Sequence alignment for CL0027

PF00078

A0A066NJ57_LELAM/135-366----------------------------------------------IPKAD...--------------------------
A0A0F6CD22_ECOLX/115-332----------------------------------------------IPKSN...--------------------------
D7ZFU1_ECOLX/62-269----------------------------------------------IPKID...--------------------------
A0A0E0UMT2_SINMB/72-291----------------------------------------------IPKKA...--------------------------
Q47526_ECOLX/33-239----------------------------------------------IPKRT...--------------------------
O01419_BOMMO/502-756----------------------------------------------IPKEGRP.--------------------------
O18558_AEDAE/472-725----------------------------------------------IPKGGRAS--------------------------
O42691_ALTAL/36-202----------------------------------------------VRDPTTG.--------------------------
O44316_DROMR/394-650----------------------------------------------IPKTVRA.--------------------------
O52231_STREE/68-275----------------------------------------------IPKPD...--------------------------
O62658_CANFA/517-773----------------------------------------------IPKPDKD.--------------------------
O64612_ARATH/788-1031----------------------------------------------YAKEM...--------------------------
O65244_ARATH/405-664----------------------------------------------IPKKKEA.--------------------------
O65598_ARATH/489-747----------------------------------------------IPKFPNA.--------------------------
O81284_ARATH/58-317----------------------------------------------IPKVPGA.--------------------------
O81454_ARATH/144-304----------------------------------------------VPKKD...--------------------------
O93520_ORYLA/518-771----------------------------------------------IPKEGKD.--------------------------
O96546_LYMDI/526-780----------------------------------------------IHKPGKR.--------------------------
O99969_PORPU/100-315----------------------------------------------IPKPN...--------------------------
POL_RSVP/769-938----------------------------------------------IRKAS...--------------------------
POL_HTL1A/633-804----------------------------------------------VKKAN...--------------------------
POL_SMRVH/71-240----------------------------------------------IKKKS...--------------------------
POL_MMTVB/68-237----------------------------------------------IKKKS...--------------------------
POL_CAMVC/289-452----------------------------------------------VNNEAE..--------------------------
POL_IPHA/60-229----------------------------------------------IKKKS...--------------------------
POL_HV1MA/655-826----------------------------------------------IKKKD...--------------------------
TF21_SCHPO/455-615----------------------------------------------VPKKE...--------------------------
POK10_HUMAN/76-245----------------------------------------------IQKKS...--------------------------
POL4_DROME/357-523----------------------------------------------VPKKSSP.--------------------------
POLY_DROME/224-390----------------------------------------------VDKKGTD.--------------------------
POL_EIAV9/249-419----------------------------------------------IKKRS...--------------------------
YTX2_XENLA/513-765----------------------------------------------LPKKGDL.--------------------------
POL_SOCMV/246-411----------------------------------------------VENHNE..--------------------------
Y2R2_DROME/498-741----------------------------------------------LLKGPDKD--------------------------
POL_BIV29/638-806----------------------------------------------IKKKG...--------------------------
RDPO_ACUOB/124-343----------------------------------------------IPKRD...--------------------------
POL2_DROME/249-414----------------------------------------------VPKKPDA.--------------------------
RT67_ECOLX/48-262----------------------------------------------IPKKG...--------------------------
RTJK_DROME/502-757----------------------------------------------IHKTGKT.--------------------------
POL_BLVAU/41-212----------------------------------------------VRKPN...--------------------------
POL_RTBVP/1228-1390----------------------------------------------VRNHSE..--------------------------
POL_CAEVC/210-380----------------------------------------------IKKKS...--------------------------
P91581_CIOIN/483-644----------------------------------------------AREGS...--------------------------
P95451_PSEAC/119-326----------------------------------------------IPKPQ...--------------------------
Q01379_NEUCS/505-761----------------------------------------------LKKPGKSA--------------------------
Q03261_SIV/246-416----------------------------------------------IRKKD...--------------------------
Q04135_DROME/496-743----------------------------------------------IPKPGKD.--------------------------
Q07995_CHITU/509-760----------------------------------------------IPKHGKP.--------------------------
Q08724_9CYAN/108-336----------------------------------------------IPKPG...--------------------------
YRD6_CAEEL/484-644----------------------------------------------IKKKG...--------------------------
Q17329_CAEEL/1071-1231----------------------------------------------VKKKD...--------------------------
Q24262_DROME/531-692----------------------------------------------VRKKD...--------------------------
Q24690_DROTE/495-742----------------------------------------------ILKPNTD.--------------------------
Q26816_9TRYP/545-793----------------------------------------------ILKAGKK.--------------------------
Q46666_ECOLX/34-241----------------------------------------------IPKRT...--------------------------
Q83013_9RETR/68-238----------------------------------------------IQKKD...--------------------------
Q88285_9RETR/848-1015----------------------------------------------VGKPD...--------------------------
POL_CSVMV/250-413----------------------------------------------VNKHSE..--------------------------
Q93137_BOMMO/515-771----------------------------------------------KPKND...--------------------------
Q93139_BOMMO/469-719----------------------------------------------LRKSGKDS--------------------------
Q94885_DROME/759-920----------------------------------------------VKKKT...--------------------------
YG31B_YEAST/639-797----------------------------------------------VPKKD...--------------------------
Q9YGS2_TAKRU/573-830----------------------------------------------LLKKPSLD--------------------------
Q9YW31_MSEPV/161-406----------------------------------------------IHKNGDK.--------------------------
Q9ZNW4_SORBI/922-1081----------------------------------------------PKKN....--------------------------
Q9ZQ67_ARATH/542-701----------------------------------------------KKKN....--------------------------
Q9ZQQ6_ARATH/659-918----------------------------------------------IPKKDEA.--------------------------
Q9ZS84_SOLLC/655-815----------------------------------------------QKKQD...--------------------------
Q9ZVK4_ARATH/510-669----------------------------------------------KKKD....--------------------------

PF05919

Q6EH16_9VIRU/1-501----------------------------------------------MKLRLKGS--------------------------
Q5TMB5_9VIRU/174-658----------------------------------------------TPLEFKKY--------------------------
Q18L80_9VIRU/166-639----------------------------------------------LDFKISST--------------------------
Q9WJ23_9VIRU/164-642----------------------------------------------LQWSRDDH--------------------------
RDRP_CPMV1/246-745----------------------------------------------LKLKITGS--------------------------
Q9ZXZ7_THACU/214-754----------------------------------------------FNKLDKKS--------------------------
Q9WJ22_9VIRU/155-622----------------------------------------------PIYTDNDH--------------------------
Q6EH19_9VIRU/208-686----------------------------------------------FEPTDWKF--------------------------
Q9WJ24_9VIRU/163-645----------------------------------------------VQWDVKNF--------------------------
Q6GYC2_9VIRU/156-638----------------------------------------------SEFDDSNH--------------------------
Q18L78_9VIRU/174-654----------------------------------------------FKKEDIND--------------------------
Q18L79_9VIRU/168-671----------------------------------------------VPFKISDL--------------------------
Q3S3F3_9VIRU/120-606----------------------------------------------PTYDLSKH--------------------------
O92614_9VIRU/173-711----------------------------------------------PKGRSKHL--------------------------

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------
B5RTA2_DEBHA/1170-1414--------------------------------------------------------------------------------
B5RTR8_DEBHA/1021-1254--------------------------------------------------------------------------------
E7KRB3_YEASL/146-383--------------------------------------------------------------------------------
Q2R072_ORYSJ/915-1159--------------------------------------------------------------------------------
Q59K02_CANAL/999-1236--------------------------------------------------------------------------------
Q5AG24_CANAL/888-1133--------------------------------------------------------------------------------
Q5AH82_CANAL/122-366--------------------------------------------------------------------------------
Q7XN23_ORYSJ/31-274--------------------------------------------------------------------------------
Q8S476_MAIZE/836-1081--------------------------------------------------------------------------------
Q8S479_MAIZE/1073-1313--------------------------------------------------------------------------------

PF00978

R1AB_LIYV9/1925-2366----------------------------YSDYYLPPCE..DLRITLSKSKPYH.--------------------------
R1AB_BYVU/2601-3046----------------------------TQVFESG.AD..NVVIRDSAPVNKST--------------------------
Q9YPH5_9VIRU/1359-1796----------------------------TGGLDIE.LS..DCKIYPNRPMKVW.--------------------------
POLN_EEVVM/2041-2488----------------------------MVDGASCCLD..TASFCPAKLRSFP.--------------------------
E0YCR0_9CLOS/53-491----------------------------TSDQSFL.IE..DVRISESFSHFTSK--------------------------
RDRP_TOMS1/1168-1609----------------------------LTDISLN.VK..DCILDMSKSVAAPK--------------------------
RDRP_PSVJ/295-726----------------------------NSDFTTD.ID..HLTLKQSDLIPKA.--------------------------
Q66107_9BROM/228-662----------------------------TQDISLE.VS..KCWLDASNFKDFTK--------------------------
Q87644_SINDV/2053-2501----------------------------MVDGTVACLD..TATFCPAKLRSYPK--------------------------
O56790_9VIRU/1323-1760----------------------------TGGLEID.IA..NIKYYPNKQKRMWQ--------------------------
RDRP_CMVFN/308-738----------------------------SADYSID.LD..HVRLRQSDLIAKI.--------------------------
Q9WJD8_PEBV/1299-1738----------------------------TEDCNLR.LT..DVTLKSGNWKDKFV--------------------------
Q80875_BSMV/195-630----------------------------TEDINMD.VQ..DCRLKFGKTFRPYE--------------------------
RDRP_RBDVR/1234-1674----------------------------VGPMSLQ.VG..SIRWDVSKISPRLF--------------------------
RDRP_SBWMN/1373-1810----------------------------TSDISIE.LE..NCTVQPNKNVKVWQ--------------------------
POLN_ONNVI/2053-2501----------------------------MVDGSESCLD..RATFNPSKLRSYP.--------------------------
RDRP_TAV/313-742----------------------------NADYSVD.ID..RVRLKQSDLLAKV.--------------------------
POLN_MIDDV/534-981----------------------------MVDGSESCLD..RAAFCPSKLRSFP.--------------------------
RDRP_TMGMV/1163-1604----------------------------LRDNSLN.VK..DCVLDFSKSIPMPK--------------------------
RDRP_TOBSV/253-689----------------------------THDIDLE.VT..SCDLDMSTFNDWTK--------------------------
RDRP_OLV2I/310-732----------------------------SDDFTVDFPT..QVRLRERDEDWFRR--------------------------
RDRP_YOMV/1155-1594----------------------------LRDISLN.VK..DCRIDFSKSVQVPK--------------------------
RDRP_AMVLE/318-752----------------------------TSDKSLD.VD..PCRIDLSVFNNWQ.--------------------------
POLN_RRVN/2019-2467----------------------------MVDGSESCLD..RATFCPAKLRCYP.--------------------------
RDRP_ASPVP/1758-2169----------------------------IGDITTE.........QFTDDHSKNR--------------------------
O56250_9VIRU/1240-1678----------------------------TTDCNLR.LD..NVTIKSGNWKDKFA--------------------------
O90699_9VIRU/1363-1800----------------------------TGGIHVE.ID..DLTYYPNKQTKVW.--------------------------
Q9Q6Q3_9CLOS/62-509----------------------------EDDFETSGLE..TLVETATISDNFPK--------------------------
POLN_AURAV/2038-2486----------------------------MVEGSVSCLD..TATFCPAKLRSFPK--------------------------
RDRP_BBMV/271-697----------------------------SADFSSD.FQ..RLKIKQSHVDWYK.--------------------------
RDRP_CCMV/267-697----------------------------LGDYNVD.IS..KLSVRQSDVDWYR.--------------------------
Q66581_EEEV/144-598----------------------------EYDAYLDMVDGASCCLDTATFCPAK.--------------------------
Q9QGG9_9BROM/363-797----------------------------TSDIALE.LD..RATLDTSVFNDWTK--------------------------
RDRP_TMOB/1167-1614----------------------------CSDISLN.VK..DCVLDFSKSVPLPR--------------------------
RDRP_BMV/256-688----------------------------NGDYSMD.FD..RIRLKQSDVDWYR.--------------------------
O40960_9CLOS/62-506----------------------------YSDIELPCLE..DLLLTPTKSKPYQ.--------------------------

PF00998

RDRP_TNVA/224-703----------------------------------------LVVIPSGRP...EK--------------------------
RDRP_TCV/272-752----------------------------------------MRVFPLANP...PK--------------------------
RDRP_TNVD/224-709----------------------------------------MLVTKGPPL...AK--------------------------
RDRP_MCMVK/460-941----------------------------------------LRSHFKDTR...HK--------------------------
POLG_HCVEU/2430-2941----------------------------------------SYSWTGALITPCAA--------------------------
POLG_HCVED/2420-2931----------------------------------------SYSWTGALVTPCAA--------------------------
POLG_HCVJL/2434-2945----------------------------------------SYSWTGALITPCAA--------------------------
POLG_HCVJK/2431-2942----------------------------------------SYSWTGALITPCAA--------------------------
POLG_HCVEV/2426-2937----------------------------------------SYTWTGALITPCSA--------------------------
POLG_HCVJ6/2445-2956----------------------------------------SYSWTGALITPCSP--------------------------
Q9IR83_9TOMB/236-712----------------------------------------MAVFPREGI...SK--------------------------
Q87031_9LUTE/24-502----------------------------------------IVVRSGAAP..RKS--------------------------
RDRP_POLVP/251-722----------------------------------------MVVRKGAPI...TT--------------------------
Q65987_9TOMB/269-750----------------------------------------MRVFPLAQP...PK--------------------------
P90338_9TOMB/1-480----------------------------------------MIEVRRNAL...VR--------------------------
RDRP_BYDV1/361-840----------------------------------------IAVTDGARL..RKV--------------------------
O09796_9HEPC/2422-2933----------------------------------------SYTWTGALITPCAA--------------------------
O09803_9FLAV/2373-2866----------------------------------------SYIWSGVPL..TRA--------------------------
O37361_9VIRU/252-737----------------------------------------ATNLGDSRP...LT--------------------------
Q9WJD9_CARMV/267-744----------------------------------------VIEVDGQCP...LK--------------------------
Q83103_9TOMB/228-711----------------------------------------LSVVKGPPL...SK--------------------------
Q66127_9TOMB/52-520----------------------------------------LHIRPSARP..RPV--------------------------
RDRP_PMVK/447-937----------------------------------------LRCHFKDRD...PK--------------------------
POLG_GBVB/2277-2785----------------------------------------SYTWTDVIS..FKT--------------------------
Q89801_9TOMB/1-479----------------------------------------MLITPRTGS...HK--------------------------
Q9IRA1_9TOMB/266-741----------------------------------------LTVSREKPA...SK--------------------------
O12301_GAMV/231-708----------------------------------------LVVKPSGRP...EK--------------------------
Q83424_MNSV/290-772----------------------------------------MTEFPQDRP...IK--------------------------
O41892_PEGIA/2409-2899----------------------------------------SYVWSGQPL..GCG--------------------------
RDRP_OCSVU/235-734----------------------------------------LRVKRLLGV...TK--------------------------
Q9IW60_9TOMB/325-800----------------------------------------LEVRTGPPN...AK--------------------------
Q96898_9FLAV/2396-2886----------------------------------------SYIWSGAPL..GTG--------------------------
RDRP_RCNMV/260-745----------------------------------------VAEKRASRV..MKS--------------------------

PF00972

POLG_YEFV1/2758-3406---------------------------TLEADVILPIGTRSVETDKGPLDKEAI--------------------------

PF00680

POLG_HAVHM/1750-2215---------------------------M..NVVSKTLFRKSPIYHHIDKTMI..--------------------------
RDRP_BPPH6/19-638---------------------------FANNIKAQQASKRSFKEGAIETYEGLL--------------------------
POLG_PYFV1/2270-2778---------------------------P..KSITKSTIVPSLIQPYMPRKPL..--------------------------
POL1_CPMVS/1186-1687---------------------------I..PLPTKTALVETPSEWHLDTPCD..--------------------------
POLG_RHDVF/1279-1750---------------------------P..VSGTRYAKVPGVPDEYKTG.....--------------------------
POLG_PVYN/2293-2763---------------------------V..ATMKSQLVTKHVVKGECRHFTEFL--------------------------
POLG_EMCVR/1844-2288---------------------------I..HVPRKTALRPTVARQVFQPA....--------------------------
POLG_FCVUR/1266-1735---------------------------.....GTRLHVSPAHTEDFEECS....--------------------------
POLG_NVN68/1301-1766---------------------------...ALSTKTKFWRSSPEPLPPGV....--------------------------
Q9DLK1_FMDVP/1865-2314---------------------------V..HVMRKTKLAPTVAHGVFNPE....--------------------------
POLG_VESVA/1379-1848---------------------------....KGTRLHVSPAHVDDYEECT....--------------------------
POL1_BAYMY/1634-2098---------------------------...GQMNKGLIDKHVIVGENDDVYDFM--------------------------

PF02123

Q83093_9VIRU/437-816---------------------------SSRQVKSSQSSNSTAGLSEVVGQKEDP..........................
Q66150_9VIRU/22-408---------------------------.HRDVRAAESEFPELKELAWPSRGSKA..........................
Q86519_9VIRU/516-902---------------------------SAQLSKTQSQYSQILKDLSVLRGEVKQ..........................
RDRP_SCPMV/464-849---------------------------.ADAVTAATKVFPELSELGWPERGSGA..........................
RDRP_SBMVA/490-847---------------------------.....................................................
RDRP_PEMVW/733-1124---------------------------GERVARTSAFLQACTEKYSWPETGAEA..........................
RDRP_PLRVW/609-1004---------------------------GQKLCQVHPELADKTAGFGWPKAGFEA..........................
RDRP_TYYVF/580-974---------------------------GKTLVGNHPALGEKTSGFGWPKFGPEA..........................
Q65969_9LUTE/603-996---------------------------GDKICKQHPEMGDLTKGFGWPQFGAKA..........................
RDRP_ROTGI/108-803---------------------------RLNVEEYASIQEIELQAKQWRAENAKSLRPYHYNIPINEYLRDNEIEVLDTGD
RDRP_ROTHC/109-749---------------------------HAPQKDAKPYENNIITSEIFKEKSEYT..........................
O55590_9REOV/104-749---------------------------NDLDYENNKLTSELFNEESYTDSLMDP..........................
RDRP_ROTPY/100-748---------------------------ADLTANELDYENNKITSELFKSAEEYT..........................
Q90153_9VIRU/1025-1530---------------------------KKNNLQVKDICKIIIQKLKNPKTMKPN..........................
Q90193_9VIRU/400-785---------------------------........................HKS..........................
RDRP_PCVC/362-832---------------------------............HTFDILSMPDAKEIA..........................
RDRP_SCVLB/837-1303---------------------------RDNFTYNYNMEKEKYRITQYHHTHVRL..........................
Q87025_SCVLA/177-657---------------------------.DRNIRPKHFKGLRLYTSSKVTAQHHT..........................
Q90155_TTV1/96-539---------------------------KNPRLLTSETELQLFPLKENSAARTKA..........................
Q9JE94_9VIRU/129-560---------------------------HSLRNLTKEQEITLFPIKDIVQANRRV..........................
Q8V615_9VIRU/41-473---------------------------VNLKFLNKEMELELFPLKKAPQADLKV..........................
Q83073_9VIRU/49-523---------------------------DSLILSLEGVLGHKYKLKQHIGASTKV..........................
RDRP_LRVLG/155-619---------------------------SDPNISQNKIPRHYYQLKVHVGAQKKV..........................
Q98XW8_9VIRU/144-622---------------------------RNGRSPSKEWLLGYWPRKSHPLAGKKA..........................
Q99AT3_9VIRU/99-573---------------------------SFRWLCDPKASYAAFPPKQHPGAMNKV..........................
Q9YXE4_9VIRU/99-573---------------------------QAGWSYSDRATLAEFGLKSNPAASNKV..........................
RDRP_HV19S/122-585---------------------------GHLVCNDKAFRERYFPKKKHAAAAIKT..........................
Q9YXE6_9VIRU/120-589---------------------------FARLLNDHSFRRSCFPTKKMLPAEVKP..........................

PF04197

RDRP_IBDVU/1-875MSDVFNSPQARSKISAAFGIKPTAGQDVEELLIPKVWVPPEDPLASPSRLAKFLRENGYKILQPRSLPENEEYETDQILP
RDRP_IPNVJ/1-842MSDIFNSPQNKASILTALM.KSTTGD.VEDVLIPKRFRPAKDPLDSPQAAAQFLKDNKYRILRPRAIPTMVELETDAALP
RDRP_BSNV/1-863MSDVFNTPHARRTITQALG.LTNVSDRTQDWLLPEPWNPPMDPIKNSQEAAEYLQRNQYRMLKPRAIPENTPLDTSELFP

PF00078

A0A066NJ57_LELAM/135-366-------------------------------....------------------..GKQRP.--.LGIASLEDKI------
A0A0F6CD22_ECOLX/115-332-------------------------------....------------------..GKSRP.--.LGIPTMKDRA------
D7ZFU1_ECOLX/62-269-------------------------------....------------------..GSKRI.--.VYSLHPKMRL------
A0A0E0UMT2_SINMB/72-291-------------------------------....------------------..GGERV.--.LGVPTVSDRI------
Q47526_ECOLX/33-239-------------------------------....------------------..IGYRI.--.IAQPTPRVKA------
O01419_BOMMO/502-756-------------------------------..RD------------------QPSGYRP.--.IVVLSEAGKL------
O18558_AEDAE/472-725-------------------------------..YE------------------EAKSFRP.--.ISLTSFLLKC------
O42691_ALTAL/36-202-------------------------------...G------------------RSGQLRLV--I......DYRD------
O44316_DROMR/394-650-------------------------------...N------------------RPQDFRP.--.ISVPSIVVRQ------
O52231_STREE/68-275-------------------------------....------------------..GGIRQ.--.LGIPTVMDRM------
O62658_CANFA/517-773-------------------------------..PT------------------KKENYRP.--.ISLMNMDAKI------
O64612_ARATH/788-1031-------------------------------....------------------..KDYRP.--.ISCCNVLYKA------
O65244_ARATH/405-664-------------------------------...K------------------EMKDYRP.--.ISCCNVLYKV------
O65598_ARATH/489-747-------------------------------...S------------------CTSDFRP.--.ISCMNTLYKV------
O81284_ARATH/58-317-------------------------------...D------------------QLNLFRP.--.VACCTTIYKV------
O81454_ARATH/144-304-------------------------------....------------------..GTWRMC--L......DCRA------
O93520_ORYLA/518-771-------------------------------..RL------------------DCANYRP.--.VSVLNIDYKL------
O96546_LYMDI/526-780-------------------------------..RT------------------EPSSYRP.--.ISLLRGLGKI------
O99969_PORPU/100-315-------------------------------....------------------..GSVRN.--.LGIPTIRDRA------
POL_RSVP/769-938-------------------------------....------------------..GSYRL.--.L....HDLRA------
POL_HTL1A/633-804-------------------------------....------------------..GTWRFI--H......DLRA------
POL_SMRVH/71-240-------------------------------....------------------..GSWRLL--Q......DLRA------
POL_MMTVB/68-237-------------------------------....------------------..GKWRLL--Q......DLRA------
POL_CAMVC/289-452-------------------------------...K------------------RRGKKRMV--V......NYKA------
POL_IPHA/60-229-------------------------------....------------------..GKWRLL--H......DLRA------
POL_HV1MA/655-826-------------------------------....------------------.STKWRKL--V......NFRE------
TF21_SCHPO/455-615-------------------------------....------------------..GTLRMV--V......DYKP------
POK10_HUMAN/76-245-------------------------------....------------------..GKWHTL--T......DLRA------
POL4_DROME/357-523-------------------------------..NS------------------DKKKWRLV--I......DYRQ------
POLY_DROME/224-390-------------------------------..AF------------------GNPNKRLV--I......DFRK------
POL_EIAV9/249-419-------------------------------....------------------..GKWRLL--Q......DLRE------
YTX2_XENLA/513-765-------------------------------...R------------------LIKNWRP.--.VSLLSTDYKI------
POL_SOCMV/246-411-------------------------------...I------------------KRGKRRMV--I......NYKK------
Y2R2_DROME/498-741-------------------------------..KC------------------EPSSYRG.--.ICLLPVFGKV------
POL_BIV29/638-806-------------------------------....------------------.TGRWRML--M......DFRE------
RDPO_ACUOB/124-343-------------------------------....------------------..GSARP.--.LSIPSYTDRC------
POL2_DROME/249-414-------------------------------...S------------------GANKYRVV--I......DYRK------
RT67_ECOLX/48-262-------------------------------....------------------..KGVRT.--.ISAPTDRLKD------
RTJK_DROME/502-757-------------------------------..PT------------------DVDSYRP.--.TSLLPSLGKI------
POL_BLVAU/41-212-------------------------------....------------------..GAWRFV--H......DLRV------
POL_RTBVP/1228-1390-------------------------------...E------------------VAQKPRIV--Y......NYKR------
POL_CAEVC/210-380-------------------------------....------------------..GKWRML--I......DFRE------
P91581_CIOIN/483-644-------------------------------....------------------..KKPRMV--I.....DYSQT------
P95451_PSEAC/119-326-------------------------------....------------------..GGTRQ.--.LGIPSVVDRL------
Q01379_NEUCS/505-761-------------------------------AQQK------------------LAGAWRP.--.ISLLSNVGKI------
Q03261_SIV/246-416-------------------------------....------------------.KKKWRML--I......DFRK------
Q04135_DROME/496-743-------------------------------..KT------------------QPSSYRP.--.ISLLTCLSKL------
Q07995_CHITU/509-760-------------------------------..AS------------------ELSSYRP.--.ISLLSSISKI------
Q08724_9CYAN/108-336-------------------------------....------------------.NVEKRP.--.LGIPTMQDRA------
YRD6_CAEEL/484-644-------------------------------....------------------.TGKIRVC--A....DFKCSG------
Q17329_CAEEL/1071-1231-------------------------------....------------------..GSIRMC--I......DYRK------
Q24262_DROME/531-692-------------------------------....------------------..GTLRVC--V......DYRK------
Q24690_DROTE/495-742-------------------------------..KT------------------KTTSYRP.--.ISLNCCIAKK------
Q26816_9TRYP/545-793-------------------------------..AE------------------DLDSYRP.--.VTLTSCLCKV------
Q46666_ECOLX/34-241-------------------------------....------------------..TGFRV.--.IAQPAKGLKD------
Q83013_9RETR/68-238-------------------------------....------------------.KSKFRML--H......DLRA------
Q88285_9RETR/848-1015-------------------------------....------------------..GSWRLT--I......DYRP------
POL_CSVMV/250-413-------------------------------...Q------------------KRGKTRMV--I......DYKD------
Q93137_BOMMO/515-771-------------------------------....------------------.PTSYRP.--.ISLLMSLGKL------
Q93139_BOMMO/469-719-------------------------------..YT------------------EPKSHRP.--.IGLLPVLGKL------
Q94885_DROME/759-920-------------------------------....------------------..GDLRMC--V......DFRK------
YG31B_YEAST/639-797-------------------------------....------------------..GTFRLC--V......DYRT------
Q9YGS2_TAKRU/573-830-------------------------------..PD------------------VLANYRP.--.ISNLPFISKV------
Q9YW31_MSEPV/161-406-------------------------------...N------------------ICNNYRG.--.INLINWACKL------
Q9ZNW4_SORBI/922-1081-------------------------------....------------------..GKMRMC--I......DFTD------
Q9ZQ67_ARATH/542-701-------------------------------....------------------..DKWRVC--I......DFTD------
Q9ZQQ6_ARATH/659-918-------------------------------...T------------------LMRDYRP.--.ISCCNVIYKV------
Q9ZS84_SOLLC/655-815-------------------------------....------------------..GTMRMC--V......DYRA------
Q9ZVK4_ARATH/510-669-------------------------------....------------------..GSFRLC--I......DYRG------

PF05919

Q6EH16_9VIRU/1-501-------------------------------L..........KAGP......NGKISLLTS--LLDALAFWSDP..LRVI
Q5TMB5_9VIRU/174-658-------------------------------HFST.......HREP.......NGHAISSV--LNDALSYDEKS..SNAL
Q18L80_9VIRU/166-639-------------------------------MAPW....LIQSSGPCSKKGCNNTEGWLTA--IRRLKHLFTWG..E.IT
Q9WJ23_9VIRU/164-642-------------------------------YLSF.......KSSP.......NGQSTLHS--SYGLFSMIFVG..HTIL
RDRP_CPMV1/246-745-------------------------------M..........KAGP......NGKISLLTS--SVDALSFITQP..TKIF
Q9ZXZ7_THACU/214-754-------------------------------LAPT.KFIMSRSASP......SNKVSWFGI--LTDTRLLREGS..PRLW
Q9WJ22_9VIRU/155-622-------------------------------YLSI.......KGSP.......NGKASMSS--LYSIISFNSSN..IRYL
Q6EH19_9VIRU/208-686-------------------------------RWVV.......TAGP.......NGPSISSC--LQDLPKFNGLF..RSQV
Q9WJ24_9VIRU/163-645-------------------------------KLLT.......KAGP.......HGPQSLTW--YHTIKLYDFNQ..WLGI
Q6GYC2_9VIRU/156-638-------------------------------FVSV.......KSSP.......TGPSTLTA--LWGLWNHSYES..FNWL
Q18L78_9VIRU/174-654-------------------------------PYSVNRLMDITKAGP......NGGVSLRNV--IIDAYALMKHP..KVYA
Q18L79_9VIRU/168-671-------------------------------LNPF....LIYSSGPCSPKGMNNTAGWILA--FRRLKALFLDK..EFFL
Q3S3F3_9VIRU/120-606-------------------------------YLSP.......KGGP.......MGKSTWSS--IWSMYALKHEL..HLSL
O92614_9VIRU/173-711-------------------------------LTLSNPIIYLLSAGP......NHSISMMGI--WKDIYAWYVSPLFPTLL

PF07727

Q7G640_ORYSJ/781-1029------------------------------------------------------NGTWEL----VHLLKQK.KP------
Q7XLN3_ORYSJ/465-703------------------------------------------------------RDVFLP----VMPTCRGFFP------
Q7XTU6_ORYSJ/940-1185------------------------------------------------------NQTWSL----AELPAGH.KA------
Q7XKS1_ORYSJ/160-403------------------------------------------------------TCTWDL----VPLPSHA.RP------
Q9FWI2_ORYSJ/795-1030------------------------------------------------------NNTWEL----VDRPRDR.KV------
Q94I36_ORYSJ/864-1109------------------------------------------------------NKDWTL----VEPPSGH.NI------
Q7G6C9_ORYSJ/1047-1286------------------------------------------------------NQVWTL----VERPK.Q.NV------
Q94LQ7_ORYSJ/550-793------------------------------------------------------NKTWHR----VPSKKGQ.NI------
Q7XKG6_ORYSJ/514-759------------------------------------------------------NKTWEL----VPFPTGK.KV------
Q7X5X4_ORYSJ/138-383------------------------------------------------------NGTWEL----VPRHAGH.CP------
Q84M55_ORYSJ/910-1155------------------------------------------------------NKTWEL----VKLPPEK.RA------
Q7Y173_ORYSJ/398-645------------------------------------------------------NGVWDL----VEIPKGS.KT------
Q8W5F4_ORYSJ/472-717------------------------------------------------------NGTWEV----TERPCGC.KP------
Q7XUD9_ORYSJ/916-1161------------------------------------------------------NNTWRL----VDLPSGH.RA------
Q8LNW7_ORYSJ/880-1128------------------------------------------------------NHTWEF----VKLPKEK.KP------
Q94HQ0_ORYSJ/485-718------------------------------------------------------NRTWEL----ADLPRGH.RA------
Q7Y1I1_ORYSJ/727-972------------------------------------------------------NKTWRL----VDLPRGH.HA------
Q94GR9_ORYSJ/975-1220------------------------------------------------------NKVWTL----IERPRDH.NV------
Q7X7N0_ORYSJ/758-1003------------------------------------------------------NGTWRL----VPRPPGA.NV------
Q7XZY2_ORYSJ/297-542------------------------------------------------------NSTWCL----TNLPPRH.KP------
Q7XN62_ORYSJ/915-1162------------------------------------------------------NDVWDL----EEIPKGA.KT------
Q7XLI2_ORYSJ/53-298------------------------------------------------------NRTWDL----VPRPNGA.NV------
B5RTA2_DEBHA/1170-1414------------------------------------------------------.EVYTV----VKNPKNV.KP------
B5RTR8_DEBHA/1021-1254------------------------------------------------------NNTWDL----VSLPKDR.KA------
E7KRB3_YEASL/146-383------------------------------------------------------.KTYRL----VSLPKQR.RA------
Q2R072_ORYSJ/915-1159------------------------------------------------------NKTWRL----VDLPSGH.RP------
Q59K02_CANAL/999-1236------------------------------------------------------NNTWSL----EPLPEGR.KA------
Q5AG24_CANAL/888-1133------------------------------------------------------NQVYTV----EKTPKNV.VP------
Q5AH82_CANAL/122-366------------------------------------------------------.DVYEE----VPIPTGV.KP------
Q7XN23_ORYSJ/31-274------------------------------------------------------NNTWHL----VPYEKGQ.NI------
Q8S476_MAIZE/836-1081------------------------------------------------------NGTWEV----VDRPYGC.QP------
Q8S479_MAIZE/1073-1313------------------------------------------------------..FWTL----VPRPK.Q.NV------

PF00978

R1AB_LIYV9/1925-2366-------------------------......PGAYVVSK-ILGKGER.....NRPNTWKQV..IQSLSHRNFNAPIINHK
R1AB_BYVU/2601-3046-------------------------D.....HDPQRVSS-IRSQAIP.....KRKPSLQEN..LYSYESRNYNF.TVCER
Q9YPH5_9VIRU/1359-1796-------------------------E.....ERRYLSPV-LRTAMPN.....KRQSSQAES..LLALKKRNMAAPRLQES
POLN_EEVVM/2041-2488-------------------------K.....KHAYLEPT-IRSAVPS.....AIQNTLQNV..LAAATKRNCNVTQMREL
E0YCR0_9CLOS/53-491-------------------------I.....ED.RFYSF-IRSSVGL.....PKRNTLKCN..LVTFENRNFNADRGCNV
RDRP_TOMS1/1168-1609-------------------------D.....AKPTLIPM-VRTAAEM.....PRQTGLLEN..LVAMIKRNFNSPELSGV
RDRP_PSVJ/295-726-------------------------D.....GGNYLKPV-LTTGSGS.....KRLGTTKEV..LTAIKKRNADVPELSGS
Q66107_9BROM/228-662-------------------------G.....QQTYAVPA-YQSGATS.....KRVNTQRET..LLAVKKRNMNIPELQST
Q87644_SINDV/2053-2501-------------------------K.....HE.YRAPN-IRSAVPS.....AMQNTLQNV..LIAATKRNCNVTQMREL
O56790_9VIRU/1323-1760-------------------------E.....VR.GLTPA-LRTAMPE.....KRQSGLIES..VLALNKRNMAAPRLQES
RDRP_CMVFN/308-738-------------------------P.....DSGHMIPV-LNTGSGH.....KRVGTTKEV..LTAIKKRNADVPELGDS
Q9WJD8_PEBV/1299-1738-------------------------E....EKETCLVPV-LRTAMPD.....KRKTTQLEG..LLALQKRNQAAPDLQQN
Q80875_BSMV/195-630-------------------------F.....KE.SLKPV-LRTAMPE.....KRQGSLIES..VLAFRKRNLAAPRLQGA
RDRP_RBDVR/1234-1674-------------------------T.....NNKFAVPH-LPTGALL.....RRNTSSRQV..GLAIEKRNANVMNSQKY
RDRP_SBWMN/1373-1810-------------------------D.....KR.GLVPV-LRTAMPP.....KRQNLPVEA..MLALKKRNMAAPKLQEA
POLN_ONNVI/2053-2501-------------------------K.....QHSYHAPT-IRSAVPS.....PFQNTLQNV..LAAATKRNCNVTQMREL
RDRP_TAV/313-742-------------------------I.....DEGHLKPV-LNTGSGQ.....KRIGTTREV..LCAIKKRNADVPELCGS
POLN_MIDDV/534-981-------------------------K.....KHSYHRAE-IRSAVPS.....PFQNTLQNV..LAAATKRNCNVTQMREL
RDRP_TMGMV/1163-1604-------------------------E.....VKPCLEPV-LRTAAEP.....PRAAGLLEN..LVAMIKRNFNAPDLTGT
RDRP_TOBSV/253-689-------------------------G.....VDTRLVPN-MSVGGLS.....HRVPTQREA..LLAIKKRNMNVPELQSN
RDRP_OLV2I/310-732-------------------------K.....PD.FAVSS-IRTGLEM.....PRIATKKEM..LMAFSKRNVGAPQMVEV
RDRP_YOMV/1155-1594-------------------------E.....RPVFMKPK-LRTAAEM.....PRTAGLLEN..LVAMIKRNMNAPDLTGT
RDRP_AMVLE/318-752-------------------------S.....SENCYEPR-FKTGALS.....TRKGTQTEA..LLAIKKRNMNVPNLGQI
POLN_RRVN/2019-2467-------------------------K.....HHAYHQPQ-VRSAVPS.....PFQNTLQNV..LAAATKRNCNVTQMREL
RDRP_ASPVP/1758-2169-------------------------G.....QE......-LTNAAERYEAIYPRHKGTDTATFLMAVKKR......LSFS
O56250_9VIRU/1240-1678-------------------------E.....KEAFLKPV-IRTAMPD.....KRKTTQLES..LLALQKRNQAAPDLQEN
O90699_9VIRU/1363-1800-------------------------S.....EVKGLTPV-LRTAMPE.....KRQGGLVES..PLALNKRNMAAPQLQES
Q9Q6Q3_9CLOS/62-509-------------------------YK..ITDRPRSQYV-VRSAIRR.....PKRNSLKCN..LVTFESRNFNADRGCDV
POLN_AURAV/2038-2486-------------------------T.....HS.YLEPT-LRSAVPS.....AFQNTLQNV..LSAATKRNCNVTQMREL
RDRP_BBMV/271-697-------------------------D.....PDKFFEPV-LNFGASS.....RRVGSQKTV..LTALKKRNADVPELSDV
RDRP_CCMV/267-697-------------------------D.....PEKYYEPE-LSIGSFQ.....RRIGTQKTV..LTALKKRNADVPELADS
Q66581_EEEV/144-598-------------------------LRSFPKKHSYLRPE-IRSAVPS.....PIQNTLQDV..LAAATKRNCNVTQMREL
Q9QGG9_9BROM/363-797-------------------------S.....SGPKLNGL-FRTGNMS.....KRIPTQREA..ALAIKKRNLNVPDLQQV
RDRP_TMOB/1167-1614-------------------------D....NTKVPMTPV-IRTAAER.....PRSQGLLEN..LVAMIKRNFNSPELSGT
RDRP_BMV/256-688-------------------------D.....PDKYFQPK-MNIGSAQ.....RRVGTQKEV..LTALKKRNADVPEMGDA
O40960_9CLOS/62-506-------------------------......AVNCKVPI-LIGKGER.....SRPDTWKQV..ILSLSKRNFAAPRLNED

PF00998

RDRP_TNVA/224-703-------------------------Q-----RQLLRYSG.IGGHLLI----GIHNNSLSNL--RRGLMERVFYVEG..PN
RDRP_TCV/272-752-------------------------V-----RRIFHICG.MGNGLDF----GVHNNSLNNL--RRGLMERVFYVED.AQK
RDRP_TNVD/224-709-------------------------P-----RKLYRFTG.MGTHIRY----GVHDHSLGNV--RRGLVERLYMVEV..KG
RDRP_MCMVK/460-941-------------------------T-----RRVFRIAG.LGNLYEF----GVHNNSAVNL--ERGLMERVFYVKD.DKG
POLG_HCVEU/2430-2941-------------------------E-----EEKLPIN..PLSNSLV----RHHNMVYSTT--SRSASLRQKKVTFDRV.
POLG_HCVED/2420-2931-------------------------E-----ESKLPIS..PLSNSLL----RHHNMVYATT--TRSAVTRQKKVTFDRL.
POLG_HCVJL/2434-2945-------------------------E-----EEKLPIS..PLSNTLI----RHHNMVYSTT--SRSAALRQKKVTFDRQ.
POLG_HCVJK/2431-2942-------------------------E-----EEKLPIS..PLSNSLL----RHHNLVYSTS--SRSAAQRQKKVTFDRL.
POLG_HCVEV/2426-2937-------------------------E-----EEKLPIN..PLSNTLL----RHHNLVYSTS--SRSAGLRQKKVTFDRL.
POLG_HCVJ6/2445-2956-------------------------E-----EEKLPIN..PLSNSLL----RYHNKVYCTT--SKSASLRAKKVTFDRMQ
Q9IR83_9TOMB/236-712-------------------------P-----RRIFQVCG.MGNGTTF----GVHNNSLTNL--RRGLVERVFYVED.ACK
Q87031_9LUTE/24-502-------------------------R-----SVISFLSQ.FTLGLDY----QCPNPSLHNA--LVAVERRVFTVG.KGNE
RDRP_POLVP/251-722-------------------------E-----RKWYSFAG.YASTYEY----IVHNSSLVNV--CRGLVERVFCVVR..DG
Q65987_9TOMB/269-750-------------------------I-----RRIFHICG.MGNGLDF----GVHNNSLNNL--RRGLMERVFYVED.AQK
P90338_9TOMB/1-480-------------------------P-----RRLYYQQE.IGTGLQY----RVHNASYANL--RRGLLERVFYVEDKVNK
RDRP_BYDV1/361-840-------------------------S-----CNIRYLSQ.THLGLVY----KAPNASLHNA--LVAVERRVYTVG.KGDK
O09796_9HEPC/2422-2933-------------------------E-----ESKLPIN..PLSNSLL----RHHNMVYATT--SRSAGLRQKKVTFDRL.
O09803_9FLAV/2373-2866-------------------------T-----PAKPPVVR.PVGSLLV----ADTTKVYVTN--PDNVGRRVDKVTFWRAP
O37361_9VIRU/252-737-------------------------D-----TNIRRVVGPFSSDYDI----VFYTNSRNNL--MRGLVNRVLTYK...GG
Q9WJD9_CARMV/267-744-------------------------E-----RKLYVQNA.ITTGYEY----RVHNHSYANL--RRGLLERVFYVER..NK
Q83103_9TOMB/228-711-------------------------P-----RKLYRFTG.FGANIRY----GVHDHSLGNV--RRGLVERVFMVEK..SG
Q66127_9TOMB/52-520-------------------------K-----RVSYQIDA.VRPSADF----GVHNNSLVNL--VRGINERVFYTDNRGSL
RDRP_PMVK/447-937-------------------------V-----RSIYRIAG.LGDQYEF----GLHNNSAANL--ERGLAERVYMVKN.YKT
POLG_GBVB/2277-2785-------------------------A-----SKVLSATR.AITSGFL----KQRSLVYVTE--PRDAELRKQKVTINRQ.
Q89801_9TOMB/1-479-------------------------V-----RKMGHVNF.MGNGKLF----GVHNASLVNL--RRGLLERVFYVER.EGK
Q9IRA1_9TOMB/266-741-------------------------V-----RRIYQITG.LDSGINF----GVHNNSLNNL--RRGLIERVYYVE..SNG
O12301_GAMV/231-708-------------------------Q-----RQLSAIVD.SWGRKPL----VFTITRLANL--RRGMIERMYYVER..DK
Q83424_MNSV/290-772-------------------------T-----RKLYCLGG.VGTSVKF----NVHNNSLANL--RRGLVERVFFVEN.DKK
O41892_PEGIA/2409-2899-------------------------R-----VIPPPITR.PVGTHLT----CDTTKVYATD--PDRAAERAEKVTIWRGQ
RDRP_OCSVU/235-734-------------------------N-----RTCMRVSG.VSPNIQI----IPFNNDITTL--ERAIKERVFFVKNLDKG
Q9IW60_9TOMB/325-800-------------------------D-----RNIFMVAG.CPSQARF----LVHNHCLKNL--KRGLVERVFCVER..NG
Q96898_9FLAV/2396-2886-------------------------R-----SVPQPMTR.PIGTHLT----CDTTKVYVTD--PDRAAERAEKVTIWRGD
RDRP_RCNMV/260-745-------------------------K-----RVVG.LPA.VSAGLKV----CVHQTSLHNM--IVSLERRVFRVKNSAGE

PF00972

POLG_YEFV1/2758-3406-------------------------E-----ERVERIKSEYMTSWFY-----DNDNPYRTWHYCGSYVTKTSGSAASMVN

PF00680

POLG_HAVHM/1750-2215----------------------...N-----FPAAMPFSKAEIDPMA.............V--MLSKYSLPIVEEPED--
RDRP_BPPH6/19-638----------------------..SV-----DPRFLSFKN.ELSRYLTDHFPANVDEYGRV--YGNGVRTNFFGMRHM--
POLG_PYFV1/2270-2778----------------------...T-----EPAILDPRDVRLGENR...YDPMIDGIKKY--EEQARPIKISWRNQI--
POL1_CPMVS/1186-1687----------------------...K-----VPSILVPTDPRIPAQHE.GYDPAKSGVSKY--SQPMSALDPELLGEV--
POLG_RHDVF/1279-1750----------------------...Y-----RPANLGRSDPDSDKSL.............M--NIAVKNLQVYQQEPK--
POLG_PVYN/2293-2763----------------------TVDA-----EAEAEAFFRPLMDAYG.......KSLLNRD--AYIKDIMKYSKPIDV--
POLG_EMCVR/1844-2288----------------------...Y-----APAVLSKFDPRTEADV...........DEV--AFSKHTSN...QESL--
POLG_FCVUR/1266-1735----------------------...H-----QPASLGSGDPRCPKSL.............T--AIVVDSLKPYC.DKV--
POLG_NVN68/1301-1766----------------------...Y-----EPAYLGGKDPRVQNGP...........SLQ--QVLRDQLKPFADPRG--
Q9DLK1_FMDVP/1865-2314----------------------...F-----GPAALSNKDPRLNEGV.........VLDDV--IFSKHKGDTRMSEED--
POLG_VESVA/1379-1848----------------------...H-----QPASLGAGDPRCPISL.............T--GIMVNNLQPYTEASP--
POL1_BAYMY/1634-2098----------------------..RE-----HPTFTWLKD.FMNEYA.......PSVLSYS--AYYKDLCKYNRAKHV--

PF02123

Q83093_9VIRU/437-816.....-------.............S-----SSKPDGFDRPAPPPT........SPSQSES--SPQNTQPQQSTESSG..
Q66150_9VIRU/22-408.....-------............EI-----GSLLFQAGRFERVEAP.........ANLQL--AITNLQAQYPRSRPR..
Q86519_9VIRU/516-902.....-------............SL-----TSLILQAGRFNRTVCP.........SGLAQ--AVQSLQERYPKVPP...
RDRP_SCPMV/464-849.....-------............EI-----GSLLLQAGKFVPTKAP.........SNLEQ--AYNNLLSRYPRSKPL..
RDRP_SBMVA/490-847.....-------..............-----HSLLLQAGKFNPTGIP.........RNLEG--ACQNLLERYPASKSC..
RDRP_PEMVW/733-1124.....-------............EL-----SSLRYQAARRQSAQTTAVIP...PKDVRED--LIKRTTEAYRS......
RDRP_PLRVW/609-1004.....-------.....ELQSL...N-----LQAARWLQRAESATIP.......GAEARKR--VIEKTVEAYRNCITNAP
RDRP_TYYVF/580-974.....-------.....ELKSL...R-----LQASRWLERAQSAEIP.......SDAERER--VIQKTADVYHPCQTNGP
Q65969_9LUTE/603-996.....-------.....ELKSL...R-----LQAARWLERAQSVKIP.......SSEEREH--VIERCCRAYQAAKTNGP
RDRP_ROTGI/108-803NRWKS-------DTLQGLLPNF...Y-----HRTHTLIGAILFAVTSRLEIYSYEQKKALR--YLLRTIEKCYNEGYLEM
RDRP_ROTHC/109-749DIYMD-------PSINTSCQSN...C-----QAMMFTISEMKLNN.........IKNAARL--EKLFTIIAATINKYGMP
O55590_9REOV/104-749.....-------.AILTSLSSN...L-----NAAMFWFHNNKSKTKTDQEF...AKLYRRR--ESLFRIVASTVNKYGVP
RDRP_ROTPY/100-748DSLMD-------PAILTSISSN...L-----NAVMFWLERHSNDVGDA......NKVYRRR--LDLFIIVASTINKYGVP
Q90153_9VIRU/1025-1530.....-------........AR...F-----GCAAAWLLRSQGQAAE.......FVTSVAA--WVVSNRIGPAAWKWLWV
Q90193_9VIRU/400-785.....-------..............-----LTIVLLIGRRRGSGLMECLS...EEEYNIR--FNNAILNCYSHMTTG..
RDRP_PCVC/362-832.....-------..............-----...SYHVGEGHTLVTN.......LLANWKG--ITQFTTVSHLVFPW...
RDRP_SCVLB/837-1303KDLFP-------SRKIVKLEGY...E-----ALLAMMLDRFNNIESTHVT....FFTYLRA--LPDREKEVFISLVLN..
Q87025_SCVLA/177-657HLRPD-------ELVEAAAKVS...P-----RRKYYLMCVVELLANLQVD....LEAAVAT--ILAYVLTLSEKFVPI..
Q90155_TTV1/96-539NFY..-------.............A-----RTLWNETTSDKSAFKPGT.....YNDTVAG--LLMWQQCALMWSLPKLI
Q9JE94_9VIRU/129-560.....-------NAYARNLLDA...S-----PLPDFALQQMLLPNT........ANDVVCA--ILLLGEVLWMLRCPISI
Q8V615_9VIRU/41-473.....-------NCYARNVLAS...T-----ELTDDLLKQSLPIGL........NNDSVCG--IVIVLELLRIAGVPSKL
Q83073_9VIRU/49-523NIHAS-------EVIAGSRKYA....-----RTVYRQYVQMSSLFSGM......YDDHVAG--ILLYSISTLKHCDVHVA
RDRP_LRVLG/155-619.NLTA-------IEVIRGCQHE...C-----SVVYCEFVRYSAYFAGL......YDDQVAA--ILLYAVAAHNVQGFGAR
Q98XW8_9VIRU/144-622NLFLD-------CVIADFLQNYKCLG-----PVLEGWMKRTHLLGI........YEDQACN--IIVYAQAVMLEFGFE..
Q99AT3_9VIRU/99-573NVYL.-------NEVASSLLSL...D-----PAAYSSASQALWPHKGKI.....ANDQASA--IILYGYGLRAQAVPDAM
Q9YXE4_9VIRU/99-573NVYL.-------CEVMRSLSDY....-----STSWAWLAEDALSRAPPM.....FNDQASA--LVLYGTALQAKGVQNG.
RDRP_HV19S/122-585NIRL.-------.............G-----PLARAWAARYGLAALGS......HLAYMVG--MPNDRACATLLLAQTYK
Q9YXE6_9VIRU/120-589NLALA-------PLIRSFSTCA...G-----PTLAGHFLRHLAGHV........TEDVAMA--AMVYAHGLVACYGQKG.

PF04197

RDRP_IBDVU/1-875DLAWMRQIEGPVLKPTLSLPIGDQEY-----FPKYYPTHRPSKEKPNAY.P---PDIALLK--QMIYLFLQVPEATDNLK
RDRP_IPNVJ/1-842RLRQM..VEDGKLKDTVSVPEGTTAF-----YPKYYPFHKPDHDEVGTFGA---PDITLLK--QLTFFLLE.....NDFP
RDRP_BSNV/1-863HLAEF..VGSGAFGTSTLVPAGSTEY-----IPRYYPTHKPEHNKPTPFGH---YDVALLK--QMTYQLTN...GKDNPE

PF00078

A0A066NJ57_LELAM/135-366--------------------------------------------------------------------------------
A0A0F6CD22_ECOLX/115-332--------------------------------------------------------------------------------
D7ZFU1_ECOLX/62-269--------------------------------------------------------------------------------
A0A0E0UMT2_SINMB/72-291--------------------------------------------------------------------------------
Q47526_ECOLX/33-239--------------------------------------------------------------------------------
O01419_BOMMO/502-756--------------------------------------------------------------------------------
O18558_AEDAE/472-725--------------------------------------------------------------------------------
O42691_ALTAL/36-202--------------------------------------------------------------------------------
O44316_DROMR/394-650--------------------------------------------------------------------------------
O52231_STREE/68-275--------------------------------------------------------------------------------
O62658_CANFA/517-773--------------------------------------------------------------------------------
O64612_ARATH/788-1031--------------------------------------------------------------------------------
O65244_ARATH/405-664--------------------------------------------------------------------------------
O65598_ARATH/489-747--------------------------------------------------------------------------------
O81284_ARATH/58-317--------------------------------------------------------------------------------
O81454_ARATH/144-304--------------------------------------------------------------------------------
O93520_ORYLA/518-771--------------------------------------------------------------------------------
O96546_LYMDI/526-780--------------------------------------------------------------------------------
O99969_PORPU/100-315--------------------------------------------------------------------------------
POL_RSVP/769-938--------------------------------------------------------------------------------
POL_HTL1A/633-804--------------------------------------------------------------------------------
POL_SMRVH/71-240--------------------------------------------------------------------------------
POL_MMTVB/68-237--------------------------------------------------------------------------------
POL_CAMVC/289-452--------------------------------------------------------------------------------
POL_IPHA/60-229--------------------------------------------------------------------------------
POL_HV1MA/655-826--------------------------------------------------------------------------------
TF21_SCHPO/455-615--------------------------------------------------------------------------------
POK10_HUMAN/76-245--------------------------------------------------------------------------------
POL4_DROME/357-523--------------------------------------------------------------------------------
POLY_DROME/224-390--------------------------------------------------------------------------------
POL_EIAV9/249-419--------------------------------------------------------------------------------
YTX2_XENLA/513-765--------------------------------------------------------------------------------
POL_SOCMV/246-411--------------------------------------------------------------------------------
Y2R2_DROME/498-741--------------------------------------------------------------------------------
POL_BIV29/638-806--------------------------------------------------------------------------------
RDPO_ACUOB/124-343--------------------------------------------------------------------------------
POL2_DROME/249-414--------------------------------------------------------------------------------
RT67_ECOLX/48-262--------------------------------------------------------------------------------
RTJK_DROME/502-757--------------------------------------------------------------------------------
POL_BLVAU/41-212--------------------------------------------------------------------------------
POL_RTBVP/1228-1390--------------------------------------------------------------------------------
POL_CAEVC/210-380--------------------------------------------------------------------------------
P91581_CIOIN/483-644--------------------------------------------------------------------------------
P95451_PSEAC/119-326--------------------------------------------------------------------------------
Q01379_NEUCS/505-761--------------------------------------------------------------------------------
Q03261_SIV/246-416--------------------------------------------------------------------------------
Q04135_DROME/496-743--------------------------------------------------------------------------------
Q07995_CHITU/509-760--------------------------------------------------------------------------------
Q08724_9CYAN/108-336--------------------------------------------------------------------------------
YRD6_CAEEL/484-644--------------------------------------------------------------------------------
Q17329_CAEEL/1071-1231--------------------------------------------------------------------------------
Q24262_DROME/531-692--------------------------------------------------------------------------------
Q24690_DROTE/495-742--------------------------------------------------------------------------------
Q26816_9TRYP/545-793--------------------------------------------------------------------------------
Q46666_ECOLX/34-241--------------------------------------------------------------------------------
Q83013_9RETR/68-238--------------------------------------------------------------------------------
Q88285_9RETR/848-1015--------------------------------------------------------------------------------
POL_CSVMV/250-413--------------------------------------------------------------------------------
Q93137_BOMMO/515-771--------------------------------------------------------------------------------
Q93139_BOMMO/469-719--------------------------------------------------------------------------------
Q94885_DROME/759-920--------------------------------------------------------------------------------
YG31B_YEAST/639-797--------------------------------------------------------------------------------
Q9YGS2_TAKRU/573-830--------------------------------------------------------------------------------
Q9YW31_MSEPV/161-406--------------------------------------------------------------------------------
Q9ZNW4_SORBI/922-1081--------------------------------------------------------------------------------
Q9ZQ67_ARATH/542-701--------------------------------------------------------------------------------
Q9ZQQ6_ARATH/659-918--------------------------------------------------------------------------------
Q9ZS84_SOLLC/655-815--------------------------------------------------------------------------------
Q9ZVK4_ARATH/510-669--------------------------------------------------------------------------------

PF05919

Q6EH16_9VIRU/1-501HFIWFNIRCYGYFWGLIWSMWLIFIM--------------IISLPY......YLIAL...................C---
Q5TMB5_9VIRU/174-658LGVS.........PEVHKRMMNFLKL--------------NEIVPLRHKL...CRAL...................F---
Q18L80_9VIRU/166-639SILD......................--------------....PYKEGK..WEKSD...................F---
Q9WJ23_9VIRU/164-642ENIL.............KIVGEKQYH--------------EIIGNHIKKLYHDHRLF...................I---
RDRP_CPMV1/246-745TYLDFSVRVYK.FRGLLLWMWMMCIL--------------LITLPY......AIVSF...................M---
Q9ZXZ7_THACU/214-754ENIQ...........AYLTMVGADQF--------------RFDLDYACSLADRLKSFDDKVDSQGQWIRQVSKSGQV---
Q9WJ22_9VIRU/155-622FNIV..................GDYQ--------------LVLNKFYQDLSQFYTKY...................I---
Q6EH19_9VIRU/208-686EVIL......................--------------PELLPIIDTLLTWEKSF...................K---
Q9WJ24_9VIRU/163-645IGIL.....................P--------------KSVLDLFTETLSYASKL...................V---
Q6GYC2_9VIRU/156-638FKIT.....................S--------------LSGVDYLTKIMNWTWLK...................D---
Q18L78_9VIRU/174-654SLLELSNVMSPYLGLLLRNQTTI..I--------------RAITDFDPIKWERIKPF...................M---
Q18L79_9VIRU/168-671TLLD......................--------------....PYKERRQWWESSP...................F---
Q3S3F3_9VIRU/120-606SYFL................GEAYKT--------------LFYLPYLKNMALSYGHD...................V---
O92614_9VIRU/173-711SFIG..........RMNRGNVLIDLL--------------RAEVSY......WEATG...................V---

PF07727

Q7G640_ORYSJ/781-1029--------------------------------------------------------------------------------
Q7XLN3_ORYSJ/465-703--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/940-1185--------------------------------------------------------------------------------
Q7XKS1_ORYSJ/160-403--------------------------------------------------------------------------------
Q9FWI2_ORYSJ/795-1030--------------------------------------------------------------------------------
Q94I36_ORYSJ/864-1109--------------------------------------------------------------------------------
Q7G6C9_ORYSJ/1047-1286--------------------------------------------------------------------------------
Q94LQ7_ORYSJ/550-793--------------------------------------------------------------------------------
Q7XKG6_ORYSJ/514-759--------------------------------------------------------------------------------
Q7X5X4_ORYSJ/138-383--------------------------------------------------------------------------------
Q84M55_ORYSJ/910-1155--------------------------------------------------------------------------------
Q7Y173_ORYSJ/398-645--------------------------------------------------------------------------------
Q8W5F4_ORYSJ/472-717--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/916-1161--------------------------------------------------------------------------------
Q8LNW7_ORYSJ/880-1128--------------------------------------------------------------------------------
Q94HQ0_ORYSJ/485-718--------------------------------------------------------------------------------
Q7Y1I1_ORYSJ/727-972--------------------------------------------------------------------------------
Q94GR9_ORYSJ/975-1220--------------------------------------------------------------------------------
Q7X7N0_ORYSJ/758-1003--------------------------------------------------------------------------------
Q7XZY2_ORYSJ/297-542--------------------------------------------------------------------------------
Q7XN62_ORYSJ/915-1162--------------------------------------------------------------------------------
Q7XLI2_ORYSJ/53-298--------------------------------------------------------------------------------
B5RTA2_DEBHA/1170-1414--------------------------------------------------------------------------------
B5RTR8_DEBHA/1021-1254--------------------------------------------------------------------------------
E7KRB3_YEASL/146-383--------------------------------------------------------------------------------
Q2R072_ORYSJ/915-1159--------------------------------------------------------------------------------
Q59K02_CANAL/999-1236--------------------------------------------------------------------------------
Q5AG24_CANAL/888-1133--------------------------------------------------------------------------------
Q5AH82_CANAL/122-366--------------------------------------------------------------------------------
Q7XN23_ORYSJ/31-274--------------------------------------------------------------------------------
Q8S476_MAIZE/836-1081--------------------------------------------------------------------------------
Q8S479_MAIZE/1073-1313--------------------------------------------------------------------------------

PF00978

R1AB_LIYV9/1925-2366L------------------DVKRSAQ.-------------ILYDSVV..KSLRQDRLTE......WYEPILPDLFKI---
R1AB_BYVU/2601-3046F------------------SGPQEFG.-------------QAMAMVMLERSFDLEKVAK.....VRSDVIAITEKGV---
Q9YPH5_9VIRU/1359-1796V------------------NEFEIIE.-------------NTISKAK..RVFLNEDLID.......CSPISNI.EAS---
POLN_EEVVM/2041-2488P------------------.VLDSAA.-------------FNVECFK..KYACNNEYWET....YKKNPIRLTEENV---
E0YCR0_9CLOS/53-491G------------------CDDSVAH.-------------ELKEIFF..EEVVNKARLAE....VTESHLSSNTMLL---
RDRP_TOMS1/1168-1609V------------------DIENTAS.-------------LVVDKFF..DSYLLKEKRK.....PNKNFSLFSRESL---
RDRP_PSVJ/295-726V------------------DLTRISK.-------------AVARRFK..ESYFNTN.AL......AQSNFLNV...V---
Q66107_9BROM/228-662F------------------DLDAEVA.-------------TCFKRFC..THVVDIPRSK......RLPQMLGT..EI---
Q87644_SINDV/2053-2501P------------------.TLDSAT.-------------FNVECFR..KYACNDEYWEE....FARKPIRITTEFV---
O56790_9VIRU/1323-1760V------------------NEFEIIE.-------------NVISKAK..AVFFDEKFID........ASPMNSVSNC---
RDRP_CMVFN/308-738V------------------NLSRLSK.-------------AVAERFF..ISYINGN.SL......ASSNFVNV...V---
Q9WJD8_PEBV/1299-1738V------------------HSTLLVE.-------------DTIKRLK..EVVYDVEKIR........SDPINNKAHM---
Q80875_BSMV/195-630L------------------NEWHTIE.-------------NVLTKAL..KVFFFEDLID........RTDHCTYESA---
RDRP_RBDVR/1234-1674F------------------DLENLAN.-------------KAVERFF..DFFIDMEKFS..........KLPTGVLG---
RDRP_SBWMN/1373-1810V------------------NEFEVIE.-------------RTVNRAK..EIFFDTSLID........DSEVSTRESN---
POLN_ONNVI/2053-2501P------------------TMDSAVF.-------------NV.ECFK..KYACNQEYWRE....FASSPIRVTTENL---
RDRP_TAV/313-742V------------------NLKRLSD.-------------DVAECFM..LSFMNGDKLC.......SSNFINI...V---
POLN_MIDDV/534-981P------------------TLDSAVF.-------------NV.ECFK..KYACNNDYWDE....FAQKPIRLTTENI---
RDRP_TMGMV/1163-1604I------------------DIESTAS.-------------VVVDKFF..DSYFIKKEKY.....TKNIAGVMTKDSM---
RDRP_TOBSV/253-689F------------------DHDDVLN.-------------RCVTRFI..THVVDKTRLS......KLNPISGE..EL---
RDRP_OLV2I/310-732P------------------.QEIHVK.-------------RLADRFF..RTFLKEGGWD.........KGD.....G---
RDRP_YOMV/1155-1594I------------------DIEDTAS.-------------LVVEKFW..DAYVVKEFSG.......TDGMAMTRESF---
RDRP_AMVLE/318-752Y------------------DVNSVAN.-------------SVVNKLL..TTVIDPDKLC......MFPDFISE.GEV---
POLN_RRVN/2019-2467P------------------TLDSAVF.-------------NV.ECFK..KFACNGEYWQE....FKDDPIRITTENI---
RDRP_ASPVP/1758-2169S------------------PAAEHAKL-------------RRAKPFG..KFLLDTFLKRVP.LNSSHDEKMMQ.EAV---
O56250_9VIRU/1240-1678V------------------HATVLIE.-------------ETMKKLK..SVVYDVGKIR........ADPIVNRAQM---
O90699_9VIRU/1363-1800V------------------NEFEIIE.-------------KTVTRAR..DIFFDVDRID........ASVMNTVENA---
Q9Q6Q3_9CLOS/62-509S------------------SDPVAAA.-------------ELASLFF..NTWVDGSKLAS....CVGDTISQNAVAA---
POLN_AURAV/2038-2486P------------------.VLDSAV.-------------FNVECFK..KYACNTDYWEE....FKEKPIRITTECV---
RDRP_BBMV/271-697V------------------D....AT.-------------EVPICLR..QSYLNIYGAD......CLFESFNI...M---
RDRP_CCMV/267-697V------------------DIKRVAC.-------------EVAEKFK..RAYLNHSGIG......LLGQSMDV...M---
Q66581_EEEV/144-598P------------------.VLDSAA.-------------FNVECFK..KYACNDEYWDF....YKTNPIRLTAENV---
Q9QGG9_9BROM/363-797L------------------FEDDEAR.-------------KIANRFI..NTVIDPNKLA......QFPGYISE.GEM---
RDRP_TMOB/1167-1614V------------------DMENTAS.-------------VVADRFF..DSYFLKDKLSGCSLGDSGGKNIIDRQAL---
RDRP_BMV/256-688I------------------NMKDTAK.-------------AIAKRFR..STFLNVDGED......CLRASMDV...M---
O40960_9CLOS/62-506I------------------SIDETAN.-------------RLLTSLM..RCMEPSRLAE......YFDVVEPDVNKI---

PF00998

RDRP_TNVA/224-703G....LQD........APKPVKGAFR--------------T.LDKFR--DLYTKNSW..------.RHTPVTSEQFL---
RDRP_TCV/272-752Q....LKP........APQPIPGIFG--------------K.LSGIR--RRLVRLAG..------.NHTPVPREKYP---
RDRP_TNVD/224-709E....LQP........TPKPTPGAFN--------------Q.MSRFS--DRLSIHLP..------.KTTRLTPREFL---
RDRP_MCMVK/460-941E....LVS........CPEPISGIFW--------------KNLKGFR--NSIVHHVG..------.HRHPVSRETFL---
POLG_HCVEU/2430-2941Q....VFD..........QHYQDVLK--------------E.IKLRA--STVQAKLLSI------EEACDLTPSHSA---
POLG_HCVED/2420-2931Q....VVD..........STYNEVLK--------------E.IKARA--SRVKPRLLTT------EEACDLTPPHSA---
POLG_HCVJL/2434-2945Q....VVD..........QHYYDTLK--------------E.MKARA--STVSAKLLSV------EEACDLTPAHSA---
POLG_HCVJK/2431-2942Q....VLD..........DHYNTTLK--------------E.IKELA--SGVKAELLSV------EEACRLVPSHSA---
POLG_HCVEV/2426-2937Q....VLD..........DHYREVVD--------------E.MKRLA--SKVKARLLPL------EEACGLTPPHSA---
POLG_HCVJ6/2445-2956A....LDA...........HYDSVLK--------------D.IKLAA--SKVTARLLTL------EEACQLTPPHSA---
Q9IR83_9TOMB/236-712N....LVP........TPQPLPGKFQ--------------E.LKYLA--RRVARIAG..------.HHTPIPREHYP---
Q87031_9LUTE/24-502V....VLP.........YKNKPGIFS--------------N.LDYFR--DSIVNKV...------GCPRTHTPEELA---
RDRP_POLVP/251-722K....LQR........PLRPKNNVFE--------------RKLGNVG--RRISSIVG..------.YCPAMTRSEFC---
Q65987_9TOMB/269-750E....LKP........APQPLPDAFA--------------K.LSGIR--RKLVKLAG..------.NHTPILREDYS---
P90338_9TOMB/1-480T....LVP........CPEPDRNAFK--------------E.LAYLK--RRLVRIVG..------.LHTRISAAQVV---
RDRP_BYDV1/361-840A....IYP.........PRPEHDIFT--------------DTMDYFQ--KSIIEEV...------GYCKTYPAQLLA---
O09796_9HEPC/2422-2933Q....VLD..........DHYRDVLK--------------E.MKAKA--STVKAKLLSI------EEACKLTPPHSA---
O09803_9FLAV/2373-2866R....VHD..........KFLVDSIE--------------R.AKRAA--QACLSMGYTY------EEAIRTVRPHAA---
O37361_9VIRU/252-737P....VLE...........PSPGAWK--------------S.LRGLA--TSLGNRC...------.LTTPLSPEEFL---
Q9WJD9_CARMV/267-744E....LVS........CPQPEPGSFK--------------E.MGYLR--RRFHRVCG..------.NHTRISANDLV---
Q83103_9TOMB/228-711K....LEY........TPKPTPGAFN--------------.QLSRFT--RALLPFLT..------.KTTRLTTKEFL---
Q66127_9TOMB/52-520P....VRP............TPGRFD--------------R....LT--VDIKHFK...------..INAWSMEDVV---
RDRP_PMVK/447-937D....FVASLDPAFCPAPEPVRGIFK--------------R.LDKYK--KEIVRRVG..------.RKSPITDEMFL---
POLG_GBVB/2277-2785P....LFP..........PSYHKQVR--------------L.AKEKA--SKVVGVMWDY------DEVAAHTPSKSA---
Q89801_9TOMB/1-479.....LVP........PPEPIPGIFS--------------R.LAGFK--SKLKKIVG..------.THSRISDDAFV---
Q9IRA1_9TOMB/266-741V....LQP........PLKPKVHQFR--------------K.LKYFA--RRLVNIVG..------.PYTPIEREEYP---
O12301_GAMV/231-708N....LVE........PPAPS.VDFR--------------..LPHFS--SAFKKVIG..------.RHTPVTRQAFV---
Q83424_MNSV/290-772E....LEP........APKPLSGAFD--------------R.LTWFR--RKLHSIVG..------.THSSISPGQFL---
O41892_PEGIA/2409-2899R....KYD..........KEYYSVVD--------------E.ALKKA--RATKSPGWTY------EQAISKVRRRAA---
RDRP_OCSVU/235-734SPTKFVSP.........PRPAPGVFA--------------QRLSNTL--GLLVPFLP..------.STAPMSHQQFV---
Q9IW60_9TOMB/325-800K....LTR........TPQPTKGAFG--------------.RLSPFR--KAVCEKVG..------.VAHRYGYDGFL---
Q96898_9FLAV/2396-2886R....KYD..........KHYEAVVE--------------A.VLKKA--AATKSHGWTY------SQAIAKVRRRAA---
RDRP_RCNMV/260-745L....VVP.........PKPIQNAFD--------------S.ISYFR--EEWLRKLSHK------GQILKSSLADVV---

PF00972

POLG_YEFV1/2758-3406GVIKILTYPWDRIEEVTRMAMTDTTPF-------------GQQRVFK--EKVDTRAKDP-------PAGTRKIMKVV---

PF00680

POLG_HAVHM/1750-2215-----------------YKEASIFYQ--------------NKIVGKT--QLVDDF.---------...LDLDMAITG---
RDRP_BPPH6/19-638-----------------NGFPMIPAT--------------WPLASNL--KKRADAD---------LADGPVSERDNL---
POLG_PYFV1/2270-2778-----------------IESMAAQMQ--------------DWETFMV--RE..GYM---------TMDLPMSVVING---
POL1_CPMVS/1186-1687-----------------ANDVLELWH--------------DCAVD..--....WDD---------FGEVSLEEALNG---
POLG_RHDVF/1279-1750-----------------LDKVDEFIE--------------RAAADVL--GYLRFLT---------KGERQANLNFKA---
POLG_PVYN/2293-2763-----------------GVVDRMHLR--------------KPSIGLS--STCNVHG---------FKKCAYVTDEQE---
POLG_EMCVR/1844-2288-----------------PPVFRMVAK--------------EYANRVF--TLL.GKD---------NGRLTVKQALEG---
POLG_FCVUR/1266-1735-----------------EGPPHDILH--------------RVQKMLI--DHLSGFV---------PVNISSETSMLS---
POLG_NVN68/1301-1766-----------------RMPEPGLLE--------------AAVETVT--SMLEQTM---------DTPSPWSYADA.---
Q9DLK1_FMDVP/1865-2314-----------------KALFRRCAA--------------DYASRLH--SVL.GTA---------NAPLSVYEAIKG---
POLG_VESVA/1379-1848-----------------GPD.TATLN--------------RVSKMLT--SHMEGYV---------PKVHKTEEDSIS---
POL1_BAYMY/1634-2098-----------------LTYNPEELH--------------YATKGLI--KMLEDAG---------LTQGSVRTPQQ.---

PF02123

Q83093_9VIRU/437-816........................................GQSGVKK--KSQRRRG......KSERQKSTQKPPQVP...
Q66150_9VIRU/22-408.................SCFRREPWCRE............DFVAEIE--KIAHSGE...........INLKASPGVP...
Q86519_9VIRU/516-902.................RRCLRDEWRFD............DIFDEVE--RILCETG..........EVNSASSPGVP...
RDRP_SCPMV/464-849.................ACFRQGTWSFD............AIFEQVV--SKATSAE...........INQKASPGVP...
RDRP_SBMVA/490-847.................YCLRGEAWSFD............AVYEEVC--KKAQSAE...........INEKASPGVP...
RDRP_PEMVW/733-1124.................TALPAPMWA..............HNFDESH--MRFEFWECVRKLKGQAGSGVPYAAFSGR...
RDRP_PLRVW/609-1004LC...............SLKSKLDWA..............GFQQDIR--EAVQSLE......LDAGVGIPYIAYGLP...
RDRP_TYYVF/580-974AA...............TRGGTLTWN..............NFMIDFK--QAVFSLE......FDAGIELPYIAYGKP...
Q65969_9LUTE/603-996MA...............TRGDRLSWD..............NFLQDFK--QAVLSLE......MDAGIGVPYIAYGKP...
RDRP_ROTGI/108-803SRDRKWSHTLPELRTLTFRLYNSKVIHAACAMISLVHANPIDYEFLC--QVVAVYQIIPANAAKLLSTPMTLYVGVATFS
RDRP_ROTHC/109-749RHNTRYRYEWETMKNKPYHL..AAWINSSIEMIACVVDHHTYMIARE--LIVKSFTNRTSLAKLVSSPMTVLTAMLP...
O55590_9REOV/104-749RHDQKYRYTYDVMKDKPYYL..VTWANSSIEILMSVHDHNDYLIAEE--LIINSYSNRSTLAKIVSSPMSILVALLD...
RDRP_ROTPY/100-748RHNEKYRYEYEVMKDKPYYL..VTWANSAIEMLMSVFSHEDYLIAKE--LIILSYSNRSTLAKLVSSPMSILVALID...
Q90153_9VIRU/1025-1530GKGL.............YQTNEDDWV..............AKAKSIH--DDLRKHGYPPHVQATEEDWSQSLYLQA....
Q90193_9VIRU/400-785.................YSAKFGRLAND..............VESFK--SFMQLRK...........PGHSQVPGNR...
RDRP_PCVC/362-832.................FKVCERDWS..............DKMKTLH--SLVRCSK.FFMNTRITEKDRQALMYMDL...
RDRP_SCVLB/837-1303.................YNGLGREWLKSE...........GVRAKQA--QGTVKYD............MSKLFELNV...
Q87025_SCVLA/177-657.................FLDSRAIWVGEPGPDALT.....ARLKASS--GQIKSIH......TADYEPLTELFELAV...
Q90155_TTV1/96-539INKI.............ISGVCDALTEKVSL.........TLLKRIS--DWLKQLG......LAYSPIFRLFIELPT...
Q9JE94_9VIRU/129-560IV...............NIS..RAICRND...........SFLKDLS--DFNKMLG......LTKIPIANCLTELNT...
Q8V615_9VIRU/41-473LP...............IIG..QAIANKD...........PFIKELS--DFNKMIG......ATTSRIANILTECNT...
Q83073_9VIRU/49-523MA...............YAIAAVRDLTQ............SVIADLS--DVLKLRA........LAAWCPNYVELKC...
RDRP_LRVLG/155-619FC....................VLWALMCVRIA.......GFADDIN--IYIKHRG........MSGLLPQLVEMKC...
Q98XW8_9VIRU/144-622.................ESLYLATWAVLRA..........KQAKALS--DVLKAMG......QNMCAVGRHLCELAV...
Q99AT3_9VIRU/99-573.................HVA..ATLATTP...........DLAKALT--NFLKATG......ANGSRLGALLCESNV...
Q9YXE4_9VIRU/99-573.................YHAATALIANP............EYAKDMT--TVLKAVG......ANSNHLGACLVEAQT...
RDRP_HV19S/122-585AR...............FGSEGVAWAIASVRQP.......ENAKGLS--NALKALG......SNTSEPGALFVEANT...
Q9YXE6_9VIRU/120-589.................YDI..AAWLVLRP..........AAAKGIS--TAIKALG......ANAHDFGAVLCEAQT...

PF04197

RDRP_IBDVU/1-875DEVTLLTQ...NIRDKAYGSGTYMGQA-------------TRLVAMK--EVATGRNPNKDPLKLGYTFESIAQLLDITLP
RDRP_IPNVJ/1-842TGPETLRQVREAIATLQYGSGSYSGQL-------------NRLLAMK--GVATGRNPNKTPKTVGYTNEQLAKLLEQTLP
RDRP_BSNV/1-863EEGTTFRQFRDTIVEQQYGSGTSQGQL-------------ARLVAMK--EVATGRNPNKSPKELGLSMEEIATMLEQTLP

PF00078

A0A066NJ57_LELAM/135-366---------------------------------------------------------------------VQY--------
A0A0F6CD22_ECOLX/115-332---------------------------------------------------------------------MQA--------
D7ZFU1_ECOLX/62-269---------------------------------------------------------------------LQS--------
A0A0E0UMT2_SINMB/72-291---------------------------------------------------------------------AQM--------
Q47526_ECOLX/33-239---------------------------------------------------------------------IQR--------
O01419_BOMMO/502-756---------------------------------------------------------------------LER--------
O18558_AEDAE/472-725---------------------------------------------------------------------LER--------
O42691_ALTAL/36-202---------------------------------------------------------------------LNS--------
O44316_DROMR/394-650---------------------------------------------------------------------LNA--------
O52231_STREE/68-275---------------------------------------------------------------------IQQ--------
O62658_CANFA/517-773---------------------------------------------------------------------LNK--------
O64612_ARATH/788-1031---------------------------------------------------------------------ISK--------
O65244_ARATH/405-664---------------------------------------------------------------------ISK--------
O65598_ARATH/489-747---------------------------------------------------------------------IAR--------
O81284_ARATH/58-317---------------------------------------------------------------------ITR--------
O81454_ARATH/144-304---------------------------------------------------------------------INN--------
O93520_ORYLA/518-771---------------------------------------------------------------------FTS--------
O96546_LYMDI/526-780---------------------------------------------------------------------YER--------
O99969_PORPU/100-315---------------------------------------------------------------------KQC--------
POL_RSVP/769-938---------------------------------------------------------------------VNA--------
POL_HTL1A/633-804---------------------------------------------------------------------TNS--------
POL_SMRVH/71-240---------------------------------------------------------------------VNK--------
POL_MMTVB/68-237---------------------------------------------------------------------VNA--------
POL_CAMVC/289-452---------------------------------------------------------------------MNK--------
POL_IPHA/60-229---------------------------------------------------------------------INN--------
POL_HV1MA/655-826---------------------------------------------------------------------LNK--------
TF21_SCHPO/455-615---------------------------------------------------------------------LNK--------
POK10_HUMAN/76-245---------------------------------------------------------------------VNA--------
POL4_DROME/357-523---------------------------------------------------------------------INK--------
POLY_DROME/224-390---------------------------------------------------------------------LNE--------
POL_EIAV9/249-419---------------------------------------------------------------------LNK--------
YTX2_XENLA/513-765---------------------------------------------------------------------VAK--------
POL_SOCMV/246-411---------------------------------------------------------------------MNE--------
Y2R2_DROME/498-741---------------------------------------------------------------------LEA--------
POL_BIV29/638-806---------------------------------------------------------------------LNK--------
RDPO_ACUOB/124-343---------------------------------------------------------------------LQA--------
POL2_DROME/249-414---------------------------------------------------------------------LNE--------
RT67_ECOLX/48-262---------------------------------------------------------------------IQR--------
RTJK_DROME/502-757---------------------------------------------------------------------MER--------
POL_BLVAU/41-212---------------------------------------------------------------------TNA--------
POL_RTBVP/1228-1390---------------------------------------------------------------------LND--------
POL_CAEVC/210-380---------------------------------------------------------------------LNK--------
P91581_CIOIN/483-644---------------------------------------------------------------------VNV--------
P95451_PSEAC/119-326---------------------------------------------------------------------IQQ--------
Q01379_NEUCS/505-761---------------------------------------------------------------------LEA--------
Q03261_SIV/246-416---------------------------------------------------------------------LNE--------
Q04135_DROME/496-743---------------------------------------------------------------------FEK--------
Q07995_CHITU/509-760---------------------------------------------------------------------LER--------
Q08724_9CYAN/108-336---------------------------------------------------------------------TQS--------
YRD6_CAEEL/484-644---------------------------------------------------------------------LNA--------
Q17329_CAEEL/1071-1231---------------------------------------------------------------------VNK--------
Q24262_DROME/531-692---------------------------------------------------------------------LNT--------
Q24690_DROTE/495-742---------------------------------------------------------------------LDK--------
Q26816_9TRYP/545-793---------------------------------------------------------------------MER--------
Q46666_ECOLX/34-241---------------------------------------------------------------------IQR--------
Q83013_9RETR/68-238---------------------------------------------------------------------VNA--------
Q88285_9RETR/848-1015---------------------------------------------------------------------LNS--------
POL_CSVMV/250-413---------------------------------------------------------------------LNK--------
Q93137_BOMMO/515-771---------------------------------------------------------------------YER--------
Q93139_BOMMO/469-719---------------------------------------------------------------------YEK--------
Q94885_DROME/759-920---------------------------------------------------------------------LNK--------
YG31B_YEAST/639-797---------------------------------------------------------------------LNK--------
Q9YGS2_TAKRU/573-830---------------------------------------------------------------------LEK--------
Q9YW31_MSEPV/161-406---------------------------------------------------------------------YSK--------
Q9ZNW4_SORBI/922-1081---------------------------------------------------------------------LNK--------
Q9ZQ67_ARATH/542-701---------------------------------------------------------------------LNK--------
Q9ZQQ6_ARATH/659-918---------------------------------------------------------------------ISK--------
Q9ZS84_SOLLC/655-815---------------------------------------------------------------------LNK--------
Q9ZVK4_ARATH/510-669---------------------------------------------------------------------LNW--------

PF05919

Q6EH16_9VIRU/1-501----------------------------------------------LGARAPV................MGQ--------
Q5TMB5_9VIRU/174-658----------------------------------------------LDKIISKPA..............FAR--------
Q18L80_9VIRU/166-639----------------------------------------------YSFWASIQP.LTDNVP.......IGK--------
Q9WJ23_9VIRU/164-642----------------------------------------------PGKIDYL................FGK--------
RDRP_CPMV1/246-745----------------------------------------------LGALIPI................MGK--------
Q9ZXZ7_THACU/214-754----------------------------------------------LTQVDSMKSKDSIRGHGIGPGLGLSQ--------
Q9WJ22_9VIRU/155-622----------------------------------------------NRDKLG.................LGK--------
Q6EH19_9VIRU/208-686----------------------------------------------LSTLMGLAGFKDDS.........LRK--------
Q9WJ24_9VIRU/163-645----------------------------------------------LPEIKSNIKSTKL..........IRR--------
Q6GYC2_9VIRU/156-638----------------------------------------------LGNKNNNKWSKQF..........LGS--------
Q18L78_9VIRU/174-654----------------------------------------------APVYQSIKDQTLNLIPDLSC...IGK--------
Q18L79_9VIRU/168-671----------------------------------------------IKYFNAILPDFDDNVS.......LGK--------
Q3S3F3_9VIRU/120-606----------------------------------------------PPKQWP.................SGK--------
O92614_9VIRU/173-711----------------------------------------------KPSVSPLDLK.............LGK--------

PF07727

Q7G640_ORYSJ/781-1029---------------------------------------------------------------------VHC--------
Q7XLN3_ORYSJ/465-703---------------------------------------------------------------------VGY--------
Q7XTU6_ORYSJ/940-1185---------------------------------------------------------------------IGL--------
Q7XKS1_ORYSJ/160-403---------------------------------------------------------------------ITC--------
Q9FWI2_ORYSJ/795-1030---------------------------------------------------------------------IGV--------
Q94I36_ORYSJ/864-1109---------------------------------------------------------------------IGT--------
Q7G6C9_ORYSJ/1047-1286---------------------------------------------------------------------IGT--------
Q94LQ7_ORYSJ/550-793---------------------------------------------------------------------IDC--------
Q7XKG6_ORYSJ/514-759---------------------------------------------------------------------VSC--------
Q7X5X4_ORYSJ/138-383---------------------------------------------------------------------IGL--------
Q84M55_ORYSJ/910-1155---------------------------------------------------------------------VGC--------
Q7Y173_ORYSJ/398-645---------------------------------------------------------------------VGC--------
Q8W5F4_ORYSJ/472-717---------------------------------------------------------------------VGC--------
Q7XUD9_ORYSJ/916-1161---------------------------------------------------------------------IGL--------
Q8LNW7_ORYSJ/880-1128---------------------------------------------------------------------IRC--------
Q94HQ0_ORYSJ/485-718---------------------------------------------------------------------VTL--------
Q7Y1I1_ORYSJ/727-972---------------------------------------------------------------------IGL--------
Q94GR9_ORYSJ/975-1220---------------------------------------------------------------------IGT--------
Q7X7N0_ORYSJ/758-1003---------------------------------------------------------------------VTG--------
Q7XZY2_ORYSJ/297-542---------------------------------------------------------------------IGL--------
Q7XN62_ORYSJ/915-1162---------------------------------------------------------------------VGC--------
Q7XLI2_ORYSJ/53-298---------------------------------------------------------------------VTG--------
B5RTA2_DEBHA/1170-1414---------------------------------------------------------------------IPT--------
B5RTR8_DEBHA/1021-1254---------------------------------------------------------------------IGN--------
E7KRB3_YEASL/146-383---------------------------------------------------------------------LGS--------
Q2R072_ORYSJ/915-1159---------------------------------------------------------------------IGL--------
Q59K02_CANAL/999-1236---------------------------------------------------------------------IGV--------
Q5AG24_CANAL/888-1133---------------------------------------------------------------------LKT--------
Q5AH82_CANAL/122-366---------------------------------------------------------------------ISM--------
Q7XN23_ORYSJ/31-274---------------------------------------------------------------------IGC--------
Q8S476_MAIZE/836-1081---------------------------------------------------------------------IGC--------
Q8S479_MAIZE/1073-1313---------------------------------------------------------------------VGT--------

PF00978

R1AB_LIYV9/1925-2366---------------------GKWLDDRDGSKYRM-------L...NR-RLDFAS.LA...DKFKTLNLMVK--------
R1AB_BYVU/2601-3046---------------------RTWMSKREPSQLRA-------L...SS-DLQKPLNLE...EEITTFKLMVK--------
Q9YPH5_9VIRU/1359-1796---------------------QRWWQNQSEQAKKQ-------L...IA-.ETKIL.SE...IDVGVYNFMIK--------
POLN_EEVVM/2041-2488---------------------VNYITKLKGPKAAA-------LY.AKT-HNLDML.QD...IPMDRFIMDLK--------
E0YCR0_9CLOS/53-491---------------------SDWLDKRAPNAYKS-------LK.RAL-.GSFVF.HP...SMLTSYTLMVK--------
RDRP_TOMS1/1168-1609---------------------NRWIAKQEQVTIGQ-------L...AD-FDFVDL.PA...VD..QYRHMIK--------
RDRP_PSVJ/295-726---------------------GNFHAYMQKWAASG-------L...TY-DDLPDL.HA...ENLQLYEHMVK--------
Q66107_9BROM/228-662---------------------QFFSDYLAGKNP..-------P...LS-EYQGPL.TL...QSLDKYMHMVK--------
Q87644_SINDV/2053-2501---------------------TAYVARLKGPKAAA-------LF.AKT-YNLVPL.QE...VPMDRFVMDMK--------
O56790_9VIRU/1323-1760---------------------QKWWDKQSVTAQKQ-------M...LA-.DTRII.SE...IDLCTYNFMIK--------
RDRP_CMVFN/308-738---------------------SNFHDYMEKWKSSG-------L...SY-DDLPDL.HA...ENLQFYDHMIK--------
Q9WJD8_PEBV/1299-1738---------------------QKWWRNQSTAVQAK-------V...MQ-.DVREL.HE...IDFSSYMFMIK--------
Q80875_BSMV/195-630---------------------LRWWDKQSVTARAQ-------L...VA-.DQRRL.CD...VDFTTYNFMIK--------
RDRP_RBDVR/1234-1674---------------------SSAEQIQTYQNKTG-------N...KV-TDPVCV.AL...SPIQKYKHMIK--------
RDRP_SBWMN/1373-1810---------------------LRWWKRQSTTAKAQ-------L...KK-.ETRLL.HE...LDLCYYNYCIK--------
POLN_ONNVI/2053-2501---------------------TMYVTKLKGPKAAA-------LF.AKT-HNLLPL.QE...VPMDRFTMDMK--------
RDRP_TAV/313-742---------------------SDFHAYMSKWQS.V-------L...SY-DDLPDL.NA...ENLQFYEHMVK--------
POLN_MIDDV/534-981---------------------TSYVTRLKGPKAAA-------LF.AKT-YDLKPL.QE...VPMDRFVVDMK--------
RDRP_TMGMV/1163-1604---------------------MRWLENRKEVLLDD-------L...AN-YNFTDL.PA...ID..QYKHMIK--------
RDRP_TOBSV/253-689---------------------HYFNQYLENKNP..-------P...LS-EYKGPV.PL...VALDKYMHMIK--------
RDRP_OLV2I/310-732---------------------HYWDDFFHRKGRKV-------F...SL-ENCYDD.PL...SS...YLVMLK--------
RDRP_YOMV/1155-1594---------------------SRWLSKQESSTVGQ-------L...AD-FNFVDL.PA...VD..EYKHMIK--------
RDRP_AMVLE/318-752---------------------SYFQDYIVGKNP..-------D...PE-LYSDPL.GV...RSIDSYKHMIK--------
POLN_RRVN/2019-2467---------------------TTYVTRLKGPKAAA-------LF.AKT-HNLVPL.QE...VPMDRFVVDMK--------
RDRP_ASPVP/1758-2169---------------------HAFEEKKLSKSMAT-------I...EN-.HSGRS.CEDWPVD.KALIFM.K--------
O56250_9VIRU/1240-1678---------------------ERWWRNQSTAIQAK-------V...VA-.DVREL.HE...IDYSSYMYMIK--------
O90699_9VIRU/1363-1800---------------------ARWWGKQSFTAQKQ-------M...IA-.DTRVV.HE...IDVCTYNFMIK--------
Q9Q6Q3_9CLOS/62-509---------------------SSWLDSRSSMAKQS-------LWVRLR-SFVYDL.AA...MT..RYQLMVK--------
POLN_AURAV/2038-2486---------------------TSYVARLKGPEAAA-------LF.AKT-HQLVPL.QE...VPMDRFVMDMK--------
RDRP_BBMV/271-697---------------------AKGLDYHKRWKS.H-------K...EL-QGVTLL.CE...TNLQRYQHMIK--------
RDRP_CCMV/267-697---------------------SRGLEYHKKWKD.H-------K...DL-TGVTVL.SE...INLQRYQHMIK--------
Q66581_EEEV/144-598---------------------TQYVTKLKGPKAAA-------LF.AKT-HNLQPL.HE...IPMDRFVMDLK--------
Q9QGG9_9BROM/363-797---------------------GYFNKYLSGKNI..-------P...ED-AFVDPC.AL...VSMDKYRHMIK--------
RDRP_TMOB/1167-1614---------------------IRWMEKQEKSTIGQ-------L...AD-YDFVDL.PA...ID..QYRHIIK--------
RDRP_BMV/256-688---------------------TKCLEYHKKWGK.H-------M...DL-QGVNVA.AE...TDLCRYQHMLK--------
O40960_9CLOS/62-506---------------------NSWLLTRDRRKYGN-------V...LR-GFDGND.WT...TKLFNLKLMVK--------

PF00998

RDRP_TNVA/224-703---------------------MNYTGRKLTIYREA-------V---DS.LSHQPL-SSR.DAKLKTFVKAEK--------
RDRP_TCV/272-752---------------------SFYKGRRATIYQKA-------L---DS.LHDRPV-SRK.DAELKTFVKAEK--------
RDRP_TNVD/224-709---------------------GFYTGRKLERYQKA-------V---ES.LEMHPV-REK.DAWLSTFVKAEK--------
RDRP_MCMVK/460-941---------------------AYYTGPKRTMYEKA-------V---NS.LYEMPV-SYD.DAKLKTFVKAEK--------
POLG_HCVEU/2430-2941---------------------RSKYGYGAQ.DVRS-------R---AS.KAVDHI-PSVWEGLLEDSDTPIP--------
POLG_HCVED/2420-2931---------------------RSKFGYGKK.DVRS-------H---SR.KAINHI-SSVWKDLLDDNNTPIP--------
POLG_HCVJL/2434-2945---------------------RSKFGYGAK.DVRG-------R---TS.KALNHI-NSVWEDLLEDNVTPIP--------
POLG_HCVJK/2431-2942---------------------RSKFGYGAK.EVRS-------L---SS.KAINHI-NSVWEDLLEDNTTPIP--------
POLG_HCVEV/2426-2937---------------------RSKYGYGAK.EVRS-------L---DK.KALKHI-EGVWQDLLDDSDTPLP--------
POLG_HCVJ6/2445-2956---------------------RSKYGFGAK.EVRS-------L---SG.RAVNHI-KSVWKDLLEDTQTPIP--------
Q9IR83_9TOMB/236-712---------------------GLYKGRRYQIYADA-------V---NS.LASNPV-HRR.DSFLKTFVKAEK--------
Q87031_9LUTE/24-502---------------------ATYHSGKRSLYNAA-------V---QS.LKKKAV-ERS.DANVTAFLKMEK--------
RDRP_POLVP/251-722---------------------ESYSGTRRATYERA-------R---LS.LDVLPC-TRK.DAYLKTFVKAEK--------
Q65987_9TOMB/269-750---------------------KLYKGRRATIYQNA-------C---ES.LADRAC-TQGGSAELKTFVKAEK--------
P90338_9TOMB/1-480---------------------DCYQGRKRTVYHNA-------R---LS.LDEIPL-DRR.DSHLRTFTKAEK--------
RDRP_BYDV1/361-840---------------------NSYSAGKRAMYHKA-------I---AS.LRTIPY-HQK.DANVQAFLKKEK--------
O09796_9HEPC/2422-2933---------------------KSKYGYGAK.DVRN-------L---SS.RAVNHI-RSVWEDLLEDTETPID--------
O09803_9FLAV/2373-2866---------------------...MGWGSKVSVKD-------L---ATPAGKMAV-HDRLQEILEG..TPVP--------
O37361_9VIRU/252-737---------------------ACYVGRKRTIYTKA-------M---ES.FKTKPW-DARKDMIVKAFIKKEK--------
Q9WJD9_CARMV/267-744---------------------DCYQGRKRTIYENA-------A---AS.LLDRAI-ERK.DGDLKTFIKAEK--------
Q83103_9TOMB/228-711---------------------GFYTGRKLERYTKA-------S---ES.LEVISF-QEK.DSWLSTFVKAEK--------
Q66127_9TOMB/52-520---------------------NSYTGRQRARYEQA-------M---LS.IMERPL-ERR.DARVSTFIKAEK--------
RDRP_PMVK/447-937---------------------SYYDGPQLTTYSKA-------V---IS.LSERPV-AVQ.DSYLKTFIKAEK--------
POLG_GBVB/2277-2785---------------------KSHITGLRGTDVRS-------G---AARKAVLDL-QKCVEAGEIPS.HYRQ--------
Q89801_9TOMB/1-479---------------------ALYHGRRNTIYQNA-------V---DS.LRIGGV-QRK.DSYLSTFIKAEK--------
Q9IRA1_9TOMB/266-741---------------------LLYQGRRKAIYQKA-------L---ES.LSERPC-TRK.DAKLRTFVKAEK--------
O12301_GAMV/231-708---------------------EFYRGRKRTIYEKA-------V---ES.LSAAPV-THR.DARLKTFVKAEK--------
Q83424_MNSV/290-772---------------------DFYTGRRRTIYEGA-------V---KS.LEGLSV-QRR.DAYLKTFVKAEK--------
O41892_PEGIA/2409-2899---------------------...AGWGSKVTAST-------L---DK..GWPHV-KEMLDKIAFH..KEVP--------
RDRP_OCSVU/235-734---------------------DSTPSRKRKVYQQA-------L---ED.ISCHGL-NLETDSKVKVFVKYEK--------
Q9IW60_9TOMB/325-800---------------------SYYSGAKLRTYTRA-------V---ES.LHITPV-SER.DSHLTTFVKAEK--------
Q96898_9FLAV/2396-2886---------------------...AGYGSKVTAST-------L---AT..GWPHV-EEMLDKIARG..QEVP--------
RDRP_RCNMV/260-745---------------------ACYSSEKRKLYQKA-------A---DS.LEKKPV-QWR.DSKVQAFIKVEK--------

PF00972

POLG_YEFV1/2758-3406---------------------NRWLFRHLAREKNP-------R---LCTKEEFIA-KVRSHAAIGAYLEEQE--------

PF00680

POLG_HAVHM/1750-2215---------------------APG......IDAIN.......M---DSSPGFPYV-----QE......KLTK--------
RDRP_BPPH6/19-638---------------------LFRAAVRLMFSDLEPVPLKIRK---GSSTCIPYF-----SNDMGTKIEIAE--------
POLG_PYFV1/2270-2778---------------------IDG...VEYYEPLN.......M---STSEGYPLI-----LNRPK.DAHGKE--------
POL1_CPMVS/1186-1687---------------------CEG...VEYMERIP.......L---ATSEGFPHI-----LSRNG.KEKGKR--------
POLG_RHDVF/1279-1750---------------------A........FNTLD.......L---STSCG.PFV-----........PGKK--------
POLG_PVYN/2293-2763---------------------I........FKALN.......M---KAAVGASY.-----........GCKK--------
POLG_EMCVR/1844-2288---------------------LEG......MDPMD.......R---NTSPGLPYT-----AL......GMRR--------
POLG_FCVUR/1266-1735---------------------A........FHKLN.......H---DTSCG.PYL-----........GGRK--------
POLG_NVN68/1301-1766---------------------.........CQSLD.......K---TTSSGYPH.-----........HKRK--------
Q9DLK1_FMDVP/1865-2314---------------------VDG......LDAME.......P---DTAPGLPWA-----LQ......GKRR--------
POLG_VESVA/1379-1848---------------------A........FYMLN.......H---DTLCG.PYI-----........GARK--------
POL1_BAYMY/1634-2098---------------------V........ISDIQ.......W---NTSAGPSY.-----........QGKK--------

PF02123

Q83093_9VIRU/437-816.....................LSVLGQSNAEVLSR-------H---GDLVYIAVA.......ERLIALSEAD........
Q66150_9VIRU/22-408.....................LAEIGVSNQQVIDV-------A---WPLVCEAVV.......ERLHALASVD........
Q86519_9VIRU/516-902.....................LAGLANSNGEVRGL-------A---RDLVCLAVV.......ERLNPLPSVD........
RDRP_SCPMV/464-849.....................LSRLATTNKDLMAQ-------H---MQFVAACVT.......GRVPLLASFE........
RDRP_SBMVA/490-847.....................LSRLASTNKDLLKR-------H---LELVALCVT.......ERLFLLSEAE........
RDRP_PEMVW/733-1124..........................KTNDKWVFD-------H---ESTEDLWET.......VRDRLFRLLN........
RDRP_PLRVW/609-1004...........................THRGWVED-------H---KLLPVLTQL.......TFDRLQKMSE........
RDRP_TYYVF/580-974...........................THRGWVED-------Q---KLLPILAQL.......TFFRLQKMLE........
Q65969_9LUTE/603-996...........................THRGWVED-------K---KLLPILARL.......TFNRLQKMLE........
RDRP_ROTGI/108-803SNQVASTGNASECAPLQIENNIYVSEAQKKEWAES-------F---KSDPLNKSRMLKLMNENLNTTLDKFS........
RDRP_ROTHC/109-749.....................IRGTFITTENLELE-------Y---SNKSINYLISKEMAEDFMQAIKQLRDEGLEYIPD
O55590_9REOV/104-749.....................INGTFITTEELELE-------F---SNKYVKAIVPQKTLDELNDMLIAMEKANLYNIPK
RDRP_ROTPY/100-748.....................INGTFITNEELELE-------F---SDKYVKAIVPDQTFNELQEMIDNMKKAGLVDIPR
Q90153_9VIRU/1025-1530.....................LYGRGGVLVNWAED-------F---ANKASHPDPIQAWDGRCYSQKLATEI........
Q90193_9VIRU/400-785...................................-------.---................CTKVIIRLTE........
RDRP_PCVC/362-832.....................LVGRGEYTVDEMAE-------V---ELRTDDTYNTKHLSYDPNRQVFTNQQ........
RDRP_SCVLB/837-1303.....................LENGVDEEVDWEKE-------K---RNRSDIKTV.....NISYAKVLEHCR........
Q87025_SCVLA/177-657.....................LMNRGVGHVSWQAE-------K---DHRLNPDVA...........VVDQAR........
Q90155_TTV1/96-539.....................LLGRGAIPGDAALD-------M---KHRLTYNPL........MTVDVPKTQ........
Q9JE94_9VIRU/129-560.....................LQGRGVTSSDAKRD-------L---THRIA.DVN.......PHEAKISREN........
Q8V615_9VIRU/41-473.....................LIGRGVKSSDPSAD-------L---YHRVAPEGN.......RHEAKIPRHI........
Q83073_9VIRU/49-523.....................LRGRGIAELDVIAE-------A---KQRLKKPTH.......PYAYADNEEL........
RDRP_LRVLG/155-619.....................LLGRGVNEIDVETE-------A---RRRLDVGSL.......SMQRLDENEL........
Q98XW8_9VIRU/144-622.....................LQGRGVNRLDLLED-------A---ERRVSATFN.......CPIVHVPADA........
Q99AT3_9VIRU/99-573.....................LLGRAAGPADLSEE-------A---RYRTSSDVE.......SHLAIFSDAD........
Q9YXE4_9VIRU/99-573.....................LQGRAVQPADMHSE-------A---ISRTTTAVA.......DIVVDYPDDV........
RDRP_HV19S/122-585.....................LQGRYDRTLDMDHE-------V---ESRCSPAAI.......ADQVIPYTDE........
Q9YXE6_9VIRU/120-589.....................LLGRAVSTIDLAHE-------A---EYRCDPDLV.......AKQVIEPGEE........

PF04197

RDRP_IBDVU/1-875VGPPGEDDKPWVPLTRVPSRMLVLTGDVDGEFEVEDYLPKINL---KSSSGLPYVGRTKGETIGEMIAISNQ--------
RDRP_IPNVJ/1-842INTPKHED...PDLRWAPSWLINYTGDLSTD...KSYLPHVTI---KSSAGLPYIGKTKGDTTAEALVLADS--------
RDRP_BSNV/1-863IGQPGGDEG.WPSLTTTLSELLNPAEGM.......DYLPHITM---KSSSGLPFIGKTKGETVTSALAICDT--------

PF00078

A0A066NJ57_LELAM/135-366-------------------------------ALVKILNAVY..----------------------------------...
A0A0F6CD22_ECOLX/115-332-------------------------------LYLLALEPVA..----------------------------------...
D7ZFU1_ECOLX/62-269-------------------------------RINKRIFKE...----------------------------------...
A0A0E0UMT2_SINMB/72-291-------------------------------VVKQMIEPDL..----------------------------------...
Q47526_ECOLX/33-239-------------------------------DIIEILKQH...----------------------------------...
O01419_BOMMO/502-756-------------------------------VVAGRLVRHLE.----------------------------------..N
O18558_AEDAE/472-725-------------------------------IIDHHIRDVYL.----------------------------------...
O42691_ALTAL/36-202-------------------------------KIVL........----------------------------------...
O44316_DROMR/394-650-------------------------------ILASRLTAA...----------------------------------...
O52231_STREE/68-275-------------------------------AIVQVMSPIC..----------------------------------...
O62658_CANFA/517-773-------------------------------ILANRIQQYI..----------------------------------...
O64612_ARATH/788-1031-------------------------------LLANRLKCLL..----------------------------------...
O65244_ARATH/405-664-------------------------------IIANRLKLVL..----------------------------------...
O65598_ARATH/489-747-------------------------------LLTDRLQKLL..----------------------------------...
O81284_ARATH/58-317-------------------------------LISKRLNLFI..----------------------------------...
O81454_ARATH/144-304-------------------------------ITIK........----------------------------------...
O93520_ORYLA/518-771-------------------------------IISRRLETIL..----------------------------------...
O96546_LYMDI/526-780-------------------------------IVLSRLRTFAE.----------------------------------...
O99969_PORPU/100-315-------------------------------LVKFALEPQY..----------------------------------...
POL_RSVP/769-938-------------------------------KLVP........----------------------------------...
POL_HTL1A/633-804-------------------------------LTID........----------------------------------...
POL_SMRVH/71-240-------------------------------VMVP........----------------------------------...
POL_MMTVB/68-237-------------------------------TMHD........----------------------------------...
POL_CAMVC/289-452-------------------------------ATIG........----------------------------------...
POL_IPHA/60-229-------------------------------QMHL........----------------------------------...
POL_HV1MA/655-826-------------------------------RTQD........----------------------------------...
TF21_SCHPO/455-615-------------------------------YVKP........----------------------------------...
POK10_HUMAN/76-245-------------------------------VIQP........----------------------------------...
POL4_DROME/357-523-------------------------------KLLA........----------------------------------...
POLY_DROME/224-390-------------------------------KTIP........----------------------------------...
POL_EIAV9/249-419-------------------------------TVQV........----------------------------------...
YTX2_XENLA/513-765-------------------------------AISLRLKSVL..----------------------------------...
POL_SOCMV/246-411-------------------------------ATIG........----------------------------------...
Y2R2_DROME/498-741-------------------------------IMVNRVREV...----------------------------------...
POL_BIV29/638-806-------------------------------ITVK........----------------------------------...
RDPO_ACUOB/124-343-------------------------------LYKLAIEPMA..----------------------------------...
POL2_DROME/249-414-------------------------------ITIP........----------------------------------...
RT67_ECOLX/48-262-------------------------------RICDLLSDCRDE----------------------------------IFA
RTJK_DROME/502-757-------------------------------LILNRLLTCKD.----------------------------------...
POL_BLVAU/41-212-------------------------------LTKP........----------------------------------...
POL_RTBVP/1228-1390-------------------------------NMHT........----------------------------------...
POL_CAEVC/210-380-------------------------------QTED........----------------------------------...
P91581_CIOIN/483-644-------------------------------FTEL........----------------------------------...
P95451_PSEAC/119-326-------------------------------ALQQQLTPIF..----------------------------------...
Q01379_NEUCS/505-761-------------------------------LVAKRLTQAAE.----------------------------------...
Q03261_SIV/246-416-------------------------------ATQD........----------------------------------...
Q04135_DROME/496-743-------------------------------MLLLRISPHLR.----------------------------------...
Q07995_CHITU/509-760-------------------------------VLLNRINDHLE.----------------------------------...
Q08724_9CYAN/108-336-------------------------------LVKLALEPEW..----------------------------------...
YRD6_CAEEL/484-644-------------------------------ALKD........----------------------------------...
Q17329_CAEEL/1071-1231-------------------------------VVKN........----------------------------------...
Q24262_DROME/531-692-------------------------------MVLM........----------------------------------...
Q24690_DROTE/495-742-------------------------------IIAKRLWWLVT.----------------------------------...
Q26816_9TRYP/545-793-------------------------------IIAARLRDTV..----------------------------------...
Q46666_ECOLX/34-241-------------------------------AFVQ.LYNF...----------------------------------...
Q83013_9RETR/68-238-------------------------------LIKD........----------------------------------...
Q88285_9RETR/848-1015-------------------------------AVSC...P....----------------------------------...
POL_CSVMV/250-413-------------------------------KAKV........----------------------------------...
Q93137_BOMMO/515-771-------------------------------LLYKRLRDFVS.----------------------------------...
Q93139_BOMMO/469-719-------------------------------MLVARLKYHL..----------------------------------...
Q94885_DROME/759-920-------------------------------MTMK........----------------------------------...
YG31B_YEAST/639-797-------------------------------ATIS........----------------------------------...
Q9YGS2_TAKRU/573-830-------------------------------VVVTQLLEHLQ.----------------------------------...
Q9YW31_MSEPV/161-406-------------------------------ILNNRLKPIM..----------------------------------...
Q9ZNW4_SORBI/922-1081-------------------------------ACVK........----------------------------------...
Q9ZQ67_ARATH/542-701-------------------------------ACPK........----------------------------------...
Q9ZQQ6_ARATH/659-918-------------------------------IIANRLKVMLPT----------------------------------..F
Q9ZS84_SOLLC/655-815-------------------------------ATIK........----------------------------------...
Q9ZVK4_ARATH/510-669-------------------------------VTVK........----------------------------------...

PF05919

Q6EH16_9VIRU/1-501-------------------------------LATV--YDQAGK----------------------------------ARI
Q5TMB5_9VIRU/174-658-------------------------------LVCI--PAPEGK----------------------------------SRI
Q18L80_9VIRU/166-639-------------------------------LAAK--EEP.GK----------------------------------VRI
Q9WJ23_9VIRU/164-642-------------------------------ISIV--KDPELK----------------------------------MRV
RDRP_CPMV1/246-745-------------------------------LSVV--YDQAGK----------------------------------ARI
Q9ZXZ7_THACU/214-754-------------------------------FALK--EEAAGK----------------------------------IRL
Q9WJ22_9VIRU/155-622-------------------------------LSIV--HDPELK----------------------------------ERV
Q6EH19_9VIRU/208-686-------------------------------IAIK--DDREGK----------------------------------SRP
Q9WJ24_9VIRU/163-645-------------------------------LSIV--HDPECK----------------------------------ERV
Q6GYC2_9VIRU/156-638-------------------------------LSLI--YDPECK----------------------------------VRI
Q18L78_9VIRU/174-654-------------------------------LSTK--EEAAGK----------------------------------VRV
Q18L79_9VIRU/168-671-------------------------------LAFK--EEP.GK----------------------------------VRV
Q3S3F3_9VIRU/120-606-------------------------------LGIV--KDPEGK----------------------------------RRI
O92614_9VIRU/173-711-------------------------------LAIK--EEAAGK----------------------------------ARV

PF07727

Q7G640_ORYSJ/781-1029-------------------------------KWIFKRKEGLSP----------------------------------SGP
Q7XLN3_ORYSJ/465-703-------------------------------KWVFVRKRNENN----------------------------------.EV
Q7XTU6_ORYSJ/940-1185-------------------------------KWVYKLKKDPSG----------------------------------.AI
Q7XKS1_ORYSJ/160-403-------------------------------KWIYKIKTRSDG----------------------------------.TL
Q9FWI2_ORYSJ/795-1030-------------------------------KWVYKTKLNPDG----------------------------------.SV
Q94I36_ORYSJ/864-1109-------------------------------KWVFKNKQNEDG----------------------------------.LI
Q7G6C9_ORYSJ/1047-1286-------------------------------KWIFRNKQDEYG----------------------------------.VV
Q94LQ7_ORYSJ/550-793-------------------------------KWVYKVKRKADG----------------------------------.SL
Q7XKG6_ORYSJ/514-759-------------------------------KWVNAVKQDPFG----------------------------------.KV
Q7X5X4_ORYSJ/138-383-------------------------------KWVFKVKCDEHG----------------------------------.EI
Q84M55_ORYSJ/910-1155-------------------------------KWVFTVKQTPEG----------------------------------.KV
Q7Y173_ORYSJ/398-645-------------------------------KWVYKTKLDSKG----------------------------------.KI
Q8W5F4_ORYSJ/472-717-------------------------------KWVFKKKLRPDG----------------------------------.TI
Q7XUD9_ORYSJ/916-1161-------------------------------KWVFKLKKDAEG----------------------------------.RV
Q8LNW7_ORYSJ/880-1128-------------------------------KWIFKRKEGMSP----------------------------------SDE
Q94HQ0_ORYSJ/485-718-------------------------------KWVFKLKRDEAG----------------------------------.AI
Q7Y1I1_ORYSJ/727-972-------------------------------KWVFKVKKDARG----------------------------------.EV
Q94GR9_ORYSJ/975-1220-------------------------------KWIFRNKQDENG----------------------------------.LV
Q7X7N0_ORYSJ/758-1003-------------------------------KWIFKHKFHSDG----------------------------------.SL
Q7XZY2_ORYSJ/297-542-------------------------------KWVFKVKRDASG----------------------------------.KI
Q7XN62_ORYSJ/915-1162-------------------------------KWVYKTKYDSRG----------------------------------.NI
Q7XLI2_ORYSJ/53-298-------------------------------KWIFRYKFQSDG----------------------------------.SL
B5RTA2_DEBHA/1170-1414-------------------------------TWVHTHKINDL.----------------------------------.KE
B5RTR8_DEBHA/1021-1254-------------------------------RWVFTKKD....----------------------------------..D
E7KRB3_YEASL/146-383-------------------------------RWVFTIK.....----------------------------------.DS
Q2R072_ORYSJ/915-1159-------------------------------KWVYKLKKDAQG----------------------------------.VV
Q59K02_CANAL/999-1236-------------------------------KWVYTIK.....----------------------------------.DT
Q5AG24_CANAL/888-1133-------------------------------MWVHTYKTNDL.----------------------------------.KN
Q5AH82_CANAL/122-366-------------------------------GWVHTEKIDSLK----------------------------------.G.
Q7XN23_ORYSJ/31-274-------------------------------KWVYKIKRKADG----------------------------------.TL
Q8S476_MAIZE/836-1081-------------------------------KWIFKKKLRPDG----------------------------------.TI
Q8S479_MAIZE/1073-1313-------------------------------KWVFRNKQDEHG----------------------------------.VV

PF00978

R1AB_LIYV9/1925-2366-------------------------------GETKPKMDLSTY-------------------D..SYNAPANIVYYQQIV
R1AB_BYVU/2601-3046-------------------------------RDAKVKLDSSCL-------------------V..KHPPAQNIMFHRKAV
Q9YPH5_9VIRU/1359-1796-------------------------------RDVKPKLDLSPQ-------------------S..EYGALQTVVYPDKIV
POLN_EEVVM/2041-2488-------------------------------RDVK..VTPGTK-------------------HTEERPKVQVIQAADPLA
E0YCR0_9CLOS/53-491-------------------------------ADVKPKLDNTPL-------------------S..KYVTGQNIVYHDRCV
RDRP_TOMS1/1168-1609-------------------------------AQPKQKLDLSIQ-------------------T..EYPALQTIVYHSKKI
RDRP_PSVJ/295-726-------------------------------SDVKPVVADTLN-------------------V..DRPVPATITFHAKGI
Q66107_9BROM/228-662-------------------------------TIVKPVEDNSLK-------------------F..ERPLCATITYHKKGI
Q87644_SINDV/2053-2501-------------------------------RDVK..VTPGTK-------------------HTEERPKVQVIQAAEPLA
O56790_9VIRU/1323-1760-------------------------------NDVKPKLDLSPQ-------------------S..EYSALQTVVYPDKIV
RDRP_CMVFN/308-738-------------------------------SDVKPVVSDTLN-------------------I..DRPVPATITYHKKSI
Q9WJD8_PEBV/1299-1738-------------------------------SDVKPKMDSTPQ-------------------H..EYSALQTVIYHEKLI
Q80875_BSMV/195-630-------------------------------NDVKPKLDLTPQ-------------------V..EYAALQTVVYPDKIV
RDRP_RBDVR/1234-1674-------------------------------RDVKFNLTDGAQ-------------------S..EYTKAATITYHQPEI
RDRP_SBWMN/1373-1810-------------------------------GDEKPKMDRSPQ-------------------H..EYGALQTVVFPDKIV
POLN_ONNVI/2053-2501-------------------------------RDVK..VTPGTK-------------------HTEERPKVQVIQAAEPLA
RDRP_TAV/313-742-------------------------------SDVKPSVTDTLN-------------------I..DRPLPATITFHRKQL
POLN_MIDDV/534-981-------------------------------RDVK..VTPGTK-------------------HTEERPKVQVIQAAEPLA
RDRP_TMGMV/1163-1604-------------------------------AQPKQKLDLSIQ-------------------N..EYPALQTIVYHSKQI
RDRP_TOBSV/253-689-------------------------------TTLKPVEEDNLH-------------------I..ERPIPATITYHKKGV
RDRP_OLV2I/310-732-------------------------------SAGKFSLDLNFP-------------------...VRSVPQTITYHEKWV
RDRP_YOMV/1155-1594-------------------------------SQPKQKLDLSIQ-------------------D..EYPALQTIVYHSKKI
RDRP_AMVLE/318-752-------------------------------SVLKPVEDNSLH-------------------L..ERPMPATITYHDKDI
POLN_RRVN/2019-2467-------------------------------RDVK..VTPGTK-------------------HTEERPKVQVIQAAEPLA
RDRP_ASPVP/1758-2169-------------------------------SQLCTKFDNRFR-------------------...SAKAGQTLACFQHSV
O56250_9VIRU/1240-1678-------------------------------SDVKPKTDLTPQ-------------------F..EYSALQTVVYHEKLI
O90699_9VIRU/1363-1800-------------------------------NDVKPKLDLSPQ-------------------S..EYAALQTVVLPDKIV
Q9Q6Q3_9CLOS/62-509-------------------------------ADAKPKLDSTPL-------------------Q..QYVTGQNIVYHDRAI
POLN_AURAV/2038-2486-------------------------------RDVK..VTPGTK-------------------HTEERPKVQVIQAAEPLA
RDRP_BBMV/271-697-------------------------------SDVKPTVTDTLH-------------------V..ERDVPATITFHGKGV
RDRP_CCMV/267-697-------------------------------SDIKPVVSDTLH-------------------L..ERAVAATITFHGKGV
Q66581_EEEV/144-598-------------------------------RDVK..VTPGTK-------------------HTEERPKVQVIQAADPLA
Q9QGG9_9BROM/363-797-------------------------------TQLKPVEDCSQI-------------------F..ERPLASPITYHDKGK
RDRP_TMOB/1167-1614-------------------------------SQPKQKLDLSIQ-------------------S..EYPSLQTIVYHSKKI
RDRP_BMV/256-688-------------------------------SDVKPVVTDTLH-------------------L..ERAVAATITFHSKGV
O40960_9CLOS/62-506-------------------------------GDMKPKLDMSGV-------------------S..EYSPASNIIYYQTMI

PF00998

RDRP_TNVA/224-703-------------------------------LNLSKKPDPAPR-------------------.------..VIQPRSPRY
RDRP_TCV/272-752-------------------------------INFTAKKDPAPR-------------------.------..VIQPRDPRY
RDRP_TNVD/224-709-------------------------------LNITAKPDPAPR-------------------.------..VIQPRDPRY
RDRP_MCMVK/460-941-------------------------------INLTKKADPVPR-------------------.------..VIQPRAPRY
POLG_HCVEU/2430-2941-------------------------------TTIMAKNEVFCV-------------------D------PSKGGRKPARL
POLG_HCVED/2420-2931-------------------------------TTIMAKNEVFAV-------------------N------PAKGGRKPARL
POLG_HCVJL/2434-2945-------------------------------TTIMAKNEVFCV-------------------D------VSKGGRKPARL
POLG_HCVJK/2431-2942-------------------------------TTIMAKNEVFAV-------------------A------PHKGGRKPARL
POLG_HCVEV/2426-2937-------------------------------TTIMAKNEVFAV-------------------E------PSKGGKKPARL
POLG_HCVJ6/2445-2956-------------------------------TTIMAKNEVFCV-------------------D------PTKGGKKAARL
Q9IR83_9TOMB/236-712-------------------------------INFSAKPDPAPR-------------------.------..VIQPRDPRY
Q87031_9LUTE/24-502-------------------------------.HLMSK.KIAPR-------------------.------..LICPRNKRY
RDRP_POLVP/251-722-------------------------------INITLKPDPAPR-------------------.------..VIQPRDPRY
Q65987_9TOMB/269-750-------------------------------INFTAKKDPAPR-------------------.------..VIQPRDPRY
P90338_9TOMB/1-480-------------------------------FCVDLKPDPAPR-------------------.------..VIQPRSPRY
RDRP_BYDV1/361-840-------------------------------.HWMTK.DIAPR-------------------.------..LICPRSKRY
O09796_9HEPC/2422-2933-------------------------------TTIMAKSEVFCV-------------------Q------PEKGGRKPARL
O09803_9FLAV/2373-2866-------------------------------FTLTVKKEVFFK-------------------.------.DRKEEKAPRL
O37361_9VIRU/252-737-------------------------------.DKLVDESCDPR-------------------.------..IIQPRTPRF
Q9WJD9_CARMV/267-744-------------------------------FNVNLKSDPAPR-------------------.------..VIQPRSPRY
Q83103_9TOMB/228-711-------------------------------INITAKPDPAPR-------------------.------..VIQPRDPRY
Q66127_9TOMB/52-520-------------------------------INFSAKPDPAPR-------------------.------..VIQPRDPRF
RDRP_PMVK/447-937-------------------------------LNLTLKTDPCPR-------------------.------..VIQPRHPRY
POLG_GBVB/2277-2785-------------------------------TVIVPKEEVFVK-------------------T------PQKPTKKPPRL
Q89801_9TOMB/1-479-------------------------------IPIYRKPDPAPR-------------------.------..VIQPRNPRY
Q9IRA1_9TOMB/266-741-------------------------------INFTSKGDPAPR-------------------.------..VIQPRDPRY
O12301_GAMV/231-708-------------------------------LVLSRKPDPAPR-------------------.------..IIQPRAPRY
Q83424_MNSV/290-772-------------------------------INTTKKPDPAPR-------------------.------..VIQPRNVRY
O41892_PEGIA/2409-2899-------------------------------FTFVTKXEVFFS-------------------.------..KTTRKPPRF
RDRP_OCSVU/235-734-------------------------------TDHTSKADPVPR-------------------.------..VISPRDPKY
Q9IW60_9TOMB/325-800-------------------------------IS.TAKSDPAPR-------------------.------..VIQPRNPRY
Q96898_9FLAV/2396-2886-------------------------------FTFVTKREVFFS-------------------.------..KTTRKPPRF
RDRP_RCNMV/260-745-------------------------------LECDTK.DPVPR-------------------.------..TIQPRSKRY

PF00972

POLG_YEFV1/2758-3406-------------------------------QWKTANEAVQDP-------------------KFWELVDEERKLHQQGRC

PF00680

POLG_HAVHM/1750-2215-------------------------------RDLIWLDENGLLL..................................GV
RDRP_BPPH6/19-638-------------------------------RALEKAEEAGNLMLQGKFDDAYQLHQMGGAYYVVYRAQSTDAITLDPKT
POLG_PYFV1/2270-2778-------------------------------YLFETMESGERR....................................I
POL1_CPMVS/1186-1687-------------------------------RFVQGDDCVVSL....................................I
POLG_RHDVF/1279-1750-------------------------------IDHVKDGVMD.......................................
POLG_PVYN/2293-2763-------------------------------KDYFEHFTDA.......................................
POLG_EMCVR/1844-2288-------------------------------TDVVDWESAT.......................................
POLG_FCVUR/1266-1735-------------------------------KDHMTNGEPD.......................................
POLG_NVN68/1301-1766-------------------------------NDDWNGTTFV.......................................
Q9DLK1_FMDVP/1865-2314-------------------------------GALIDFENGT.......................................
POLG_VESVA/1379-1848-------------------------------KDHVKDGVLD.......................................
POL1_BAYMY/1634-2098-------------------------------RDLCAHLSDD.......................................

PF02123

Q83093_9VIRU/437-816................................LEAHPKPSDLV.......RLGLCDPV....RLFVKNEP.........H
Q66150_9VIRU/22-408...............................PRQHDWSPEELV.......KRGLCDPV....RLFVKQEP.........H
Q86519_9VIRU/516-902...............................PPQHNWTPRELV.......EKGLCDPV....RLFVKNEP.........H
RDRP_SCPMV/464-849................................DIHALSPTEMV.......EMGLCDPV....RLFVKQEP.........H
RDRP_SBMVA/490-847................................DLLDESPVDLV.......RRGLCDPV....RLFVKQEP.........H
RDRP_PEMVW/733-1124...............................QDFID..PVQAV.......KDGLVDPI....RLFVKLEP.........H
RDRP_PLRVW/609-1004...............................ASFEDMSAEELV.......QEGLCDPI....RLFVKGEP.........H
RDRP_TYYVF/580-974...............................VNFEDMGPEELV.......RNGLCDPI....RLFVKGEP.........H
Q65969_9LUTE/603-996...............................VRYVDLSPAELV.......RRGLCDPI....RVFVKGEP.........H
RDRP_ROTGI/108-803...............LIFNCFSSTFHVGHRIDNAQDAITDQVTATYTSNVNREMYDSYYYKLKQMLKEEIVQYVED...H
RDRP_ROTHC/109-749YYEKWFKSPDPLTFPNIALIYSFSFHVGYRKQALSDAVYDQITVTYSDNVNMEMYKEY....SERIENEIFTILKDKIIH
O55590_9REOV/104-749LIRNWIDAPTLSGFKLMAKIYSFSFHVGFRKQKMIDAALDQLSTEYSDDVDDEMYQEY....SMLIRDEVVKMLQESVIH
RDRP_ROTPY/100-748MIQEWLVDCSLEKFTLMSKIYSWSFHVGFRKQKMIDAALDQLKTEYTEDVDNEMYNEY....TMLIRDEIVKMLEVPVKH
Q90153_9VIRU/1025-1530..............................INETVNSVVETAY.......PKAVPQSF....DRFMDNAYEWLVSGSSAG
Q90193_9VIRU/400-785................................HMAELDADPSA.......GELLTDPI......................
RDRP_PCVC/362-832.............................YKKDFITSVEEAYV.RLKIEPKPVNVDGF....IDFYHRRASWLTKGGLVY
RDRP_SCVLB/837-1303........................................ELFIMARAEGKRPMRMKW....QEYWRQRAVIMPGGSV.H
Q87025_SCVLA/177-657..............................LYSCVRDMFEGSK.....QTYKYPFMTW....DDYTANRWEWVPGGSVHS
Q90155_TTV1/96-539..............................LHDLIYRLLSRNY.......NNTKISSF....EHHLEERLLWSRSGSHYY
Q9JE94_9VIRU/129-560..............................LREAINQIYKEEI......TRKEVPDTF....KQHVFTSPLWVKKGAHHH
Q8V615_9VIRU/41-473..............................LIEAINKIYKNEM......TDMPPPGDF....KLHLITSPLWCKAGSHHH
Q83073_9VIRU/49-523..............................LRNAIRRVFDEEL.....PRDKVVLRPK....DDFWSSRWLWAANG...G
RDRP_LRVLG/155-619...............................RAAVRLIYSEEL......RRPVTYPLI....CDFWSSRWLWAANG...S
Q98XW8_9VIRU/144-622..............................LRQCVRDVLRREL......RTRVVLPPS....DDFFRRRYAWCVGGAHNL
Q99AT3_9VIRU/99-573..............................LGAAIDAILDEEI.KRVEGSQHIEFDSY....QEHWNDRWAWAVNGA..H
Q9YXE4_9VIRU/99-573..............................LRSHIRTVLEREI.QRVGDSHAIEYPTL....QEHWDSRWLWAVNG...S
RDRP_HV19S/122-585..............................LGACIDFILDTEL.....GGDTIELPDE....DEWWTSRWLWCVNG....
Q9YXE6_9VIRU/120-589..............................LRSHIRAVLAMEL.....AGRDLSLPDL....DSWWSSRWLWCVNGS..Q

PF04197

RDRP_IBDVU/1-875----FLRELSALLKQGAGTKGSNKKKLLSMLSDYWYLSCGLLFPKAERYDKSTCCTKTRNKWSAQSSTHLMISMITWPVM
RDRP_IPNVJ/1-842----FIRDLGR.....AATSADPEAGVKKTITDFWYLSCGLLFPKGERYTQVDWDKKTRNIWSAPYPTHLLLSMVSTPVM
RDRP_BSNV/1-863----FLREVSECVKEGA..MASDNQKLQKLLQDYWYLSCGLLFPKAERYEKKAWLTKTRNIWSAPFPTHLLLSTISWPIM

PF00078

A0A066NJ57_LELAM/135-366.ENDFMGFSYGFRPGRSQHDA------L....DALATG..LVRTNVNW--------------------------------
A0A0F6CD22_ECOLX/115-332.EVTADQRSFGFRTGRSTADA------I....AQCFCVLAQKTSA.EW--------------------------------
D7ZFU1_ECOLX/62-269.LVVFPSFLFGSVPSKNDVLN------SNV.KRDYVSCAKAHCGA.KT--------------------------------
A0A0E0UMT2_SINMB/72-291.DSLFLPDSYGYRPGKSALDA------VG...VTRQRC....WKY.DW--------------------------------
Q47526_ECOLX/33-239..THIHDAATAYVDGKNILD.------.........NA.KIHQSS.VY--------------------------------
O01419_BOMMO/502-756VGPNLADSQYGFRRGRSTLDA------VQR.VRDLSDQACSRGGV.LL--------------------------------
O18558_AEDAE/472-725ANMPLHVNQHAYQSGKSTVTL------LHK.VVYDIEKAFAQKQS.CL--------------------------------
O42691_ALTAL/36-202....DEYPIPLSRTL......------...........MNDLAGA.DW--------------------------------
O44316_DROMR/394-650..VSWDPRQRGFLPTDGCADN------ATIVDLVLRDH..HKRYASCY--------------------------------
O52231_STREE/68-275.EPHFSDTSYGFRPNRSCEKA------I....MKLLEY..LNDGY.EW--------------------------------
O62658_CANFA/517-773.KKIIHHDQVGFIPGTQGWFN------TRKTINVIHHISKRKTKN.HM--------------------------------
O64612_ARATH/788-1031.PEFIAPNQSAFISDRLLMEN------LLL.ASELVKDYHKDGLSPRC--------------------------------
O65244_ARATH/405-664.PKFIVGNQSAFVKDRLLIEN------VLLATEIVKDYHKDSVSS.RC--------------------------------
O65598_ARATH/489-747.SCVISPSQSAFLPGRLLAEN------VLLATEMVHGYNWRNISL.RG--------------------------------
O81284_ARATH/58-317.DQAVQSNQVGFIKGRLLCEN------VLLASELVDNFQAEGDTS.RG--------------------------------
O81454_ARATH/144-304....YRHPIPRLYDM......------...........LDELSGA.II--------------------------------
O93520_ORYLA/518-771.PMLMHKDQTGFIKQRQTQDS------IRK.VLNIIHQVVQQKQE.TL--------------------------------
O96546_LYMDI/526-780ANNLVPDAQFGFRAKHSCVQQ------VHR.LVEYTSSQFIMNRY.TG--------------------------------
O99969_PORPU/100-315.EAIFEPNSYGFRPGRSANDA------R....KAIVKC..LQRKP.KH--------------------------------
POL_RSVP/769-938....FGAVQQGAPVLSAL...------...............PRG.WP--------------------------------
POL_HTL1A/633-804....LSSSSPGPPDLSSL...------...............PTTLAH--------------------------------
POL_SMRVH/71-240....MGALQPGLPSPVAI...------...............PLN.YH--------------------------------
POL_MMTVB/68-237....MGALQPGLPSPVAV...------...............PKG.WE--------------------------------
POL_CAMVC/289-452....DAYNLPNKDEL......------...........LTLIRGK.KI--------------------------------
POL_IPHA/60-229....FGPVQRGLPLLSAL...------...............PQD.WK--------------------------------
POL_HV1MA/655-826....FWEVQLGIPHPAGL...------...............KKK.KS--------------------------------
TF21_SCHPO/455-615....NIYPLPLIEQL......------...........LAKIQGS.TI--------------------------------
POK10_HUMAN/76-245....MGPLQPGLPSPAMI...------...............PKD.WP--------------------------------
POL4_DROME/357-523....DKFPLPRIDDI......------...........LDQLGRA.KY--------------------------------
POLY_DROME/224-390....DRYPMPSIPMI......------...........LANLGKA.KF--------------------------------
POL_EIAV9/249-419....GTEISRGLPHPGGL...------...............IKC.KH--------------------------------
YTX2_XENLA/513-765.AEVIHPDQSYTVPGRTIFDN------VFL.IRDLLHFARRTGLS.LA--------------------------------
POL_SOCMV/246-411....DSYKLPRKDFI......------...........LEKIKGS.LW--------------------------------
Y2R2_DROME/498-741.LPEGCRWQFGFRQGRCVEDA------WRH.VKSSVGA..SAAQY.VL--------------------------------
POL_BIV29/638-806....GQEFSTGLPYPPGI...------...............KEC.EH--------------------------------
RDPO_ACUOB/124-343.EEVADLSSYGFRPMRNVSWA------VG...RVLNGLNNPLANY.QY--------------------------------
POL2_DROME/249-414....DRYPIPNMDEI......------...........LGKLGKC.QY--------------------------------
RT67_ECOLX/48-262IRKISNNYSFGFERGKSIIL.------........NAY..KHRGK.QI--------------------------------
RTJK_DROME/502-757VTKAIPKFQFGFRLQHGTPEQ------LHRVVNFALEA.MENKEY.AV--------------------------------
POL_BLVAU/41-212....IPALSPGPPDLTAI...------...............PTHLPH--------------------------------
POL_RTBVP/1228-1390....DPFNIPHKISM......------...........INLIQKA.NI--------------------------------
POL_CAEVC/210-380....LTEAQLGLPHPGGL...------...............QKK.KH--------------------------------
P91581_CIOIN/483-644....DAYPLPSIESI......------...........VNKVTQD.KV--------------------------------
P95451_PSEAC/119-326.DPLFSDYSYGFRPGRSTHQA------I....EMARAH..VTAGH.RW--------------------------------
Q01379_NEUCS/505-761EFNLLPEGQMGNRAGRSTEFA------VRV.VTDAVHTAWKLGAV.TS--------------------------------
Q03261_SIV/246-416....FFEVQLGIPHPGGL...------................KR.QK--------------------------------
Q04135_DROME/496-743INNTLPTHQFGFREKHGTIEQ------VNR.ITSEIRTAFEHREY.CT--------------------------------
Q07995_CHITU/509-760DNNIIPNQQCGFRTGRSTSHQ------LIK.VIKSAKENLNNKKS.TG--------------------------------
Q08724_9CYAN/108-336.EAKFEPNSYGFRPGRNAHDA------REAIFNSIRYS......N.KW--------------------------------
YRD6_CAEEL/484-644....EFHPLPTSEDIFSR...------...............LKG.TV--------------------------------
Q17329_CAEEL/1071-1231....NAHPLPNIEAT......------...........LQSLAGK.KL--------------------------------
Q24262_DROME/531-692....DCFPVPIMEEV......------...........LEKLQSA.KW--------------------------------
Q24690_DROTE/495-742HSNLLSENQFGFKKGKSTSDC------LLYVDYLITKS....KMH.TS--------------------------------
Q26816_9TRYP/545-793.ESQLTPQQSAFRPGCSTLEQ------LL...HVRAALCRPTHQS.RT--------------------------------
Q46666_ECOLX/34-241...PVHDASMAYMKGKGIRD.------........NAA..AHAGN.QY--------------------------------
Q83013_9RETR/68-238....WGALQPGTPWPGAI...------...............PSE.WP--------------------------------
Q88285_9RETR/848-1015....YPTVASTPELF......------...........AKLEKKY.QV--------------------------------
POL_CSVMV/250-413....VKYPIPNKDTL......------...........IHRSIQA.RY--------------------------------
Q93137_BOMMO/515-771SKGILIDEQFGFRTNHSCVQQ------VHRLTEHILVGLNRPKPLYTG--------------------------------
Q93139_BOMMO/469-719.LPRMSTRQFGFMPQRSTEDS------LYT.LMQHVKEKLKEKRI.IT--------------------------------
Q94885_DROME/759-920....DNYPLPLIDDL......------...........LDRMNEK.TV--------------------------------
YG31B_YEAST/639-797....DPFPLPRIDNL......------...........LSRIGNA.QI--------------------------------
Q9YGS2_TAKRU/573-830RNSLFEMFQSGFRAHHSTETA------LLK.VTNDLLIASDHGLV.SM--------------------------------
Q9YW31_MSEPV/161-406.ENLISEEQSGFRKNRSIKDN------I....YILHEIIRNRKKE.TY--------------------------------
Q9ZNW4_SORBI/922-1081....DSFPLPRIDTS......------...........VDKAAGC.QR--------------------------------
Q9ZQ67_ARATH/542-701....DSFPLPHIDRM......------...........VEATTGN.EL--------------------------------
Q9ZQQ6_ARATH/659-918ILQNQSAFVRERLLMENVLLA------TELVKDYHKDS....ISP.RC--------------------------------
Q9ZS84_SOLLC/655-815....NKYSVPLVQDL......------...........MDRLSKA.CW--------------------------------
Q9ZVK4_ARATH/510-669....NKYPLPRIDEL......------...........LDQLRGA.TC--------------------------------

PF05919

Q6EH16_9VIRU/1-501VASTNSWIQCSLFGLHNKIFS------ILRSIPQ.DGTFDQNKPF-DLLLESLQPGY.M..-------------------
Q5TMB5_9VIRU/174-658IGEMNFWAQCALKPLHDKEMK------ALRSIRQ.DLTFYQGIGP-QVLKLHPGSK.....-------------------
Q18L80_9VIRU/166-639FAMVDAVTQWLLKPLHEAIFK------LLNIFAF.DGTFDQIGQL-EKFMDRMKDKAPY..-------------------
Q9WJ23_9VIRU/164-642IAMVDYHSQFVLKKIHNSLFN------KLKLIKS.DRTFTQDPIF-TTPTMGHR.......-------------------
RDRP_CPMV1/246-745VAITNSWIQTAFYSLHLHVFK------LLKNIDQ.DGTFDQERPF-KLLIKWLNEPTQK..-------------------
Q9ZXZ7_THACU/214-754FALMDSITQSVMSPLHDYMFA------ILRNIPN.DGTFDQEASI-ARSQEKAVTAG.K..-------------------
Q9WJ22_9VIRU/155-622IAMVDYTTQFALRPIHNILLN------NLSKLPC.DRTFTQDPFH-KW.NDDHKER.....-------------------
Q6EH19_9VIRU/208-686FAIFDYWSQTVLSPLHDWAYA------TLRSIPQ.DCTFNQAEGL-SKVTARPSQKY....-------------------
Q9WJ24_9VIRU/163-645IAIFDYGSQMVLKPIADVLFD------LLRNIPS.DRTFTQSPFF-THTDLDNKSK.....-------------------
Q6GYC2_9VIRU/156-638VAMLDYTTQLFLRPIHNDLFK------LLKKLPQ.DRTFTQNPLN-DWENNEHS.......-------------------
Q18L78_9VIRU/174-654FAMVDIWTQSILNPLHKKIFS------IIRELPT.DGTFDQLKPL-DRLHELSTQD.....-------------------
Q18L79_9VIRU/168-671FAMADCITQWVLHPLHQYLFS------ILKQISIVDATFDQEEGV-KTLSAKIKAGKRV..-------------------
Q3S3F3_9VIRU/120-606IAMVDYHSQLVLRSIHDGLLN------KLRNLPQ.DRTYNQDPNN-AWEENKEC.......-------------------
O92614_9VIRU/173-711FAMADSITQSVMAPLNSWVFS------KLKDLPM.DGTFNQQAPL-NRLVQLYQDGLLHDV-------------------

PF07727

Q7G640_ORYSJ/781-1029PRFNARLVAKGFSQIAGVDYN..DVFSPVVKHSSIRTFFCIVAMHDLE--------------------------------
Q7XLN3_ORYSJ/465-703VRYKARLVAQGFTQKSGDDFN..ETYSPVMSGITFRYLISLAVQNRIV--------------------------------
Q7XTU6_ORYSJ/940-1185VKHKARLVAKGYVQQQGVDFD..EVFAPVARMETVRLLVALAAQKGWE--------------------------------
Q7XKS1_ORYSJ/160-403ERYKARLVACGFQQEHGRDYD..ETFAPVAHMTTVRTLLAIASARHWN--------------------------------
Q9FWI2_ORYSJ/795-1030QKYKARLVAKGFKQKPGIDYY..ETYAPVARLETIRTIIALAAQKRWK--------------------------------
Q94I36_ORYSJ/864-1109VRNKARLVAQGFTQVEGLYFD..ETFAPVARIEAIRLLLAFAASKGFK--------------------------------
Q7G6C9_ORYSJ/1047-1286VRNKARLVAQGFTQVEGLDFG..ETFAPVARFESIRILLAYAAHHDFR--------------------------------
Q94LQ7_ORYSJ/550-793DRYKARLVAKGFKQRYGIDYE..DTFRPVVKAATIRTILSIAISRGWT--------------------------------
Q7XKG6_ORYSJ/514-759ERYKARLVAKGYSQTYGIDYD..ETFAPVAKMSTVRTLISCAANFDWP--------------------------------
Q7X5X4_ORYSJ/138-383VRHKARLITKGYVQRQGIDFE..EVFSPIVRIESVRLLLAVTACEGWE--------------------------------
Q84M55_ORYSJ/910-1155DRYKARLVAKGYSQTYGIDYD..ETFAPVAKMGTVRALVSCAVNFGWP--------------------------------
Q7Y173_ORYSJ/398-645ERFKARLVAKGFSQREGIDYN..ETFSPVSKKDSFRIVMALVAHYDLE--------------------------------
Q8W5F4_ORYSJ/472-717KKYKARLVAKGYTQKEGEDFF..DTYSPIAGLTTIRVLLSLAASHGLL--------------------------------
Q7XUD9_ORYSJ/916-1161AKHKARLIAKGYVQQPGIDFE..EVFTPVARLESVRLLLAQAAQAGWT--------------------------------
Q8LNW7_ORYSJ/880-1128ARYKARLVAKGYSQIPGIDFN..DVFSPIMKHSSIRTLLGIVAMHDYE--------------------------------
Q94HQ0_ORYSJ/485-718VKHKARLVARGFVQQEGIDYD..DAFAPVARMESVRLLLALAAQEGRG--------------------------------
Q7Y1I1_ORYSJ/727-972TKFKARLVAKGYVQQPGVDFN..EVFAPMARLESVRMLLALAAQAGWF--------------------------------
Q94GR9_ORYSJ/975-1220VRNKTRLVAQGFTQVEGLDFG..EIFAPMARLEAIRILFAFASCFDIK--------------------------------
Q7X7N0_ORYSJ/758-1003ARHKARWVVHGYSQQHGIDYD..ETFSPVVKPSTIRVVLSIATSRSWP--------------------------------
Q7XZY2_ORYSJ/297-542LKHKARLVAKGYVQQHGVDYD..EVFAPVARMETVRLLVAMAAQEGWE--------------------------------
Q7XN62_ORYSJ/915-1162EKFKARLVAKGFTQREGIDYN..ETFSPVSCKDSFRIIMALVAHYDLE--------------------------------
Q7XLI2_ORYSJ/53-298DRYKARWVLRGFTQRPGIDFD..EIFSPVIKPATVRTVLSLAVSRDWP--------------------------------
B5RTA2_DEBHA/1170-1414VQYKSRCVVQGFRQIANEHYDTSKVSSPVIELSIIRLLTAIAVEYEWP--------------------------------
B5RTR8_DEBHA/1021-1254GRYKARLVAQGFSQVPGEDYL..DTFSPVIRYESVKLLLAFSAVDNRV--------------------------------
E7KRB3_YEASL/146-383GKYKARLVAQGHTQKAGIDYQ..ETFAPVIRYDSVRLFLALASCLKLI--------------------------------
Q2R072_ORYSJ/915-1159VKHKARLVAKGYVQRAGIDFD..EVFAPVARLDSVRLLLALAAQEGWM--------------------------------
Q59K02_CANAL/999-1236GRYKARLVALGYRQQAGVDFL..ETYAPVIRGESIKLIFALASKSKLK--------------------------------
Q5AG24_CANAL/888-1133HNYKSRCVVMGNYMVENRDFDPHAISSPVVDLTSIRLLSAIAVENNLV--------------------------------
Q5AH82_CANAL/122-366VVRKSRCVVHGNRQKEKLDYDPFSVSSPVIDLVTIRLLTIIGCELGMT--------------------------------
Q7XN23_ORYSJ/31-274DRYKARLVAKGFKQRYGIDYE..DTFSSVVKAATIRIILSIAISRGWS--------------------------------
Q8S476_MAIZE/836-1081ERYKARLVAKGYTQKEGEDFF..DTYSPVARLTTIRTLIAVAASYGLI--------------------------------
Q8S479_MAIZE/1073-1313TRNKARLVAKGCAQVAGLDFE..ETFAPVARLESIRILLAYVAHHSFR--------------------------------

PF00978

R1AB_LIYV9/1925-2366NLYFSPIFLECFARLTYC------LSD.KIVLYSGMNTDVLAE.LIESKLPLGLN..AYHT......LEI----------
R1AB_BYVU/2601-3046NAIFSPCFDEFKNRVITC------TNS.NIVFFTEM....TNSTLASIAKEMLGSEHVYNV......GEI----------
Q9YPH5_9VIRU/1359-1796NALFGPVIKEINERIIHA------LKP.HVIYNTRM....TAA.EMDRSLEFLNVYEDYDS......VEI----------
POLN_EEVVM/2041-2488TAYLCGIHRELVRRLNAV------LLP.NIHTLFDMSAEDFDA.IIAEHFQPGD.....WV......LET----------
E0YCR0_9CLOS/53-491TALFSCIFTACVERLKYV------VDE.RWLFYHGM...DTAE.LAAALRNNLGDIRQYYT......YEL----------
RDRP_TOMS1/1168-1609NAIFGPLFSELTRQLLDS------IDSSRFLFFTRK....TPA.QIEDFFGDLDSHVPMDV......LEL----------
RDRP_PSVJ/295-726TSQFSPLFISLFERFQRC------LRG.RVVVPVGK....ISS.LEMDNFSVLN....KHC......LEI----------
Q66107_9BROM/228-662VMQSSPLFLSAMSRLFYV------LKS.KIHIPSGK....WHQ.LFTLDAAAFDA..AKWF......KEV----------
Q87644_SINDV/2053-2501TAYLCGIHRELVRRLTAV------LLP.NIHTLFDMSAEDFDA.IIAEHFKQGDP.....V......LET----------
O56790_9VIRU/1323-1760NAIFGPVMKEINERILLA------LRP.HVVYNTRM....TAE.ELDRSVEFLDVREQYDA......VEI----------
RDRP_CMVFN/308-738TSQFSPLFTALFERFQRC------LRE.RIILPVGK....ISS.LEMAGFDVKN....KHC......LEI----------
Q9WJD8_PEBV/1299-1738NSLFGPIFKEINERRLDA------IHP.HFVFNTRM....TAS.DLNDRVRCLHPDADYDF......IEV----------
Q80875_BSMV/195-630NAFFGPIIKEINERIIRA------LRP.HVVFNSRM....TAD.ELNETVAFLTP.HKYRA......LEI----------
RDRP_RBDVR/1234-1674TQVATAIFGQFKTRLLAC------RNK.FLNIPLEH....DND.LSGYLTKYHLGSENNTF......TEI----------
RDRP_SBWMN/1373-1810NALFGPAMKEINERIRLA------LKP.HVVYNSRM....NAE.ELNRTVEFLDPEEDFNA......FEI----------
POLN_ONNVI/2053-2501TAYLCGIHRELVRRLNAV------LLP.NVHTLFDMSAEDFDA.IIATHFKPGDA.....V......LET----------
RDRP_TAV/313-742TSQFSPLFTALFQRFQRC------LTK.RVILPVGK....ISS.LEIKDFSVLN....KFC......LEI----------
POLN_MIDDV/534-981TAYLCGIHRELVRRLNAV------LLP.NVHTLFDMSAEDFDA.IISEHFRPGDA.....V......LET----------
RDRP_TMGMV/1163-1604NGILAG.FSELTRLLLEA------FDSKKFLFFTRK....TPE.QIQEFFSDLDSHVPMDV......LEL----------
RDRP_TOBSV/253-689VMMTSPYFLCAMVRLLYV------LKS.KFVVPTGK....YHQ.IFQMNPELLKH..SKEF......KEI----------
RDRP_OLV2I/310-732TEVFSPMFLQVMARFFSR------LQD.WVVVPAGP.....MA.DFSRVWPSFEG...KCL......TEI----------
RDRP_YOMV/1155-1594NAIFGPMFSELTRMLLET------IDTSKFLFYTRK....TPT.QIEEFFSDLDSSQAMEI......LEL----------
RDRP_AMVLE/318-752VMSSSPIFLAAAARLMLI------LRD.KITIPSGK....FHQ.LFSIDAEAFDA..SFHF......KEI----------
POLN_RRVN/2019-2467TAYLCGIHRELVRRLKAV------LAP........N....IHT.LFDMSAEDFDAIIAAHFQPGDAVLET----------
RDRP_ASPVP/1758-2169LCRFAPYMRYIESKVTEV------LPK.NLYIHSGK....NID.DLAAWVTTSKF..NGVC......TES----------
O56250_9VIRU/1240-1678NSLFGPIFKEINERKLDA------MQP.HFVFNTRM....SSS.DLNDRVKFLNTEAAYDF......VEI----------
O90699_9VIRU/1363-1800NALFGPIMKKINERIRFA------LKP.HVIYNTRM....TAS.ELDAAVEFLDVREEFES......VEI----------
Q9Q6Q3_9CLOS/62-509TAMFSHIFTQAVERLKYV------LHS.KVMAYHGMSTDDFSR.EVCERLRDISG...YYV......YEL----------
POLN_AURAV/2038-2486TAYLCGIHRELVRRLTAV------LLP.NIHTLFDMSAEDFDA.IIAANFSYVHP.....V......LET----------
RDRP_BBMV/271-697TSCFSPFFTACFEKFSLA------LRE.SIYVPIGK....ISS.LELKSKALNN....KFF......LEA----------
RDRP_CCMV/267-697TSCFSPYFTACFEKFSKA------LKS.RFVVPIGK....ISS.LELKNVPLSN....KWF......LEA----------
Q66581_EEEV/144-598TAYLCGIHRELVRRLNAV------LLP.NIHTLFDMSAEDFDA.IIAEHFQFGDA.....V......LET----------
Q9QGG9_9BROM/363-797VMSTSPILVMMCNRLLLC------LTE.KISIPTGN....ISL.FSLDPFASEMT...KEF......KEI----------
RDRP_TMOB/1167-1614NALFGPIFSELTRQMLSA------IDTSRYLFFTRK....TPE.QIEEFFSDLDAHQPMEV......LEL----------
RDRP_BMV/256-688TSNFSPFFTACFEKLSLA------LKS.RFIVPIGK....ISS.LELKNVRLNN....RYF......LEA----------
O40960_9CLOS/62-506NMFFSPIFLEIFGRIKYC------LGD.KVILFSGMNLDEMGD.LLESRLCYPLN..SYNF......VEV----------

PF00998

RDRP_TNVA/224-703NVCLGRYLRHYEHHAFKT......IAK-CFGEITVFKGFTLEQ-QGEIMRSKWNKYVNPVA------VGL----------
RDRP_TCV/272-752NIEVGKYLKPYEHHLYRA......IDA-MWGGPTVLKGYDVGE-LGNIMSNTWDKFRKTCA------IGF----------
RDRP_TNVD/224-709NVEVGRFLRHSEEMLFKA......INK-TFGGRTIFKGLSSDQ-AGEEFKTLWDSFKDPVG------IGM----------
RDRP_MCMVK/460-941NVELGRYLRPVEHPIYHA......IDK-IWGGPTIMKGYSVEQ-IGRHIENAFRSFTDPVA------IGF----------
POLG_HCVEU/2430-2941IVYPDLGVRVCEKMALYDVT..QKLPQ-AVMGPAYGFQYSPNQ-RVEYLLKMWRSKKVPMG------FSY----------
POLG_HCVED/2420-2931IVYPDLGSRVCEKRALHDVI..KKTAL-AVMGAAYGFQYSPAQ-RVEFLLTAWKSKNDPMG------FSY----------
POLG_HCVJL/2434-2945IVYPDLSVRVCEKRALYDVT..RKLPV-AVMGAAYGFQYSPSQ-RVEYLLKIWRSKKTPMG------FSY----------
POLG_HCVJK/2431-2942IVYPDLGVRICEKRALYDVI..QKLPS-AIMGSAYGFQYSPKQ-RVEYLLKMWNSKKTPLG------FSY----------
POLG_HCVEV/2426-2937IVYPDLGVRVCEKRALYDVA..QKLPT-ALMGPSYGFQYSPAQ-RVDFLLKAWKSKKIPMA------FSY----------
POLG_HCVJ6/2445-2956IVYPDLGVRVCEKMALYDIT..QKLPQ-AVMGASYGFQYSPAQ-RVEFLLKAWAEKKDPMG------FSY----------
Q9IR83_9TOMB/236-712NVEVGRYLKPYEHHLYRA......LDV-VWKGPTVLKGYTVSE-IGSIMHSHWSQFQKPCA------VGF----------
Q87031_9LUTE/24-502NVELGRRLKFNEKKFMHA......IDS-TFDSPTVLSGYDSFR-VGKIIANKWSKFKRPVA------IGV----------
RDRP_POLVP/251-722NVEVGRYLKPLEPRLMKA......IDK-LWGEKTAIKGYTVEK-VGEILHQKSLRFKNPCF------VGL----------
Q65987_9TOMB/269-750NIEVGKYLKCYEHHLYRA......IDK-MWCGPTVLKGYNVEE-IGNIMSDAWNQFQKPCA------IGF----------
P90338_9TOMB/1-480NLQVARYLKKTEHHIYRG......LDK-IWGGPCVMKGYNVEE-VASHIIGAWEQFQKPVA------IGF----------
RDRP_BYDV1/361-840NIILGTRLKFNEKKIMHA......IDS-VFGSPTVLSGYDNFK-QGRIIAKKWQKFACPVA------IGV----------
O09796_9HEPC/2422-2933IVFPDLGVRVCEKMALYDVV..STLPQ-AVMGSSYGFQYSPKQ-RVEFLVNTWKSKKCPMG------FSY----------
O09803_9FLAV/2373-2866IVFPPLDFRIAEKLILGDP...GRVAK-AVLGGAYAFQYTPNQ-RVREMLKLWESKKTPCA------ICV----------
O37361_9VIRU/252-737VTRFGRYVRAIEKRLYIEWTKSFSSFT-VTTTPVCLKGMNYRT-RARALLEKWQSFDSPVA------VCL----------
Q9WJD9_CARMV/267-744NVELGRYLKKYEHHAYKA......LDK-IWGGPTVMKGYTTEE-VAQHIWSAWNQFQTPVA------IGF----------
Q83103_9TOMB/228-711NVELGRYLRIVKSICSRL......LIA-LFGGRTIFKGINADE-AGVEMKEIWDSFVDPIG------IGM----------
Q66127_9TOMB/52-520NVVFAKYIKPLEPMLYKA......LGR-LYEQPCVAKGFNAFQ-TGEIIRKKWDSFRNPVC------VGL----------
RDRP_PMVK/447-937NVELGKYLKHIEHPIYKA......IDR-IWGGKTIFKGMNVEA-MGAEIHKKMCKYSNPCA------IGF----------
POLG_GBVB/2277-2785ISYPHLEMRCVEKMYYGQVA..PDVVK-AVMGDAYGF.VDPRT-RVKRLLSMWSP..DAVG------ATC----------
Q89801_9TOMB/1-479NVEVGRYLRPFEHHLYRG......IDE-IMGGPTVIKGYDVNQ-IGNIMEKASGQFVRPVA------VGF----------
Q9IRA1_9TOMB/266-741NIEVGKYLKKAEHHIYSA......IDR-IWGGPTVLKGYTVEQ-LGTNIANIWSQFQRPCA------VGF----------
O12301_GAMV/231-708NVELGVYLRPFEHKAFRA......VER-VFGSPTIMKGYTAEE-QASIAREKWDRFSKPVA------IGL----------
Q83424_MNSV/290-772NVEVGRYLRRFEHYLYRG......IDE-IWNGPTIIKGYTVEQ-IGKIARDAWDSFVSPVA------IGF----------
O41892_PEGIA/2409-2899IVFPPLDFRIAEKMILGDP...GIVAK-AVLGSAYLFQYTPNQ-RVKALVAAWEGKKHPAA------ITV----------
RDRP_OCSVU/235-734NLALGRYLRPMEERIFKA......LGK-LFGHRTVMKGMDTDV-TARVIQEKWNMFNKPVA------IGL----------
Q9IW60_9TOMB/325-800NVELGRYLRHMESKLMKA......VDG-VFGETTCIKGYTADE-VGAIFREKWDRFDKPVA------IGL----------
Q96898_9FLAV/2396-2886IVFPPLDFRIAEKMILGDP...GIVAK-SILGDAYLFQYTPNQ-RVKALVKAWEGKLHPAA------ITV----------
RDRP_RCNMV/260-745NLAIGQYLRLNEKKMLDS......IDD-VFKEKTVLSGLDNRA-QGRAIAHKWRKYQNPIG------IGL----------

PF00972

POLG_YEFV1/2758-3406RTCVYNMMGKREKKLSEF-GKAKGSRA-IWYMWLGARYLEFEA-LGFLNEDHWASRENSGGGVEGIGLQYLGYVIRDLAA

PF00680

POLG_HAVHM/1750-2215HPRLAQRILFNTVMMENC.----------SDLDVVFTTCPKDE-LRPL-----EKV.....------...----------
RDRP_BPPH6/19-638GKFVSKDRMVADFEYAVT.----------GGEQGSLFAASKDA-SRLK-----EQYGIDVP------DGF----------
POLG_PYFV1/2270-2778KSAKLEAHYESYGHALQST----------EPFPLICIECPKDE-RRAL-----DKI.....------..Y----------
POL1_CPMVS/1186-1687PGTTVAKAYEELEASAHR.----------FVPALVGIECPKDE-KLPM-----RKV.....------..F----------
POLG_RHDVF/1279-1750.QVLAKHLYKCWSVANSG.----------KALHHIYACGLKDE-LRPL-----DKV.....------...----------
POLG_PVYN/2293-2763.DKEEIVMQSCLRLYKGL.----------LG...IWNGSLKAE-LRCK-----EKI.....------...----------
POLG_EMCVR/1844-2288...LIPFAAERLRKMNEG.----------DFSEVVYQTFLKDE-LRPI-----EKV.....------...----------
POLG_FCVUR/1266-1735.KPLLDLLSAKWKLATQG.----------IALPHEYTIGLKDE-LRPV-----EKV.....------...----------
POLG_NVN68/1301-1766.GELGEQAAHANNMYENA.----------KHMKPIYTAALKDE-LVKP-----EKI.....------..Y----------
Q9DLK1_FMDVP/1865-2314...VGPEVEAALKLMESR.----------EY.KFVCQTFLKDE-IRPL-----EKV.....------...----------
POLG_VESVA/1379-1848.KNLLDLLSSKWNRAKLG.----------LALPHEYALGLKDE-LRPK-----DKV.....------...----------
POL1_BAYMY/1634-2098.EVLHLAEVCRQQFLEGK.----------.S.TGVWNGSLKAE-LRTI-----EKV.....------...----------

PF02123

Q83093_9VIRU/437-816PANKVREGRFRLISSVSLVDQ......-.LVERLLFGPQNKAE-IALW.....QSVPSKPG------MGL----------
Q66150_9VIRU/22-408SRQKIEQGRFRLISSVSLVDQ......-.LVERMLFGPQNTTE-IALW.....HSNPSKPG------MGL----------
Q86519_9VIRU/516-902PRKKLLERRFRLISSVSLVDQ......-.LVERMLFGPQNNTE-ISTW.....WQWPSKPG------MGL----------
RDRP_SCPMV/464-849PSRKLKEGRYRLISSVSIVDQ......-.LVERMLFGAQNELE-IAEW.....QSIPSKPG------MGL----------
RDRP_SBMVA/490-847ASRKVREGRFRLISSVSLVDQ......-.LVERMLFGPQNQLE-IAEW.....EHIPSKPG------MGL----------
RDRP_PEMVW/733-1124KMEKIRNKRYRLIASVSIVDQ......-.LVARMLFRDQNEEE-LLQH.....MAIPSKPG------LGF----------
RDRP_PLRVW/609-1004KQSKLDEGRYRLIMSVSLVDQ......-.LVARVLFQNQNKRE-ISLW.....RSVPSKPG------FGL----------
RDRP_TYYVF/580-974KQAKLDEGRYRLIMSVSLVDQ......-.LVARVLFQNQNKRE-IALW.....RAIPSKPG------FGL----------
Q65969_9LUTE/603-996KQAKLDEGRYRLIMSVSLVDQ......-.LVARVLFQNQNKRE-IALW.....RVVPSKPG------FGL----------
RDRP_ROTGI/108-803VAKQYKDVTAESLSALANSSNGFSKEV-KFIDRNIKTTKKILH-LDNDLI...TNDYSDLS------KAL----------
RDRP_ROTHC/109-749EDKRLEEYELSALLSMSSASNGILREI-NFGGQKVRSTKKNMH-VIDDIYHKKYTTDI.PP------VDA----------
O55590_9REOV/104-749DDHLLVDSELAGLLSMSSASNGESRQL-KFGKKTIFSTKKNMH-VMDDMYNGKYNPELVPK------VDQ----------
RDRP_ROTPY/100-748DDHLLRDSELAGLLSMSSASNGESRQL-KFGRKTIFSTKKNMH-VMDDIAHGRYTPGVIPP------VNV----------
Q90153_9VIRU/1025-1530IPSPLKNSPMRDLVLKEYGLS.....P-RPTKRSVMEAIPRDK-VLKILTETSPKIVAKAH------MKL----------
Q90193_9VIRU/400-785DRIQLRLNKSTLLNFLPVVEA......-..VEAAWRNYDPNSF-TGVF.......WKHEVG------KNA----------
RDRP_PCVC/362-832NKLPPEMKKFGGQVFDAIYNTCREIQG-RHNKKSLFEVYELAE-VLQG...ANENNFNLTK------TQI----------
RDRP_SCVLB/837-1303SQHPVEQDVIRVLPREIRSKKGVASVM-PYKEQKYFTSRR...-.........PEIHAYTS------TKY----------
Q87025_SCVLA/177-657QYEEDNDYIYPGQYTRNKFITVNKMPK-HKISRMIASPP...E-VRAW...........TS------TKY----------
Q90155_TTV1/96-539PDEQIDQ....LLPPQPTRKE......-.FLDIVTIDYIKQCK-.........PQVFIRQS------RKL----------
Q9JE94_9VIRU/129-560PLFGSYDNRLEFVENV...........-.DLDRVLKSH.....-.........PAVYITQA------PKL----------
Q8V615_9VIRU/41-473PHFAKYSSRLDFVMDV...........-.PADKIAAVP.....-.........PSVFITQA------EKL----------
Q83073_9VIRU/49-523HSRALEHAHPELRTRKEVR........-.AYRKCVLEQWRNNP-MDAW....DGQVYVTPS------QKL----------
RDRP_LRVLG/155-619HSRALEHAHPELATRKEGQ........-.AYRKAVMEQWQHNP-MDRW....DGTVYVTPS------AKL----------
Q98XW8_9VIRU/144-622NGNDHWLPRSLLPQFPAALL.......-.WNRRAALNCVERNP-LKRW....SGHVRVSVA------EKV----------
Q99AT3_9VIRU/99-573SGHVSRL..YPRVPKPPGMLR......-.EHRRAWLESVTEDP-RTDW....DGKTFVSAS------PKL----------
Q9YXE4_9VIRU/99-573QSGLLSREHLEAAPRPPGAAR......-.EYRAVMARESEQDP-RPAW....DGHTYVSGS------PKL----------
RDRP_HV19S/122-585SQNALSDKALGIKNKSGQ.........-.RYRRMAAEEVNNNP-VPAW....NGHTSVSPS------VKL----------
Q9YXE6_9VIRU/120-589NDASSRLLGIDTARFREFHTR......-.EYRRMASEALTHEP-ITSW....DGYTNISAS------PKL----------

PF04197

RDRP_IBDVU/1-875SNSPNNVLNIEGCPSLYKFNPFRGGLN-RIVEWI...MAPDEP-KALVYADNIYIVHSNTW------YSI----------
RDRP_IPNVJ/1-842NESKLNITNTQ.TPSLYGFSPFHGGMD-RIMTIIRDSLDNDED-LVMIYADNIYILQDNTW------YSI----------
RDRP_BSNV/1-863NSSKNNILNVPECVSLYGFNPFSGGMD-AVVTNIL..AQPDET-LFLIYADNIYIYMDRTW------FSI----------

PF00078

A0A066NJ57_LELAM/135-366----------VLDADISQFFDRVSHEWL--IR.FTEHRIGDRRVIRLIRKWL....T----------AGTSEEG....QW
A0A0F6CD22_ECOLX/115-332----------VLEGDIRGCFDNISHQWL--IDNTSTDRQILTK...WLKAGYREKG.----------...........QL
D7ZFU1_ECOLX/62-269----------VLKVDISNFFDNIHRDLV--RS.VFEE..ILHIKDEALEYLV.....----------...........DI
A0A0E0UMT2_SINMB/72-291----------VLEFDIKGLFDNLPHDLL--LKAVRKDVKCN......WALLYIERWL----------TAPM.EKN.G.EV
Q47526_ECOLX/33-239----------LLKLDLVNFFNKITPELL--FK.ALARQKVD..ISDTNKNLL.....----------.KQFCFWN.RTKR
O01419_BOMMO/502-756----------AVSIDISNAFNTVPWSTI--LE.SLRFHRVPTGLRNLIEDYLAGRAV----------VFPERRGW...GH
O18558_AEDAE/472-725----------GVFLDIEGAFDNVSFDAI--LE.AARNHGLPTMITNWIHQMLKNRH.----------..LFSTLRQAAIR
O42691_ALTAL/36-202----------ITAMDVRSGFANLRMAPG--SE.KATAFKTF................----------...........FG
O44316_DROMR/394-650----------IATLDVSKAFDSVAHDAV--FN.TVTAYGAPKSFVDYVRRWYSGGGT----------YFNGGDWR.S.EE
O52231_STREE/68-275----------IVDIDLEKFFDTVPQDRL--MS.LVHNIIEDGDTESLIRKYL....H----------SGVIING....QR
O62658_CANFA/517-773----------ILSLDAEKAFDKIQHPFL--IK.TLQSVGIEGTFLDILKAIYEKPTA----------NIIL.NGE.ALGA
O64612_ARATH/788-1031----------AMKIDLSKAFDSVQWPFL--LN.TLAALDIPEKFIHWINLCISTAS.----------............F
O65244_ARATH/405-664----------ALKIDISKAFDSVQWKFL--IN.VLEAMNFPPEFTHWITLCITTASF----------SVQV.NGE.LAGV
O65598_ARATH/489-747----------MLKVDLRKAFDSVRWEFI--IA.ALLALGVPTKFINWIHQCISTPTF----------TVSV.NGCCG.GF
O81284_ARATH/58-317----------CLQVDLTKAYDNVNWEFL--IN.ILKALNLPPIFINWIWVCISTPSY----------SIAY.NGE.LIGF
O81454_ARATH/144-304----------FSKVDLRSGYHQVRMREG--DE.WKTAFKTK................----------...........QG
O93520_ORYLA/518-771----------VISLDAEKAFDSVRWTFL--YK.VLGKFGFCKSIIETISGLYNKPTA----------RIKI.NGD.LTET
O96546_LYMDI/526-780----------VLFLDVAKAFDKVWHEGL--IY.KLYLLKIPHYLIHIIHDYLSHRSF----------RYRV.EGT.LSTS
O99969_PORPU/100-315----------ILDADIKGCFDNIDHSKL--LE.KLNTFPLF...RNQINTWL....K----------VGVLSDFQGNKTE
POL_RSVP/769-938----------LMVLDLKDCFFSIPLAEQ--DR.EAFAFTLPSV..............----------.....NNQ.APAR
POL_HTL1A/633-804----------LQTIDLRDAFFQIPLPKQ--FQ.PYFAFTVPQQ..............----------......CNYGPGT
POL_SMRVH/71-240----------KIVIDLKDCFFTIPLHPE--DR.PYFAFSVPQI..............----------......NFQSPMP
POL_MMTVB/68-237----------IIIIDLQDCFFNIKLHPE--DC.KRFAFSVPSP..............----------......NFKRPYQ
POL_CAMVC/289-452----------FSSFDCKSGFWQVLLDQE--SR.PLTAFTCP................----------...........QG
POL_IPHA/60-229----------LIIIDIKDCFFSIPLYPR--DR.PRFAFTIPSL..............----------......NHMEPDK
POL_HV1MA/655-826----------VTVLDVGDAYFSVPLDED--FR.KYTAFTIPSI..............----------......NNETPGI
TF21_SCHPO/455-615----------FTKLDLKSAYHLIRVRKG--DE.HKLAFRCP................----------...........RG
POK10_HUMAN/76-245----------LIIIDLKDCFFTIPLAEQ--DC.EKFAFTIPAI..............----------......NNKEPAT
POL4_DROME/357-523----------FSCLDLMSGFHQIELDEG--SR.DITSFSTS................----------...........NG
POLY_DROME/224-390----------FTTLDLKSGYHQIYLAEH--DR.EKTSFSVN................----------...........GG
POL_EIAV9/249-419----------MTVLDIGDAYFTIPLDPE--FR.PYTAFTIPSI..............----------......NHQEPDK
YTX2_XENLA/513-765----------FLSLDQEKAFDRVDHQYL--IG.TLQAYSFGPQFVGYLKTMYASAEC----------LVKI.NWS.LTAP
POL_SOCMV/246-411----------FSSLDAKSGYYQLRLHEN--TK.PLTAFSCP................----------..........PQK
Y2R2_DROME/498-741----------GTFVDFKGAFDNVEWSAA--LS.RLADLGCREM..GLWQSFFSGRRA----------VIRSSSG...TVE
POL_BIV29/638-806----------LTAIDIKDAYFTIPLHED--FR.PFTAFSVVPV..............----------......NREGPIE
RDPO_ACUOB/124-343----------VVEIDIKGCVDNINHQFI--SQ.VTPFIPKK.....ILWAWL....K----------CGYIERNS.N.TL
POL2_DROME/249-414----------FTTIDLAKGFHQIEMDEE--SI.SKTAFSTK................----------...........SG
RT67_ECOLX/48-262----------ILNIDLKDFFESFNFGRV--RG.YFLS.....NQDFLLNPVVATTL.----------..........AKA
RTJK_DROME/502-757----------GAFLDIQQAFDRVWHPGL--LY.KAKRLFPPQL.YLVVKSFLEERTF----------HVSV.DGY.KSSI
POL_BLVAU/41-212----------IICLDLKDAFFQIPVEDR--FR.SYFAFTLPTP..............----------......GGLQPHR
POL_RTBVP/1228-1390----------FSKFDLKAGFHHMKLKDD--FK.DWTTFTCS................----------...........EG
POL_CAEVC/210-380----------VTILDIGDAYFTIPLYEP--YR.EYTCFTLLSP..............----------......NNLGPCK
P91581_CIOIN/483-644----------YSSLDLRSAYHQIPLKDS--DR.PFTAFEAE................----------...........GQ
P95451_PSEAC/119-326----------CVELDLEKFFDRVNHDIL--MA.CIERRIKDKCVLRLIRRYL....E----------AGIM.SGG...VV
Q01379_NEUCS/505-761----------LMLLDLKGAFDRVNHRWL--LH.TLWEMQLPTWIIRWVASFVAGRRG----------SLFF.DDE.TSRP
Q03261_SIV/246-416----------LTIIDLKDAYYSVPLDKE--FR.PYTAFTVPSI..............----------......NNASPGE
Q04135_DROME/496-743----------AIFLDVAQAFDRVWLDGL--LF.KIIK.LLPQNTHKLLKSYLYNRVF----------AIRC.DTS.TSRD
Q07995_CHITU/509-760----------MIFLDVEKAFDRVWHPGL--LY.KMLKLRFPLPLIKTVRSFLSERSF----------AVFI.KGQFS.EI
Q08724_9CYAN/108-336----------VLDADISKCFDKINHEKL--LT.KINTFPTMRR...QIKAWL....K----------AGVL.DNG...HF
YRD6_CAEEL/484-644----------YSQIDLKDAYLQVELDEE--AQ.KLAVINTH................----------...........RG
Q17329_CAEEL/1071-1231----------YTVFDMIAGFWQIPLDEK--SK.EITAFAIG................----------...........SE
Q24262_DROME/531-692----------FTTMDLQNGFFHVAVEEA--SK.PYTAFVTR................----------...........EG
Q24690_DROTE/495-742----------LVTLDFSRAFDRVGVHSI--IH.QLQEWKTGPKIINYIQNFMINRKI----------IVRV.GPH.TSSP
Q26816_9TRYP/545-793----------GAVFVDYKAFDTVDHDKI--AR.EMHRMKVSPHIVKWCVSFLSNRTG----------RVRF.KEK.LSRS
Q46666_ECOLX/34-241----------LLKADLEDFFNSITPAIF--WR.CIEMSSALTPQFEPQDKFF....I----------EKIL.FWQ.PIKH
Q83013_9RETR/68-238----------VIAMDISDCFFSIPLAER--DS.ERFAFTIPSP..............----------......NLREPAK
Q88285_9RETR/848-1015----------YSSLDISNGFWSIRLEEE--CQ.YLFAFTFD................----------...........TQ
POL_CSVMV/250-413----------YSKFDCKSGFYHIKLEED--SK.KYTAFTVP................----------...........QG
Q93137_BOMMO/515-771----------ALFFDVAKAFDKVWHNGL--IF.KLFNMGVPDSLVLIIRDFLSNRSF----------RYRV.EGT.RSSP
Q93139_BOMMO/469-719----------IVSLDIEGAFDSAWWPAL--EV.RLAEEKCPEYLRRVISSYLSDRRV----------SVRY.AGA.E.YE
Q94885_DROME/759-920----------FTKLDLKNGFFHVHVKKE--SI.KYTSFVTP................----------...........LG
YG31B_YEAST/639-797----------FTTLDLHSGYHQIPMEPK--DR.YKTAFVTP................----------...........SG
Q9YGS2_TAKRU/573-830----------LVLLDLSAAFDTVDHSIL--LQRLEHVIGIKGTALDWFRSYLSDRYQ----------FAHV.HGVPS.SY
Q9YW31_MSEPV/161-406----------FAFIDFKKAFDNVDREIL--WN.IMHLHGYPPHLINAIKSLYENTR.----------......IIVKSKV
Q9ZNW4_SORBI/922-1081----------FSLLDCFSGYHQIWLKKE--DE.GKASFTTP................----------...........FG
Q9ZQ67_ARATH/542-701----------LSFMDAFSGYNQIPMHKD--DQ.EKTSFIID................----------...........RG
Q9ZQQ6_ARATH/659-918----------AMKIDISKAFDSVQWQFL--LN.TLEALKFPEKFRHWIKLCISTATF----------SVQV.NSE.QAGF
Q9ZS84_SOLLC/655-815----------FTKLDLRAGYWQVRIAEG--DE.PKTTCVTR................----------...........YG
Q9ZVK4_ARATH/510-669----------FSKIDLTSGYHLIPIAEA--DV.RKTAFRTR................----------...........YG

PF05919

Q6EH16_9VIRU/1-501---------.LYGFDLSAATDRLPIAFQ--KD-ILNHLG...YPGGPWRRLL.GIKY-------..........NSPCGF
Q5TMB5_9VIRU/174-658---------.YYSFDLKSATDRFPVELQ--EK-VIQAFYGE.DFARSWRSLITDQAF-------..........AYGESE
Q18L80_9VIRU/166-639---------.YYSFDLSAATDRLPLSIQ--IL-ILKHLVSV.PFSEAWGRLLTGRTY-------....HL..FYKKTSYE
Q9WJ23_9VIRU/164-642---------.FWSMDLSAATDRFPIDLQ--ER-LLSYLYGS.EISSAWKQLLIDRTY-------.........KTPEGDE
RDRP_CPMV1/246-745---------.FYGFDLTAATDRLPIDLQ--VD-ILNIIFKN.SPGSSWRSLL.RIKY-------..........KSPQGF
Q9ZXZ7_THACU/214-754---------.AFSYDLTAATDRLPVILT--AF-ILSTIVGIRTFGGLWRSILVKRPF-------GFNSNVAEKLKVSDGP
Q9WJ22_9VIRU/155-622---------.YHSLDLSAATDRFPIFLQ--QK-LISLIFNDYEFGKNWRNLLVDRNY-------..........DYQGIS
Q6EH19_9VIRU/208-686---------.FYSYDLEAATDRFPIQFQ--KK-VLSLIFNT.TYAQAWAEIMTQEPF-------........RVKGLSDP
Q9WJ24_9VIRU/163-645---------.FWSIDLSSATDRFPIVFQ--KR-VLQKILGK.QMTDSWERIMIGSKF-------.........LAPDGDT
Q6GYC2_9VIRU/156-638---------.FWSIDLTAATDRFPISLQ--RR-LLLYIYSDPEIANSWQNLLVHREY-------.........ARNGLNP
Q18L78_9VIRU/174-654---------.RFSFDLSAATDRLPLTLQ--KD-ILTLLVSP.SFAEAWGTALVGRPY-------....KL..KFGTTEDE
Q18L79_9VIRU/168-671---------.VFSLDLSAATDRLPLTIQ--AQ-ILNHIVP..KLGDHWANLLVNRDY-------SVPNHT..TLPVNPGT
Q3S3F3_9VIRU/120-606---------.FHSLDLSSATDRFPVKLQ--SR-LLTEMYSDPSFGENWMNLLLNRDY-------LLP.....EEGLSGER
O92614_9VIRU/173-711---------EFYSYDLSSATDRLPMAFQ--KQ-IISVLFGS.KFAKDWATLLVGRDW-------..........YLKDIP

PF07727

Q7G640_ORYSJ/781-1029----------LEQLDVKTIFLHGELEEE..IY-MDQPEGFI--------------------------------VPGKEDD
Q7XLN3_ORYSJ/465-703----------MQLMDVVTTYLYGSLDSD..IY-MKVLDGID--------------------------------IPNQ...
Q7XTU6_ORYSJ/940-1185----------IHHMDVKSAFLNGELEEE..VY-VVQPPGFD--------------------------------DKTNASK
Q7XKS1_ORYSJ/160-403----------ISQLDVKNAFLNGELHEE..VY-MRSPQGYS--------------------------------VP..EGM
Q9FWI2_ORYSJ/795-1030----------IYQLDVKSAFLNGYLDEE..IY-VEQPEGFS--------------------------------VQGGENK
Q94I36_ORYSJ/864-1109----------LYQMDVKSAFLNGFIHEE..VY-VKQPPGFE--------------------------------NSDFPNH
Q7G6C9_ORYSJ/1047-1286----------LFQMDVKSAFLNGPISEL..VY-VEQPPGFE--------------------------------DLKLPNH
Q94LQ7_ORYSJ/550-793----------LRQLDVQNAFLHGVLEED..VF-MRQPPGYE--------------------------------QK..DGY
Q7XKG6_ORYSJ/514-759----------LYQLDVKNAFLHGDLQEE..VY-MEIPPGFS--------------------------------TSQTKGK
Q7X5X4_ORYSJ/138-383----------VHHMDVKTAFLNGEPLEE..VY-VEQAPGFT--------------------------------TPGAGDK
Q84M55_ORYSJ/910-1155----------LHQLDVKNAFLHGDLHEE..VY-MEIPPGFG--------------------------------NSQTVGK
Q7Y173_ORYSJ/398-645----------LHQMDVKTAFLNGELHED..VY-MAEPEGFV--------------------------------MEGKDHL
Q8W5F4_ORYSJ/472-717----------VHQMDVKTAFLNGELDEE..IY-MDQPNGFV--------------------------------VEGQEGK
Q7XUD9_ORYSJ/916-1161----------VHHMDVKSAFLNGELAEE..VY-VKQPPGFV--------------------------------KEGREHQ
Q8LNW7_ORYSJ/880-1128----------LEQMDVKTAFLHGELEED..IY-MEQPEGFV--------------------------------VLGKENL
Q94HQ0_ORYSJ/485-718----------IHHMDVKSAFLNSDLKEE..VY-VHQPPGFV--------------------------------IPGKEGK
Q7Y1I1_ORYSJ/727-972----------VHHMDVKSAFLNGELTEE..VY-VVQPPGFV--------------------------------VEGHEHQ
Q94GR9_ORYSJ/975-1220----------LFQMDVKSAFLNGEIAEL..VF-VEQPPGFE--------------------------------DPKNPNH
Q7X7N0_ORYSJ/758-1003----------IHQLDVKNAFLHGTLDET..VY-CQQSSGFI--------------------------------DPAAPDA
Q7XZY2_ORYSJ/297-542----------IHHMDVKSAFLNGDLEED..VY-VVQPPGFV--------------------------------DEEHPDK
Q7XN62_ORYSJ/915-1162----------LHQMDVKTAFLNGDLEEK..VY-MAQPKGFV--------------------------------MKGNENM
Q7XLI2_ORYSJ/53-298----------VHQLDVKNAFLHRTLQET..VY-CTQPAGFV--------------------------------DPTKPDL
B5RTA2_DEBHA/1170-1414----------IHHLDISSAYLHADIDYEKSIF-VKPPPGSN--------------------------------ID..SGK
B5RTR8_DEBHA/1021-1254----------VHQMDVDTAFLNGTVEET..LY-MKQPVGFI--------------------------------NENEPEK
E7KRB3_YEASL/146-383----------VYQMDVDTAFLNSTMDEP..VY-VKQPPGFV--------------------------------NERNPDY
Q2R072_ORYSJ/915-1159----------VHHMDVKSAFLNGELIEE..VY-VVQPPGFE--------------------------------IDGQENK
Q59K02_CANAL/999-1236----------IHSIDVTTAFLNGEISEL..IF-VKQPPGYE--------------------------------DKKRPNH
Q5AG24_CANAL/888-1133----------MHQLDIASAYLNASLEDGRVIF-VRPPRGFE--------------------------------VK..PGY
Q5AH82_CANAL/122-366----------IQHLDVESAYLNASITHSNPIY-VFPPKSVP--------------------------------LK..KNH
Q7XN23_ORYSJ/31-274----------LRQLDVQNVFLHGFLQEE..VY-MQQPPGFE--------------------------------SSSKPNY
Q8S476_MAIZE/836-1081----------IHQMDVKTAFLNGELDEE..IY-MDQPEGFI--------------------------------ADGQENK
Q8S479_MAIZE/1073-1313----------LFQMDVKSAFLNGPIKEE..VY-VEQPPGFE--------------------------------DERYPDH

PF00978

R1AB_LIYV9/1925-2366---------DFSKFDKSQGTCFKLYEEM-----MYKMFGFSP----ELYDR.DF.KY.......TEYFCR.....A...K
R1AB_BYVU/2601-3046---------DFSKFDKSQDAFIKSFERT-----LYSAFGFDE----DLLDV.WM.QG.......EYTSNA.....T...T
Q9YPH5_9VIRU/1359-1796---------DFRKFDKSKVSLHIKVVIE-----LYKLFGLDD----MLAVL.WE.KS.......QCQTLV.....K...D
POLN_EEVVM/2041-2488---------DIASFDKSEDDAMALTALM-----ILEDLGVDP----ELLTL.IEAAF.......GEISSIHLPTKT...K
E0YCR0_9CLOS/53-491---------DISKYDKSQSALMKQVEEL-----ILLTLGVDR----EVLST.FF.CG.......EYDSVV.....R...T
RDRP_TOMS1/1168-1609---------DVSKYDKSQNEFHCAVEYE-----IWRRLGLED----FLAEV.WK.QG.......HRKTTL.....K...D
RDRP_PSVJ/295-726---------DLSKFDKSQGELHLMIQEE-----ILNLLGCPV----DISKW.WC.DF.......HRYSYI.....K...D
Q66107_9BROM/228-662---------DFSKFDKSQGELHHKVQKM-----IFDLLKLPP----EFVEM.WF.TS.......HERSYI.....T...D
Q87644_SINDV/2053-2501---------DIASFDKSQDDAMALTGLM-----ILEDLGVDQ----PLLDLIEC.AF.......GEISSTHLPTGT...R
O56790_9VIRU/1323-1760---------DFSKFDKSKTSLHIRAVIE-----LYKIFGLDD----MLAFL.WE.KS.......QCQTTI.....R...D
RDRP_CMVFN/308-738---------DLSKFDKSQGEFHLLIQEH-----ILNGLGCPA----PITKW.WC.DF.......HRFSYI.....R...D
Q9WJD8_PEBV/1299-1738---------DLSKFDKSANRFHLQLQLE-----IYRMFGLDE----WAAFL.WE.VS.......HSQTTV.....R...D
Q80875_BSMV/195-630---------DFSKFDKSKTGLHIKAVIG-----LYKLFGLDG----LLKVL.WE.KS.......QYQTYV.....K...D
RDRP_RBDVR/1234-1674---------DFSKFDKSQGEIHQLIQDL-----ILIKFGCDP----EFVAL.WS.TA.......HRSSSI.....F...D
RDRP_SBWMN/1373-1810---------DFSKFDKSKTSLHIRAVIE-----LYKLFGLND----LFALL.WE.KS.......QCQTKI.....R...D
POLN_ONNVI/2053-2501---------DIASFDKSQDDSLALTAMM-----LLEDLGVDQ----PILDL.IE.AAFGEISSCHLPTGT.....R....
RDRP_TAV/313-742---------DLSKFDKSQGELHLMIQEG-----ILNRLGCPV----HISKW.WC.DF.......HRMSYI.....K...D
POLN_MIDDV/534-981---------DIASFDKSQDDSLAYTGLM-----LLEDLGVDQ----PLLEL.IE.ASF....GEITSTHLP..TGT...R
RDRP_TMGMV/1163-1604---------DISKYDKSQNEFHCAVEYE-----IWKRLGLNE----FLAEV.WK.QG.......HRKTTL.....K...D
RDRP_TOBSV/253-689---------DFSKFDKSQGRLHHDVQFR-----LFLALGIPE----HFVTT.WF.NS.......HEKSYI.....R...D
RDRP_OLV2I/310-732---------DLSKFDKSQGKLLHDVQRE-----IFLRLGFPP----IWCDW.WF.KF.......HESSYL.....N...D
RDRP_YOMV/1155-1594---------DISKYDKSQNEFHCAVEYK-----IWEKLGIDD----WLAEV.WR.QG.......HRKTTL.....K...D
RDRP_AMVLE/318-752---------DFSKFDKSQNELHHLIQER-----FLKYLGIPN----EFLTL.WF.NA.......HRKSRI.....S...D
POLN_RRVN/2019-2467---------DIASFDKSQDDSLALTALM-----LLEDLGVDQ----ELLDLIEE.AF.......GEITSVHLPTGT...R
RDRP_ASPVP/1758-2169---------DYEAFDASQDHFILAFELE-----VMKFLGLPS----DLIA...............DYTFI.....KTHLG
O56250_9VIRU/1240-1678---------DMSKFDKSANRFHLQLQLE-----IYRLFGLDE----WAAFL.WE.VS.......HTQTTV.....R...D
O90699_9VIRU/1363-1800---------DFSKFDKSKTSLHIRAVLE-----LYRMFGLDD----LCAYL.WE.KS.......QCQTIV.....K...D
Q9Q6Q3_9CLOS/62-509---------DISKYDKSQGACMKDVERL-----ILIGLGVAE----SVVDA.FF.CG.......EYDSVV.....T...M
POLN_AURAV/2038-2486---------DIGSFDKSQDDSLALTALM-----ILEDLGVDD----RLMDLIEC.AF.......GEITSVHLPTAT...T
RDRP_BBMV/271-697---------DLSKFDKSQGELHLEFQRL-----ILINLGFPV----PLTNW.WC.DF.......HR.SIL.....S...R
RDRP_CCMV/267-697---------DLSKFDKSQGELHLEFQRE-----ILLSLGFPA----PLTNW.WC.DF.......HRESML.....S...D
Q66581_EEEV/144-598---------DIASFDKSEDDAIAMSALM-----ILEDLGVDQ----ALLNL.IEAAF.......GNITSVHLPTGT...R
Q9QGG9_9BROM/363-797---------DPSTFDKSQQRLHHLTHYH-----TPTALGAPA----DFIDM.WF.GS.......HEISHI.....R...D
RDRP_TMOB/1167-1614---------DVSKYDKSQNEFHCAVEYE-----IWKRLGIDE----FLAEV.WK.QG.......HRKTTL.....K...D
RDRP_BMV/256-688---------DLSKFDKSQGELHLEFQRE-----ILLALGFPA----PLTNW.WS.DF.......HRDSYL.....S...D
O40960_9CLOS/62-506---------DFSKFDKSQGHVIKLYEEL-----VYKIFKFSP----NLYD..NF.KL.......SEYFCR.....A...S

PF00998

RDRP_TNVA/224-703---------DASRFDQHVSVEALEYEHE-----FYLRDYPNDK...QLKWL-LKQQL-------CNVGTA---------F
RDRP_TCV/272-752---------DMKRFDQHVSVDALRWEHS-----VYNAGFNCP....ELAQL-LTWQL-------TNKGVG---------R
RDRP_TNVD/224-709---------DASRFDQHISKDALEFEHK-----MWLSMFPKSER.AELARL-LSWQI-------NNRGLA---------R
RDRP_MCMVK/460-941---------DASRFDQHVSVEALRWEHS-----VYSRIYGYPE...LLTQL-LRWQI-------HNRGTA---------Y
POLG_HCVEU/2430-2941---------DTRCFDSTVTERDIRTEND-----IYQSCQLDPVA.RRVVSS-LTERL-------YVGGPM---------A
POLG_HCVED/2420-2931---------DTRCFDSTVTEKDIRVEEE-----VYQCCDLEPEA.RKVITA-LTDRL-------YVGGPM---------H
POLG_HCVJL/2434-2945---------DTRCFDSTVTERDIRTEES-----IYQCCELDPVA.RKAISS-LTERL-------YVGGPM---------Y
POLG_HCVJK/2431-2942---------DTRCFDSTVTEQDIRVEES-----IYQACDLKDEA.RRVITS-LTERL-------YCGGPM---------F
POLG_HCVEV/2426-2937---------DTRCFDSTITEHDIMTEES-----IYQSCDLQPEA.RVAIRS-LTQRL-------YCGGPM---------Y
POLG_HCVJ6/2445-2956---------DTRCFDSTVTERDIRTEES-----IYRACSLPEEA.HTAIHS-LTERL-------YVGGPM---------F
Q9IR83_9TOMB/236-712---------DMKRFDQHVSVDALRFEHS-----VYGRSFCSK....ELDRL-LEWQL-------LNSGVG---------H
Q87031_9LUTE/24-502---------DASRFDQHVGVEALQWEHS-----IYNGAFK.DP...ILKEL-LHWQT-------ENR.IM---------L
RDRP_POLVP/251-722---------DASRFDQHCSRQALEWEHS-----VYNAIFRDP....YLSEL-LTWQI-------DNVGTA---------Y
Q65987_9TOMB/269-750---------DMKRFDQHVSVDALKWEHS-----VYNASFNCP....DLAKM-LTWQL-------KNKGVG---------R
P90338_9TOMB/1-480---------DMSRFDQHVSVPALQFEHS-----IYQAIFKGDR...ELQQL-LSWQL-------RNYGTG---------F
RDRP_BYDV1/361-840---------DASRFDQHVSEQALKWEHG-----IYNGVFG.DS...ELALA-LEHQI-------TNN.IK---------M
O09796_9HEPC/2422-2933---------DTRCFDSTVTENDIRVEES-----IYQCCDLAPEA.KLAIRS-LTERL-------YIGGPL---------T
O09803_9FLAV/2373-2866---------DATCFDSSITEEDVALETE-----LYALASDHPD....WVRA-LG.KY-------YASGTM---------V
O37361_9VIRU/252-737---------DASRFDLHVSVDALKFTDQ-----IYLSAFTGIDR.SELKEI-LRNRH-------KTTGFA---------T
Q9WJD9_CARMV/267-744---------DMSRFDQHVSVAALEFEHS-----CYLACFEGDA...HLANL-LKMQL-------VNHGVG---------F
Q83103_9TOMB/228-711---------DASRFDQHISVEALQFEHK-----MWLEMFPVSQR.KHLKRL-LDLQL-------HNRGLA---------R
Q66127_9TOMB/52-520---------DASRFDQHVSVEALKFTHS-----VYKRFNSSK....EFVDL-LNQMY-------VNRGLG---------T
RDRP_PMVK/447-937---------DASRFDQHVSVEALRFEHS-----IYKSIHGYPE...LLSLL-LKWQI-------HNQGTA---------H
POLG_GBVB/2277-2785---------DTVCFDSTITPEDIMVETD-----IYSAAKLSDQH.RAGIHT-IARQL-------YAGGPM---------I
Q89801_9TOMB/1-479---------DMSRFDQHVSFDALQFEHG-----VYLQHFGGDR...FLAKL-LSWQL-------NNKGFA---------N
Q9IRA1_9TOMB/266-741---------DAKRFDQHVSVDALRFEHS-----VYNSIFHSP....ELARL-LSYQL-------HNVGVA---------V
O12301_GAMV/231-708---------DASRFDQHVSVAALKWEHK-----LYHHAFNHDK...TLKKL-LKWQI-------HNEGTA---------F
Q83424_MNSV/290-772---------DMKRFDQHVSSDALKWEHS-----VYLDAFCHDS...YLAEL-LKWQL-------VNKGVG---------Y
O41892_PEGIA/2409-2899---------DATCFDSSIDEHDMQVEAA-----IFAAASDDPV....RVHA-LC.RY-------YVEGPM---------V
RDRP_OCSVU/235-734---------DASRFDQHVSLEALEFEHS-----VYLKCVRRMVDKRKLGNI-LRHQL-------LNKCYG---------N
Q9IW60_9TOMB/325-800---------DASRFDQHCSMEALQYEHS-----FYRAMYPGN...KLLSKL-LEWQL-------HNKGKG---------Y
Q96898_9FLAV/2396-2886---------DATCFDSSIDEHDMQVEAS-----VFAAASDNPS....MVHA-LC.KY-------YSGGPM---------V
RDRP_RCNMV/260-745---------DASRFDQHCSVDALKFEQT-----FYKACFPGDQ...QLETL-LKWQL-------SNTGSA---------L

PF00972

POLG_YEFV1/2758-3406MDGGGFYADDTAGWDTRITEADLDDEQE-----ILNYMSPHHK---KLAQA-VMEMT-------YKNKVV-----KVLRP

PF00680

POLG_HAVHM/1750-2215---------LESK---TRAIDACPLDYS-----ILCRMYWG------PAISYFHLNP-------GFHTGV------AIGI
RDRP_BPPH6/19-638---------FCER---RRTAMGGPFALN-----APIMAVAQ------PVRNKIYSKY-------AYTFHH------TTRL
POLG_PYFV1/2270-2778---------EKPK---TRLFSILPVEFN-----MHARRLFL------DFNVFVMAN.-------RHKHGI------MVGI
POL1_CPMVS/1186-1687---------DKPK---TRCFTILPMEYN-----LVVRRKFL------NFVRFIMAN.-------RHRLSC------QVGI
POLG_RHDVF/1279-1750---------KEGK---KRLLWGCDVGVA-----VCAAAVFH------NICYKLKMV.-------ARFGPI------AVGV
POLG_PVYN/2293-2763---------LANK---TRTFTAAPLDTL-----LGGKVCVD------DFNNQFYSK.-------NIECCW------TVGM
POLG_EMCVR/1844-2288---------QAAK---TRIVDVPPFEHC-----ILGRQLLG------KFASKFQTQP-------GLELGS------AIGC
POLG_FCVUR/1266-1735---------AEGK---RRMIWGCDVGVA-----TVCAAAFK------GVSDAITAN.-------HQYGPV------QVGI
POLG_NVN68/1301-1766---------QKVK---KRLLWGADLGTV-----VRAARAFG------PFCDAIKSH.-------VIKLPI------KVGM
Q9DLK1_FMDVP/1865-2314---------RAGK---TRIVDVLPVEHI-----LYTRMMIG------RFCAQMHSNN-------GPQIGS------AVGC
POLG_VESVA/1379-1848---------AVGK---RRLIWGCDVGVS-----TVCAAAFK------RVSESIMAN.-------HALGFI------QVGI
POL1_BAYMY/1634-2098---------EPEK---TRVFTASPITSL-----FAMKFYVD------DFNKKFYAT.-------NLKAPH------TVGI

PF02123

Q83093_9VIRU/437-816---------.......SQKWQFEALWKD-----LQIKHASA------PAAEA.....-------...........DISGF
Q66150_9VIRU/22-408---------.......SKASQVALLWED-----LARKHQTH------PGAMA.....-------...........DISGF
Q86519_9VIRU/516-902---------.......LTPEQIRLVWDD-----VFQKHQAH------PAAEA.....-------...........DISGF
RDRP_SCPMV/464-849---------.......SVIHQADAIFRD-----LRVKHTVC------PAAEA.....-------...........DISGF
RDRP_SBMVA/490-847---------.......SLRQQAKSLFDD-----LRVKHSRC------PAAEA.....-------...........DISGF
RDRP_PEMVW/733-1124---------.......SQDHQVLAFTES-----VAALAG.T------SAQDLVDNWS-------RYLTPT.....DCSGF
RDRP_PLRVW/609-1004---------.......STDTQTAEFLEC-----LQKVSGAP------SVEELCANHK-------EHTRPT.....DCSGF
RDRP_TYYVF/580-974---------.......STDEQVLDFVES-----LARQVGTT------TTE.VVANWK-------NYLTPT.....DCSGF
Q65969_9LUTE/603-996---------.......STDEQVAEFMQI-----LSAQVGLT------PSD.LITEWR-------AHMIAT.....DCSGF
RDRP_ROTGI/108-803---------SHGIPMGTRNVPARQTRGI-----FILPWQVA------AVQHTIAESL-------YKRAKKGAYQGSFAEA
RDRP_ROTHC/109-749---------RNPIPLGRRDVPGRRTRAI-----FILPYQYF------IAQHSFAEIM-------LNYAKR...EREYSEF
O55590_9REOV/104-749---------THPIPLGRRDVPGRRTRII-----FILPYEYF------LAQHAVVEKM-------LQYAKH...TREYAEF
RDRP_ROTPY/100-748---------DRPIPLGRRDVPGRRTRII-----FILPYEYN------SAQHAVVEKM-------LSYAKH...TREYAEF
Q90153_9VIRU/1025-1530---------NETGGK.ARAIYGVTLWHY-----IFSNWLMA------PVEKHLNHRS-------VDINLD.....GSAML
Q90193_9VIRU/400-785---------.......SRSLWPAHLVHY-----VLVSMILH------LIDKSGEIPG-------SRNNAPSDRQLKDHWM
RDRP_PCVC/362-832---------KYEVGKKDRTLLPGTLVHF-----VVFTYVLY------LAEKQGQIGS-------VRLNTD..SEVDIRYF
RDRP_SCVLB/837-1303---------EWGK...VRALYGCDFSSH-----TMADFGLL------QCEDTF....-------....PGFVPTGSYANE
Q87025_SCVLA/177-657---------EWGK...QRAIYGTDLRST-----LITNFAMF------RCEDVLTHKF-------PVGDQA.....EAAKV
Q90155_TTV1/96-539---------EHGK...ERFIYNCDTISY-----VYFDFVLK------LFESGWQDSE-------AILSPG...DYSSECL
Q9JE94_9VIRU/129-560---------EHGK...TRFIYNCDTVSY-----IYFDYILN------YIESVWSNKH-------VLLNPDYMNPVIFSTL
Q8V615_9VIRU/41-473---------EHGK...TRYIYNCDTXSY-----LFFDYILH------YVECVWSNES-------VLLNPAAMSVERFSVL
Q83073_9VIRU/49-523---------EHGK...SRLLLACDTLSY-----LWFEYYLK------PVETAWLNKR-------TLLNPG...VVNHYSM
RDRP_LRVLG/155-619---------EHGK...TRLLLACDTLSY-----MWFEYALR------PVERIWENSN-------VILDPG...SMGNCGI
Q98XW8_9VIRU/144-622---------EQGK...GRAIYSCDTLSY-----TAFSWLLE------AVEKEWASRS-------VILNPG...KGGTLGM
Q99AT3_9VIRU/99-573---------EAGK...TRAIFACDTVNY-----LAFEHLLA------PVEKRWRNSK-------VILDPG...RGGHLGM
Q9YXE4_9VIRU/99-573---------EHGK...TRAIFACDTLNY-----LAFEHLLA------SVESRWRGER-------VVLNPG...RGGNVGM
RDRP_HV19S/122-585---------ENGK...DRAIFACDTRSY-----FAFTYWLT------PIEKKWRGAR-------VILNPG...EGGLYGT
Q9YXE6_9VIRU/120-589---------EHGK...TRAIFACDTRSY-----FAFEWLLG------ATQKAWRNHR-------VLLDPG...GGGHLGI

PF04197

RDRP_IBDVU/1-875---------DLEKGEANCTRQHMQAAMY-----YILTRGWS.DNGDPMFNQTWATFA-------MNIAPALVVDSSCLIM
RDRP_IPNVJ/1-842---------DLEKGEANCTPQHMQAMMY-----YLLTRGWTNEDGSPRYNPTWATFA-------MNVAPSMVVDSSCLLM
RDRP_BSNV/1-863---------DLEKGEANATPEHAQAVSY-----YLLTRGWTQDDGSPAFNATWATIA-------MMIAPSLVVDSSCLFM

PF00078

A0A066NJ57_LELAM/135-366RATEEGT----------------PQGAVISPLLANIYLHYVFDL------------------------------WAHQW-
A0A0F6CD22_ECOLX/115-332FPVNSGT----------------PQGGIISPVLANIALDGLEAL------------------------------LASEF-
D7ZFU1_ECOLX/62-269CTKDDFV----------------VQGALTSSYIATLCLFAVEGD------------------------------VVRRA-
A0A0E0UMT2_SINMB/72-291IERSRGT----------------PQGGVVSPILANLFLHYAFDL------------------------------WMTRT-
Q47526_ECOLX/33-239KNGALVL----------------SVGAPSSPFISNIVMSSFDEE------------------------------ISSFC-
O01419_BOMMO/502-756KAVSCGV----------------PQGSVLGPLLWDVGFDWVLRG------------------------------ANLR.-
O18558_AEDAE/472-725KLSVCGC----------------PQGGVLSPLLWNLVADTLLRQ------------------------------LNNC.-
O42691_ALTAL/36-202SFEYTIM----------------PMGLATAPSVFQRFINSVLNP------------------------------YLG..-
O44316_DROMR/394-650FVPARGV----------------KQGDPLSPVLFNLIIDRLLRS------------------------------LPKDI-
O52231_STREE/68-275YKTLVGT----------------PQGGNLSPLLSNIMLNELDKE------------------------------LEKR.-
O62658_CANFA/517-773FPLRSGT----------------RQGCPLSPLLFNIVVEVLASA------------------------------IRQQK-
O64612_ARATH/788-1031SVQVNGL----------------RQGCSLSPYLFVICMNVLSAM------------------------------LDKGA-
O65244_ARATH/405-664FSSAREL----------------RQGCSLSPYLFVISMDVLSKM------------------------------LDKAV-
O65598_ARATH/489-747FKSAKGL----------------RQGDPLSPYLFVLAMEVFSKL------------------------------LNSRF-
O81284_ARATH/58-317FVGKKGI----------------RQGDPMSSHLFVLVMDILARS------------------------------LDLGA-
O81454_ARATH/144-304LYECLVM----------------PFGLTNAPSTFMRLMNQVLRS------------------------------FIG..-
O93520_ORYLA/518-771ITLERGT----------------RQGCNMSALLFALYIEPLGQW------------------------------IRQRA-
O96546_LYMDI/526-780HPIKAGV----------------PQGSVLSPFLFTLYTSDMPKF------------------------------NRV..-
O99969_PORPU/100-315IIPQSGT----------------PQGGTISPLLANIALHGIEKL------------------------------VSKR.-
POL_RSVP/769-938RFQWKVL----------------PQGMTCSPTICQLVVGQVLEP------------------------------LRLKH-
POL_HTL1A/633-804RYAWKVL----------------PQGFKNSPTLFEMQLAHILQP------------------------------IRQAF-
POL_SMRVH/71-240RYQWKVL----------------PQGMANSPTLCQKFVAAAIAP------------------------------VRSQW-
POL_MMTVB/68-237RFQWKVL----------------PQGMKNSPTLCQKFVDKAILT------------------------------VRDKY-
POL_CAMVC/289-452HYEWNVV----------------PFGLKQAPSIFQRHMDEAFRV------------------------------FRK..-
POL_IPHA/60-229RFQWKVL----------------PQGMANSPTICQLYVQEALEP------------------------------IRKQF-
POL_HV1MA/655-826RYQYNVL----------------PQGWKGSPAIFQSSMTKILEP------------------------------FRTKN-
TF21_SCHPO/455-615VFEYLVM----------------PYGISTAPAHFQYFINTILGE------------------------------AKE..-
POK10_HUMAN/76-245RFQWKVL----------------PQGMLNSPTICQTFVGRALQP------------------------------VREKF-
POL4_DROME/357-523SYRFTRL----------------PFGLKIAPNSFQRMMTIAFSG------------------------------IEP..-
POLY_DROME/224-390KYEFCRL----------------PFGLRNASSIFQRALDDVLRE------------------------------QIG..-
POL_EIAV9/249-419RYVWNCL----------------PQGFVLSPYIYQKTLQEILQP------------------------------FRERY-
YTX2_XENLA/513-765LAFGRGV----------------RQGCPLSGQLYSLAIEPFLCL------------------------------LRKRL-
POL_SOCMV/246-411HYEWNVL----------------SFGLKQAPSIYQRFMDQSLKG------------------------------LEH..-
Y2R2_DROME/498-741VPVTRGC----------------PQGSISGPFIWDILMDVLLQR------------------------------LQPY.-
POL_BIV29/638-806RFQWNVL----------------PQGWVCSPAIYQTTTQKIIEN------------------------------IKKSH-
RDPO_ACUOB/124-343QPTTTGV----------------PQGGIISPLIMNLTLDGLEFH------------------------------IYKKI-
POL2_DROME/249-414HYEYLRM----------------PFGLRNAPATFQRCMNNILRP------------------------------LLN..-
RT67_ECOLX/48-262ACYNGTL----------------PQGSPCSPIISNLICNIMDMR------------------------------LAKLA-
RTJK_DROME/502-757KPIAAGV----------------PQGSVLGPTLYSVFASDMPTH------------------------------TPVTE-
POL_BLVAU/41-212RFAWRVL----------------PQGFINSPALFERALQEPLRQ------------------------------VSAAF-
POL_RTBVP/1228-1390LYTWNVC----------------PFGIANAPCAFQRFMQESFGD------------------------------LK...-
POL_CAEVC/210-380RYYWKVL----------------PQGWKLSPSVYQFTMQEILED------------------------------WIQQH-
P91581_CIOIN/483-644LYQYKRL----------------PFGVTNGVSAFQRIINRFIQD------------------------------NHL..-
P95451_PSEAC/119-326SPRQEGT----------------PQGGPLSPLLSNILLDELDRE------------------------------LERR.-
Q01379_NEUCS/505-761YAITAGV----------------PQGSPLSPILFILFITPLYRK------------------------------LATIP-
Q03261_SIV/246-416RYQFTVL----------------PQGWKGSPTIFQSTINQILQP------------------------------FRKKY-
Q04135_DROME/496-743CAIEAGV----------------PQGSVLGPILYTLYTADFPID------------------------------YNL..-
Q07995_CHITU/509-760KVIKFGV----------------PQGAVLSPTLYNIFTYDVVRE------------------------------TTN..-
Q08724_9CYAN/108-336SETTEGT----------------PQGGVISPLLANIALHGLEKL------------------------------VKEFA-
YRD6_CAEEL/484-644IFKYLRM----------------TFGLKPAPASFQKIMDKMVSG------------------------------LT...-
Q17329_CAEEL/1071-1231LFEWNVL----------------PFGLVISPALFQGTMEEIIGD------------------------------LLG..-
Q24262_DROME/531-692LFEFNKA----------------PFGFKNSPAAFIRFVQFIFQE------------------------------LINS.-
Q24690_DROTE/495-742LPLSNGI----------------PLGSPISVILFLIAFNKLSNI------------------------------ISLYK-
Q26816_9TRYP/545-793RTFERGV----------------PQGIVLGPIMFIIVMNSLSQR------------------------------LAEVP-
Q46666_ECOLX/34-241RKTKLIL----------------SVGAPSSPVISNFCMYEFDNR------------------------------IHAAC-
Q83013_9RETR/68-238RYQWTVL----------------PQGMKNSPYICQQVVAEVIRP------------------------------IRERF-
Q88285_9RETR/848-1015QYTWTRL----------------PQGFHASPGIFHQALYNGLAS------------------------------CKTAI-
POL_CSVMV/250-413YYQWKVL----------------PFGYHNSPSIFQQFMDRIFRP------------------------------YYD..-
Q93137_BOMMO/515-771RPLTAGV----------------PQGSVLSPLLFSLFVNDIPRS------------------------------PPT..-
Q93139_BOMMO/469-719RATSKGC----------------VQGSIGGPILWNLLLDPLIHQ------------------------------LQAR.-
Q94885_DROME/759-920QYEWLRM----------------PFGLKNAPSVFQRFVNKIFAD------------------------------MIRE.-
YG31B_YEAST/639-797KYEYTVM----------------PFGLVNAPSTFARYMADTFRD------------------------------LR...-
Q9YGS2_TAKRU/573-830SRVSHGV----------------PQGSVLGPILFTLYMLPLGNI------------------------------IRQH.-
Q9YW31_MSEPV/161-406IKINKGI----------------KQGCAVSLSLFNIYIDHIMNE------------------------------WKQHN-
Q9ZNW4_SORBI/922-1081TYCYTRM----------------PEGLKNAGATFSRMMGKVLGS------------------------------QLQ..-
Q9ZQ67_ARATH/542-701TYCYKVM----------------PFGLKNVGARYQRLVNQMFAP------------------------------QLG..-
Q9ZQQ6_ARATH/659-918FGSKRGL----------------RQGCALSPYLFVICMNVLSHM------------------------------IDVAA-
Q9ZS84_SOLLC/655-815SYEFLVM----------------PFGLTNAPATFCNLMNNVLFD------------------------------YLD..-
Q9ZVK4_ARATH/510-669HFEFVVM----------------PFGLTNAPAAFMRLMNSVFQE------------------------------VLD..-

PF05919

Q6EH16_9VIRU/1-501ISYAVGQ----------------PMGAYSSFAMLALTHHVLVQV------------------------------AAQKA-
Q5TMB5_9VIRU/174-658VRYGCGQ----------------PIGAYSSWATFTLCHHMIVQM------------------------------LCHRY-
Q18L80_9VIRU/166-639VQYQVGQ----------------PMGALSSWGMLALTHHLVVQY------------------------------SAYLA-
Q9WJ23_9VIRU/164-642LHYKVGQ----------------PMGAYSSWAAFTLTHHLVVFY------------------------------SARMA-
RDRP_CPMV1/246-745LTYAVGQ----------------PMGAYSSFAMLALTHHVIVQV------------------------------AALNS-
Q9ZXZ7_THACU/214-754YFYEVGQ----------------PMGALSSWPGLALTHHWIVQV------------------------------AAFRV-
Q9WJ22_9VIRU/155-622YRYSVGQ----------------PMGAYTSWAAFTLTHHLVVHW------------------------------AAELA-
Q6EH19_9VIRU/208-686LRWGAGQ----------------PLGAKSSWAIFTLCHHLVVHI------------------------------AAVRT-
Q9WJ24_9VIRU/163-645VSYNCGQ----------------PMGAQSSWPMFTLAHHVIVRV------------------------------AANRC-
Q6GYC2_9VIRU/156-638IKYSVGQ----------------PMGAYSSWPAFTLSHHLVVHW------------------------------CAHLC-
Q18L78_9VIRU/174-654LMYSVGQ----------------PMGALSSWGMLALTHHTIVQV------------------------------AASRA-
Q18L79_9VIRU/168-671VRYGAGQ----------------PMGAYSSWAMLALTHHFIVQY------------------------------CAFKV-
Q3S3F3_9VIRU/120-606LRYAVGQ----------------PMGAYSSWAAFTLSHHLVVAW------------------------------CTYKS-
O92614_9VIRU/173-711YRYSVGQ----------------PMGALSSWAMLALSHHVIVQI------------------------------AAMRV-

PF07727

Q7G640_ORYSJ/781-1029VCKLKRS----------------LYGLKQSPRQWYKRFDSFMLS------------------------------HGFKR-
Q7XLN3_ORYSJ/465-703....KKS----------------LYGLKQSDRMWYNRLSEILSL------------------------------KGYTK-
Q7XTU6_ORYSJ/940-1185VLKLRKA----------------LYGLRQAPRAWNAKLDNTLLS------------------------------LKFNK-
Q7XKS1_ORYSJ/160-403VCCLRCS----------------LYGLKQAPRAWFQRFSSVVLE------------------------------AGFST-
Q9FWI2_ORYSJ/795-1030VFRLKKA----------------LYGLKQAPRAWYSQIDQYFIQ------------------------------KGFAK-
Q94I36_ORYSJ/864-1109VFKLSKA----------------LYGLKQAPMAWYDRLKNFLLA------------------------------KGFTM-
Q7G6C9_ORYSJ/1047-1286VYELHKA----------------LYGLKQAPRAWYECLRDFLLK------------------------------NGFEI-
Q94LQ7_ORYSJ/550-793VCKLDKA----------------LYGLKQAPRAWYSRLSTKLHE------------------------------LGFKS-
Q7XKG6_ORYSJ/514-759VLRLKKS----------------LYGLKQSPRAWFDRFRRAMCG------------------------------MGYKQ-
Q7X5X4_ORYSJ/138-383VYHLKHA----------------LYSLRQAPRMWNAKLDGTLRC------------------------------LGFKR-
Q84M55_ORYSJ/910-1155VCKLKKS----------------LYGLKQSPRAWFDRFRHAVCD------------------------------MGYSQ-
Q7Y173_ORYSJ/398-645ACKLKKS----------------IYELKQASRQWYLKFDEIIKR------------------------------FGFKE-
Q8W5F4_ORYSJ/472-717VCKLLKS----------------LYGLKQAPKQWHEKFDKTLTS------------------------------AGFAV-
Q7XUD9_ORYSJ/916-1161VLRLDKA----------------LYGLRQAPRAWNSKLEATLLS------------------------------LGFRR-
Q8LNW7_ORYSJ/880-1128VCRLKKS----------------LYGLKQSPRQWYKRFDSFMLS------------------------------QKFRR-
Q94HQ0_ORYSJ/485-718VLRLHKA----------------LYGLRQAPRAWNAKLDSTLKG------------------------------MGFEQ-
Q7Y1I1_ORYSJ/727-972VLKLDKA----------------LYGLRQAPRVWNAKLDTSLTS------------------------------LGFRR-
Q94GR9_ORYSJ/975-1220VYKLSKA----------------LYGLKQAPRAWYERLKDFLLS------------------------------KDFKI-
Q7X7N0_ORYSJ/758-1003VCLLQRS----------------LYGLKQAPRAWYQRFATYIRQ------------------------------LGFTP-
Q7XZY2_ORYSJ/297-542VLILQKT----------------LYGLKQAPRAWNAKLDESLVS------------------------------LGFRR-
Q7XN62_ORYSJ/915-1162GCRLKRS----------------IYGLKQASRQWYLKFDGTIKK------------------------------FGFQE-
Q7XLI2_ORYSJ/53-298VCRLNKS----------------LYGLKQAPRAWYSRFASFLLT------------------------------LGFVE-
B5RTA2_DEBHA/1170-1414CWQLNKS----------------VYGMKQAGYMWYQCITKVLMD------------------------------LNFEP-
B5RTR8_DEBHA/1021-1254VCKLNKS----------------LYGLKQAPICWNTTISDFLAE------------------------------HRFNR-
E7KRB3_YEASL/146-383VWELYGG----------------MYGLKQAPLLWNEHINNTLKK------------------------------IGFCR-
Q2R072_ORYSJ/915-1159VYRLDKA----------------LYGLRQAPRAWNTKLDCTLKK------------------------------LGFKQ-
Q59K02_CANAL/999-1236VCKLNRS----------------LYGLKQSPLMWNIKLNDVLIK------------------------------EGFRR-
Q5AG24_CANAL/888-1133SWRLHKS----------------VYGLRQSAHNWYSHFKNVLEA------------------------------NGLKQ-
Q5AH82_CANAL/122-366CWLLKRS----------------VYGLKQSGFEWYHTIKRVLED------------------------------IGFNQ-
Q7XN23_ORYSJ/31-274VCKLDKA----------------LYGLKQATRAWYSRLSKKLVE------------------------------LGFEA-
Q8S476_MAIZE/836-1081VCRLIKS----------------LYGLKQAPKQWHEKFDNTLTA------------------------------AGFVV-
Q8S479_MAIZE/1073-1313VCKLSKA----------------LYGLMQAPRAWYECLRNFLIA------------------------------NAFKV-

PF00978

R1AB_LIYV9/1925-2366ATC..GV----------------DLELGTQRRT..GSPNTWLSNT...L...VT--------------------LGMML-
R1AB_BYVU/2601-3046LDG..QL----------------SFSVDNQRKS..GASNTWIGNS...I...ET--------------------LGILS-
Q9YPH5_9VIRU/1359-1796RIN..GV----------------QAYLLYQQKS..GNCDTYGSNT...W...SA--------------------ALALL-
POLN_EEVVM/2041-2488FRF..GA----------------MM......KS..GMFLTLFVNT...V...IN--------------------MVIAS-
E0YCR0_9CLOS/53-491MTK..EL----------------VLSVGSQRRS..GGANTWLGNS...L...VL--------------------CTLLS-
RDRP_TOMS1/1168-1609YTA..GI----------------KTCLWYQRKS..GDVTTFIGNT...V...II--------------------ASCLA-
RDRP_PSVJ/295-726KRA..GV----------------SMPISFQRRT..GDAFTYFGNT...L...VT--------------------MALFS-
Q66107_9BROM/228-662RDT..GV----------------GFAVDFQRRT..GDANTYLGNT...L...VT--------------------LICLA-
Q87644_SINDV/2053-2501FKF..GA----------------MM......KS..GMFLTLFVNTVLNV...VI--------------------ASRVL-
O56790_9VIRU/1323-1760RQN..GL----------------IAHILYQQKS..GNCDTYGSNT...W...SA--------------------ALALL-
RDRP_CMVFN/308-738RRA..GV----------------GMPISFQRRT..GDALTYFGNT...I...VT--------------------MAEFA-
Q9WJD8_PEBV/1299-1738VQN..GM----------------TAYIWYQQKS..GDADTYNANS...D...RT--------------------MCALL-
Q80875_BSMV/195-630RNF..GL----------------EAYLLYQQKS..GNCDTYGSNT...W...SA--------------------ALALL-
RDRP_RBDVR/1234-1674QNV..GI----------------GFKTDFQRRT..GDAFTFLGNS...L...VT--------------------AAMLA-
RDRP_SBWMN/1373-1810FVN..GI----------------TAYLLYQQKS..GNCDTYGSNT...W...SA--------------------ALALL-
POLN_ONNVI/2053-2501FKF..GA----------------MM......KS..GMFLTLFVNT...L...LN--------------------ITIAS-
RDRP_TAV/313-742KRA..GV----------------SMPISFQRRT..GDAFTYFGNT...L...VT--------------------MSMFA-
POLN_MIDDV/534-981FKF..GA----------------MM......KS..GMFLTLFVNT...M...LN--------------------MTIAS-
RDRP_TMGMV/1163-1604YIA..GI----------------KTCLWYQRKS..GDVTTFIGNT...V...II--------------------AACLG-
RDRP_TOBSV/253-689RDC..GI----------------GFSVDYQRRT..GDACTYLGNT...L...VT--------------------LSVLS-
RDRP_OLV2I/310-732KNL..GI----------------AFSVDYQRRT..GNTATYFGNT...L...VT--------------------MIMMA-
RDRP_YOMV/1155-1594YTA..GI----------------KTCLWYQRKS..GDVTTFIGNT...I...II--------------------AACLS-
RDRP_AMVLE/318-752SKN..GV----------------FFNVDFQRRT..GDALTYLGNT...I...VT--------------------LACLC-
POLN_RRVN/2019-2467FKF..GA----------------MM......KS..GMFLTLFINT...LLNIVI--------------------ACRVL-
RDRP_ASPVP/1758-2169SKL..G.----------------SFAIM..RFT..GEASTFLFNT...M...AN--------------------MLFTF-
O56250_9VIRU/1240-1678IQN..GM----------------MAHIWYQQKS..GDADTYNANS...D...RT--------------------LCALL-
O90699_9VIRU/1363-1800RVN..GL----------------VAHLLYQQKS..GNCDTYGSNT...W...SA--------------------ALSLI-
Q9Q6Q3_9CLOS/62-509GKN..EL----------------VLSVGAQRRS..GGANTWLGNT...L...VL--------------------MTLLA-
POLN_AURAV/2038-2486FKF..GA----------------MM......KS..GMFLTLFVNT...V...LN--------------------VVIAS-
RDRP_BBMV/271-697WTLRPGV----------------SIPLL..SKTNRG.CFHLLWEH...F...SD--------------------NAMMA-
RDRP_CCMV/267-697PHA..GV----------------NMPVSFQRRT..GDAFTYFGNT...L...VT--------------------MAMMA-
Q66581_EEEV/144-598FKF..GA----------------MM......KS..GMFLTLFINT...V...VN--------------------IMIAS-
Q9QGG9_9BROM/363-797GPC..GV----------------GFSVNYQPRT..GDACTYLANT...I...IT--------------------LSALA-
RDRP_TMOB/1167-1614YTA..GI----------------KTCLWYQRKS..GDVTTFIGNT...V...II--------------------AACMA-
RDRP_BMV/256-688PHA..KV----------------GMSVSFQRRT..GDAFTYFGNT...L...VT--------------------MAMIA-
O40960_9CLOS/62-506ATC..GV----------------NLDLYCQRRT..GSPNTWLSNS...L...AT--------------------LAMLA-

PF00998

RDRP_TNVA/224-703ASD--GI--------------.IKYKKKGCRMS--GDMNTSLGNC-------IL--------------------MCAMV-
RDRP_TCV/272-752ASD--GF--------------.IKYQVDGCRMS--GDVNTALGNC-------LL--------------------ACSIT-
RDRP_TNVD/224-709CPD--GE--------------.IRYRVEGCRMS--GDMNTSSGNC-------YI--------------------MCATV-
RDRP_MCMVK/460-941ASD--GA--------------.FNYQVDGKRMS--GDMNISLGNC-------IL--------------------ATAIT-
POLG_HCVEU/2430-2941NSK--GQ--------------..SCGYRRCRAS--GVLPTSMGNT-------LT--------------------CYLKA-
POLG_HCVED/2420-2931NSK--GD--------------..LCGYRRCRAT--GVYTTSFGNT-------LT--------------------CYLKA-
POLG_HCVJL/2434-2945NSQ--GQ--------------..SCGYRRCRAS--GVLPTSMGNT-------LT--------------------CYLKA-
POLG_HCVJK/2431-2942NSK--GQ--------------..HCGYRRCRAS--GVLPTSFGNT-------VT--------------------CYLKA-
POLG_HCVEV/2426-2937NSK--GQ--------------..QCGYRRCRAS--GVFTTSMGNT-------MT--------------------CYIKA-
POLG_HCVJ6/2445-2956NSK--GQ--------------..TCGYRRCRAS--GVLTTSMGNT-------IT--------------------CYVKA-
Q9IR83_9TOMB/236-712AND--GY--------------.IRYKVDGCRMS--GDVNTAMGNC-------LL--------------------ACLIT-
Q87031_9LUTE/24-502FVE--DK--------------ILKFKVKGHRMS--GDINTSSGNK-------LI--------------------MCGMM-
RDRP_POLVP/251-722LKD--GF--------------.VRYRVDGCRMS--GDMNTSMGNY-------LI--------------------MSCLV-
Q65987_9TOMB/269-750ASD--GY--------------.IKYQVEGCRMS--GDVNTAMGNC-------LL--------------------ACSIT-
P90338_9TOMB/1-480AHD--GL--------------.IRYKVDGCRMS--GDMNTALGNC-------IL--------------------ACLIT-
RDRP_BYDV1/361-840FVE--DK--------------MLRFKVRGHRMS--GDINTSMGNK-------LI--------------------MCGMM-
O09796_9HEPC/2422-2933NSK--GQ--------------..NCGYRRCRAS--GVLTTSCGNT-------LT--------------------CYLKA-
O09803_9FLAV/2373-2866TPE--GV--------------..PVGERYCRSS--GVLTTSASNC-------LT--------------------CYIKV-
O37361_9VIRU/252-737CKE--GT--------------.FHYEKVGGRCS--GDSDTSLGNV-------SI--------------------MLAIT-
Q9WJD9_CARMV/267-744ASN--GM--------------.LRYTKEGCRMS--GDMNTALGNC-------LL--------------------ACLIT-
Q83103_9TOMB/228-711CPD--GT--------------.ARYKVDGCRMS--GDMNTSSGNC-------FI--------------------MCATV-
Q66127_9TOMB/52-520CKD--GL--------------.VKYKVKGCRMS--GDMDTALGNC-------VL--------------------MVLMT-
RDRP_PMVK/447-937TND--GF--------------.FKYLVDGKRMS--GDMNTSLGNC-------IL--------------------ASLIV-
POLG_GBVB/2277-2785AYD--GR--------------..EIGYRRCRSS--GVYTTSSSNS-------LT--------------------CWLKV-
Q89801_9TOMB/1-479LPE--GK--------------.VKYTRRGCRMS--GDMNTAMGNC-------LL--------------------ACAIT-
Q9IRA1_9TOMB/266-741ASD--GF--------------.ARYSVDGCRMS--GDINTALGNC-------LL--------------------SCAIT-
O12301_GAMV/231-708ASD--GC--------------.IKYKKTGCRMS--GDMNTSLGNC-------LI--------------------MCGMV-
Q83424_MNSV/290-772ASD--GM--------------.IKYKVDGCRMS--GDMNTAMGNC-------LI--------------------ACAIT-
O41892_PEGIA/2409-2899SPD--GV--------------..MLGHRACRSS--GVLTTSSANS-------XT--------------------CYIKX-
RDRP_OCSVU/235-734TPD--GA--------------.VSYTIEGTRMS--GDMNTSLGNC-------VL--------------------MCMMI-
Q9IW60_9TOMB/325-800VPD--GT--------------.ITYRKEGCRMS--GDINTSLGNY-------LL--------------------MCAMV-
Q96898_9FLAV/2396-2886SPD--GV--------------..PLGYRQCRSS--GVLTTSSANS-------IT--------------------CYIKV-
RDRP_RCNMV/260-745LPT--GE--------------LVRYRTKGCRMS--GDINTGLGNK-------IL--------------------MCSMV-

PF00972

POLG_YEFV1/2758-3406APGGKAY--------------MDVISRRDQRGS--GQVVTYALNTITNLKVQLIRMAEAEMVIHHQHVQDCDESVLTRL-

PF00680

POLG_HAVHM/1750-2215DP.DRQW---DELFKTMIRFGDVGLDLDFSAFD-ASLSPFMIREA-------..--------------------GRIMS-
RDRP_BPPH6/19-638NKEEKVK---E.........WSLCVATDVSDHD-TFWPGWLRDLI-------CD--------------------ELLNM-
POLG_PYFV1/2270-2778NPHSREW---SDLAISLASFSPYGFNGDFANFD-GMFHPSSFSMV-------..--------------------SELAN-
POL1_CPMVS/1186-1687NPYSMEW---SRLAARMKEKGNDVLCCDYSSFD-GLLSKQVMDVI-------..--------------------ASMIN-
POLG_RHDVF/1279-1750DMTSRDV---DVIINNLTSKASDFLCLDYSKWD-STMSPCVVRLA-------..--------------------IDILA-
POLG_PVYN/2293-2763TKFYGGW---DKLLRRLPE.NWVYCDADGSQFD-SSLTPYLINAV-------..--------------------LTIRS-
POLG_EMCVR/1844-2288DP.DVHW---TAFGVAMQG.FERVYDVDYSNFD-STHSVAMFRLL-------..--------------------A...E-
POLG_FCVUR/1266-1735NMDSPSV---EALHQRIKS.AAKVYAVDYSKWD-STQSPRVSAAS-------..--------------------IDILR-
POLG_NVN68/1301-1766NT.IEDG---PLIYAEHAK.YKNHFDADYTAWD-STQNRQIMTES-------..--------------------FSIMS-
Q9DLK1_FMDVP/1865-2314NP.DVDW---QRFGTHFAQ.YKNVWDVDYSAFD-ANHCSDAMNIM-------FE--------------------EVFRT-
POLG_VESVA/1379-1848NMDGPAV---EDLFKRLERPKHDRYCVDYSKWD-STQPPKVTSQS-------..--------------------IDILR-
POL1_BAYMY/1634-2098NKFGRGW---ERLHDKLNRPGWLHGSGDGSRFD-SSIDPFFFDVV-------..--------------------KTIRK-

PF02123

Q83093_9VIRU/437-816DWSVQKW...................ELEADVC.MRIERGNFPA.-------RM--------------------RKAAL.
Q66150_9VIRU/22-408DWSVQDW...................ELWADVS.MRIELGSFPA.-------LM--------------------AKAAI.
Q86519_9VIRU/516-902DWSVQDW...................ELWSDLA.IRINRGNFQG.-------NL--------------------RRAAI.
RDRP_SCPMV/464-849DWSVQDW...................ELWADVE.MRIVLGSFPP.-------MM--------------------ARAAR.
RDRP_SBMVA/490-847DWSVQDW...................ELWADVE.MRIVLGGFGH.-------KL--------------------AKAAQ.
RDRP_PEMVW/733-1124DWSVPMW...................LLEDDLAVRNELTLGLPH.-------GL--------------------RKMRE.
RDRP_PLRVW/609-1004DWSVAYW...................MLEDDMEVRNRLTFNNTQ.-------LT--------------------ERLRA.
RDRP_TYYVF/580-974DWSVADW...................MLHDDMIVRNRLTIDLNP.-------AT--------------------ERLRS.
Q65969_9LUTE/603-996DWSVSDW...................LLEDDMEVRNRLTLDLNE.-------TT--------------------RRLRS.
RDRP_ROTGI/108-803YTAKTASLTYGVLAEDTSKATKIILYTDVSQWDASQHNTEPYRS.-------AW--------------------INAIRE
RDRP_ROTHC/109-749YSQANQVLSYGDVTRYLDSNSILCF.TDVSQWDASQHNTKVLRRS-------II--------------------RAMKRL
O55590_9REOV/104-749YSQSNQLLSYGDVTRFLSDDALVLY.TDVSQWDSSQHNTEPFRKG-------II--------------------AGLDKL
RDRP_ROTPY/100-748YSQSNQLLSYGDVTRFLSSNSMVLY.TDVSQWDSSQHNTQPFRKG-------II--------------------MGLDML
Q90153_9VIRU/1025-1530TATLHRL........GQVEANMVFNSYDYPDFN.SMHTYEHMAS.-------IY--------------------RAAKRC
Q90193_9VIRU/400-785WSECQDF...............VPLMMDYANFN.EQHSIEAMKA.-------TI--------------------QPLRD.
RDRP_PCVC/362-832DKKMCTG..............VFHVLYDWADFN.EQHSAWEMGV.-------VV--------------------DYLKH.
RDRP_SCVLB/837-1303DYVRTRI.........AGTHSLIPFCYDFDDFN.SQHSKEAMQA.-------VI--------------------DAWIS.
Q87025_SCVLA/177-657HKRVNMM...........LDGASSFCFDYDDFN.SQHSIASMYT.-------VL--------------------CAFRD.
Q90155_TTV1/96-539HAKISGY..............KYKAMLDYTDFN.SQHTIQSMRL.-------IF--------------------ETMKE.
Q9JE94_9VIRU/129-560NYDEYCM...................LDYTDFN.SQHSIESMKQ.-------VF--------------------LCLFP.
Q8V615_9VIRU/41-473DYPEYCM...................IDYTDFN.SQHSLESQKL.-------VF--------------------ECLRP.
Q83073_9VIRU/49-523AKKVKVLLADAEHDETNIERGTKLYSLDFEDFN.SQHSLAAQKM.-------VF--------------------EELFK.
RDRP_LRVLG/155-619ATRINGW........RNGMPGQSFFAVDYDDFN.SQHTLMSQKI.-------VF--------------------EELFH.
Q98XW8_9VIRU/144-622MNRIRGA........ATGGRRQCYLMLDYSDFN.SQHSNEAMRI.-------VI--------------------EETLA.
Q99AT3_9VIRU/99-573IFRTTAA..........RARAGVSMMLDYDDFN.SHHSTRAMQM.-------LF--------------------QRLGD.
Q9YXE4_9VIRU/99-573SFRVAAA..........RQRAGISLMLDYDDFN.SHHSIRAMQI.-------LF--------------------EETAA.
RDRP_HV19S/122-585ARRIRGS..........QTSGGVNLMLDYDNFN.SQHSNETMAA.-------LY--------------------EKALS.
Q9YXE6_9VIRU/120-589SRRVRSF..........MKHGGVNLMLDFDDFN.SHHSLNSQRM.-------LF--------------------GELCD.

PF04197

RDRP_IBDVU/1-875NLQIKTY-GQGSGNAATFINNHLLSTLVLDQWNLMKQPSPDSEEF-------KS--------------------IEDKL-
RDRP_IPNVJ/1-842NLQLKTY-GQGSGNAFTFLNNHLMSTIVVAEWVKAGKPNPMTKEF-------MD--------------------LEEKT-
RDRP_BSNV/1-863NLQLKTY-GQGSGNAWTFLINHTLSTILVGKWIEAGQPNPRSKEF-------MD--------------------LEAAT-

PF00078

A0A066NJ57_LELAM/135-366------------------------R....RRY...ATGN--VVMVRYADDIVI---GFDK.RYD----------------
A0A0F6CD22_ECOLX/115-332------------------------KK.RTVKGR.LVNPK--VNYVRYADDFII---TGES.KEL----------------
D7ZFU1_ECOLX/62-269------------------------......Q.....RKG--LVYTRLVDDITV---SSKISNYD----------------
A0A0E0UMT2_SINMB/72-291------------------------............HPD--LPWCRYADDGLV---HCQS.EQQ----------------
Q47526_ECOLX/33-239------------------------......K.....ENK--ISYSRYADDLTF---STNE.RDV----------------
O01419_BOMMO/502-756------------------------..............G--VQVICYADDTLV---TARGDDYR----------------
O18558_AEDAE/472-725------------------------..............G--FPTYGFADEYLA---LIVG.MCI----------------
O42691_ALTAL/36-202------------------------...............--IFCHAYLDDVVI---FTKGSLDQ----------------
O44316_DROMR/394-650------------------------G....VHV...GNAK--VNACAFADDLML---FAST.PKG----------------
O52231_STREE/68-275------------------------..............G--LRFVRYADDCVI---TVGS.EAA----------------
O62658_CANFA/517-773------------------------DF..RGIQ..FGKEE--VKLSLFADEMIL---YIEN.PKV----------------
O64612_ARATH/788-1031------------------------VEKRFGYHPRCRNMG--LTHLCFADDIMV---FSAGSAHS----------------
O65244_ARATH/405-664------------------------GARQFGYHPKCRAIG--LTHLSFADDLMI---LSDG.KVR----------------
O65598_ARATH/489-747------------------------DSGYIRYHPKASDLS--ISHLMFADDVMI---FFDG.GSS----------------
O81284_ARATH/58-317------------------------VEGRFVLHPKCLAPM--ITHLSFADDILV---FCDGSLSS----------------
O81454_ARATH/144-304------------------------...............--KFVVVYFDDILI---YNKS.YSD----------------
O93520_ORYLA/518-771------------------------DI..KGVK..VSGKE--QKLSLFADDLLL---TISQ.PTK----------------
O96546_LYMDI/526-780------------------------...............--.HKALYADDTAL---FCAG.RSP----------------
O99969_PORPU/100-315------------------------..............G--VYLIRYADDFLV---LCNE.EKE----------------
POL_RSVP/769-938------------------------.............PS--LCMLHYMDDLLL---AASS.HDG----------------
POL_HTL1A/633-804------------------------.............PQ--CTILQYMDDILL---ASPS.HED----------------
POL_SMRVH/71-240------------------------.............PE--AYILHYMDDILL---ACDS.AEA----------------
POL_MMTVB/68-237------------------------.............QD--SYIVHYMDDILL---AHPS.RSI----------------
POL_CAMVC/289-452------------------------...............--.FCCVYVDDILV---FSNN.EED----------------
POL_IPHA/60-229------------------------.............TS--LIVIHYMDDILI---CHKE.LDV----------------
POL_HV1MA/655-826------------------------.............PE--IVIYQYMDDLYV---GSDLEIGQ----------------
TF21_SCHPO/455-615------------------------...............--SHVVCYMDDILI---HSKS.ESE----------------
POK10_HUMAN/76-245------------------------.............SD--CYIIHYIDDILC---AAET.KDK----------------
POL4_DROME/357-523------------------------...............--SQAFLYMDDLIV---IGCS.EKH----------------
POLY_DROME/224-390------------------------...............--KICYVYVDDVII---FSEN.ESD----------------
POL_EIAV9/249-419------------------------.............PE--VQLYQYMDDLFV---GSNGSKKQ----------------
YTX2_XENLA/513-765------------------------TG..LVLK..EPDMR--VVLSAYADDVIL---VAQD.LVD----------------
POL_SOCMV/246-411------------------------...............--.ICLAYIDDILI---FTKGSKEQ----------------
Y2R2_DROME/498-741------------------------...............--CQLSAYADDLLL---LVEG.NSR----------------
POL_BIV29/638-806------------------------.............PD--VMLYQYMDDLLI---GSNR..DD----------------
RDPO_ACUOB/124-343------------------------Q...KSSS...QSKG--NTYCRYADDMVI---LTTT.EET----------------
POL2_DROME/249-414------------------------...............--KHCLVYLDDIII---FSTS.LTE----------------
RT67_ECOLX/48-262------------------------......K.....KYG--CTYSRYADDITI---STNK.NTF----------------
RTJK_DROME/502-757------------------------.....VD.....EED--VLIATYADDTAV---LTKS.KSI----------------
POL_BLVAU/41-212------------------------.............SQ--SLLVSYMDDILY---VSPT.EEQ----------------
POL_RTBVP/1228-1390------------------------...............--.FALLYIDDILI---ASNN.EKE----------------
POL_CAEVC/210-380------------------------.............PE--IQFGIYMDDIYI---GSDLEIKK----------------
P91581_CIOIN/483-644------------------------...............--NKVYAYLDDITV---TGET.LEE----------------
P95451_PSEAC/119-326------------------------..............G--HRFVRYADDANI---YVRS.PRA----------------
Q01379_NEUCS/505-761------------------------..............N--TITVGFADDTNV---VAVA.RTT----------------
Q03261_SIV/246-416------------------------.............SD--LTLIQYMDDLLI---GTDRSEKA----------------
Q04135_DROME/496-743------------------------...............--.TTSTFADDTAI---LSRS.KCP----------------
Q07995_CHITU/509-760------------------------...............--.NIGLFADDTAL---YHSAENSA----------------
Q08724_9CYAN/108-336------------------------AS.QRGGKV.KNQNS--ISLIRYADDFVI---LAPN.KTQ----------------
YRD6_CAEEL/484-644------------------------...............--.GVAVYWDDIII---SASS.IEE----------------
Q17329_CAEEL/1071-1231------------------------...............--VCAFVYVDDLLI---ASKD.MEQ----------------
Q24262_DROME/531-692------------------------...............--NIMQLYMDDIIV---YAAT.PEE----------------
Q24690_DROTE/495-742------------------------..............E--IKFNAYADDFFL---IINF.KKN----------------
Q26816_9TRYP/545-793------------------------..............L--LQHGFFADDLTL---FSRH.TER----------------
Q46666_ECOLX/34-241------------------------......N.....KLE--ITYTRYADDLTF---SCNI.PNV----------------
Q83013_9RETR/68-238------------------------.............RD--AVIIHYMDDILI---AAAE.ERQ----------------
Q88285_9RETR/848-1015------------------------......E.....SQG--CKLLQYVDDILL---MSED.RDH----------------
POL_CSVMV/250-413------------------------...............--.FIIVYIDDILV---FSKT.IEE----------------
Q93137_BOMMO/515-771------------------------...............--.HLALFADDTTV---YYSS.RNK----------------
Q93139_BOMMO/469-719------------------------..............G--EYIQAFADDVVL---VFDG.DSA----------------
Q94885_DROME/759-920------------------------...............--NKVVVYMDDILL---ATEN.INE----------------
YG31B_YEAST/639-797------------------------...............--.FVNVYLDDILI---FSES.PEE----------------
Q9YGS2_TAKRU/573-830------------------------..............G--INFHCYADDTQL---YLSMKPEE----------------
Q9YW31_MSEPV/161-406------------------------IK..GIEL..NDNTN--LNYILYADDLVI---ISTN.KND----------------
Q9ZNW4_SORBI/922-1081------------------------...............--RNIIAYVDDVVV---MSKR.KED----------------
Q9ZQ67_ARATH/542-701------------------------...............--KTMEVYIDDMLV---KSTR.SAD----------------
Q9ZQQ6_ARATH/659-918------------------------VHRNIGYHPKCKKLS--LTHLCFADDLMV---FIDG.QQR----------------
Q9ZS84_SOLLC/655-815------------------------...............--DFVVVYLDDIVI---YSRT.LEE----------------
Q9ZVK4_ARATH/510-669------------------------...............--EFVIIFIDDILV---YSKS.LEE----------------

PF05919

Q6EH16_9VIRU/1-501--------------------------------.GFSDRF--TDYCILGDDIVI---ANSLVAEAYK-----------SLI
Q5TMB5_9VIRU/174-658--------------------------------...RAPR--SHYIILGDDIVI---AHDKVAEGYC-----------EIM
Q18L80_9VIRU/166-639--------------------------------FGKVNLF--KDYIVLGDDIVI---GNHEVSIRYH-----------YLM
Q9WJ23_9VIRU/164-642--------------------------------..GIKDF--TNYILLGDDIVI---NNDKVAKYYI-----------RTM
RDRP_CPMV1/246-745--------------------------------.GFTTRF--TDYCILGDDIVI---AHDTVASEYL-----------KLM
Q9ZXZ7_THACU/214-754--------------------------------TNSKSWN--TEYEILGDDIVI---FNELIAQEYL-----------NIM
Q9WJ22_9VIRU/155-622--------------------------------..GLKNF--KDYIILGDDIVI---KNNKVAQIYI-----------NLM
Q6EH19_9VIRU/208-686--------------------------------....NSD--PYYVILGDDIVL---RGSRLATVYK-----------RIM
Q9WJ24_9VIRU/163-645--------------------------------..GLSNF--DKYIILGDDIVI---NNDNVALKYM-----------EIM
Q6GYC2_9VIRU/156-638--------------------------------..HINKF--KDYIILGDDIVI---HNDKVAKKYI-----------EIM
Q18L78_9VIRU/174-654--------------------------------.GYKDLF--LDYALLGDDICI---ANKAVADNYL-----------LIM
Q18L79_9VIRU/168-671--------------------------------YHTNSFF--KDYLILGDDLLL---LDAKVAKQYL-----------QVM
Q3S3F3_9VIRU/120-606--------------------------------.KKVIRS--SQYIILGDDIVI---KDNDIARKYI-----------GQM
O92614_9VIRU/173-711--------------------------------..GKLPF--TNYALLGDDIVI---ADKAVATSYH-----------MIM

PF07727

Q7G640_ORYSJ/781-1029------------------------SEFDSCVYIKFVNGSH.IYLLLYVDDMLI---AAKSKEQI----------------
Q7XLN3_ORYSJ/465-703------------------------NDDFPCVFIKKSPTGF.CFISVYVDDLNI---IRNTQD.I----------------
Q7XTU6_ORYSJ/940-1185------------------------SATESAVYVRGVGDSK.LIVGVYVDDLII---TGSQKKEI----------------
Q7XKS1_ORYSJ/160-403------------------------SAHDPALFVHTSPRGC.TVLLLYVDDMLI---TGEDAEFI----------------
Q9FWI2_ORYSJ/795-1030------------------------SI..........STDI.LIVSLYVDDLIY---TANSEKMM----------------
Q94I36_ORYSJ/864-1109------------------------GKVDKTLFVLKHGDNQ.LFVQIYVDDIIF---GYSTHALV----------------
Q7G6C9_ORYSJ/1047-1286------------------------GKADTTLFTKKFKSDL.FICQIYVDDIIF---GSTNASFC----------------
Q94LQ7_ORYSJ/550-793------------------------SKSDTSLFFYSKGDVT.IFMLVYVDDIIV---ASSSIVAT----------------
Q7XKG6_ORYSJ/514-759------------------------CNGDHTLFYRHRGKKI.AILAVYVDDIII---TGDDTQEI----------------
Q7X5X4_ORYSJ/138-383------------------------SDTEHAVYVRAEGNTH.LIVGMYVDDLVI---TGSTVECI----------------
Q84M55_ORYSJ/910-1155------------------------CNGDHTVFYKHRGTHI.TILAVYVDDIVI---TGDDVEEI----------------
Q7Y173_ORYSJ/398-645------------------------NEVDNCIYIKTKGGKF.IILVLYVDDILL---ASSDINML----------------
Q8W5F4_ORYSJ/472-717------------------------NEADKCVYYRHGGGEG.VILCLYVDDVLI---FGTNLEVI----------------
Q7XUD9_ORYSJ/916-1161------------------------NDCEHAVYVRGNTSAR.LLVGVYVDDLII---TGTKEDEI----------------
Q8LNW7_ORYSJ/880-1128------------------------SNYDSCVYLKVVDGSA.IYLLLYVDDMLI---AAKDKSEI----------------
Q94HQ0_ORYSJ/485-718------------------------SPHEAAIYRRGNGGNA.LLVGVYVDDLVI---TGTKDAEV----------------
Q7Y1I1_ORYSJ/727-972------------------------CDFEHAVYAQGQGTHH.LLVGVYVDDLII---TGSDAVEI----------------
Q94GR9_ORYSJ/975-1220------------------------GKVDTTLFTKIIGDDF.FVCQIYVDDIIF---SSTNEVFC----------------
Q7X7N0_ORYSJ/758-1003------------------------SASDTSLFILRDGDRL.AYLLLYVDDIIL---MASSAELL----------------
Q7XZY2_ORYSJ/297-542------------------------SVTEGAVYTRGRGDAR.LIVGVYVDDLII---TGAKVGEI----------------
Q7XN62_ORYSJ/915-1162------------------------NVEDNCIYSKFKNGRF.IFLILYVDDILL---ASSDVSLL----------------
Q7XLI2_ORYSJ/53-298------------------------AKSDTSLFIYRRGSDT.VYLLLYVDDIVL---TASSDALL----------------
B5RTA2_DEBHA/1170-1414------------------------DTAISGMFCKYFGENKKLIVALYVDDMFL---TSSNITIL----------------
B5RTR8_DEBHA/1021-1254------------------------IDTELGIYVRG....N.IIIGLYVDDILI---SGKDMKEI----------------
E7KRB3_YEASL/146-383------------------------HEGEHGLYFRSTSDGP.IYIALYVDDLLV---AAPSPKIY----------------
Q2R072_ORYSJ/915-1159------------------------SPLEHGLYARGDGSGR.LLVGVYVDDLVI---VGGDSGMI----------------
Q59K02_CANAL/999-1236------------------------LGGDLGIYISKDK..R.TIMGVYVDDILI---CGPSDSEI----------------
Q5AG24_CANAL/888-1133------------------------TLHNDGIFWKNYENGDVLYVSVYVDDVFM---IATNEKII----------------
Q5AH82_CANAL/122-366------------------------VLHNDGLFHIEYEEGSVIYLGLYVDDILM---VGSSQKVI----------------
Q7XN23_ORYSJ/31-274------------------------SKADTSLFFLNKGGII.MFVLVYVDDIIV---ASSTEKAT----------------
Q8S476_MAIZE/836-1081------------------------NESDTCVYYRYGGGES.VMLCLYVDDILI---FGSNLNVI----------------
Q8S479_MAIZE/1073-1313------------------------GKADPTLFTKTCNGDL.FVCQIYVDDIIF---GSTNQKSC----------------

PF00978

R1AB_LIYV9/1925-2366------------------------SSY..D..ID...--DIDLLLVSGDDSLI...FSRKH..LPN-----------KTQ
R1AB_BYVU/2601-3046------------------------MFY..Y..TN...--RFKALFVSGDDSLI...FSESP..IRN-----------SAD
Q9YPH5_9VIRU/1359-1796------------------------DCM..P..LE...--KLRPMISGGDDSLF...FFKKGITIED-----------PCR
POLN_EEVVM/2041-2488------------------------RVL..RERLT...--NSPCAAFIGDDNIV...KGVKS..DKL-----------MAD
E0YCR0_9CLOS/53-491------------------------VVL..R..GL...--DYSYIVVSGDDSLI...FSRQP..LDI-----------DTS
RDRP_TOMS1/1168-1609------------------------SML..P..ME...--KLIKGAFCGDDSLL...YFPKGCEYPD-----------IQQ
RDRP_PSVJ/295-726------------------------WCY..D..TD...--QFDRMLFSGDDSLA...FSLNP..IEG-----------KSD
Q66107_9BROM/228-662------------------------RVY..D..LCD.P--KITFVIASGDDSLI...GSVEE.LPRA-----------PEH
Q87644_SINDV/2053-2501------------------------EER.....LK...--TSRCAAFIGDDNIIHGVVSDKE.....-----------MAE
O56790_9VIRU/1323-1760------------------------DAL..P..LE...--RAKFMVFGGDDSLV...FFPKNMNLAD-----------PCG
RDRP_CMVFN/308-738------------------------WCY..D..TD...--QFEKLLFSGDDSLG...FSLLP..PVG-----------DPS
Q9WJD8_PEBV/1299-1738------------------------SEL..P..LE...--KCVLMTYGGDDSLI...VFPKGLKLVD-----------PCE
Q80875_BSMV/195-630------------------------DCL..P..LE...--DAHFCVFGGDDSLI...LFDQGYIISD-----------PCQ
RDRP_RBDVR/1234-1674------------------------FVI..S..DPDRE--KIRYMLVGGDDSLI...CSYGP..IQV-----------PLE
RDRP_SBWMN/1373-1810------------------------ESM..P..LE...--KAKFMIFGGDDSLI...LFPKHLTIED-----------PCR
POLN_ONNVI/2053-2501------------------------RVL..EERLT...--TSACAAFIGDDNII...HGVVS..DAL-----------MAA
RDRP_TAV/313-742------------------------WCY..D..TS...--QFDKLIFSGDDSLG...FSIKA..PVG-----------DPS
POLN_MIDDV/534-981------------------------RVL..EERLT...--NSKCAAFIGDDNIV...HGVKS..DKL-----------LAE
RDRP_TMGMV/1163-1604------------------------SML..P..ME...--KVIKGAFCGDDSVL...YFPKGLDFPD-----------IQS
RDRP_TOBSV/253-689------------------------YVY..D..LSN.P--NILFVAASGDDSLI...GSIEP.LPRE-----------KED
RDRP_OLV2I/310-732------------------------EVY..E..LD..S--LPFCGLFSGDDNLI...VTDRP..LEG-----------RVS
RDRP_YOMV/1155-1594------------------------SMI..P..MD...--KVIKAAFCGDDSLI...YIPKGLDLPD-----------IQA
RDRP_AMVLE/318-752------------------------HVY..D..LMD.P--NVKFVVASGDDSLI...GTVEE.LPRD-----------QEF
POLN_RRVN/2019-2467------------------------REK.....LT...--NSICAAFIGDDNIV...HGVRS..DPL-----------MAE
RDRP_ASPVP/1758-2169------------------------LRY..D..LN...--GREAICFAGDDMCA...NSRLK..VTN-----------RFS
O56250_9VIRU/1240-1678------------------------SEL..P..LE...--KAVMVTYGGDDSLI...AFPRGTQFVD-----------PCP
O90699_9VIRU/1363-1800------------------------ESL..P..LE...--KARFMIFGGDDSLI...FFPKRMAIPD-----------PCR
Q9Q6Q3_9CLOS/62-509------------------------ISL..K..GF...--EPDLVVVCGDDSLI...FSKNE..LVI-----------NDR
POLN_AURAV/2038-2486------------------------RVL..E..QRL.R--DSKCAAFIGDDNII...HGVVS..DKI-----------MAD
RDRP_BBMV/271-697------------------------YCF..D..MS...--TAELAMFSGDDSLV...ICGSK..PEF-----------DPG
RDRP_CCMV/267-697------------------------YCC..D..MN...--TVDCAIFSGDDSLL...ICKSK..PHL-----------DAN
Q66581_EEEV/144-598------------------------RVLRER..LT...--TSPCAAFIGDDNIV...KGVTS..DAL-----------MAE
Q9QGG9_9BROM/363-797------------------------YMY..D..LLD.P--NITFVIASGDDSLI...GSRVP.LDRD-----------DEF
RDRP_TMOB/1167-1614------------------------SML..P..ME...--KVIKAAFCGDDSLV...YLPKGCELPN-----------IQS
RDRP_BMV/256-688------------------------YAS..D..LS...--DCDCAIFSGDDSLI...ISKVK..PVL-----------DTD
O40960_9CLOS/62-506------------------------SVY..D..LD...--DIDLIIVSGDDSLI...ISRKE..IEN-----------KCL

PF00998

RDRP_TNVA/224-703------------------------YGL-----KEHLN..INLSLANNGDDCVI---VCEKADLKKL-----------TS.
RDRP_TCV/272-752------------------------KYL-----MKG....IKCKLINNGDDCVL---FFEADEVDRV-----------RE.
RDRP_TNVD/224-709------------------------HNW-----CDNIKHIKHFRLANNGDDCML---VVERSDEKKV-----------RN.
RDRP_MCMVK/460-941------------------------HDF-----VTKLG..IPARLINNGDDNVL---ICPAVEVGRV-----------RQ.
POLG_HCVEU/2430-2941------------------------QAA-----CRAAN.IKDCDMLVCGDDLVV---ICESAGVQED-----------TAS
POLG_HCVED/2420-2931------------------------TAA-----IRAAA.LRDCTMLVCGDDLVV---IAESDGVEED-----------NRA
POLG_HCVJL/2434-2945------------------------MAA-----CKAAG.LKNFDMLVCGDDLVV---ISESLGVSED-----------ASA
POLG_HCVJK/2431-2942------------------------KAA-----TKAAG.IKDPSFLVCGDDLVV---IAESAGIDED-----------KSA
POLG_HCVEV/2426-2937------------------------LAS-----CRAAK.LRDCTLLVCGDDLVA---ICESQGTHED-----------EAS
POLG_HCVJ6/2445-2956------------------------LAA-----CKAAG.IIAPTMLVCGDDLVV---ISESQGTEED-----------ERN
Q9IR83_9TOMB/236-712------------------------KHL-----LKG....IRCRLINNGDDCVL---FFNTPDLAAV-----------TE.
Q87031_9LUTE/24-502------------------------HYY-----FKTLG..VKAELCNNGDDCVI---ICERKD.ENK-----------FQ.
RDRP_POLVP/251-722------------------------YQF-----CKDIG..IDASLANCGDDCVL---YLEKEDLPKL-----------K..
Q65987_9TOMB/269-750------------------------RYL-----MKG....IKSRLINNGDDCVV---FFESGDMHEV-----------RE.
P90338_9TOMB/1-480------------------------KHI-----CRG....LDARLINNGDDCVL---ICETRDVGRV-----------VD.
RDRP_BYDV1/361-840------------------------HAY-----FKKLG..VEAELCNNGDDCVI---ITDRAN.EKL-----------FD.
O09796_9HEPC/2422-2933------------------------SAA-----CRAAK.LQDCTMLVNGDDLVV---ICESAGTQED-----------AAS
O09803_9FLAV/2373-2866------------------------KAA-----CERVG.LKNVSLLIAGDDCLI---ICERPMCDPS-----------D..
O37361_9VIRU/252-737------------------------RVI-----CEELK.GIHIEVANDGDDQVL---MVETNQLDNL-----------IK.
Q9WJD9_CARMV/267-744------------------------KHL-----MK.....IRSRLINNGDDCVL---ICERTDIDYV-----------VS.
Q83103_9TOMB/228-711------------------------WNW-----CTRLN.LKHFRLANNGDDCMV---FMERHNEESF-----------RR.
Q66127_9TOMB/52-520------------------------RNL-----CLDLS..IPHELMDNGDDCIV---IFEKEHLQRF-----------NA.
RDRP_PMVK/447-937------------------------KDL-----VDSLG..VDAQLVNNGDDNVL---ICSVDDEEVV-----------VK.
POLG_GBVB/2277-2785------------------------NAA-----AEQAG.MKNPRFLICGDDCTV---IWKSAGADAD-----------KQA
Q89801_9TOMB/1-479------------------------WDL-----MK..G..IKYRLLNNGDDCVV---ITESKNVDFV-----------CK.
Q9IRA1_9TOMB/266-741------------------------HFL-----CRG....IRCRLINNGDDCVL---FFESSDLTLV-----------NE.
O12301_GAMV/231-708------------------------YDL-----LVTHD..IDAELLNNGDDCVL---ICERSEEAHL-----------LE.
Q83424_MNSV/290-772------------------------HDF-----FRSRG..IRARLMNNGDDCVV---ICEKECAAVV-----------KA.
O41892_PEGIA/2409-2899------------------------XAA-----XXRAG.VKEPTFXIAGDDCLI---IYENDGTDPC-----------A..
RDRP_OCSVU/235-734------------------------HAY-----GLHKS..VNIQLANNGDDCVV---FLEQSDLATF-----------SE.
Q9IW60_9TOMB/325-800------------------------HGY-----MRHLG.INEFSLANCGDDCVL---IVERRNLKQV-----------QR.
Q96898_9FLAV/2396-2886------------------------SAA-----CRRVG.IKAPSFFIAGDDCLI---IYENDGTDPC-----------P..
RDRP_RCNMV/260-745------------------------HAF-----LKETG..VRASLANNGDDCVL---FCEKGDYEQI-----------NR.

PF00972

POLG_YEFV1/2758-3406------------------------EAW-----LTEHGCDRLKRMAVSGDDCVV----------RPI-----------DDR

PF00680

POLG_HAVHM/1750-2215---ELS....GTPSHF--------GTA-----LINTII---YSKHLLYNCCY......HVCGSMPS-----------GSP
RDRP_BPPH6/19-638---GYA.PWWVKLFET--------SLK-----LPVYVG---APAPEQGHTLLGDPSNPDLEVGLSS-----------GQG
POLG_PYFV1/2270-2778---IFY...GNFLSTE--------RDN-----LTRMLT---NRFSLMKGAIL......RVPGGGPS-----------GFP
POL1_CPMVS/1186-1687---ELC.GGEDQLKNA--------RRN-----LLMACC---SRLAICKNTVW......RVECGIPS-----------GFP
POLG_RHDVF/1279-1750---DCC....EQTELT--------KSV-----VLTLKS---HPMTILDAMIV......QTKRGLPS-----------GMP
POLG_PVYN/2293-2763---TYMEDWDVGLQML--------RNL-----YTEIVY---TPISTPDGTIV......KKFRGNNS-----------GQP
POLG_EMCVR/1844-2288---EFF.TPENGFDPL--------TRE-----YLESLA---ISTHAFEEKRF......LITGGLPS-----------GCA
POLG_FCVUR/1266-1735---YFS....DRSPIV--------DSA-----ANTLKS---PPIAIFNGVAV......KVSSGLPS-----------GMP
POLG_NVN68/1301-1766---RLT....ASPELA--------EVV-----AQDLLA---PSEMDVGDYVI......RVKEGLPS-----------GFP
Q9DLK1_FMDVP/1865-2314---EFG......FHPN--------AEW-----ILKTLV---NTEHAYENKRI......VVEGGMPS-----------GCS
POLG_VESVA/1379-1848---HFT....DKSPIV--------DSA-----CATLKS---NPIGIFNGVAF......KVAGGLPS-----------GMP
POL1_BAYMY/1634-2098---HFL..PSEHHKAI--------DLI-----YDEILN---TTICLANGMVI......KKNVGTQR-----------.QP

PF02123

Q83093_9VIRU/437-816.........................NR-----FKCFAN---AVFQLSNGELI----EQGLPGLMKS...........GSY
Q66150_9VIRU/22-408.........................SR-----FYCLMN---ATFQLTNGELL----TQELPGLMKS...........GSY
Q86519_9VIRU/516-902.........................SR-----YYCFMN---SVFQLSDGTLI----QQELPGLMKS...........GSY
RDRP_SCPMV/464-849.........................NR-----FSCFMN---SVLQLSNGQLL----QQELPGIMKS...........GSY
RDRP_SBMVA/490-847.........................NR-----FSCFMN---SVFQLSDGTLI----EQQLPGIMKS...........GSY
RDRP_PEMVW/733-1124.........................TW-----LKCLGQ---SVFCLSNGLLL----AQTSPGIQKS...........GSF
RDRP_PLRVW/609-1004.........................AW-----LKCIGN---SVLCLSDGTLL----AQTVPGVQKS...........GSY
RDRP_TYYVF/580-974.........................CW-----LRCISN---SVLCLSDGTLL----AQIHPGVQKS...........GSY
Q65969_9LUTE/603-996..........................W-----LYCISN---SVLCLSDGTLL----AQRVPGVQKS...........GSY
RDRP_ROTGI/108-803ARAELKWRYDDEPKVL........EMN-----VLDSMI---KIQEYLLNSNL----VVASPGSQRPTKIIRYHGVASGEK
RDRP_ROTHC/109-749KQLTHNINIHKAINIY.........IQ-----SQENLE---NSYVLIDKKAI----...QYGATAS...........GEK
O55590_9REOV/104-749ITMTNNRRVKETLEKY........RQT-----QINLMD---SYVQIPDGNKI----LKIQYGAVAS...........GEK
RDRP_ROTPY/100-748ANMTNDPKVVQTLNLY........KQT-----QINLMD---SYVQIPDGNVI----KKIQYGAVAS...........GEK
Q90153_9VIRU/1025-1530AIKELRQRRGAQVSDQDLALIEHGFDW-----LIESVY---HQYVIHPDTGA----IIKTASGLYS...........GDR
Q90193_9VIRU/400-785.VYAKAGVLSKDLADA........IDW-----VVKSFD---QICAIDENGDL----RRFTHGLLS............GWR
RDRP_PCVC/362-832.....LIVAPRDYAVF........VEA-----IVAGMY---NMGLHDRDGNV----HKIWRG.LYS...........GWR
RDRP_SCVLB/837-1303...VYHDKLTDDQIEA........AKW-----TRNSVD---RMVAHQPNTGE----TYDVKGTLFS...........GWR
Q87025_SCVLA/177-657...TFSRNMSDEQAEA........MNW-----VCESVR---HMWVLDPDTKE----WYRLQGTLLS...........GWR
Q90155_TTV1/96-539.......LLPPEASFA........LDW-----CIASFD---NMQTSDG....----.RKWTATLPS...........GHR
Q9JE94_9VIRU/129-560.......FLPRSMHSI........LQW-----CVTSFD---NMYINK.....----.THWNSTLPS...........GHR
Q8V615_9VIRU/41-473.......YLPSEMHPI........LDW-----CIASMD---HMEIGG.....----.QHWLSTLPS...........GHR
Q83073_9VIRU/49-523.......HVGIENEET.........RK-----VVSSFE---RMIVYNGKEPL----.GRVHGTLMS...........GHR
RDRP_LRVLG/155-619.......HIGYNASWV.........KT-----LVDSFD---SMELWIKGKCA----.GIMAGTLMS...........GHR
Q98XW8_9VIRU/144-622.......CCDHNEPEL........AAK-----LLKSID---DMHIYLRGVHI----.GRVAGSLMS...........GHR
Q99AT3_9VIRU/99-573.......RVGYPADKL.........AK-----LVASFE---KMYIYNGMEQV----.GRVKGTLMS...........GHR
Q9YXE4_9VIRU/99-573........LTHYPPEL........AAK-----LVASFE---NMDLYLGSSCI----.GRVLGTLMS...........GRR
RDRP_HV19S/122-585........RTNAPAYL........KKA-----VAASVE---STYIHYKGRD.----.RHVLGTLMS...........GHR
Q9YXE6_9VIRU/120-589........RANAPGWY........RKV-----LSDSWG---KMHVNIAGHM.----.RPWLGTLPS...........GHR

PF04197

RDRP_IBDVU/1-875---GINFKIERSIDDI--------RGK-----LRQLVPLA.QPGYLSGGVE.----.PEQPSPTVELDLL-------GWS
RDRP_IPNVJ/1-842---GINFKIERELKNL--------RET-----IVEAVETAPQDGYLADGSDL----PPIRPGKAVELDLL-------GWS
RDRP_BSNV/1-863---GINFKIEREIEGL--------PTR-----LQEAMDKAVHTGFLGDGTTN----PPEKEGPTVDLDLL-------GWS

PF00078

A0A066NJ57_LELAM/135-366---..........ARRFRIAMQRRLRE...-FGL----T----VHP--EKTR----------LM----------------
A0A0F6CD22_ECOLX/115-332---.........LESQVLPVVRRFMAE...-RGL----M----LSP--EKTK----------IT----------------
D7ZFU1_ECOLX/62-269---..........FSQMQSHIERMLSE...-HDL----P----INK--HKTK----------IF----------------
A0A0E0UMT2_SINMB/72-291---..........AEALRVELSSRLAA...-CGL----Q----MHP--TKTK----------IV----------------
Q47526_ECOLX/33-239---..........LGLAHQKVKTTLIRFFG-TRI----I----INN--NKIV----------YS----------------
O01419_BOMMO/502-756---SA.....SILAAAAVATVVARIRK...-LGL----E----VAL--HKSE----------AV----------------
O18558_AEDAE/472-725---STL....FDLMQSALQVVESWCRQ...-YGL----S----VNP--NKTS----------IV----------------
O42691_ALTAL/36-202---..........HKEHVRLILEALQD...-NGL----R----LKP--HKCK----------WF----------------
O44316_DROMR/394-650---..........LQELLNTTVKFLSS...-VGL----T----LNA--DKCF----------TI----------------
O52231_STREE/68-275---..........AKRVMYSVSRFIEK..R-LGL----K----VNM--TKTK----------IT----------------
O62658_CANFA/517-773---.........STPRLLQLMQHCGSV...-AGY----I----INA--QKSV----------AF----------------
O64612_ARATH/788-1031---..........LEGVLAIFKDFAAF...-SGL----N----ISL--EKST----------LF----------------
O65244_ARATH/405-664---.........SIDGIVKVLYEFAKW...-SGL----K----ISM--EKST----------MY----------------
O65598_ARATH/489-747---.........SLHGICETLEDFASW...-SGL----K----VNN--DKSH----------FF----------------
O81284_ARATH/58-317---..........LVAILDILDVFKKG...-SGL----G----INL--QKTA----------LL----------------
O81454_ARATH/144-304---..........HIQPLELILKTLRK...-EGL----Y----ANL--KKCT----------FC----------------
O93520_ORYLA/518-771---.........TLPIIMDSLKDFGTL...-SGY----K----INV--NKIQ----------VL----------------
O96546_LYMDI/526-780---TTV....ARTLQTAVTALANWFRN...-WRL----E----INP--EKSQ----------AV----------------
O99969_PORPU/100-315---..........LLEAKQKIEVFLKT...-IGL----E----FSA--EKTK----------IT----------------
POL_RSVP/769-938---..........LEAAGEEVISTLER...-AGF----T----ISP--DKVQ----------RE----------------
POL_HTL1A/633-804---..........LLLLSEATMASLIS...-HGL----P----VSE--NKTQ----------QT----------------
POL_SMRVH/71-240---..........AKACYAHIISCLTS...-YGL----K----IAP--DKVQ----------VS----------------
POL_MMTVB/68-237---..........VDEILTSMIQALNK...-HGL----V----VST--EKIQ----------KY----------------
POL_CAMVC/289-452---..........HLLHVAMILQKCNQ...-HGI----I----LSK--KKAQ----------LF----------------
POL_IPHA/60-229---..........LQKAFPMLVAELKQ...-WGL----E----IAS--EKVQ----------IA----------------
POL_HV1MA/655-826---..........HRTKIEELREHLLK...-WGF----T----TPD--KKHQ----------KE----------------
TF21_SCHPO/455-615---..........HVKHVKDVLQKLKN...-ANL----I----INQ--AKCE----------FH----------------
POK10_HUMAN/76-245---..........LIDCYTFLQAEVAN...-AGL----A----IAS--DKIQ----------TS----------------
POL4_DROME/357-523---..........MLKNLTEVFGKCRE...-YNL----K----LHP--EKCS----------FF----------------
POLY_DROME/224-390---..........HVRHIDTVLKCLID...-ANM----R----VSQ--EKTR----------FF----------------
POL_EIAV9/249-419---..........HKELIIELRAILLE...-EGF----E----TPD--DKLQ----------EV----------------
YTX2_XENLA/513-765---..........LERAQECQEVYAAA...-SSA----R----INW--SKSS----------GL----------------
POL_SOCMV/246-411---..........HVNDVRIVLQRIKE...-KGI----I----ISK--KKSK----------LI----------------
Y2R2_DROME/498-741---AVL....EEKGAQLMSIVETWGAE...-VGD----C----LST--SKTV----------IM----------------
POL_BIV29/638-806---..........HKQIVQEIRDKLGS...-YGF----K----TPD--EKVQ----------EE----------------
RDPO_ACUOB/124-343---..........ALIALPAVKEFLAV...-RGL----E----VKL--AKTT----------IK----------------
POL2_DROME/249-414---..........HLNSIQLVFTKLAD...-ANL----K----LQL--DKCE----------FL----------------
RT67_ECOLX/48-262---PLEMATVQPEGVVLGKVLVKEIEN...-SGF----E----IND--SKTR----------LT----------------
RTJK_DROME/502-757---LAA....TSGLQEYLDAFQQWAEN...-WNV----R----INA--EKCA----------NV----------------
POL_BLVAU/41-212---..........RLQCYQTMAAHLRD...-LGF----Q----VAS--EKTR----------QT----------------
POL_RTBVP/1228-1390---..........HIEHLKIFFNRVKE...-VGC----V----LSK--KKSK----------MF----------------
POL_CAEVC/210-380---..........HREIVKDLANYIAQ...-YGF----T----LPE--EKRQ----------KG----------------
P91581_CIOIN/483-644---..........HDRNLKKLLVAAKR...-HNL----T----INE--EKSK----------LR----------------
P95451_PSEAC/119-326---..........GERVLVSVERFLRE..R-LKL----T----VNR--KKSQ----------VA----------------
Q01379_NEUCS/505-761---EEN....CRTLQAAWEVCSEWAGA...-RGM----E----FEA--TKTE----------LM----------------
Q03261_SIV/246-416---..........HQEIVQQIVTALLK...-VGF----K----VPK--EKWQ----------DQ----------------
Q04135_DROME/496-743---IKA....TALLSRHLTSVERWLAD...-WRI----S----INV--QKCK----------QV----------------
Q07995_CHITU/509-760---DI.....VTHLQHTGRKVQQYMNK...-WKI----N----LNK--QKTQ----------AL----------------
Q08724_9CYAN/108-336---..........IIVLKEIVKTWLAE...-MGL----E----LNP--NKTR----------IV----------------
YRD6_CAEEL/484-644---..........HEKILRELFERFKE...-YGF----R----VSA--EKCA----------FA----------------
Q17329_CAEEL/1071-1231---..........HLQDVKEALTRIRK...-SGM----K----LRA--SKCH----------IA----------------
Q24262_DROME/531-692---..........CMEKTEMVLKRAAE...-FGL----K----IKW--KKCN----------FM----------------
Q24690_DROTE/495-742---TN......ISLDNLLNDIGNWGSY...-SGA----S----LSL--SKCQ----------HL----------------
Q26816_9TRYP/545-793---NVI....NHTLQCGLNVVLQWSKE...-YFM----S----VNV--AKTK----------GT----------------
Q46666_ECOLX/34-241---..........LKAVPSTIEALLKDLFG-SEL----R----LNH--SKTV----------FS----------------
Q83013_9RETR/68-238---..........TEVIFEAVKTTCHE...-KGL----K----INE--AKTQ----------RA----------------
Q88285_9RETR/848-1015---..........HLRSLAILLQGLKD...-LGV----K----INP--KKSH----------FC----------------
POL_CSVMV/250-413---..........HKIHIAKFRDITLA...-NGL----I----ISK--KKTE----------LC----------------
Q93137_BOMMO/515-771---SLI....AKKLQSAALALGQWFRK...-WRI----D----INP--AKST----------AV----------------
Q93139_BOMMO/469-719---LQI....ERQANTSLEHVQAWGVR...-NKL----K----FAP--HKTC----------AM----------------
Q94885_DROME/759-920---..........HLETLKEIFKRLVE...-NKL----E----LRI--DKCE----------FM----------------
YG31B_YEAST/639-797---..........HWKHLDTVLERLKN...-ENL----I----VKK--KKCK----------FA----------------
Q9YGS2_TAKRU/573-830---TEK....LVKLQTCLKDIKSWMSS...-NFL----L----LNP--GKTE----------VM----------------
Q9YW31_MSEPV/161-406---..........FIHGIDMLNNLSKK...-YKL----P----ISF--EKTK----------VM----------------
Q9ZNW4_SORBI/922-1081---..........HIKDLQETFVNLRS...-AGL----K----LNP--EKCV----------FG----------------
Q9ZQ67_ARATH/542-701---..........HIDHLKACFETLNK...-YNM----K----LNP--AKCL----------FG----------------
Q9ZQQ6_ARATH/659-918---.........SVEGVINIFKDFAGK...-SGL----H----ISL--EKST----------LY----------------
Q9ZS84_SOLLC/655-815---..........HVNHLSLVLSQLRK...-YTL----Y----VKM--EKCE----------FA----------------
Q9ZVK4_ARATH/510-669---..........HEVHLRRVMEKLRE...-QKL----F----AKL--SKCS----------FW----------------

PF05919

Q6EH16_9VIRU/1-501FD.LGLEISESKSVIS..GTFTEFAKKLRG.PLM----D----ISP--IGAG..........LI----------------
Q5TMB5_9VIRU/174-658RA.LSVDISDLKTHVS..KDSYEIAKRWFV.NGE----E----ITP--FPIN..........SI----------------
Q18L80_9VIRU/166-639TEILKVKINPTKGIMS..PHSLEFAKRFYV.QYQ----D----CSP--LSLKEFSSFGTVYSSF----------------
Q9WJ23_9VIRU/164-642KR.LGVELSMNKTHVS..KNTYEFAKRWFK.NKK----E----ITG--LPLR..........GI----------------
RDRP_CPMV1/246-745ET.LGLSISSGKSVIS..SEFTEFAKKLKGRNNF----D----IFY--RSWF..........SI----------------
Q9ZXZ7_THACU/214-754AV.IGCEINLNKSISSRCRPVFEFAKRTCW.GFA----I----VSG--ISLA..........QI----------------
Q9WJ22_9VIRU/155-622TK.WGVDISLSKTHVS..YDTYEFAKRWIK.NGK----E----ISG--ISLK..........GI----------------
Q6EH19_9VIRU/208-686SE.LGVSISETKSHVS..KDTFEFAKMWMH.QGR----N----ASG--FPVV..........GL----------------
Q9WJ24_9VIRU/163-645ND.FKVEISRNKTHVS..NDTYEFAKRWIK.NKM----E----FFP--LPIR..........GI----------------
Q6GYC2_9VIRU/156-638GK.LGVGLSDSKTHVS..KDTYEFAKRWIH.KGQ----E----ISP--LPIT..........GI----------------
Q18L78_9VIRU/174-654HD.LGVEINLSKSLIS.STGVVEFAKRWRV.GQT----D----VSP--ASPA..........LI----------------
Q18L79_9VIRU/168-671NQ.LDVGVNLAKSLIS.VRGYGEFAKQFLS.PDG----P----LQG--VSLREFSSLKDGMSNI----------------
Q3S3F3_9VIRU/120-606SK.LGVAISMQKTHVS..KDTYEFAKRWVH.KGV----E----ISG--LPLK..........GI----------------
O92614_9VIRU/173-711TQILGVEINLSKSLVS..NNSFEFAKRLVT.MDG----E----VSA--VGAK..........NL----------------

PF07727

Q7G640_ORYSJ/781-1029-----TTLKKQLSSEFDMKDLVASKKI----LGM----E----ITRDINSGL----------LF----------------
Q7XLN3_ORYSJ/465-703-----NEACHHLKTEFEMKDLGQTKFC----LGL----Q----LDH..LPSR----------IL----------------
Q7XTU6_ORYSJ/940-1185-----DAFKLQMKQRFNMSDLGFLSYY----LGM----E----VVQ..KGEG----------IF----------------
Q7XKS1_ORYSJ/160-403-----TFVKARLGEQFLMTDLGPLRYF----LCI----E----ISS..TPEG----------FH----------------
Q9FWI2_ORYSJ/795-1030-----QDFKKDMMHTYEMSDLGLLHYF----LGM----E----VHQ..SDEG----------IF----------------
Q94I36_ORYSJ/864-1109-----VDFAENMRREFEMSMMGELSYF----LGL----Q----IKQ..TPQG----------TF----------------
Q7G6C9_ORYSJ/1047-1286-----EEFSSIMTKRFEMSLMGELTFF----LGL----Q----VKQ..AQEG----------TF----------------
Q94LQ7_ORYSJ/550-793-----NALLKNLNQEFALKDLGRLHYF----LGI----E----VKE..VNDG----------IV----------------
Q7XKG6_ORYSJ/514-759-----AQLKENISKEFEVKDLGQLKYF----LGI----E----IAR..SPRG----------IV----------------
Q7X5X4_ORYSJ/138-383-----RRFKEEMGAMFKMSDLGRLSYY----LGI----D----VKQ..NAAG----------IT----------------
Q84M55_ORYSJ/910-1155-----RCLKERLGKAFEVKDLGPLRYF----LGI----E----IAR..SSKG----------IV----------------
Q7Y173_ORYSJ/398-645-----HQTKEFLSSNFDMKDLGEASYV----LGI----E----IHRDRSKGV----------LG----------------
Q8W5F4_ORYSJ/472-717-----NEVKSFLSQNFDMKDLGVVDVI----LNI----K----LIR..GENG----------IT----------------
Q7XUD9_ORYSJ/916-1161-----VRFKGEMKALFKMSDLGLLSFY----LGI----E----VEQ..VAGS----------IR----------------
Q8LNW7_ORYSJ/880-1128-----AKLKAQLSSEFGMKDLGAAKKI----LGM----E----ITRERHSGK----------LY----------------
Q94HQ0_ORYSJ/485-718-----AAFKEEMKATFQMSDLGPLSFY----LGI----E----.........----------..----------------
Q7Y1I1_ORYSJ/727-972-----DRFKAEMMSLFRMSDLGLLCFY----LGI----E----VKQ..VAGS----------TR----------------
Q94GR9_ORYSJ/975-1220-----KEFGDMMSREFEMSMIGELSFF----LGL----Q----IKQ..LKDG----------TF----------------
Q7X7N0_ORYSJ/758-1003-----CHITARLHTEFAMTDLGDLHFF----LGI----S----VRR..TPDD----------LF----------------
Q7XZY2_ORYSJ/297-542-----SKFKEQMRSLFSMSDLELLTYY----LGM----E----VNQ..SSEG----------VT----------------
Q7XN62_ORYSJ/915-1162-----QETKKFLSSNFDMKDLGEASYV----LGI----E----IHRDRTKYA----------LG----------------
Q7XLI2_ORYSJ/53-298-----RWTIRALQSEFSMKDLGSLHHF----LGI----S----ISR..QSSG----------LH----------------
B5RTA2_DEBHA/1170-1414-----NDFKLELAKHFDLKYFADISEF----LGI----E----FIQ..IAGG----------YR----------------
B5RTR8_DEBHA/1021-1254-----EDVKKMLASKFKMKDLGVAKKF----LGI----N----IAQ..DTNG----------IK----------------
E7KRB3_YEASL/146-383-----DRVKQELTKLYSMKDLGKVDKF----LGL----N----IHQ.SSNGD----------IT----------------
Q2R072_ORYSJ/915-1159-----KGFKEQMKAEFKMSDLGPLSFY----LGI----E----VHQ..EAGI----------IT----------------
Q59K02_CANAL/999-1236-----EQVKNNVRKYFSITDNGLCRKF----LGI----N----VYQ..QANE----------IR----------------
Q5AG24_CANAL/888-1133-----KEFVAMLETYFQLQYFGEATEY----LGI----Q----FRK..TPDG----------YT----------------
Q5AH82_CANAL/122-366-----DNFVDQLRDHFEVKVFGEISNY----LGI----E----FRK..TESG----------YI----------------
Q7XN23_ORYSJ/31-274-----TALLKDLNKEFALKDLGDLHYF----LGI----E----VTK..VSNG----------II----------------
Q8S476_MAIZE/836-1081-----EEVKNLLSSNFEMKDLGEADVI----LNI----K----LVR.EADGG----------VT----------------
Q8S479_MAIZE/1073-1313-----EEFSRVMTQKFEMPMMGELSYF----LGF----Q----VKQ..LKDG----------TF----------------

PF00978

R1AB_LIYV9/1925-2366------------EINKNFG----MEAK----YIE....K....SS.--...P----------YF--CSKFIV..E..LN.
R1AB_BYVU/2601-3046------------AMCTELG----FETK----FLT....P....SV.--...P----------YF--CSKFFV..M..TG.
Q9YPH5_9VIRU/1359-1796------------RLSSLWN----FDCK----LFD....F....EN.--...E----------AF--CGKFLL..K..IG.
POLN_EEVVM/2041-2488------------RCATWLN----MEVK----IID....A....VVG--EKAP----------YF--CGGFIL..CDSVT.
E0YCR0_9CLOS/53-491------------VLSDNFG----FDVK----IFN....Q....AA.--...P----------YF--CSKFLV..Q..VE.
RDRP_TOMS1/1168-1609------------AANLMWN----FEAK----LFK....K....QY.--...G----------YF--CGRYVI..H..HD.
RDRP_PSVJ/295-726------------WFTSLFN----MEAK----NMD....P....PT.--...P----------YI--CSKFLL..T..DE.
Q66107_9BROM/228-662------------LFTSLFN----FEAK----FP.....H....NQ.--...P----------FI--CSKILV..S..VD.
Q87644_SINDV/2053-2501------------RCATWLN----MEVK----IID....A....VIG--ERPP----------YF--CGGFIL..Q..DS.
O56790_9VIRU/1323-1760------------RLASLWN----FDCK----FFN....F....QN.--...N----------MF--CGKFLL..K..IG.
RDRP_CMVFN/308-738------------KFTTLFN----MEAK----VME....P....AV.--...P----------YI--CSKFLL..S..DE.
Q9WJD8_PEBV/1299-1738------------KLATKWN----FECK----IFK....F....LV.--...P----------AF--CGKFLI..R..VQ.
Q80875_BSMV/195-630------------LAGT.WN----LECK----VFD....F....KY.--...P----------AF--CGKFLL..C..ID.
RDRP_RBDVR/1234-1674------------PLGDIFN----MSCK----LVQ....P....AC.--...P----------YF--ASRYLI..R..RG.
RDRP_SBWMN/1373-1810------------RLASLWN----FDCK----LFD....F....KH.--...N----------MF--CGKFLL..K..VG.
POLN_ONNVI/2053-2501------------RCATWMN----MEVK----IIDAVVSE....KA.--...P----------YF--CGGFIL..HDTVT.
RDRP_TAV/313-742------------LFTSLFN----MEAK----VME....P....SV.--...P----------YI--CSKFLL..T..DD.
POLN_MIDDV/534-981------------RCAAWMN----MEVK----IID....A....VMC--ERPP----------YF--CGGFIVFDQ..VT.
RDRP_TMGMV/1163-1604------------CANLMWN----FEAK----LYR....K....RY.--...G----------YF--CGRYII..H..HD.
RDRP_TOBSV/253-689------------LCVSLFN----FETK----FP.....H....NQ.--...P----------FI--CSKFLL..V..VE.
RDRP_OLV2I/310-732------------LFPNMFN----MEAK----VMR....P....GQ.--...N----------YM--CSKYLC..T..VD.
RDRP_YOMV/1155-1594------------GANLTWN----FEAK----LFR....K....KY.--...G----------YF--CGRYVI..H..HD.
RDRP_AMVLE/318-752------------LFTTLFN----LEAK----FP.....H....NQ.--...P----------FI--CSKFLI..T..MP.
POLN_RRVN/2019-2467------------RCASWVN----MEVK----IID....A....TMC--EKPP----------YF--CGGFILYDN..VT.
RDRP_ASPVP/1758-2169------------NFLDKIK----LKAK----VQF....T....AT.--...P----------TF--CGWGLC..E..HG.
O56250_9VIRU/1240-1678------------KLATKWN----FECK----IFK....Y....DV.--...P----------MF--CGKFLL..K..TS.
O90699_9VIRU/1363-1800------------RLAAVWN----FDCK----MFN....F....EN.--...N----------AF--CGKFLI..K..VG.
Q9Q6Q3_9CLOS/62-509------------ILEESFG----FDLK----LTC....Q....CV.--...P----------YF--CSKYLV..R..TP.
POLN_AURAV/2038-2486------------RCATWMN----MEVK----IID....AVIGIKA.--...P----------YF--CGGFIL..E..DQ.
RDRP_BBMV/271-697------------VFQSLFN----MEVK----VMD....P....SL.--...P----------YI--CSKFLL..E..SE.
RDRP_CCMV/267-697------------VFQSLFN----MEIK----VMD....P....SL.--...P----------YV--CSKFLL..E..TE.
Q66581_EEEV/144-598------------RCATWLN----MEVK----IID....AVVGVKA.--...P----------YF--CGGFIV..V..DQI
Q9QGG9_9BROM/363-797------------KFTTLFN----FEAK----FP.....H....NQ.--...P----------FV--CSKFLC..L..VP.
RDRP_TMOB/1167-1614------------CANLMWN----FEAK----LFK....K....TY.--...G----------YF--CGRYVI..H..HD.
RDRP_BMV/256-688------------MFTSLFN----MEIK----VMD....P....SV.--...P----------YV--CSKFLV..E..TE.
O40960_9CLOS/62-506------------EINNDFG----MDAK----FLA....N....PV.--...P----------YF--CSKFII..Q..VD.

PF00998

RDRP_TNVA/224-703..----------SIEPYFKQFG.FKME----VEK----P----VDI--FERI----------EF..CQTQPV--F--DG-
RDRP_TCV/272-752..----------RLHH.WIDFG.FQCI----AEE----P----QYE--LEKV----------EF..CQMSPI--F--DG-
RDRP_TNVD/224-709..----------GLIEYYATLG.FTMK----VEP----T----VDV--LERL----------EF..CQTRPV--L--VD-
RDRP_MCMVK/460-941..----------ELYRHWLNYG.FEVI----SEE----P----VYI--LEQV----------EF..CQMRPV--F--DG-
POLG_HCVEU/2430-2941LR----------AFTDAMTRYSAPPGD----APQ----P----TYD--LELI----------TS..CSSNVS--V--AH-
POLG_HCVED/2420-2931LR----------AFTEAMTRYSAPPGD----APQ----P----AYD--LELI----------TS..CSSNVS--V--AH-
POLG_HCVJL/2434-2945LR----------AFTDAMTRYSAPPGD----EPH----P----EYD--LEHI----------TS..CSSNVS--V--AH-
POLG_HCVJK/2431-2942LR----------AFTEAMTRYSAPPGD----PPQ----P----TYD--LELI----------TS..CSSNVS--V--AH-
POLG_HCVEV/2426-2937LR----------AFTEAMTRYSAPPGD----PPV----P----AYD--LELV----------TS..CSSNVS--V--AR-
POLG_HCVJ6/2445-2956LR----------AFTEAMTRYSAPPGD----PPR----P----EYD--LELI----------TS..CSSNVS--V--AL-
Q9IR83_9TOMB/236-712..----------RLAH.WLDFG.FQCV----VEE----P----VYE--LEEV----------EF..CQMKPV--F--DG-
Q87031_9LUTE/24-502..----------HMHSWFKDYG.FDMQ----IET----P----VYK--IGQI----------EF..CQSKPV--K--IN-
RDRP_POLVP/251-722..----------ALPDWFGKMG.YSMK----VEK----P----VFT--VEEI----------EF..CQQHPV--Q--LS-
Q65987_9TOMB/269-750..----------RLCR.WIDFG.FQCI----AEE----P----QYD--LEKV----------EF..CQMSPI--Y--DG-
P90338_9TOMB/1-480..----------KLTTAWLHFG.FTCI----AEE----P----VYE--PEKI----------RF..CQMAPV--Y--DG-
RDRP_BYDV1/361-840..----------GMYDHFLRYG.FNMV----TEK----P----VYE--LEQL----------EF..CQSKPV--S--IN-
O09796_9HEPC/2422-2933LR----------VFTEAMTRYSAPPGD----PPQ----P----EYD--LELI----------TS..CSSNVS--V--AH-
O09803_9FLAV/2373-2866..----------ALGRALASY....GY----ACE----P----SYH--ASLD----------TAPFCSTWLA--E--CN-
O37361_9VIRU/252-737..----------ELSPTFARFG.FRVK----VED----P----VWE--FERI----------DF..CQTRPI--F--LS-
Q9WJD9_CARMV/267-744..----------NLTTGWSRFG.FNCI----AEE----P----VYE--MEKI----------RF..CQMAPV--F--DG-
Q83103_9TOMB/228-711..----------GLIDYYTGLG.FTMK----VEE----T----VDV--LERV----------EF..CQTRPV--L--VD-
Q66127_9TOMB/52-520..----------AVKPYFAALG.FTMK----VEA----P----VYQ--FEKV----------EF..CQTQPV--F--DG-
RDRP_PMVK/447-937..----------ALYDHWMKYG.FEVV----AEQ----P----VYI--TEQI----------EF..CQMKPV--F--DG-
POLG_GBVB/2277-2785MR----------VFASWMKVMGAPQDC----VPQ----P----KYS--LEEL----------TS..CSSNVT--S--GI-
Q89801_9TOMB/1-479..----------QLER.FRDYG.FTCI----AEE----P----VYE--LEKL----------EF..CNLHPL--Y--DG-
Q9IRA1_9TOMB/266-741..----------RLTK.WSDFG.