852................QACKTRTFT----AAPLDTLLGAKVCVDDFNA-------QFYDK.HLTAPWTVGICKYYK-GWD
POLG_RHDVF/1279-1750................KEGKKRLLW----GCDVGVAVCAAAVFHNICY-------KLKMV.ARFGPIAVGVDMTSR-DVD
POLG_PVYHU/2293-2761................LANKTRTFT----AAPLDTLLGGKVCVDDFNN-------QFYSK.NIECCWTVGMTKFYG-GWD
POLG_PSBMV/2413-2881................HENKTRTFT----AAPLDTLLGGKVCVDDFNN-------FFYSC.HLRGPWTVGITKFYA-GWN
POLG_SMSV1/1376-1852................AVGKRRLIW----GCDVGVSTVCRAAFKRVSE-------SIMAN.HALGFIQVGINMDGP-AVE
POLG_TEV/2297-2761................ENNKTRTFT----AAPIDTLLAGKVCVDDFNN-------QFYDL.NIKAPWTVGMTKFYQ-GWN
POLG_HRV8A/1721-2162................KDGKTRVIE----ANSVNDTVLFRSVFGNLFS-------AFHKNPGIVTGSAVGCDP.EV-FWS
POLG_PEMVC/2294-2762................EANKTRTFT----AAPIDTLLGGKVCVDDLNN-------QFYSK.NIECCWTVGMTKFYG-GWD
POLG_TMEVB/1854-2301................HEAKTRIVD----VPPFAHCIWGRQLLGRFAS-------KFQTKPGLELGSAIGTDP.DV-DWT
POLG_BOVEV/1731-2174................RKGKSRLIE----ASSLNDSVAMRCYFGNLYK-------VFHTNPGTISGCAVGCDP.ET-FWS
POL1_APMV/57-557...............YTSPKTRCFS----ILPMEYNLLVRQKFLHFVR-------FMMKR.RDVLPSQVGVNPYSL-EWG
POLG_CXA21/1762-2205................EQGKSRLIE----ASSLNDSVAMRMAFGNLYA-------AFHKNPGVVTGSAVGCDP.DL-FWS
POLG_PPVD/2311-2779................EANKTRSFT----AAPIDTLLGGKVCVDDFNN-------QFYSL.NLHCPWSVGMTKFRG-GWD
POLG_EMCV/1842-2288................QAAKTRIVD----VPPFEHCILGRQLLGKFAS-------KFQTQPGLELGSAIGCDP.DV-HWT
POLG_TVMV/2260-2728................IENKTRTFT----AAPIETLLGGKVCVDDFNN-------HFYSK.HIQCPWSVGMTKFYG-GWN
POLG_SOUV3/1299-1766...............YQKVKKRLLW----GADLGTVVRAARAFGPFCD-------AIKSH.TIKLPIKVGMNS.IE-DGP
POLG_CXA9/1756-2200................AKGKSRLIE----ASSLNDSVAMRQTFGNLYK-------TFHLNPGIVTGSAVGCDP.DL-FWS
POLG_FMDV1/1875-2327................RAGKTRIVD----VLPVEHILYTKMMIGRFCA-------QMHSNNGPQIGSAVGCNP.DV-DWQ
POLG_HRV14/1736-2178................RLGKSRLIE----ASSLNDSVNMRMKLGNLYK-------AFHQNPGVLTGSAVGCDP.DV-FWS
POLG_HRV1B/1714-2156................SAGKTRVIE----ASSINDTILFRTTFGNLFS-------KFHLNPGVVTGSAVGCDP.ET-FWS
POLG_PRSVH/2537-3005................LAKKTRSFT----AAPLDTLLGAKVCVDDFNN-------WFYSK.NMECPWTVGMTKFYK-GWD
Q9FZT2_9VIRU/64-684.......PEG.....FFATRRRTAM----ACPFTSNAPIMVIAQSVRA-------RVYHEYAYTLHHTTRSQKQEK-VSD
POL1_GFLV/1488-1974................DTPGTRLFS----VLPLAYNLLLRVKFLSFSR-------LLMKK.RGHLPCQVGINPYSR-EWT

PF00998

RDRP_TNVA/224-703----------------QPRSPRYNV----CLGRYLRHYEHHAFKT......IAKCFGEITVFKGFTLEQQGEIMRS-KWN
RDRP_TCV/272-752----------------QPRDPRYNI----EVGKYLKPYEHHLYRA......IDAMWGGPTVLKGYDVGELGNIMSN-TWD
RDRP_TNVD/224-709----------------QPRDPRYNV----EVGRFLRHSEEMLFKA......INKTFGGRTIFKGLSSDQAGEEFKT-LWD
RDRP_MCMVK/460-941----------------QPRAPRYNV----ELGRYLRPVEHPIYHA......IDKIWGGPTIMKGYSVEQIGRHIEN-AFR
POLG_HCVEU/2430-2941----------------GRKPARLIV----YPDLGVRVCEKMALYDVT..QKLPQAVMGPAYGFQYSPNQRVEYLLK-MWR
POLG_HCVED/2420-2931----------------GRKPARLIV----YPDLGSRVCEKRALHDVI..KKTALAVMGAAYGFQYSPAQRVEFLLT-AWK
POLG_HCVJL/2434-2945----------------GRKPARLIV----YPDLSVRVCEKRALYDVT..RKLPVAVMGAAYGFQYSPSQRVEYLLK-IWR
POLG_HCVJK/2431-2942----------------GRKPARLIV----YPDLGVRICEKRALYDVI..QKLPSAIMGSAYGFQYSPKQRVEYLLK-MWN
POLG_HCVEV/2426-2937----------------GKKPARLIV----YPDLGVRVCEKRALYDVA..QKLPTALMGPSYGFQYSPAQRVDFLLK-AWK
POLG_HCVJ6/2445-2956----------------GKKAARLIV----YPDLGVRVCEKMALYDIT..QKLPQAVMGASYGFQYSPAQRVEFLLK-AWA
Q9IR83_9TOMB/236-712----------------QPRDPRYNV----EVGRYLKPYEHHLYRA......LDVVWKGPTVLKGYTVSEIGSIMHS-HWS
Q87031_9LUTE/24-502----------------CPRNKRYNV----ELGRRLKFNEKKFMHA......IDSTFDSPTVLSGYDSFRVGKIIAN-KWS
RDRP_POLVP/251-722----------------QPRDPRYNV----EVGRYLKPLEPRLMKA......IDKLWGEKTAIKGYTVEKVGEI</