Sequence alignment for CL0030

PF08016

PKD1_MOUSE/3701-4103SQAFLAITRSDEFWPWMSHVFLPYV.....HGNQS............SPELGPPRLRQVRLQEA....FCPDPSSSEHM.
PKD2_MOUSE/265-685KTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHT.QADNRSFIFYENLLLGVPRLRQLRVRNG..SCSIPQDLRDEIKE
Q8T8Z2_DROME/169-596TFGLSQVYFIYQVHSYMKITLVEAF.....YAQKT.NGYEGWWAMEQWQKIGVVRLRQMRPVD.................
PKDRE_MOUSE/1621-2051SVDLATVMKLGDIYTWLHGVFLPLL.....HNDPNPTFLPDS....SSKILGLPLVRQVRARPSNKTCLLAKKFVQSSVA
Q95V80_STRPU/2211-2645NKDYHLMNDFRSFLKWADSTLLPGL.....LSENRWGAEKQS.....TLIGGGLRLRQVRVKPS..SCETHPLFVDLIND
PKD2_CAEEL/119-538APAFGSCTSMDNIWDWLSQVLIPGIYW.TETSNST...DNENMIYYENRLLGEPRIRMLKVTND..SCTVMKSFQREIKE
Q9VVZ8_DROME/165-591AFGLLSVGDVPDIYFFVVSSLVLAF.....TDGKNTSGGAPWIHAEGTRLLGVVRLRQLRTES.................
PKDRE_HUMAN/1748-2178SMDLATVTKLEDIYRWLNSVLLPLL.....HNDLNPTFLPES....SSKILGLPLMRQVRAKSSEKMCLPAEKFVQNSIR
Q9VK95_DROME/402-803VSGNYLKDDSDSI.................QANMSFHHLEGRVFLYENLLLGPPRLRQIRVRKE..SCYVNDAFIRYFNT
PK2L1_MOUSE/147-567..SFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRND..SCVVHEDFREDILN
F7APR1_MACMU/91-490..TFLAITRSEELWPWMAHVLLPYV.....HGNQS............SPELGPPRLRQVRLQEA....LCPDPPGPRVHT
Q9W4X5_DROME/170-595.TGLQEVYFLNQLFDFIESTLVLAF.....NSNSTESGSPGWAHAEQSVLLGVMRLRQLRVSN.................

PF00520

TRPC5_RABIT/372-636--------------------------------------------------------------------------------
O46129_LOLFO/351-636--------------------------------------------------------------------------------
TRPG_DROME/361-664--------------------------------------------------------------------------------
TRPL_DROME/382-680--------------------------------------------------------------------------------
Q94447_CALVI/372-670--------------------------------------------------------------------------------
TRPC2_MOUSE/670-932--------------------------------------------------------------------------------
TRPC3_HUMAN/379-670--------------------------------------------------------------------------------
TRPC6_MOUSE/447-738--------------------------------------------------------------------------------
TRPM2_HUMAN/801-1060--------------------------------------------------------------------------------
TRPM1_HUMAN/833-1087--------------------------------------------------------------------------------
Q20766_CAEEL/902-1141--------------------------------------------------------------------------------
TRPG_CAEEL/1312-1567--------------------------------------------------------------------------------
TRPV5_RABIT/332-590--------------------------------------------------------------------------------
Q9VUD5_DROME/475-730--------------------------------------------------------------------------------
Q6JGX2_9RODE/387-652--------------------------------------------------------------------------------
O61220_CAEEL/519-775--------------------------------------------------------------------------------
Q9W3W0_DROME/459-665--------------------------------------------------------------------------------
PAIN_DROME/494-746--------------------------------------------------------------------------------
TRPA1_DROME/793-1039--------------------------------------------------------------------------------
TRPA1_HUMAN/720-972--------------------------------------------------------------------------------
TRPA1_CAEEL/813-1080--------------------------------------------------------------------------------
Q9VHY7_DROME/551-812--------------------------------------------------------------------------------
PYX_DROME/496-735--------------------------------------------------------------------------------
O13054_MAKNI/4778-4992--------------------------------------------------------------------------------
O61567_HOMAM/1212-1418--------------------------------------------------------------------------------
O96310_HELVI/229-436--------------------------------------------------------------------------------
ITPR_DROME/2408-2692--------------------------------------------------------------------------------
O77089_PANAR/2326-2624--------------------------------------------------------------------------------
ITPR1_MOUSE/2315-2600--------------------------------------------------------------------------------
ITPR2_HUMAN/2270-2552--------------------------------------------------------------------------------
Q9VW35_DROME/351-581--------------------------------------------------------------------------------
N1P4B6_YEASC/769-1010--------------------------------------------------------------------------------
NALCN_RAT/35-333--------------------------------------------------------------------------------
CCH1_SCHPO/514-755--------------------------------------------------------------------------------
B9DFD5_ARATH/429-683--------------------------------------------------------------------------------
TPC1_HUMAN/440-698--------------------------------------------------------------------------------
B9DFD5_ARATH/103-316--------------------------------------------------------------------------------
CCH1_SCHPO/1272-1517--------------------------------------------------------------------------------
N1P4B6_YEASC/1529-1779--------------------------------------------------------------------------------
N1P4B6_YEASC/1209-1484--------------------------------------------------------------------------------
CCH1_SCHPO/941-1224--------------------------------------------------------------------------------
CCH1_SCHPO/184-493--------------------------------------------------------------------------------
TPC1_HUMAN/105-331--------------------------------------------------------------------------------
NALCN_RAT/1209-1458--------------------------------------------------------------------------------
NALCN_RAT/383-610--------------------------------------------------------------------------------
NALCN_RAT/885-1167--------------------------------------------------------------------------------
CAC1E_DIPOM/1104-1385--------------------------------------------------------------------------------
Q17354_CAEEL/340-623--------------------------------------------------------------------------------
M9NDV1_DROME/768-1051--------------------------------------------------------------------------------
P91744_HETBL/894-1174--------------------------------------------------------------------------------
O02038_CYACP/868-1147--------------------------------------------------------------------------------
O97017_9CNID/849-1127--------------------------------------------------------------------------------
O96057_HALRO/803-1082--------------------------------------------------------------------------------
CAC1D_DROME/1343-1621--------------------------------------------------------------------------------
CAC1S_CYPCA/814-1092--------------------------------------------------------------------------------
CAC1S_HUMAN/798-1076--------------------------------------------------------------------------------
CAC1C_HUMAN/899-1197--------------------------------------------------------------------------------
CAC1D_HUMAN/885-1163--------------------------------------------------------------------------------
CAC1G_RAT/1254-1527--------------------------------------------------------------------------------
Q9W433_DROME/2144-2418--------------------------------------------------------------------------------
O44930_AIPPA/1046-1318--------------------------------------------------------------------------------
O62604_POLPE/908-1178--------------------------------------------------------------------------------
Q17314_CYACP/963-1231--------------------------------------------------------------------------------
P97706_RAT/954-1225--------------------------------------------------------------------------------
SCN7A_HUMAN/933-1204--------------------------------------------------------------------------------
SCN1_HETBL/781-1052--------------------------------------------------------------------------------
O02037_BDECA/985-1259--------------------------------------------------------------------------------
SCNBA_RAT/1033-1299--------------------------------------------------------------------------------
SCNBA_HUMAN/1055-1319--------------------------------------------------------------------------------
Q25150_HALRO/1260-1547--------------------------------------------------------------------------------
SCNAA_CANFA/1158-1436--------------------------------------------------------------------------------
SCNA_ELEEL/999-1275--------------------------------------------------------------------------------
SCN4A_HORSE/1027-1303--------------------------------------------------------------------------------
SCN8A_RAT/1195-1473--------------------------------------------------------------------------------
P90670_APLCA/1177-1452--------------------------------------------------------------------------------
Q25377_DOROP/1022-1296--------------------------------------------------------------------------------
SCNA_DROME/1300-1571--------------------------------------------------------------------------------
Q9XZC1_RHIMP/461-733--------------------------------------------------------------------------------
Q9W433_DROME/300-623--------------------------------------------------------------------------------
CAC1I_RAT/76-407--------------------------------------------------------------------------------
CAC1G_RAT/80-406--------------------------------------------------------------------------------
CAC1H_HUMAN/99-430--------------------------------------------------------------------------------
CAC1E_DIPOM/101-374--------------------------------------------------------------------------------
M9NDV1_DROME/37-324--------------------------------------------------------------------------------
P91744_HETBL/64-348--------------------------------------------------------------------------------
O02038_CYACP/112-392--------------------------------------------------------------------------------
O97017_9CNID/80-362--------------------------------------------------------------------------------
O96057_HALRO/46-328--------------------------------------------------------------------------------
CAC1D_DROME/614-889--------------------------------------------------------------------------------
CAC1S_CYPCA/69-362--------------------------------------------------------------------------------
CAC1F_HUMAN/91-383--------------------------------------------------------------------------------
CAC1D_CHICK/120-412--------------------------------------------------------------------------------
CAC1S_HUMAN/50-345--------------------------------------------------------------------------------
CAC1S_LITCT/50-343--------------------------------------------------------------------------------
P97706_RAT/117-405--------------------------------------------------------------------------------
SCN7A_HUMAN/117-405--------------------------------------------------------------------------------
O02037_BDECA/134-418--------------------------------------------------------------------------------
SCNBA_RAT/128-406--------------------------------------------------------------------------------
SCNBA_HUMAN/128-411--------------------------------------------------------------------------------
SCNA_DROME/152-440--------------------------------------------------------------------------------
P90670_APLCA/137-431--------------------------------------------------------------------------------
Q25377_DOROP/131-412--------------------------------------------------------------------------------
Q25150_HALRO/130-477--------------------------------------------------------------------------------
SCNAA_CANFA/129-417--------------------------------------------------------------------------------
SCNA_ELEEL/121-413--------------------------------------------------------------------------------
SCN4A_HUMAN/130-458--------------------------------------------------------------------------------
SCN5A_HUMAN/130-424--------------------------------------------------------------------------------
Q90518_TAKRU/128-427--------------------------------------------------------------------------------
SCN1_HETBL/54-345--------------------------------------------------------------------------------
O44930_AIPPA/112-392--------------------------------------------------------------------------------
Q17314_CYACP/142-419--------------------------------------------------------------------------------
CAC1G_RAT/1578-1830--------------------------------------------------------------------------------
Q17354_CAEEL/666-920--------------------------------------------------------------------------------
P91744_HETBL/1217-1468--------------------------------------------------------------------------------
M9NDV1_DROME/1094-1348--------------------------------------------------------------------------------
CAC1B_DIPOM/1467-1716--------------------------------------------------------------------------------
CAC1E_DIPOM/1428-1674--------------------------------------------------------------------------------
CAC1E_HUMAN/1477-1734--------------------------------------------------------------------------------
O02038_CYACP/1188-1437--------------------------------------------------------------------------------
O97017_9CNID/1168-1422--------------------------------------------------------------------------------
CAC1M_MUSDO/1108-1378--------------------------------------------------------------------------------
O96057_HALRO/1123-1384--------------------------------------------------------------------------------
CAC1S_CYPCA/1133-1413--------------------------------------------------------------------------------
CAC1S_RABIT/1117-1392--------------------------------------------------------------------------------
CAC1C_HUMAN/1238-1535--------------------------------------------------------------------------------
O02037_BDECA/1306-1555--------------------------------------------------------------------------------
SCN7A_HUMAN/1250-1507--------------------------------------------------------------------------------
P90670_APLCA/1499-1743--------------------------------------------------------------------------------
Q25377_DOROP/1343-1600--------------------------------------------------------------------------------
SCNA_DROME/1618-1871--------------------------------------------------------------------------------
Q9XZC1_RHIMP/780-1031--------------------------------------------------------------------------------
SCNBA_RAT/1345-1595--------------------------------------------------------------------------------
SCNBA_HUMAN/1365-1615--------------------------------------------------------------------------------
Q25150_HALRO/1593-1850--------------------------------------------------------------------------------
SCNA_ELEEL/1321-1578--------------------------------------------------------------------------------
SCN1A_HUMAN/1540-1797--------------------------------------------------------------------------------
SCN5A_HUMAN/1527-1783--------------------------------------------------------------------------------
SCN1_HETBL/1100-1362--------------------------------------------------------------------------------
O44930_AIPPA/1367-1619--------------------------------------------------------------------------------
O62604_POLPE/1225-1481--------------------------------------------------------------------------------
Q17314_CYACP/1278-1536--------------------------------------------------------------------------------
O62604_POLPE/486-725--------------------------------------------------------------------------------
Q17314_CYACP/509-745--------------------------------------------------------------------------------
P97706_RAT/526-760--------------------------------------------------------------------------------
SCN7A_HUMAN/504-739--------------------------------------------------------------------------------
SCNBA_RAT/571-809--------------------------------------------------------------------------------
SCNBA_HUMAN/576-822--------------------------------------------------------------------------------
Q25150_HALRO/798-1033--------------------------------------------------------------------------------
SCNAA_CANFA/673-910--------------------------------------------------------------------------------
SCNA_ELEEL/565-801--------------------------------------------------------------------------------
SCN5A_RAT/717-953--------------------------------------------------------------------------------
SCN4A_HORSE/571-807--------------------------------------------------------------------------------
SCN1A_RAT/767-1003--------------------------------------------------------------------------------
P90670_APLCA/753-995--------------------------------------------------------------------------------
Q25377_DOROP/591-824--------------------------------------------------------------------------------
SCN1_HETBL/410-640--------------------------------------------------------------------------------
O44930_AIPPA/622-858--------------------------------------------------------------------------------
CAC1G_RAT/743-976--------------------------------------------------------------------------------
Q9W433_DROME/1230-1471--------------------------------------------------------------------------------
Q17354_CAEEL/9-248--------------------------------------------------------------------------------
P91744_HETBL/480-720--------------------------------------------------------------------------------
CAC1A_RAT/488-727--------------------------------------------------------------------------------
M9NDV1_DROME/440-678--------------------------------------------------------------------------------
O02038_CYACP/496-738--------------------------------------------------------------------------------
O97017_9CNID/468-710--------------------------------------------------------------------------------
CAC1D_DROME/984-1226--------------------------------------------------------------------------------
O96057_HALRO/428-670--------------------------------------------------------------------------------
CAC1S_CYPCA/446-687--------------------------------------------------------------------------------
O73697_TAKRU/439-680--------------------------------------------------------------------------------
CAC1C_HUMAN/523-764--------------------------------------------------------------------------------
CAC1S_LITCT/430-671--------------------------------------------------------------------------------
CAC1S_HUMAN/431-672--------------------------------------------------------------------------------
CNGC3_ARATH/80-406--------------------------------------------------------------------------------
CNGC6_ARATH/111-443--------------------------------------------------------------------------------
CNGC7_ARATH/98-431--------------------------------------------------------------------------------
CNG16_ARATH/52-386--------------------------------------------------------------------------------
CNG14_ARATH/84-410--------------------------------------------------------------------------------
HCN4_MOUSE/262-525--------------------------------------------------------------------------------
O96385_PARTE/140-383--------------------------------------------------------------------------------
Q27170_PARTE/142-388--------------------------------------------------------------------------------
SKOR_ARATH/82-334--------------------------------------------------------------------------------
KAT3_ARATH/86-336--------------------------------------------------------------------------------
Q9XH40_SAMSA/77-327--------------------------------------------------------------------------------
Q9SM12_MAIZE/69-319--------------------------------------------------------------------------------
AKT2_ARATH/75-324--------------------------------------------------------------------------------
O04703_SOLTU/88-338--------------------------------------------------------------------------------
O24538_VICFA/55-305--------------------------------------------------------------------------------
AKT5_ARATH/78-324--------------------------------------------------------------------------------
O04242_MAIZE/64-310--------------------------------------------------------------------------------
O24382_SOLTU/63-309--------------------------------------------------------------------------------
B9DI19_ARATH/57-300--------------------------------------------------------------------------------
KAT2_ARATH/59-307--------------------------------------------------------------------------------
Q41461_SOLTU/60-311--------------------------------------------------------------------------------
KCNH5_RAT/214-479--------------------------------------------------------------------------------
O44164_CAEEL/216-496--------------------------------------------------------------------------------
KCNAE_DROME/236-500--------------------------------------------------------------------------------
KCNH6_RAT/256-523--------------------------------------------------------------------------------
Q23974_DROME/267-516--------------------------------------------------------------------------------
KCNH3_RAT/224-515--------------------------------------------------------------------------------
KCNH8_RAT/221-481--------------------------------------------------------------------------------
Q9U5E2_DROME/125-365--------------------------------------------------------------------------------
CNG_CAEEL/165-422--------------------------------------------------------------------------------
CNGA4_RAT/34-277--------------------------------------------------------------------------------
CNGA_DROME/107-358--------------------------------------------------------------------------------
CNG_ICTPU/138-376--------------------------------------------------------------------------------
CNGA1_BOVIN/163-406--------------------------------------------------------------------------------
CNG1_CHICK/210-453--------------------------------------------------------------------------------
CNGA2_BOVIN/140-383--------------------------------------------------------------------------------
CNGB1_BOVIN/770-1005--------------------------------------------------------------------------------
Q9W2D5_DROME/468-704--------------------------------------------------------------------------------
KCMA1_RAT/178-400--------------------------------------------------------------------------------
SLO_DROME/126-348--------------------------------------------------------------------------------
SLO1_CAEEL/138-363--------------------------------------------------------------------------------
KCNQ1_HUMAN/122-359--------------------------------------------------------------------------------
Q9XWG9_CAEEL/76-313--------------------------------------------------------------------------------
KCNQ3_HUMAN/122-363--------------------------------------------------------------------------------
KCNQ2_HUMAN/92-324--------------------------------------------------------------------------------
KCNQ4_HUMAN/98-330--------------------------------------------------------------------------------
Q9RW39_DEIRA/33-252--------------------------------------------------------------------------------
Q16976_APLCA/213-469--------------------------------------------------------------------------------
Q9XXD1_CAEEL/229-477--------------------------------------------------------------------------------
KCNG2_CHICK/216-464--------------------------------------------------------------------------------
G1R5R7_NOMLE/226-471--------------------------------------------------------------------------------
KCNAL_DROME/184-417--------------------------------------------------------------------------------
P91784_POLPE/201-427--------------------------------------------------------------------------------
KCNV1_RAT/212-442--------------------------------------------------------------------------------
KCNS3_HUMAN/184-417--------------------------------------------------------------------------------
KCNS1_MOUSE/188-439--------------------------------------------------------------------------------
KCNS2_MOUSE/186-421--------------------------------------------------------------------------------
F7H076_MACMU/181-417--------------------------------------------------------------------------------
KCNAB_DROME/434-670--------------------------------------------------------------------------------
Q26344_APLSP/314-551--------------------------------------------------------------------------------
KCNAG_CAEEL/203-453--------------------------------------------------------------------------------
O76457_APLCA/173-421--------------------------------------------------------------------------------
B3N373_DROER/173-424--------------------------------------------------------------------------------
KCNSK_CAEEL/274-519--------------------------------------------------------------------------------
O76266_HIRME/209-446--------------------------------------------------------------------------------
Q26094_POLPE/173-409--------------------------------------------------------------------------------
Q26095_POLPE/181-410--------------------------------------------------------------------------------
KCNA6_RAT/230-470--------------------------------------------------------------------------------
Q25376_DOROP/169-415--------------------------------------------------------------------------------
KCNA1_HUMAN/166-419--------------------------------------------------------------------------------
KCNAS_DROME/226-489--------------------------------------------------------------------------------

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7MJ92_VIBVY/25-103--------------------------------------------------------------------------------
Q7MND5_VIBVY/236-324--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------
W5K2Z9_ASTMX/155-233--------------------------------------------------------------------------------

PF01007

Q17KL4_AEDAE/26-358--------------------------------------------------------------------------------
E4WZQ3_OIKDI/115-447--------------------------------------------------------------------------------
F6SPD2_XENTR/30-357--------------------------------------------------------------------------------
H2ZYX1_LATCH/30-357--------------------------------------------------------------------------------
W5M8R3_LEPOC/3-329--------------------------------------------------------------------------------
F7FJC1_MONDO/157-485--------------------------------------------------------------------------------
T1EE13_HELRO/114-441--------------------------------------------------------------------------------
H3B1J1_LATCH/31-362--------------------------------------------------------------------------------
U3II41_ANAPL/29-354--------------------------------------------------------------------------------
B4KG98_DROMO/94-428--------------------------------------------------------------------------------
V8NV91_OPHHA/467-790--------------------------------------------------------------------------------
A5PJL2_BOVIN/30-357--------------------------------------------------------------------------------
H3BAR9_LATCH/36-360--------------------------------------------------------------------------------
U3JLS4_FICAL/37-368--------------------------------------------------------------------------------
H2T749_TAKRU/56-383--------------------------------------------------------------------------------
H3A9C1_LATCH/46-374--------------------------------------------------------------------------------
Q1L8I6_DANRE/24-353--------------------------------------------------------------------------------
W4YAR4_STRPU/79-411--------------------------------------------------------------------------------
J0XL15_LOALO/80-413--------------------------------------------------------------------------------
M3XYC0_MUSPF/50-375--------------------------------------------------------------------------------
Q5TQ25_ANOGA/25-357--------------------------------------------------------------------------------
H2MFJ0_ORYLA/42-360--------------------------------------------------------------------------------
U3KL94_FICAL/39-359--------------------------------------------------------------------------------
KCJ10_RAT/31-363--------------------------------------------------------------------------------
E7F2Q1_DANRE/50-373--------------------------------------------------------------------------------
K1QHC7_CRAGI/79-409--------------------------------------------------------------------------------
H2US08_TAKRU/8-335--------------------------------------------------------------------------------
KCJ16_MOUSE/37-357--------------------------------------------------------------------------------
H2Q537_PANTR/31-359--------------------------------------------------------------------------------
B0W1P8_CULQU/118-451--------------------------------------------------------------------------------
H2T950_TAKRU/46-374--------------------------------------------------------------------------------
I3K6N4_ORENI/30-360--------------------------------------------------------------------------------
H9JWA7_BOMMO/187-510--------------------------------------------------------------------------------
M3XLP7_LATCH/62-390--------------------------------------------------------------------------------
W4YRL0_STRPU/65-403--------------------------------------------------------------------------------
B0W1P7_CULQU/12-344--------------------------------------------------------------------------------
B0XCY9_CULQU/27-361--------------------------------------------------------------------------------
IRK1_CAEEL/76-406--------------------------------------------------------------------------------
H2TK24_TAKRU/37-368--------------------------------------------------------------------------------
H2LGJ6_ORYLA/48-374--------------------------------------------------------------------------------
K1QR55_CRAGI/39-367--------------------------------------------------------------------------------
H2TFE7_TAKRU/4-329--------------------------------------------------------------------------------
Q7PX90_ANOGA/27-353--------------------------------------------------------------------------------

PF00060

Q9VIA5_DROME/402-665--------------------------------------------------------------------------------
Q9VVU7_DROME/386-644--------------------------------------------------------------------------------
Q8T0V7_DROME/343-610--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
Q53YX3_ARATH/613-869--------------------------------------------------------------------------------
GLR31_ARATH/587-839--------------------------------------------------------------------------------
GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
C7G3M1_PANTR/559-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
GLRK_ANAPL/168-431--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
B7ZPS4_XENLA/162-426--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
B4II60_DROSE/545-823--------------------------------------------------------------------------------
C7G3L5_PANTR/560-831--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
GLR1_DROME/610-907--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
G1R3B7_NOMLE/543-824--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
Q9U0T0_DOROP/568-841--------------------------------------------------------------------------------

PF02386

TRKG_ECOLI/38-485--------------------------------------------------------------------------------
TRKH_HAEIN/35-487--------------------------------------------------------------------------------
Q9HPA9_HALSA/77-556--------------------------------------------------------------------------------
O83176_TREPA/103-567--------------------------------------------------------------------------------
Y460_MYCPN/24-557--------------------------------------------------------------------------------
TRK1_SCHPO/316-816--------------------------------------------------------------------------------
TRK2_YEAST/301-846--------------------------------------------------------------------------------
TRK2_SCHPO/354-857--------------------------------------------------------------------------------
TRK1_YEAST/624-1180--------------------------------------------------------------------------------

PF03814

E3GJV8_EUBLK/5-557--------------------------------------------------------------------------------
R4KGK3_CLOPA/7-555--------------------------------------------------------------------------------
X4ZCZ5_9BACL/10-554--------------------------------------------------------------------------------
I2BB55_SHIBC/11-556--------------------------------------------------------------------------------
D2B153_STRRD/14-551--------------------------------------------------------------------------------
A7I6Q1_METB6/235-800--------------------------------------------------------------------------------
Q6F8C8_ACIAD/9-565--------------------------------------------------------------------------------
ATKA_BACCR/7-552--------------------------------------------------------------------------------
ATKA_PARD8/9-566--------------------------------------------------------------------------------
T0LA52_9EURY/11-544--------------------------------------------------------------------------------
V5XQW1_ENTMU/10-555--------------------------------------------------------------------------------
Q4JUS0_CORJK/12-549--------------------------------------------------------------------------------
I4D2C5_DESAJ/10-560--------------------------------------------------------------------------------
D3F9I8_CONWI/10-571--------------------------------------------------------------------------------
B8GER2_METPE/14-556--------------------------------------------------------------------------------
E3JBQ1_FRASU/12-552--------------------------------------------------------------------------------
R4TDT9_AMYOR/13-552--------------------------------------------------------------------------------
Q11TL6_CYTH3/25-575--------------------------------------------------------------------------------
G8X3F4_STREN/12-552--------------------------------------------------------------------------------
D3UX96_XENBS/10-561--------------------------------------------------------------------------------
ATKA_DESVH/10-561--------------------------------------------------------------------------------
F9ZTB8_ACICS/11-575--------------------------------------------------------------------------------
A4FMI7_SACEN/14-552--------------------------------------------------------------------------------
ATKA_MAGSA/10-548--------------------------------------------------------------------------------
L0DLW9_SINAD/14-575--------------------------------------------------------------------------------
ATKA_METPP/10-570--------------------------------------------------------------------------------
H8KMI0_SOLCM/10-568--------------------------------------------------------------------------------
F0S640_PEDSD/9-559--------------------------------------------------------------------------------
A0LLJ6_SYNFM/11-602--------------------------------------------------------------------------------
ATKA_PECAS/12-556--------------------------------------------------------------------------------
I3VXZ2_THESW/9-560--------------------------------------------------------------------------------
ATKA_THEAC/28-571--------------------------------------------------------------------------------
R6BHA4_9CLOT/5-583--------------------------------------------------------------------------------
K9VF82_9CYAN/9-558--------------------------------------------------------------------------------
ATKA_DESMR/10-578--------------------------------------------------------------------------------
ATKA_DEIRA/9-559--------------------------------------------------------------------------------
N0BB32_9RHIZ/10-561--------------------------------------------------------------------------------
K9Q855_9NOSO/9-574--------------------------------------------------------------------------------
K9V7P3_9CYAN/9-555--------------------------------------------------------------------------------
F8L2P0_PARAV/10-555--------------------------------------------------------------------------------
ATKA_LISMO/10-557--------------------------------------------------------------------------------
Q6L2R0_PICTO/23-567--------------------------------------------------------------------------------
D1Z017_METPS/13-542--------------------------------------------------------------------------------
E3GWW4_METFV/10-558--------------------------------------------------------------------------------
I3THP9_TISMK/10-558--------------------------------------------------------------------------------
C6VYG5_DYAFD/9-559--------------------------------------------------------------------------------
ATKA_PSESM/10-560--------------------------------------------------------------------------------
U5QJ68_9CYAN/10-567--------------------------------------------------------------------------------
D9R2J7_CLOSW/10-558--------------------------------------------------------------------------------
ATKA_CLOBB/10-575--------------------------------------------------------------------------------
G7M3P7_9CLOT/7-555--------------------------------------------------------------------------------
Q4K7X6_PSEF5/9-559--------------------------------------------------------------------------------
F4KRB0_HALH1/9-568--------------------------------------------------------------------------------
J7QUT1_METSZ/10-561--------------------------------------------------------------------------------
L0J1B4_MYCSM/12-554--------------------------------------------------------------------------------
T0N7P9_9EURY/29-575--------------------------------------------------------------------------------
I4ETN2_MODMB/13-566--------------------------------------------------------------------------------
ATKA_LEPIN/9-549--------------------------------------------------------------------------------
C7Q1T1_CATAD/12-560--------------------------------------------------------------------------------
F5XJD1_MICPN/12-552--------------------------------------------------------------------------------
R5EPZ2_9BACE/10-566--------------------------------------------------------------------------------
A7HRV4_PARL1/16-556--------------------------------------------------------------------------------
R7I6C6_9BURK/13-562--------------------------------------------------------------------------------
ATKA_STAA8/4-555--------------------------------------------------------------------------------
R5UVN1_9PORP/10-563--------------------------------------------------------------------------------
C7LZF2_ACIFD/8-557--------------------------------------------------------------------------------
E8SI98_STAPH/4-555--------------------------------------------------------------------------------
I3TDE3_THEC1/12-531--------------------------------------------------------------------------------
R7C503_9BURK/9-553--------------------------------------------------------------------------------
J7U1A2_MORMO/10-556--------------------------------------------------------------------------------
E8N7S4_MICTS/9-553--------------------------------------------------------------------------------
ATKA_METNO/10-559--------------------------------------------------------------------------------
K7WVS0_9NOST/9-560--------------------------------------------------------------------------------
C6X587_FLAB3/9-559--------------------------------------------------------------------------------
ATKA_CAUCR/10-560--------------------------------------------------------------------------------
S5Z0Q6_PARAH/9-553--------------------------------------------------------------------------------
X2GUB6_9BACI/5-560--------------------------------------------------------------------------------
ATKA_SOLUE/10-559--------------------------------------------------------------------------------
E0UCQ4_CYAP2/9-555--------------------------------------------------------------------------------
R5SY62_9CLOT/9-579--------------------------------------------------------------------------------
D7BJD8_MEISD/5-565--------------------------------------------------------------------------------
T0LT74_9EURY/28-573--------------------------------------------------------------------------------
B1WPS5_CYAA5/10-555--------------------------------------------------------------------------------
R7GCL6_9FIRM/7-576--------------------------------------------------------------------------------
D7A9S5_STAND/10-561--------------------------------------------------------------------------------
ATKA_RHOCS/10-561--------------------------------------------------------------------------------
V6F0K6_9PROT/10-558--------------------------------------------------------------------------------
ATKA_GLOVI/10-566--------------------------------------------------------------------------------
A0JW40_ARTS2/13-553--------------------------------------------------------------------------------
W0JFF5_DESAE/10-566--------------------------------------------------------------------------------
M4V8V0_9DELT/10-555--------------------------------------------------------------------------------
ATKA_AGRVS/10-560--------------------------------------------------------------------------------
K9PBZ4_CYAGP/8-552--------------------------------------------------------------------------------
M1E4S0_9FIRM/11-558--------------------------------------------------------------------------------
D2UFZ8_XANAP/7-575--------------------------------------------------------------------------------
E8U851_DEIML/5-570--------------------------------------------------------------------------------
J9Z8M5_LEPFM/10-559--------------------------------------------------------------------------------
ATKA_STRCO/12-552--------------------------------------------------------------------------------
I0K505_9BACT/9-568--------------------------------------------------------------------------------
C8XB13_NAKMY/15-551--------------------------------------------------------------------------------
E4T7V0_PALPW/11-556--------------------------------------------------------------------------------
ATKA_CLOAB/7-555--------------------------------------------------------------------------------
ATKA_LARHH/11-562--------------------------------------------------------------------------------
ATKA_ACIC5/10-582--------------------------------------------------------------------------------
E3I291_RHOVT/10-561--------------------------------------------------------------------------------
B2FJX0_STRMK/5-564--------------------------------------------------------------------------------
E4NDZ7_KITSK/13-552--------------------------------------------------------------------------------
F8AWS9_FRADG/16-552--------------------------------------------------------------------------------
V5XHA6_MYCNE/12-554--------------------------------------------------------------------------------
S6C6G0_9ACTN/14-591--------------------------------------------------------------------------------
ATKA_EDWI9/11-556--------------------------------------------------------------------------------
W0PFX0_9BURK/11-559--------------------------------------------------------------------------------
F8I8V0_SULAT/10-560--------------------------------------------------------------------------------
ATKA_YERPE/10-556--------------------------------------------------------------------------------
E6STC1_BACT6/10-566--------------------------------------------------------------------------------
A9HGI8_GLUDA/24-574--------------------------------------------------------------------------------
ATKA_KINRD/13-552--------------------------------------------------------------------------------
ATKA_KORVE/10-583--------------------------------------------------------------------------------
G7ZDN7_AZOL4/10-561--------------------------------------------------------------------------------
ATKA_SORC5/10-576--------------------------------------------------------------------------------
S0ART7_FERAC/11-546--------------------------------------------------------------------------------
B7J712_ACIF2/10-575--------------------------------------------------------------------------------
H1YB12_9SPHI/10-568--------------------------------------------------------------------------------
R6ULB1_9FIRM/11-565--------------------------------------------------------------------------------
C7PUT0_CHIPD/9-567--------------------------------------------------------------------------------
ATKA_DESDA/9-579--------------------------------------------------------------------------------
K9RWG4_SYNP3/9-555--------------------------------------------------------------------------------
ATKA_STAEQ/4-554--------------------------------------------------------------------------------
ATKA_CLAMS/12-556--------------------------------------------------------------------------------
ATKA_SYNY3/9-555--------------------------------------------------------------------------------
ATKA_KLEP7/11-556--------------------------------------------------------------------------------
K9Z7H8_CYAAP/9-557--------------------------------------------------------------------------------
D1CGX3_THET1/8-561--------------------------------------------------------------------------------
E2Q1F7_STRC2/12-553--------------------------------------------------------------------------------
W8EUK3_9BACT/12-563--------------------------------------------------------------------------------
K9TR50_9CYAN/9-555--------------------------------------------------------------------------------
W0EX99_9SPHI/9-563--------------------------------------------------------------------------------
C6D691_PAESJ/7-556--------------------------------------------------------------------------------
ATKA_VARPS/10-571--------------------------------------------------------------------------------
B3EAQ3_GEOLS/13-570--------------------------------------------------------------------------------
K9VVM6_9CYAN/9-559--------------------------------------------------------------------------------
K9X7N8_9CHRO/9-556--------------------------------------------------------------------------------
I3Y5A2_THIV6/11-568--------------------------------------------------------------------------------
W5WRB9_9PSEU/12-552--------------------------------------------------------------------------------
F4C4K6_SPHS2/10-559--------------------------------------------------------------------------------
D9QG06_BRESC/10-560--------------------------------------------------------------------------------
A8HY16_AZOC5/10-561--------------------------------------------------------------------------------
Q186E7_PEPD6/11-560--------------------------------------------------------------------------------
B1XRB5_SYNP2/9-555--------------------------------------------------------------------------------
ATKA_TOLAT/12-560--------------------------------------------------------------------------------
U5LJM5_9BACI/9-555--------------------------------------------------------------------------------
E6WH85_PANSA/10-554--------------------------------------------------------------------------------
ATKA_BEII9/10-560--------------------------------------------------------------------------------
R5F2L1_9CLOT/9-579--------------------------------------------------------------------------------
ATKA_ANADE/10-573--------------------------------------------------------------------------------
G8M758_9BURK/10-579--------------------------------------------------------------------------------
ATKA_MYCA9/14-570--------------------------------------------------------------------------------
E8X5C7_ACISM/10-587--------------------------------------------------------------------------------
D6E871_9ACTN/9-587--------------------------------------------------------------------------------
C5C4A0_BEUC1/16-557--------------------------------------------------------------------------------
K8GCZ3_9CYAN/9-558--------------------------------------------------------------------------------
D0IYN9_COMT2/9-559--------------------------------------------------------------------------------
E0SEX9_DICD3/10-555--------------------------------------------------------------------------------
R6RMK4_9FIRM/8-574--------------------------------------------------------------------------------
F4F4Y7_VERMA/14-551--------------------------------------------------------------------------------
A8KYG3_FRASN/13-567--------------------------------------------------------------------------------
F7UZ80_EEGSY/10-588--------------------------------------------------------------------------------
E1VQU5_9GAMM/5-576--------------------------------------------------------------------------------
C6XZL6_PEDHD/9-568--------------------------------------------------------------------------------
B7J714_ACIF2/9-575--------------------------------------------------------------------------------
E8RRM4_ASTEC/14-564--------------------------------------------------------------------------------
K0CGH7_ALCDB/5-555--------------------------------------------------------------------------------
K8E2F1_CARML/9-558--------------------------------------------------------------------------------
D3EAK4_GEOS4/7-556--------------------------------------------------------------------------------
D5WU10_KYRT2/12-563--------------------------------------------------------------------------------
G8TDF8_NIAKG/9-568--------------------------------------------------------------------------------
ATKA_HYDS0/11-568--------------------------------------------------------------------------------
D7DKK2_METV0/11-584--------------------------------------------------------------------------------
R6PVD9_9CLOT/5-571--------------------------------------------------------------------------------
F2IFU1_FLUTR/9-571--------------------------------------------------------------------------------
B1YM42_EXIS2/11-544--------------------------------------------------------------------------------
F7QKE7_9BRAD/10-559--------------------------------------------------------------------------------
ATKA_MICAN/9-574--------------------------------------------------------------------------------
S0EVD3_CHTCT/10-589--------------------------------------------------------------------------------
ATKA_RHIME/11-561--------------------------------------------------------------------------------
D5AKZ2_RHOCB/10-560--------------------------------------------------------------------------------
C9R8E6_AMMDK/12-560--------------------------------------------------------------------------------
D2QBF3_SPILD/9-570--------------------------------------------------------------------------------
C6W8P0_ACTMD/12-539--------------------------------------------------------------------------------
Q09AH8_STIAD/10-563--------------------------------------------------------------------------------
I0DX89_PROSM/10-561--------------------------------------------------------------------------------
C4KYL4_EXISA/11-542--------------------------------------------------------------------------------
ATKA_PSEAE/10-560--------------------------------------------------------------------------------
F8EK12_RUNSL/9-581--------------------------------------------------------------------------------
A0KED5_AERHH/10-553--------------------------------------------------------------------------------
E9T4H3_COREQ/12-565--------------------------------------------------------------------------------
Q31MM1_SYNE7/10-552--------------------------------------------------------------------------------
ATKA_NOSS1/9-555--------------------------------------------------------------------------------
F6D4T7_METSW/10-559--------------------------------------------------------------------------------
K9UDW3_9CHRO/9-563--------------------------------------------------------------------------------
ATKA_HALSA/11-578--------------------------------------------------------------------------------
W0A4I8_9SPHN/10-559--------------------------------------------------------------------------------
ATKA_RHORT/10-561--------------------------------------------------------------------------------
R6NNJ3_9FIRM/5-564--------------------------------------------------------------------------------
D3RSD8_ALLVD/5-565--------------------------------------------------------------------------------
I0H1S8_ACTM4/10-547--------------------------------------------------------------------------------
ATKA_GEOKA/9-557--------------------------------------------------------------------------------
ATKA_THETN/9-558--------------------------------------------------------------------------------
D2Q289_KRIFD/12-553--------------------------------------------------------------------------------
K9RK69_9CYAN/10-555--------------------------------------------------------------------------------
ATKA_ALIAD/10-559--------------------------------------------------------------------------------
B6JA58_OLICO/10-557--------------------------------------------------------------------------------
W6EHN8_SULMU/10-557--------------------------------------------------------------------------------
D3PV93_STANL/12-552--------------------------------------------------------------------------------
H1ZCI8_MYROD/9-559--------------------------------------------------------------------------------
H9ZZC9_FERFK/11-532--------------------------------------------------------------------------------
ATKA_FLAPJ/10-570--------------------------------------------------------------------------------
A5FU08_ACICJ/10-556--------------------------------------------------------------------------------
K9Y0M2_STAC7/9-555--------------------------------------------------------------------------------
C0ZIZ1_BREBN/7-554--------------------------------------------------------------------------------
D6ZE64_SEGRD/12-555--------------------------------------------------------------------------------
H7C701_ENTFA/10-555--------------------------------------------------------------------------------
F4CT92_PSEUX/12-552--------------------------------------------------------------------------------
E8V6X7_TERSS/10-579--------------------------------------------------------------------------------
ATKA_PHOLL/10-561--------------------------------------------------------------------------------
ATKA_MYCTU/10-568--------------------------------------------------------------------------------
J7J1Q1_DESMD/10-560--------------------------------------------------------------------------------
D5UVP7_TSUPD/12-549--------------------------------------------------------------------------------
U5RTG7_9CLOT/7-555--------------------------------------------------------------------------------
ATKA_METI4/11-566--------------------------------------------------------------------------------
D1BAQ9_SANKS/14-555--------------------------------------------------------------------------------
L0ABX1_CALLD/9-533--------------------------------------------------------------------------------
ATKA_GRABC/10-560--------------------------------------------------------------------------------
C9A6Y5_ENTCA/10-555--------------------------------------------------------------------------------
W0I187_9ENTR/10-555--------------------------------------------------------------------------------
ATKA_RHILO/10-559--------------------------------------------------------------------------------
B8ESF4_METSB/10-566--------------------------------------------------------------------------------
ATKA_METB6/11-574--------------------------------------------------------------------------------
C3AK38_BACMY/16-560--------------------------------------------------------------------------------
D5SYH3_PLAL2/10-576--------------------------------------------------------------------------------
D7B3X9_NOCDD/11-556--------------------------------------------------------------------------------
E3EDK0_PAEPS/7-556--------------------------------------------------------------------------------
ATKA_PROAC/12-555--------------------------------------------------------------------------------
B8GSR6_THISH/5-564--------------------------------------------------------------------------------
A5N882_CLOK5/5-568--------------------------------------------------------------------------------
W5WRG8_9CORY/12-549--------------------------------------------------------------------------------
H6NGX7_9BACL/8-552--------------------------------------------------------------------------------
ATKA_ECOLI/10-556--------------------------------------------------------------------------------
R5W702_9BACT/12-563--------------------------------------------------------------------------------
G2I8K8_GLUMN/10-560--------------------------------------------------------------------------------
ATKA_HERA2/10-575--------------------------------------------------------------------------------

PF08016

PKD1_MOUSE/3701-4103....CSAAGSLSTSD...YGIGW....QSVVQNGSETWAYSA...........PDLL..............GAWYWGYCA
PKD2_MOUSE/265-685....CYDVYSVSSEDR...........APFGPRNGTAWMYTS...........EKELN.............GSSHWGIIA
Q8T8Z2_DROME/169-596....CHIGLGKPEWDKKTYAPEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLLL.............NYDHYGYLL
PKDRE_MOUSE/1621-2051GEIHCHPQYGIDPEDTQHYSSVWSKAGKQSTDKASHGFTYKP...........PGKRW.............VYHSYGVLN
Q95V80_STRPU/2211-2645....CRALFTPESEDRELYNASWS...QPIVNMSALLNSSQT...........VEEWSLSNYSPWHFYPDKAVGMWGHAT
PKD2_CAEEL/119-538....CFANYEEKLEDK...........TMVGDGSVDAFIYAT...........AKELE.............NLKTVGTIA
Q9VVZ8_DROME/165-591....NRLGLSLPVFTERDFSESWTLPYERVPYTDKYWPIYTPWLPS..VSVARDNLLM.............GINHVGHMF
PKDRE_HUMAN/1748-2178REIHCHPKYGIDPEDTKNYSGFWNEVDKQAIDESTNGFTYKP...........QGTQW.............LYYSYGLLH
Q9VK95_DROME/402-803....CYAAYSSGAEDR...........KPMHKGSP....FRT...........MHDLD.............STPIWTVLA
PK2L1_MOUSE/147-567....CYDVYSPDKEDQ...........LPFGPQNGTAWTYHS...........QNELG.............GSSHWGRLT
F7APR1_MACMU/91-490....CSAAGGFSTSD...YDVGWE.....SPHNGSGTWAYSA...........PDLL..............GAWSWGSCA
Q9W4X5_DROME/170-595....PQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYWRIYEPWIPIKMGFEFLDALLM.............NFDHVGSLN

PF00520

TRPC5_RABIT/372-636--------------------------------------------------------------------------------
O46129_LOLFO/351-636--------------------------------------------------------------------------------
TRPG_DROME/361-664--------------------------------------------------------------------------------
TRPL_DROME/382-680--------------------------------------------------------------------------------
Q94447_CALVI/372-670--------------------------------------------------------------------------------
TRPC2_MOUSE/670-932--------------------------------------------------------------------------------
TRPC3_HUMAN/379-670--------------------------------------------------------------------------------
TRPC6_MOUSE/447-738--------------------------------------------------------------------------------
TRPM2_HUMAN/801-1060--------------------------------------------------------------------------------
TRPM1_HUMAN/833-1087--------------------------------------------------------------------------------
Q20766_CAEEL/902-1141--------------------------------------------------------------------------------
TRPG_CAEEL/1312-1567--------------------------------------------------------------------------------
TRPV5_RABIT/332-590--------------------------------------------------------------------------------
Q9VUD5_DROME/475-730--------------------------------------------------------------------------------
Q6JGX2_9RODE/387-652--------------------------------------------------------------------------------
O61220_CAEEL/519-775--------------------------------------------------------------------------------
Q9W3W0_DROME/459-665--------------------------------------------------------------------------------
PAIN_DROME/494-746--------------------------------------------------------------------------------
TRPA1_DROME/793-1039--------------------------------------------------------------------------------
TRPA1_HUMAN/720-972--------------------------------------------------------------------------------
TRPA1_CAEEL/813-1080--------------------------------------------------------------------------------
Q9VHY7_DROME/551-812--------------------------------------------------------------------------------
PYX_DROME/496-735--------------------------------------------------------------------------------
O13054_MAKNI/4778-4992--------------------------------------------------------------------------------
O61567_HOMAM/1212-1418--------------------------------------------------------------------------------
O96310_HELVI/229-436--------------------------------------------------------------------------------
ITPR_DROME/2408-2692--------------------------------------------------------------------------------
O77089_PANAR/2326-2624--------------------------------------------------------------------------------
ITPR1_MOUSE/2315-2600--------------------------------------------------------------------------------
ITPR2_HUMAN/2270-2552--------------------------------------------------------------------------------
Q9VW35_DROME/351-581--------------------------------------------------------------------------------
N1P4B6_YEASC/769-1010--------------------------------------------------------------------------------
NALCN_RAT/35-333--------------------------------------------------------------------------------
CCH1_SCHPO/514-755--------------------------------------------------------------------------------
B9DFD5_ARATH/429-683--------------------------------------------------------------------------------
TPC1_HUMAN/440-698--------------------------------------------------------------------------------
B9DFD5_ARATH/103-316--------------------------------------------------------------------------------
CCH1_SCHPO/1272-1517--------------------------------------------------------------------------------
N1P4B6_YEASC/1529-1779--------------------------------------------------------------------------------
N1P4B6_YEASC/1209-1484--------------------------------------------------------------------------------
CCH1_SCHPO/941-1224--------------------------------------------------------------------------------
CCH1_SCHPO/184-493--------------------------------------------------------------------------------
TPC1_HUMAN/105-331--------------------------------------------------------------------------------
NALCN_RAT/1209-1458--------------------------------------------------------------------------------
NALCN_RAT/383-610--------------------------------------------------------------------------------
NALCN_RAT/885-1167--------------------------------------------------------------------------------
CAC1E_DIPOM/1104-1385--------------------------------------------------------------------------------
Q17354_CAEEL/340-623--------------------------------------------------------------------------------
M9NDV1_DROME/768-1051--------------------------------------------------------------------------------
P91744_HETBL/894-1174--------------------------------------------------------------------------------
O02038_CYACP/868-1147--------------------------------------------------------------------------------
O97017_9CNID/849-1127--------------------------------------------------------------------------------
O96057_HALRO/803-1082--------------------------------------------------------------------------------
CAC1D_DROME/1343-1621--------------------------------------------------------------------------------
CAC1S_CYPCA/814-1092--------------------------------------------------------------------------------
CAC1S_HUMAN/798-1076--------------------------------------------------------------------------------
CAC1C_HUMAN/899-1197--------------------------------------------------------------------------------
CAC1D_HUMAN/885-1163--------------------------------------------------------------------------------
CAC1G_RAT/1254-1527--------------------------------------------------------------------------------
Q9W433_DROME/2144-2418--------------------------------------------------------------------------------
O44930_AIPPA/1046-1318--------------------------------------------------------------------------------
O62604_POLPE/908-1178--------------------------------------------------------------------------------
Q17314_CYACP/963-1231--------------------------------------------------------------------------------
P97706_RAT/954-1225--------------------------------------------------------------------------------
SCN7A_HUMAN/933-1204--------------------------------------------------------------------------------
SCN1_HETBL/781-1052--------------------------------------------------------------------------------
O02037_BDECA/985-1259--------------------------------------------------------------------------------
SCNBA_RAT/1033-1299--------------------------------------------------------------------------------
SCNBA_HUMAN/1055-1319--------------------------------------------------------------------------------
Q25150_HALRO/1260-1547--------------------------------------------------------------------------------
SCNAA_CANFA/1158-1436--------------------------------------------------------------------------------
SCNA_ELEEL/999-1275--------------------------------------------------------------------------------
SCN4A_HORSE/1027-1303--------------------------------------------------------------------------------
SCN8A_RAT/1195-1473--------------------------------------------------------------------------------
P90670_APLCA/1177-1452--------------------------------------------------------------------------------
Q25377_DOROP/1022-1296--------------------------------------------------------------------------------
SCNA_DROME/1300-1571--------------------------------------------------------------------------------
Q9XZC1_RHIMP/461-733--------------------------------------------------------------------------------
Q9W433_DROME/300-623--------------------------------------------------------------------------------
CAC1I_RAT/76-407--------------------------------------------------------------------------------
CAC1G_RAT/80-406--------------------------------------------------------------------------------
CAC1H_HUMAN/99-430--------------------------------------------------------------------------------
CAC1E_DIPOM/101-374--------------------------------------------------------------------------------
M9NDV1_DROME/37-324--------------------------------------------------------------------------------
P91744_HETBL/64-348--------------------------------------------------------------------------------
O02038_CYACP/112-392--------------------------------------------------------------------------------
O97017_9CNID/80-362--------------------------------------------------------------------------------
O96057_HALRO/46-328--------------------------------------------------------------------------------
CAC1D_DROME/614-889--------------------------------------------------------------------------------
CAC1S_CYPCA/69-362--------------------------------------------------------------------------------
CAC1F_HUMAN/91-383--------------------------------------------------------------------------------
CAC1D_CHICK/120-412--------------------------------------------------------------------------------
CAC1S_HUMAN/50-345--------------------------------------------------------------------------------
CAC1S_LITCT/50-343--------------------------------------------------------------------------------
P97706_RAT/117-405--------------------------------------------------------------------------------
SCN7A_HUMAN/117-405--------------------------------------------------------------------------------
O02037_BDECA/134-418--------------------------------------------------------------------------------
SCNBA_RAT/128-406--------------------------------------------------------------------------------
SCNBA_HUMAN/128-411--------------------------------------------------------------------------------
SCNA_DROME/152-440--------------------------------------------------------------------------------
P90670_APLCA/137-431--------------------------------------------------------------------------------
Q25377_DOROP/131-412--------------------------------------------------------------------------------
Q25150_HALRO/130-477--------------------------------------------------------------------------------
SCNAA_CANFA/129-417--------------------------------------------------------------------------------
SCNA_ELEEL/121-413--------------------------------------------------------------------------------
SCN4A_HUMAN/130-458--------------------------------------------------------------------------------
SCN5A_HUMAN/130-424--------------------------------------------------------------------------------
Q90518_TAKRU/128-427--------------------------------------------------------------------------------
SCN1_HETBL/54-345--------------------------------------------------------------------------------
O44930_AIPPA/112-392--------------------------------------------------------------------------------
Q17314_CYACP/142-419--------------------------------------------------------------------------------
CAC1G_RAT/1578-1830--------------------------------------------------------------------------------
Q17354_CAEEL/666-920--------------------------------------------------------------------------------
P91744_HETBL/1217-1468--------------------------------------------------------------------------------
M9NDV1_DROME/1094-1348--------------------------------------------------------------------------------
CAC1B_DIPOM/1467-1716--------------------------------------------------------------------------------
CAC1E_DIPOM/1428-1674--------------------------------------------------------------------------------
CAC1E_HUMAN/1477-1734--------------------------------------------------------------------------------
O02038_CYACP/1188-1437--------------------------------------------------------------------------------
O97017_9CNID/1168-1422--------------------------------------------------------------------------------
CAC1M_MUSDO/1108-1378--------------------------------------------------------------------------------
O96057_HALRO/1123-1384--------------------------------------------------------------------------------
CAC1S_CYPCA/1133-1413--------------------------------------------------------------------------------
CAC1S_RABIT/1117-1392--------------------------------------------------------------------------------
CAC1C_HUMAN/1238-1535--------------------------------------------------------------------------------
O02037_BDECA/1306-1555--------------------------------------------------------------------------------
SCN7A_HUMAN/1250-1507--------------------------------------------------------------------------------
P90670_APLCA/1499-1743--------------------------------------------------------------------------------
Q25377_DOROP/1343-1600--------------------------------------------------------------------------------
SCNA_DROME/1618-1871--------------------------------------------------------------------------------
Q9XZC1_RHIMP/780-1031--------------------------------------------------------------------------------
SCNBA_RAT/1345-1595--------------------------------------------------------------------------------
SCNBA_HUMAN/1365-1615--------------------------------------------------------------------------------
Q25150_HALRO/1593-1850--------------------------------------------------------------------------------
SCNA_ELEEL/1321-1578--------------------------------------------------------------------------------
SCN1A_HUMAN/1540-1797--------------------------------------------------------------------------------
SCN5A_HUMAN/1527-1783--------------------------------------------------------------------------------
SCN1_HETBL/1100-1362--------------------------------------------------------------------------------
O44930_AIPPA/1367-1619--------------------------------------------------------------------------------
O62604_POLPE/1225-1481--------------------------------------------------------------------------------
Q17314_CYACP/1278-1536--------------------------------------------------------------------------------
O62604_POLPE/486-725--------------------------------------------------------------------------------
Q17314_CYACP/509-745--------------------------------------------------------------------------------
P97706_RAT/526-760--------------------------------------------------------------------------------
SCN7A_HUMAN/504-739--------------------------------------------------------------------------------
SCNBA_RAT/571-809--------------------------------------------------------------------------------
SCNBA_HUMAN/576-822--------------------------------------------------------------------------------
Q25150_HALRO/798-1033--------------------------------------------------------------------------------
SCNAA_CANFA/673-910--------------------------------------------------------------------------------
SCNA_ELEEL/565-801--------------------------------------------------------------------------------
SCN5A_RAT/717-953--------------------------------------------------------------------------------
SCN4A_HORSE/571-807--------------------------------------------------------------------------------
SCN1A_RAT/767-1003--------------------------------------------------------------------------------
P90670_APLCA/753-995--------------------------------------------------------------------------------
Q25377_DOROP/591-824--------------------------------------------------------------------------------
SCN1_HETBL/410-640--------------------------------------------------------------------------------
O44930_AIPPA/622-858--------------------------------------------------------------------------------
CAC1G_RAT/743-976--------------------------------------------------------------------------------
Q9W433_DROME/1230-1471--------------------------------------------------------------------------------
Q17354_CAEEL/9-248--------------------------------------------------------------------------------
P91744_HETBL/480-720--------------------------------------------------------------------------------
CAC1A_RAT/488-727--------------------------------------------------------------------------------
M9NDV1_DROME/440-678--------------------------------------------------------------------------------
O02038_CYACP/496-738--------------------------------------------------------------------------------
O97017_9CNID/468-710--------------------------------------------------------------------------------
CAC1D_DROME/984-1226--------------------------------------------------------------------------------
O96057_HALRO/428-670--------------------------------------------------------------------------------
CAC1S_CYPCA/446-687--------------------------------------------------------------------------------
O73697_TAKRU/439-680--------------------------------------------------------------------------------
CAC1C_HUMAN/523-764--------------------------------------------------------------------------------
CAC1S_LITCT/430-671--------------------------------------------------------------------------------
CAC1S_HUMAN/431-672--------------------------------------------------------------------------------
CNGC3_ARATH/80-406--------------------------------------------------------------------------------
CNGC6_ARATH/111-443--------------------------------------------------------------------------------
CNGC7_ARATH/98-431--------------------------------------------------------------------------------
CNG16_ARATH/52-386--------------------------------------------------------------------------------
CNG14_ARATH/84-410--------------------------------------------------------------------------------
HCN4_MOUSE/262-525--------------------------------------------------------------------------------
O96385_PARTE/140-383--------------------------------------------------------------------------------
Q27170_PARTE/142-388--------------------------------------------------------------------------------
SKOR_ARATH/82-334--------------------------------------------------------------------------------
KAT3_ARATH/86-336--------------------------------------------------------------------------------
Q9XH40_SAMSA/77-327--------------------------------------------------------------------------------
Q9SM12_MAIZE/69-319--------------------------------------------------------------------------------
AKT2_ARATH/75-324--------------------------------------------------------------------------------
O04703_SOLTU/88-338--------------------------------------------------------------------------------
O24538_VICFA/55-305--------------------------------------------------------------------------------
AKT5_ARATH/78-324--------------------------------------------------------------------------------
O04242_MAIZE/64-310--------------------------------------------------------------------------------
O24382_SOLTU/63-309--------------------------------------------------------------------------------
B9DI19_ARATH/57-300--------------------------------------------------------------------------------
KAT2_ARATH/59-307--------------------------------------------------------------------------------
Q41461_SOLTU/60-311--------------------------------------------------------------------------------
KCNH5_RAT/214-479--------------------------------------------------------------------------------
O44164_CAEEL/216-496--------------------------------------------------------------------------------
KCNAE_DROME/236-500--------------------------------------------------------------------------------
KCNH6_RAT/256-523--------------------------------------------------------------------------------
Q23974_DROME/267-516--------------------------------------------------------------------------------
KCNH3_RAT/224-515--------------------------------------------------------------------------------
KCNH8_RAT/221-481--------------------------------------------------------------------------------
Q9U5E2_DROME/125-365--------------------------------------------------------------------------------
CNG_CAEEL/165-422--------------------------------------------------------------------------------
CNGA4_RAT/34-277--------------------------------------------------------------------------------
CNGA_DROME/107-358--------------------------------------------------------------------------------
CNG_ICTPU/138-376--------------------------------------------------------------------------------
CNGA1_BOVIN/163-406--------------------------------------------------------------------------------
CNG1_CHICK/210-453--------------------------------------------------------------------------------
CNGA2_BOVIN/140-383--------------------------------------------------------------------------------
CNGB1_BOVIN/770-1005--------------------------------------------------------------------------------
Q9W2D5_DROME/468-704--------------------------------------------------------------------------------
KCMA1_RAT/178-400--------------------------------------------------------------------------------
SLO_DROME/126-348--------------------------------------------------------------------------------
SLO1_CAEEL/138-363--------------------------------------------------------------------------------
KCNQ1_HUMAN/122-359--------------------------------------------------------------------------------
Q9XWG9_CAEEL/76-313--------------------------------------------------------------------------------
KCNQ3_HUMAN/122-363--------------------------------------------------------------------------------
KCNQ2_HUMAN/92-324--------------------------------------------------------------------------------
KCNQ4_HUMAN/98-330--------------------------------------------------------------------------------
Q9RW39_DEIRA/33-252--------------------------------------------------------------------------------
Q16976_APLCA/213-469--------------------------------------------------------------------------------
Q9XXD1_CAEEL/229-477--------------------------------------------------------------------------------
KCNG2_CHICK/216-464--------------------------------------------------------------------------------
G1R5R7_NOMLE/226-471--------------------------------------------------------------------------------
KCNAL_DROME/184-417--------------------------------------------------------------------------------
P91784_POLPE/201-427--------------------------------------------------------------------------------
KCNV1_RAT/212-442--------------------------------------------------------------------------------
KCNS3_HUMAN/184-417--------------------------------------------------------------------------------
KCNS1_MOUSE/188-439--------------------------------------------------------------------------------
KCNS2_MOUSE/186-421--------------------------------------------------------------------------------
F7H076_MACMU/181-417--------------------------------------------------------------------------------
KCNAB_DROME/434-670--------------------------------------------------------------------------------
Q26344_APLSP/314-551--------------------------------------------------------------------------------
KCNAG_CAEEL/203-453--------------------------------------------------------------------------------
O76457_APLCA/173-421--------------------------------------------------------------------------------
B3N373_DROER/173-424--------------------------------------------------------------------------------
KCNSK_CAEEL/274-519--------------------------------------------------------------------------------
O76266_HIRME/209-446--------------------------------------------------------------------------------
Q26094_POLPE/173-409--------------------------------------------------------------------------------
Q26095_POLPE/181-410--------------------------------------------------------------------------------
KCNA6_RAT/230-470--------------------------------------------------------------------------------
Q25376_DOROP/169-415--------------------------------------------------------------------------------
KCNA1_HUMAN/166-419--------------------------------------------------------------------------------
KCNAS_DROME/226-489--------------------------------------------------------------------------------

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7MJ92_VIBVY/25-103--------------------------------------------------------------------------------
Q7MND5_VIBVY/236-324--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------
W5K2Z9_ASTMX/155-233--------------------------------------------------------------------------------

PF01007

Q17KL4_AEDAE/26-358--------------------------------------------------------------------------------
E4WZQ3_OIKDI/115-447--------------------------------------------------------------------------------
F6SPD2_XENTR/30-357--------------------------------------------------------------------------------
H2ZYX1_LATCH/30-357--------------------------------------------------------------------------------
W5M8R3_LEPOC/3-329--------------------------------------------------------------------------------
F7FJC1_MONDO/157-485--------------------------------------------------------------------------------
T1EE13_HELRO/114-441--------------------------------------------------------------------------------
H3B1J1_LATCH/31-362--------------------------------------------------------------------------------
U3II41_ANAPL/29-354--------------------------------------------------------------------------------
B4KG98_DROMO/94-428--------------------------------------------------------------------------------
V8NV91_OPHHA/467-790--------------------------------------------------------------------------------
A5PJL2_BOVIN/30-357--------------------------------------------------------------------------------
H3BAR9_LATCH/36-360--------------------------------------------------------------------------------
U3JLS4_FICAL/37-368--------------------------------------------------------------------------------
H2T749_TAKRU/56-383--------------------------------------------------------------------------------
H3A9C1_LATCH/46-374--------------------------------------------------------------------------------
Q1L8I6_DANRE/24-353--------------------------------------------------------------------------------
W4YAR4_STRPU/79-411--------------------------------------------------------------------------------
J0XL15_LOALO/80-413--------------------------------------------------------------------------------
M3XYC0_MUSPF/50-375--------------------------------------------------------------------------------
Q5TQ25_ANOGA/25-357--------------------------------------------------------------------------------
H2MFJ0_ORYLA/42-360--------------------------------------------------------------------------------
U3KL94_FICAL/39-359--------------------------------------------------------------------------------
KCJ10_RAT/31-363--------------------------------------------------------------------------------
E7F2Q1_DANRE/50-373--------------------------------------------------------------------------------
K1QHC7_CRAGI/79-409--------------------------------------------------------------------------------
H2US08_TAKRU/8-335--------------------------------------------------------------------------------
KCJ16_MOUSE/37-357--------------------------------------------------------------------------------
H2Q537_PANTR/31-359--------------------------------------------------------------------------------
B0W1P8_CULQU/118-451--------------------------------------------------------------------------------
H2T950_TAKRU/46-374--------------------------------------------------------------------------------
I3K6N4_ORENI/30-360--------------------------------------------------------------------------------
H9JWA7_BOMMO/187-510--------------------------------------------------------------------------------
M3XLP7_LATCH/62-390--------------------------------------------------------------------------------
W4YRL0_STRPU/65-403--------------------------------------------------------------------------------
B0W1P7_CULQU/12-344--------------------------------------------------------------------------------
B0XCY9_CULQU/27-361--------------------------------------------------------------------------------
IRK1_CAEEL/76-406--------------------------------------------------------------------------------
H2TK24_TAKRU/37-368--------------------------------------------------------------------------------
H2LGJ6_ORYLA/48-374--------------------------------------------------------------------------------
K1QR55_CRAGI/39-367--------------------------------------------------------------------------------
H2TFE7_TAKRU/4-329--------------------------------------------------------------------------------
Q7PX90_ANOGA/27-353--------------------------------------------------------------------------------

PF00060

Q9VIA5_DROME/402-665--------------------------------------------------------------------------------
Q9VVU7_DROME/386-644--------------------------------------------------------------------------------
Q8T0V7_DROME/343-610--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
Q53YX3_ARATH/613-869--------------------------------------------------------------------------------
GLR31_ARATH/587-839--------------------------------------------------------------------------------
GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
C7G3M1_PANTR/559-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
GLRK_ANAPL/168-431--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
B7ZPS4_XENLA/162-426--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
B4II60_DROSE/545-823--------------------------------------------------------------------------------
C7G3L5_PANTR/560-831--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
GLR1_DROME/610-907--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
G1R3B7_NOMLE/543-824--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
Q9U0T0_DOROP/568-841--------------------------------------------------------------------------------

PF02386

TRKG_ECOLI/38-485--------------------------------------------------------------------------------
TRKH_HAEIN/35-487--------------------------------------------------------------------------------
Q9HPA9_HALSA/77-556--------------------------------------------------------------------------------
O83176_TREPA/103-567--------------------------------------------------------------------------------
Y460_MYCPN/24-557--------------------------------------------------------------------------------
TRK1_SCHPO/316-816--------------------------------------------------------------------------------
TRK2_YEAST/301-846--------------------------------------------------------------------------------
TRK2_SCHPO/354-857--------------------------------------------------------------------------------
TRK1_YEAST/624-1180--------------------------------------------------------------------------------

PF03814

E3GJV8_EUBLK/5-557--------------------------------------------------------------------------------
R4KGK3_CLOPA/7-555--------------------------------------------------------------------------------
X4ZCZ5_9BACL/10-554--------------------------------------------------------------------------------
I2BB55_SHIBC/11-556--------------------------------------------------------------------------------
D2B153_STRRD/14-551--------------------------------------------------------------------------------
A7I6Q1_METB6/235-800--------------------------------------------------------------------------------
Q6F8C8_ACIAD/9-565--------------------------------------------------------------------------------
ATKA_BACCR/7-552--------------------------------------------------------------------------------
ATKA_PARD8/9-566--------------------------------------------------------------------------------
T0LA52_9EURY/11-544--------------------------------------------------------------------------------
V5XQW1_ENTMU/10-555--------------------------------------------------------------------------------
Q4JUS0_CORJK/12-549--------------------------------------------------------------------------------
I4D2C5_DESAJ/10-560--------------------------------------------------------------------------------
D3F9I8_CONWI/10-571--------------------------------------------------------------------------------
B8GER2_METPE/14-556--------------------------------------------------------------------------------
E3JBQ1_FRASU/12-552--------------------------------------------------------------------------------
R4TDT9_AMYOR/13-552--------------------------------------------------------------------------------
Q11TL6_CYTH3/25-575--------------------------------------------------------------------------------
G8X3F4_STREN/12-552--------------------------------------------------------------------------------
D3UX96_XENBS/10-561--------------------------------------------------------------------------------
ATKA_DESVH/10-561--------------------------------------------------------------------------------
F9ZTB8_ACICS/11-575--------------------------------------------------------------------------------
A4FMI7_SACEN/14-552--------------------------------------------------------------------------------
ATKA_MAGSA/10-548--------------------------------------------------------------------------------
L0DLW9_SINAD/14-575--------------------------------------------------------------------------------
ATKA_METPP/10-570--------------------------------------------------------------------------------
H8KMI0_SOLCM/10-568--------------------------------------------------------------------------------
F0S640_PEDSD/9-559--------------------------------------------------------------------------------
A0LLJ6_SYNFM/11-602--------------------------------------------------------------------------------
ATKA_PECAS/12-556--------------------------------------------------------------------------------
I3VXZ2_THESW/9-560--------------------------------------------------------------------------------
ATKA_THEAC/28-571--------------------------------------------------------------------------------
R6BHA4_9CLOT/5-583--------------------------------------------------------------------------------
K9VF82_9CYAN/9-558--------------------------------------------------------------------------------
ATKA_DESMR/10-578--------------------------------------------------------------------------------
ATKA_DEIRA/9-559--------------------------------------------------------------------------------
N0BB32_9RHIZ/10-561--------------------------------------------------------------------------------
K9Q855_9NOSO/9-574--------------------------------------------------------------------------------
K9V7P3_9CYAN/9-555--------------------------------------------------------------------------------
F8L2P0_PARAV/10-555--------------------------------------------------------------------------------
ATKA_LISMO/10-557--------------------------------------------------------------------------------
Q6L2R0_PICTO/23-567--------------------------------------------------------------------------------
D1Z017_METPS/13-542--------------------------------------------------------------------------------
E3GWW4_METFV/10-558--------------------------------------------------------------------------------
I3THP9_TISMK/10-558--------------------------------------------------------------------------------
C6VYG5_DYAFD/9-559--------------------------------------------------------------------------------
ATKA_PSESM/10-560--------------------------------------------------------------------------------
U5QJ68_9CYAN/10-567--------------------------------------------------------------------------------
D9R2J7_CLOSW/10-558--------------------------------------------------------------------------------
ATKA_CLOBB/10-575--------------------------------------------------------------------------------
G7M3P7_9CLOT/7-555--------------------------------------------------------------------------------
Q4K7X6_PSEF5/9-559--------------------------------------------------------------------------------
F4KRB0_HALH1/9-568--------------------------------------------------------------------------------
J7QUT1_METSZ/10-561--------------------------------------------------------------------------------
L0J1B4_MYCSM/12-554--------------------------------------------------------------------------------
T0N7P9_9EURY/29-575--------------------------------------------------------------------------------
I4ETN2_MODMB/13-566--------------------------------------------------------------------------------
ATKA_LEPIN/9-549--------------------------------------------------------------------------------
C7Q1T1_CATAD/12-560--------------------------------------------------------------------------------
F5XJD1_MICPN/12-552--------------------------------------------------------------------------------
R5EPZ2_9BACE/10-566--------------------------------------------------------------------------------
A7HRV4_PARL1/16-556--------------------------------------------------------------------------------
R7I6C6_9BURK/13-562--------------------------------------------------------------------------------
ATKA_STAA8/4-555--------------------------------------------------------------------------------
R5UVN1_9PORP/10-563--------------------------------------------------------------------------------
C7LZF2_ACIFD/8-557--------------------------------------------------------------------------------
E8SI98_STAPH/4-555--------------------------------------------------------------------------------
I3TDE3_THEC1/12-531--------------------------------------------------------------------------------
R7C503_9BURK/9-553--------------------------------------------------------------------------------
J7U1A2_MORMO/10-556--------------------------------------------------------------------------------
E8N7S4_MICTS/9-553--------------------------------------------------------------------------------
ATKA_METNO/10-559--------------------------------------------------------------------------------
K7WVS0_9NOST/9-560--------------------------------------------------------------------------------
C6X587_FLAB3/9-559--------------------------------------------------------------------------------
ATKA_CAUCR/10-560--------------------------------------------------------------------------------
S5Z0Q6_PARAH/9-553--------------------------------------------------------------------------------
X2GUB6_9BACI/5-560--------------------------------------------------------------------------------
ATKA_SOLUE/10-559--------------------------------------------------------------------------------
E0UCQ4_CYAP2/9-555--------------------------------------------------------------------------------
R5SY62_9CLOT/9-579--------------------------------------------------------------------------------
D7BJD8_MEISD/5-565--------------------------------------------------------------------------------
T0LT74_9EURY/28-573--------------------------------------------------------------------------------
B1WPS5_CYAA5/10-555--------------------------------------------------------------------------------
R7GCL6_9FIRM/7-576--------------------------------------------------------------------------------
D7A9S5_STAND/10-561--------------------------------------------------------------------------------
ATKA_RHOCS/10-561--------------------------------------------------------------------------------
V6F0K6_9PROT/10-558--------------------------------------------------------------------------------
ATKA_GLOVI/10-566--------------------------------------------------------------------------------
A0JW40_ARTS2/13-553--------------------------------------------------------------------------------
W0JFF5_DESAE/10-566--------------------------------------------------------------------------------
M4V8V0_9DELT/10-555--------------------------------------------------------------------------------
ATKA_AGRVS/10-560--------------------------------------------------------------------------------
K9PBZ4_CYAGP/8-552--------------------------------------------------------------------------------
M1E4S0_9FIRM/11-558--------------------------------------------------------------------------------
D2UFZ8_XANAP/7-575--------------------------------------------------------------------------------
E8U851_DEIML/5-570--------------------------------------------------------------------------------
J9Z8M5_LEPFM/10-559--------------------------------------------------------------------------------
ATKA_STRCO/12-552--------------------------------------------------------------------------------
I0K505_9BACT/9-568--------------------------------------------------------------------------------
C8XB13_NAKMY/15-551--------------------------------------------------------------------------------
E4T7V0_PALPW/11-556--------------------------------------------------------------------------------
ATKA_CLOAB/7-555--------------------------------------------------------------------------------
ATKA_LARHH/11-562--------------------------------------------------------------------------------
ATKA_ACIC5/10-582--------------------------------------------------------------------------------
E3I291_RHOVT/10-561--------------------------------------------------------------------------------
B2FJX0_STRMK/5-564--------------------------------------------------------------------------------
E4NDZ7_KITSK/13-552--------------------------------------------------------------------------------
F8AWS9_FRADG/16-552--------------------------------------------------------------------------------
V5XHA6_MYCNE/12-554--------------------------------------------------------------------------------
S6C6G0_9ACTN/14-591--------------------------------------------------------------------------------
ATKA_EDWI9/11-556--------------------------------------------------------------------------------
W0PFX0_9BURK/11-559--------------------------------------------------------------------------------
F8I8V0_SULAT/10-560--------------------------------------------------------------------------------
ATKA_YERPE/10-556--------------------------------------------------------------------------------
E6STC1_BACT6/10-566--------------------------------------------------------------------------------
A9HGI8_GLUDA/24-574--------------------------------------------------------------------------------
ATKA_KINRD/13-552--------------------------------------------------------------------------------
ATKA_KORVE/10-583--------------------------------------------------------------------------------
G7ZDN7_AZOL4/10-561--------------------------------------------------------------------------------
ATKA_SORC5/10-576--------------------------------------------------------------------------------
S0ART7_FERAC/11-546--------------------------------------------------------------------------------
B7J712_ACIF2/10-575--------------------------------------------------------------------------------
H1YB12_9SPHI/10-568--------------------------------------------------------------------------------
R6ULB1_9FIRM/11-565--------------------------------------------------------------------------------
C7PUT0_CHIPD/9-567--------------------------------------------------------------------------------
ATKA_DESDA/9-579--------------------------------------------------------------------------------
K9RWG4_SYNP3/9-555--------------------------------------------------------------------------------
ATKA_STAEQ/4-554--------------------------------------------------------------------------------
ATKA_CLAMS/12-556--------------------------------------------------------------------------------
ATKA_SYNY3/9-555--------------------------------------------------------------------------------
ATKA_KLEP7/11-556--------------------------------------------------------------------------------
K9Z7H8_CYAAP/9-557--------------------------------------------------------------------------------
D1CGX3_THET1/8-561--------------------------------------------------------------------------------
E2Q1F7_STRC2/12-553--------------------------------------------------------------------------------
W8EUK3_9BACT/12-563--------------------------------------------------------------------------------
K9TR50_9CYAN/9-555--------------------------------------------------------------------------------
W0EX99_9SPHI/9-563--------------------------------------------------------------------------------
C6D691_PAESJ/7-556--------------------------------------------------------------------------------
ATKA_VARPS/10-571--------------------------------------------------------------------------------
B3EAQ3_GEOLS/13-570--------------------------------------------------------------------------------
K9VVM6_9CYAN/9-559--------------------------------------------------------------------------------
K9X7N8_9CHRO/9-556--------------------------------------------------------------------------------
I3Y5A2_THIV6/11-568--------------------------------------------------------------------------------
W5WRB9_9PSEU/12-552--------------------------------------------------------------------------------
F4C4K6_SPHS2/10-559--------------------------------------------------------------------------------
D9QG06_BRESC/10-560--------------------------------------------------------------------------------
A8HY16_AZOC5/10-561--------------------------------------------------------------------------------
Q186E7_PEPD6/11-560--------------------------------------------------------------------------------
B1XRB5_SYNP2/9-555--------------------------------------------------------------------------------
ATKA_TOLAT/12-560--------------------------------------------------------------------------------
U5LJM5_9BACI/9-555--------------------------------------------------------------------------------
E6WH85_PANSA/10-554--------------------------------------------------------------------------------
ATKA_BEII9/10-560--------------------------------------------------------------------------------
R5F2L1_9CLOT/9-579--------------------------------------------------------------------------------
ATKA_ANADE/10-573--------------------------------------------------------------------------------
G8M758_9BURK/10-579--------------------------------------------------------------------------------
ATKA_MYCA9/14-570--------------------------------------------------------------------------------
E8X5C7_ACISM/10-587--------------------------------------------------------------------------------
D6E871_9ACTN/9-587--------------------------------------------------------------------------------
C5C4A0_BEUC1/16-557--------------------------------------------------------------------------------
K8GCZ3_9CYAN/9-558--------------------------------------------------------------------------------
D0IYN9_COMT2/9-559--------------------------------------------------------------------------------
E0SEX9_DICD3/10-555--------------------------------------------------------------------------------
R6RMK4_9FIRM/8-574--------------------------------------------------------------------------------
F4F4Y7_VERMA/14-551--------------------------------------------------------------------------------
A8KYG3_FRASN/13-567--------------------------------------------------------------------------------
F7UZ80_EEGSY/10-588--------------------------------------------------------------------------------
E1VQU5_9GAMM/5-576--------------------------------------------------------------------------------
C6XZL6_PEDHD/9-568--------------------------------------------------------------------------------
B7J714_ACIF2/9-575--------------------------------------------------------------------------------
E8RRM4_ASTEC/14-564--------------------------------------------------------------------------------
K0CGH7_ALCDB/5-555--------------------------------------------------------------------------------
K8E2F1_CARML/9-558--------------------------------------------------------------------------------
D3EAK4_GEOS4/7-556--------------------------------------------------------------------------------
D5WU10_KYRT2/12-563--------------------------------------------------------------------------------
G8TDF8_NIAKG/9-568--------------------------------------------------------------------------------
ATKA_HYDS0/11-568--------------------------------------------------------------------------------
D7DKK2_METV0/11-584--------------------------------------------------------------------------------
R6PVD9_9CLOT/5-571--------------------------------------------------------------------------------
F2IFU1_FLUTR/9-571--------------------------------------------------------------------------------
B1YM42_EXIS2/11-544--------------------------------------------------------------------------------
F7QKE7_9BRAD/10-559--------------------------------------------------------------------------------
ATKA_MICAN/9-574--------------------------------------------------------------------------------
S0EVD3_CHTCT/10-589--------------------------------------------------------------------------------
ATKA_RHIME/11-561--------------------------------------------------------------------------------
D5AKZ2_RHOCB/10-560--------------------------------------------------------------------------------
C9R8E6_AMMDK/12-560--------------------------------------------------------------------------------
D2QBF3_SPILD/9-570--------------------------------------------------------------------------------
C6W8P0_ACTMD/12-539--------------------------------------------------------------------------------
Q09AH8_STIAD/10-563--------------------------------------------------------------------------------
I0DX89_PROSM/10-561--------------------------------------------------------------------------------
C4KYL4_EXISA/11-542--------------------------------------------------------------------------------
ATKA_PSEAE/10-560--------------------------------------------------------------------------------
F8EK12_RUNSL/9-581--------------------------------------------------------------------------------
A0KED5_AERHH/10-553--------------------------------------------------------------------------------
E9T4H3_COREQ/12-565--------------------------------------------------------------------------------
Q31MM1_SYNE7/10-552--------------------------------------------------------------------------------
ATKA_NOSS1/9-555--------------------------------------------------------------------------------
F6D4T7_METSW/10-559--------------------------------------------------------------------------------
K9UDW3_9CHRO/9-563--------------------------------------------------------------------------------
ATKA_HALSA/11-578--------------------------------------------------------------------------------
W0A4I8_9SPHN/10-559--------------------------------------------------------------------------------
ATKA_RHORT/10-561--------------------------------------------------------------------------------
R6NNJ3_9FIRM/5-564--------------------------------------------------------------------------------
D3RSD8_ALLVD/5-565--------------------------------------------------------------------------------
I0H1S8_ACTM4/10-547--------------------------------------------------------------------------------
ATKA_GEOKA/9-557--------------------------------------------------------------------------------
ATKA_THETN/9-558--------------------------------------------------------------------------------
D2Q289_KRIFD/12-553--------------------------------------------------------------------------------
K9RK69_9CYAN/10-555--------------------------------------------------------------------------------
ATKA_ALIAD/10-559--------------------------------------------------------------------------------
B6JA58_OLICO/10-557--------------------------------------------------------------------------------
W6EHN8_SULMU/10-557--------------------------------------------------------------------------------
D3PV93_STANL/12-552--------------------------------------------------------------------------------
H1ZCI8_MYROD/9-559--------------------------------------------------------------------------------
H9ZZC9_FERFK/11-532--------------------------------------------------------------------------------
ATKA_FLAPJ/10-570--------------------------------------------------------------------------------
A5FU08_ACICJ/10-556--------------------------------------------------------------------------------
K9Y0M2_STAC7/9-555--------------------------------------------------------------------------------
C0ZIZ1_BREBN/7-554--------------------------------------------------------------------------------
D6ZE64_SEGRD/12-555--------------------------------------------------------------------------------
H7C701_ENTFA/10-555--------------------------------------------------------------------------------
F4CT92_PSEUX/12-552--------------------------------------------------------------------------------
E8V6X7_TERSS/10-579--------------------------------------------------------------------------------
ATKA_PHOLL/10-561--------------------------------------------------------------------------------
ATKA_MYCTU/10-568--------------------------------------------------------------------------------
J7J1Q1_DESMD/10-560--------------------------------------------------------------------------------
D5UVP7_TSUPD/12-549--------------------------------------------------------------------------------
U5RTG7_9CLOT/7-555--------------------------------------------------------------------------------
ATKA_METI4/11-566--------------------------------------------------------------------------------
D1BAQ9_SANKS/14-555--------------------------------------------------------------------------------
L0ABX1_CALLD/9-533--------------------------------------------------------------------------------
ATKA_GRABC/10-560--------------------------------------------------------------------------------
C9A6Y5_ENTCA/10-555--------------------------------------------------------------------------------
W0I187_9ENTR/10-555--------------------------------------------------------------------------------
ATKA_RHILO/10-559--------------------------------------------------------------------------------
B8ESF4_METSB/10-566--------------------------------------------------------------------------------
ATKA_METB6/11-574--------------------------------------------------------------------------------
C3AK38_BACMY/16-560--------------------------------------------------------------------------------
D5SYH3_PLAL2/10-576--------------------------------------------------------------------------------
D7B3X9_NOCDD/11-556--------------------------------------------------------------------------------
E3EDK0_PAEPS/7-556--------------------------------------------------------------------------------
ATKA_PROAC/12-555--------------------------------------------------------------------------------
B8GSR6_THISH/5-564--------------------------------------------------------------------------------
A5N882_CLOK5/5-568--------------------------------------------------------------------------------
W5WRG8_9CORY/12-549--------------------------------------------------------------------------------
H6NGX7_9BACL/8-552--------------------------------------------------------------------------------
ATKA_ECOLI/10-556--------------------------------------------------------------------------------
R5W702_9BACT/12-563--------------------------------------------------------------------------------
G2I8K8_GLUMN/10-560--------------------------------------------------------------------------------
ATKA_HERA2/10-575--------------------------------------------------------------------------------

PF08016

PKD1_MOUSE/3701-4103VYD.SGGYIQ.ELG.LSLEESRAR-------------------------------------------------LGFLQLH
PKD2_MOUSE/265-685SYS.GAGYYL.DLS.RTREETAAQ-------------------------------------------------LAGLRRN
Q8T8Z2_DROME/169-596NYPEVAGYVV.LMM.STKINCLKQ-------------------------------------------------IEYLRDY
PKDRE_MOUSE/1621-2051TYG.SGGYVFYFFPGQQMFNSTVR-------------------------------------------------LKELEGK
Q95V80_STRPU/2211-2645SLP.SSGYIW.VLG.SMYEEAKDS-------------------------------------------------LAEMVDA
PKD2_CAEEL/119-538SYG.GGGFVQ.RLPVAGSTEAQSA-------------------------------------------------IATLKAN
Q9VVZ8_DROME/165-591NYPESKGYKV.LLS.DTRHKSLKI-------------------------------------------------IDYLMKK
PKDRE_HUMAN/1748-2178TYG.SGGYALYFFPEQQRFNSTLR-------------------------------------------------LKELQES
Q9VK95_DROME/402-803FYR.TGGYTV.NLD.YDKDRNVKI-------------------------------------------------INDLKDI
PK2L1_MOUSE/147-567SYS.GGGYYL.DLP.GSRQASAEA-------------------------------------------------LQGLQEG
F7APR1_MACMU/91-490VYD.SGGYVQ.ELG.LSLEESRDR-------------------------------------------------LRFLQLH
Q9W4X5_DROME/170-595SYPELAGYVS.LLA.RSAANSMKV-------------------------------------------------IDYLSEN

PF00520

TRPC5_RABIT/372-636-------------------------------------------------------------------------------A
O46129_LOLFO/351-636-------------------------------------------------------------------------------A
TRPG_DROME/361-664-------------------------------------------------------------------------------A
TRPL_DROME/382-680-------------------------------------------------------------------------------S
Q94447_CALVI/372-670-------------------------------------------------------------------------------C
TRPC2_MOUSE/670-932-------------------------------------------------------------------------------A
TRPC3_HUMAN/379-670-------------------------------------------------------------------------------.
TRPC6_MOUSE/447-738-------------------------------------------------------------------------------.
TRPM2_HUMAN/801-1060-------------------------------------------------------------------------------L
TRPM1_HUMAN/833-1087-------------------------------------------------------------------------------F
Q20766_CAEEL/902-1141-------------------------------------------------------------------------------S
TRPG_CAEEL/1312-1567-------------------------------------------------------------------------------.
TRPV5_RABIT/332-590-------------------------------------------------------------------------------.
Q9VUD5_DROME/475-730-------------------------------------------------------------------------------T
Q6JGX2_9RODE/387-652-------------------------------------------------------------------------------R
O61220_CAEEL/519-775-------------------------------------------------------------------------------R
Q9W3W0_DROME/459-665-------------------------------------------------------------------------------R
PAIN_DROME/494-746-------------------------------------------------------------------------------I
TRPA1_DROME/793-1039-------------------------------------------------------------------------------N
TRPA1_HUMAN/720-972-------------------------------------------------------------------------------M
TRPA1_CAEEL/813-1080-------------------------------------------------------------------------------M
Q9VHY7_DROME/551-812-------------------------------------------------------------------------------R
PYX_DROME/496-735-------------------------------------------------------------------------------S
O13054_MAKNI/4778-4992-------------------------------------------------------------------------------E
O61567_HOMAM/1212-1418-------------------------------------------------------------------------------D
O96310_HELVI/229-436-------------------------------------------------------------------------------D
ITPR_DROME/2408-2692-------------------------------------------------------------------------------I
O77089_PANAR/2326-2624-------------------------------------------------------------------------------G
ITPR1_MOUSE/2315-2600-------------------------------------------------------------------------------A
ITPR2_HUMAN/2270-2552-------------------------------------------------------------------------------A
Q9VW35_DROME/351-581-------------------------------------------------------------------------------R
N1P4B6_YEASC/769-1010-------------------------------------------------------------------------------Y
NALCN_RAT/35-333-------------------------------------------------------------------------------K
CCH1_SCHPO/514-755-------------------------------------------------------------------------------Y
B9DFD5_ARATH/429-683-------------------------------------------------------------------------------S
TPC1_HUMAN/440-698-------------------------------------------------------------------------------S
B9DFD5_ARATH/103-316-------------------------------------------------------------------------------D
CCH1_SCHPO/1272-1517-------------------------------------------------------------------------------R
N1P4B6_YEASC/1529-1779-------------------------------------------------------------------------------N
N1P4B6_YEASC/1209-1484-------------------------------------------------------------------------------V
CCH1_SCHPO/941-1224-------------------------------------------------------------------------------Y
CCH1_SCHPO/184-493-------------------------------------------------------------------------------H
TPC1_HUMAN/105-331-------------------------------------------------------------------------------N
NALCN_RAT/1209-1458-------------------------------------------------------------------------------H
NALCN_RAT/383-610-------------------------------------------------------------------------------S
NALCN_RAT/885-1167-------------------------------------------------------------------------------V
CAC1E_DIPOM/1104-1385-------------------------------------------------------------------------------L
Q17354_CAEEL/340-623-------------------------------------------------------------------------------T
M9NDV1_DROME/768-1051-------------------------------------------------------------------------------L
P91744_HETBL/894-1174-------------------------------------------------------------------------------L
O02038_CYACP/868-1147-------------------------------------------------------------------------------N
O97017_9CNID/849-1127-------------------------------------------------------------------------------N
O96057_HALRO/803-1082-------------------------------------------------------------------------------Y
CAC1D_DROME/1343-1621-------------------------------------------------------------------------------H
CAC1S_CYPCA/814-1092-------------------------------------------------------------------------------H
CAC1S_HUMAN/798-1076-------------------------------------------------------------------------------A
CAC1C_HUMAN/899-1197-------------------------------------------------------------------------------D
CAC1D_HUMAN/885-1163-------------------------------------------------------------------------------H
CAC1G_RAT/1254-1527-------------------------------------------------------------------------------H
Q9W433_DROME/2144-2418-------------------------------------------------------------------------------Q
O44930_AIPPA/1046-1318-------------------------------------------------------------------------------H
O62604_POLPE/908-1178-------------------------------------------------------------------------------H
Q17314_CYACP/963-1231-------------------------------------------------------------------------------N
P97706_RAT/954-1225-------------------------------------------------------------------------------N
SCN7A_HUMAN/933-1204-------------------------------------------------------------------------------N
SCN1_HETBL/781-1052-------------------------------------------------------------------------------N
O02037_BDECA/985-1259-------------------------------------------------------------------------------H
SCNBA_RAT/1033-1299-------------------------------------------------------------------------------H
SCNBA_HUMAN/1055-1319-------------------------------------------------------------------------------H
Q25150_HALRO/1260-1547-------------------------------------------------------------------------------H
SCNAA_CANFA/1158-1436-------------------------------------------------------------------------------H
SCNA_ELEEL/999-1275-------------------------------------------------------------------------------H
SCN4A_HORSE/1027-1303-------------------------------------------------------------------------------H
SCN8A_RAT/1195-1473-------------------------------------------------------------------------------H
P90670_APLCA/1177-1452-------------------------------------------------------------------------------N
Q25377_DOROP/1022-1296-------------------------------------------------------------------------------H
SCNA_DROME/1300-1571-------------------------------------------------------------------------------N
Q9XZC1_RHIMP/461-733-------------------------------------------------------------------------------H
Q9W433_DROME/300-623-------------------------------------------------------------------------------N
CAC1I_RAT/76-407-------------------------------------------------------------------------------N
CAC1G_RAT/80-406-------------------------------------------------------------------------------N
CAC1H_HUMAN/99-430-------------------------------------------------------------------------------N
CAC1E_DIPOM/101-374-------------------------------------------------------------------------------W
M9NDV1_DROME/37-324-------------------------------------------------------------------------------W
P91744_HETBL/64-348-------------------------------------------------------------------------------W
O02038_CYACP/112-392-------------------------------------------------------------------------------W
O97017_9CNID/80-362-------------------------------------------------------------------------------W
O96057_HALRO/46-328-------------------------------------------------------------------------------W
CAC1D_DROME/614-889-------------------------------------------------------------------------------W
CAC1S_CYPCA/69-362-------------------------------------------------------------------------------W
CAC1F_HUMAN/91-383-------------------------------------------------------------------------------W
CAC1D_CHICK/120-412-------------------------------------------------------------------------------W
CAC1S_HUMAN/50-345-------------------------------------------------------------------------------W
CAC1S_LITCT/50-343-------------------------------------------------------------------------------W
P97706_RAT/117-405-------------------------------------------------------------------------------H
SCN7A_HUMAN/117-405-------------------------------------------------------------------------------H
O02037_BDECA/134-418-------------------------------------------------------------------------------H
SCNBA_RAT/128-406-------------------------------------------------------------------------------H
SCNBA_HUMAN/128-411-------------------------------------------------------------------------------H
SCNA_DROME/152-440-------------------------------------------------------------------------------H
P90670_APLCA/137-431-------------------------------------------------------------------------------H
Q25377_DOROP/131-412-------------------------------------------------------------------------------H
Q25150_HALRO/130-477-------------------------------------------------------------------------------H
SCNAA_CANFA/129-417-------------------------------------------------------------------------------H
SCNA_ELEEL/121-413-------------------------------------------------------------------------------N
SCN4A_HUMAN/130-458-------------------------------------------------------------------------------H
SCN5A_HUMAN/130-424-------------------------------------------------------------------------------H
Q90518_TAKRU/128-427-------------------------------------------------------------------------------H
SCN1_HETBL/54-345-------------------------------------------------------------------------------N
O44930_AIPPA/112-392-------------------------------------------------------------------------------N
Q17314_CYACP/142-419-------------------------------------------------------------------------------N
CAC1G_RAT/1578-1830-------------------------------------------------------------------------------S
Q17354_CAEEL/666-920-------------------------------------------------------------------------------S
P91744_HETBL/1217-1468-------------------------------------------------------------------------------S
M9NDV1_DROME/1094-1348-------------------------------------------------------------------------------S
CAC1B_DIPOM/1467-1716-------------------------------------------------------------------------------S
CAC1E_DIPOM/1428-1674-------------------------------------------------------------------------------S
CAC1E_HUMAN/1477-1734-------------------------------------------------------------------------------S
O02038_CYACP/1188-1437-------------------------------------------------------------------------------S
O97017_9CNID/1168-1422-------------------------------------------------------------------------------S
CAC1M_MUSDO/1108-1378-------------------------------------------------------------------------------S
O96057_HALRO/1123-1384-------------------------------------------------------------------------------S
CAC1S_CYPCA/1133-1413-------------------------------------------------------------------------------S
CAC1S_RABIT/1117-1392-------------------------------------------------------------------------------S
CAC1C_HUMAN/1238-1535-------------------------------------------------------------------------------S
O02037_BDECA/1306-1555-------------------------------------------------------------------------------N
SCN7A_HUMAN/1250-1507-------------------------------------------------------------------------------S
P90670_APLCA/1499-1743-------------------------------------------------------------------------------D
Q25377_DOROP/1343-1600-------------------------------------------------------------------------------N
SCNA_DROME/1618-1871-------------------------------------------------------------------------------D
Q9XZC1_RHIMP/780-1031-------------------------------------------------------------------------------N
SCNBA_RAT/1345-1595-------------------------------------------------------------------------------S
SCNBA_HUMAN/1365-1615-------------------------------------------------------------------------------S
Q25150_HALRO/1593-1850-------------------------------------------------------------------------------H
SCNA_ELEEL/1321-1578-------------------------------------------------------------------------------Q
SCN1A_HUMAN/1540-1797-------------------------------------------------------------------------------R
SCN5A_HUMAN/1527-1783-------------------------------------------------------------------------------K
SCN1_HETBL/1100-1362-------------------------------------------------------------------------------S
O44930_AIPPA/1367-1619-------------------------------------------------------------------------------S
O62604_POLPE/1225-1481-------------------------------------------------------------------------------T
Q17314_CYACP/1278-1536-------------------------------------------------------------------------------K
O62604_POLPE/486-725-------------------------------------------------------------------------------S
Q17314_CYACP/509-745-------------------------------------------------------------------------------S
P97706_RAT/526-760-------------------------------------------------------------------------------H
SCN7A_HUMAN/504-739-------------------------------------------------------------------------------A
SCNBA_RAT/571-809-------------------------------------------------------------------------------D
SCNBA_HUMAN/576-822-------------------------------------------------------------------------------D
Q25150_HALRO/798-1033-------------------------------------------------------------------------------D
SCNAA_CANFA/673-910-------------------------------------------------------------------------------D
SCNA_ELEEL/565-801-------------------------------------------------------------------------------D
SCN5A_RAT/717-953-------------------------------------------------------------------------------D
SCN4A_HORSE/571-807-------------------------------------------------------------------------------D
SCN1A_RAT/767-1003-------------------------------------------------------------------------------D
P90670_APLCA/753-995-------------------------------------------------------------------------------D
Q25377_DOROP/591-824-------------------------------------------------------------------------------D
SCN1_HETBL/410-640-------------------------------------------------------------------------------D
O44930_AIPPA/622-858-------------------------------------------------------------------------------H
CAC1G_RAT/743-976-------------------------------------------------------------------------------S
Q9W433_DROME/1230-1471-------------------------------------------------------------------------------H
Q17354_CAEEL/9-248-------------------------------------------------------------------------------T
P91744_HETBL/480-720-------------------------------------------------------------------------------T
CAC1A_RAT/488-727-------------------------------------------------------------------------------T
M9NDV1_DROME/440-678-------------------------------------------------------------------------------T
O02038_CYACP/496-738-------------------------------------------------------------------------------S
O97017_9CNID/468-710-------------------------------------------------------------------------------T
CAC1D_DROME/984-1226-------------------------------------------------------------------------------S
O96057_HALRO/428-670-------------------------------------------------------------------------------S
CAC1S_CYPCA/446-687-------------------------------------------------------------------------------S
O73697_TAKRU/439-680-------------------------------------------------------------------------------T
CAC1C_HUMAN/523-764-------------------------------------------------------------------------------S
CAC1S_LITCT/430-671-------------------------------------------------------------------------------S
CAC1S_HUMAN/431-672-------------------------------------------------------------------------------S
CNGC3_ARATH/80-406-------------------------------------------------------------------------------L
CNGC6_ARATH/111-443-------------------------------------------------------------------------------L
CNGC7_ARATH/98-431-------------------------------------------------------------------------------L
CNG16_ARATH/52-386-------------------------------------------------------------------------------I
CNG14_ARATH/84-410-------------------------------------------------------------------------------N
HCN4_MOUSE/262-525-------------------------------------------------------------------------------R
O96385_PARTE/140-383-------------------------------------------------------------------------------L
Q27170_PARTE/142-388-------------------------------------------------------------------------------S
SKOR_ARATH/82-334-------------------------------------------------------------------------------Y
KAT3_ARATH/86-336-------------------------------------------------------------------------------Y
Q9XH40_SAMSA/77-327-------------------------------------------------------------------------------Y
Q9SM12_MAIZE/69-319-------------------------------------------------------------------------------Y
AKT2_ARATH/75-324-------------------------------------------------------------------------------Y
O04703_SOLTU/88-338-------------------------------------------------------------------------------Y
O24538_VICFA/55-305-------------------------------------------------------------------------------Y
AKT5_ARATH/78-324-------------------------------------------------------------------------------Y
O04242_MAIZE/64-310-------------------------------------------------------------------------------Y
O24382_SOLTU/63-309-------------------------------------------------------------------------------Y
B9DI19_ARATH/57-300-------------------------------------------------------------------------------Y
KAT2_ARATH/59-307-------------------------------------------------------------------------------F
Q41461_SOLTU/60-311-------------------------------------------------------------------------------Y
KCNH5_RAT/214-479-------------------------------------------------------------------------------K
O44164_CAEEL/216-496-------------------------------------------------------------------------------K
KCNAE_DROME/236-500-------------------------------------------------------------------------------K
KCNH6_RAT/256-523-------------------------------------------------------------------------------K
Q23974_DROME/267-516-------------------------------------------------------------------------------K
KCNH3_RAT/224-515-------------------------------------------------------------------------------R
KCNH8_RAT/221-481-------------------------------------------------------------------------------K
Q9U5E2_DROME/125-365-------------------------------------------------------------------------------Y
CNG_CAEEL/165-422-------------------------------------------------------------------------------N
CNGA4_RAT/34-277-------------------------------------------------------------------------------Y
CNGA_DROME/107-358-------------------------------------------------------------------------------H
CNG_ICTPU/138-376-------------------------------------------------------------------------------Y
CNGA1_BOVIN/163-406-------------------------------------------------------------------------------Y
CNG1_CHICK/210-453-------------------------------------------------------------------------------Y
CNGA2_BOVIN/140-383-------------------------------------------------------------------------------Y
CNGB1_BOVIN/770-1005-------------------------------------------------------------------------------Y
Q9W2D5_DROME/468-704-------------------------------------------------------------------------------Y
KCMA1_RAT/178-400-------------------------------------------------------------------------------G
SLO_DROME/126-348-------------------------------------------------------------------------------G
SLO1_CAEEL/138-363-------------------------------------------------------------------------------G
KCNQ1_HUMAN/122-359-------------------------------------------------------------------------------C
Q9XWG9_CAEEL/76-313-------------------------------------------------------------------------------C
KCNQ3_HUMAN/122-363-------------------------------------------------------------------------------A
KCNQ2_HUMAN/92-324-------------------------------------------------------------------------------A
KCNQ4_HUMAN/98-330-------------------------------------------------------------------------------A
Q9RW39_DEIRA/33-252-------------------------------------------------------------------------------A
Q16976_APLCA/213-469-------------------------------------------------------------------------------A
Q9XXD1_CAEEL/229-477-------------------------------------------------------------------------------A
KCNG2_CHICK/216-464-------------------------------------------------------------------------------G
G1R5R7_NOMLE/226-471-------------------------------------------------------------------------------G
KCNAL_DROME/184-417-------------------------------------------------------------------------------A
P91784_POLPE/201-427-------------------------------------------------------------------------------A
KCNV1_RAT/212-442-------------------------------------------------------------------------------A
KCNS3_HUMAN/184-417-------------------------------------------------------------------------------A
KCNS1_MOUSE/188-439-------------------------------------------------------------------------------S
KCNS2_MOUSE/186-421-------------------------------------------------------------------------------S
F7H076_MACMU/181-417-------------------------------------------------------------------------------A
KCNAB_DROME/434-670-------------------------------------------------------------------------------A
Q26344_APLSP/314-551-------------------------------------------------------------------------------A
KCNAG_CAEEL/203-453-------------------------------------------------------------------------------A
O76457_APLCA/173-421-------------------------------------------------------------------------------A
B3N373_DROER/173-424-------------------------------------------------------------------------------A
KCNSK_CAEEL/274-519-------------------------------------------------------------------------------A
O76266_HIRME/209-446-------------------------------------------------------------------------------A
Q26094_POLPE/173-409-------------------------------------------------------------------------------A
Q26095_POLPE/181-410-------------------------------------------------------------------------------A
KCNA6_RAT/230-470-------------------------------------------------------------------------------E
Q25376_DOROP/169-415-------------------------------------------------------------------------------A
KCNA1_HUMAN/166-419-------------------------------------------------------------------------------A
KCNAS_DROME/226-489-------------------------------------------------------------------------------A

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7MJ92_VIBVY/25-103--------------------------------------------------------------------------------
Q7MND5_VIBVY/236-324--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------
W5K2Z9_ASTMX/155-233--------------------------------------------------------------------------------

PF01007

Q17KL4_AEDAE/26-358--INKAGERNV.LFLNLP.QKSVR-------------------------------------------------FVKDLVT
E4WZQ3_OIKDI/115-447--VDKKGRNQV.SFKDME.EQSAM-------------------------------------------------YMKDIFT
F6SPD2_XENTR/30-357--ISKSGHSNV.KIDKVE.GVFLL-------------------------------------------------YLQDLWT
H2ZYX1_LATCH/30-357--VSKSGQSNI.KLDHVD.GLVLL-------------------------------------------------YLHDLWT
W5M8R3_LEPOC/3-329--VTKDGKCRV.NLRHIA.EPG.R-------------------------------------------------FLSDIFT
F7FJC1_MONDO/157-485--VKKNGQCNI.EFANMD.DKSQR-------------------------------------------------YLADMFT
T1EE13_HELRO/114-441--F.KNGECNV.NRANIK.KRRQR-------------------------------------------------YMADIFT
H3B1J1_LATCH/31-362--MSKDGHSNV.RMDHIA.DKSFL-------------------------------------------------YLKDLWT
U3II41_ANAPL/29-354--VDKNGRCNV.QHGNLG.GESSR-------------------------------------------------YLSDLFT
B4KG98_DROMO/94-428--MQKNGHENV.VFRRIP.EKSWR-------------------------------------------------YMRDAIT
V8NV91_OPHHA/467-790--VKKDGHCNV.QFINVG.EKGQR-------------------------------------------------YLADIFT
A5PJL2_BOVIN/30-357--MSKSGHSNV.RIDKVD.GIYLL-------------------------------------------------YLQDLWT
H3BAR9_LATCH/36-360--VAKNGACNV.AHKNIR.EQG.R-------------------------------------------------FLQDVFT
U3JLS4_FICAL/37-368--IAKNGACNL.AHKNIR.EQG.R-------------------------------------------------FLQDIFT
H2T749_TAKRU/56-383--VKKNGQCNV.VFTNME.EKSQR-------------------------------------------------YLADIFT
H3A9C1_LATCH/46-374--VKKNGQCNV.YFANLS.NKSQR-------------------------------------------------YMADIFT
Q1L8I6_DANRE/24-353--VTKDGRCNI.EFDNVMHRNRFA-------------------------------------------------YVRDFWT
W4YAR4_STRPU/79-411--VGKDGVCNV.VHTRVA...RLR-------------------------------------------------FIEDLFT
J0XL15_LOALO/80-413--IAKNGICNV.YNTNVP.KKDRQ-------------------------------------------------YLRDIFT
M3XYC0_MUSPF/50-375--VKKDGHCNV.RFVNLG.GQGAR-------------------------------------------------YLSDLFT
Q5TQ25_ANOGA/25-357--INKKGEGNV.HLAHLP.QRSLR-------------------------------------------------YVRDIAT
H2MFJ0_ORYLA/42-360--IRKEGSCNI.TFRHIP.EEWLL-------------------------------------------------FVTDIFT
U3KL94_FICAL/39-359--LHKDGSCNV.YFKHIF.GEWES-------------------------------------------------YVADIFT
KCJ10_RAT/31-363--LTKDGRSNV.RMEHIA.DKRFL-------------------------------------------------YLKDLWT
E7F2Q1_DANRE/50-373--VNKDGRCNV.QFINMS.EKGQR-------------------------------------------------YLADIFT
K1QHC7_CRAGI/79-409--VYKNGEVNI.TQTNIR.KRRRR-------------------------------------------------FLADIFT
H2US08_TAKRU/8-335--VGKDGRCNV.TFVNMS.ERGQR-------------------------------------------------YLSDLFT
KCJ16_MOUSE/37-357--LHKDGSCNV.YFKHIF.GEWGS-------------------------------------------------YMVDIFT
H2Q537_PANTR/31-359--VSKDGRCNI.EFGNVEAQSRFI-------------------------------------------------FFVDIWT
B0W1P8_CULQU/118-451--INKKGNLNV.LLVNLP.QKSLR-------------------------------------------------FVKDLVT
H2T950_TAKRU/46-374--VSKSGQCNI.HFSNMD.EKSWR-------------------------------------------------YISDIFT
I3K6N4_ORENI/30-360--VTKDGHCNI.EFGNIEYSNQFA-------------------------------------------------YLVDFWT
H9JWA7_BOMMO/187-510--VYKNGDENVPVRSNIP.AKSIK-------------------------------------------------YMRDLVN
M3XLP7_LATCH/62-390--VDKDGHCNV.QFVNMS.ERSQR-------------------------------------------------YLTDIFT
W4YRL0_STRPU/65-403--VSKNGECNV.VYTHVP.SRWSD-------------------------------------------------FFTDMFT
B0W1P7_CULQU/12-344--IDKLGERNV.QFLNLP.QRSLK-------------------------------------------------FLKDLVN
B0XCY9_CULQU/27-361--L.KNGECNI.TTSKVS.QQHLR-------------------------------------------------FLQDIFT
IRK1_CAEEL/76-406--VGKNGICNV.YNTNVP.KKDRQ-------------------------------------------------YLRDIFT
H2TK24_TAKRU/37-368--IAKNGSCNL.AHKNIR.EQG.R-------------------------------------------------FLQDVFT
H2LGJ6_ORYLA/48-374--VKKNGQCNV.VFNNME.GKPQR-------------------------------------------------YLADIFT
K1QR55_CRAGI/39-367--VQKSGHYRV.KYTGLK.EYRAK-------------------------------------------------FFQDLYI
H2TFE7_TAKRU/4-329--VSKDGHNNV.RIDNVE.GMVKL-------------------------------------------------YLHDIWT
Q7PX90_ANOGA/27-353--..KQGDCNV.IQGNVA.KRRRR-------------------------------------------------YLQDIFT

PF00060

Q9VIA5_DROME/402-665--------------------------------------------------------------------------------
Q9VVU7_DROME/386-644--------------------------------------------------------------------------------
Q8T0V7_DROME/343-610--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
Q53YX3_ARATH/613-869--------------------------------------------------------------------------------
GLR31_ARATH/587-839--------------------------------------------------------------------------------
GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
C7G3M1_PANTR/559-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
GLRK_ANAPL/168-431--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
B7ZPS4_XENLA/162-426--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
B4II60_DROSE/545-823--------------------------------------------------------------------------------
C7G3L5_PANTR/560-831--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
GLR1_DROME/610-907--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
G1R3B7_NOMLE/543-824--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
Q9U0T0_DOROP/568-841--------------------------------------------------------------------------------

PF02386

TRKG_ECOLI/38-485---SLFVFFITFVIFFCIGGGAWY-TT----------------------------------------------KKSG..I
TRKH_HAEIN/35-487---GGKAFMQAFMLSLIAGTLLWW-PC----------------------------------------------HHHK..Q
Q9HPA9_HALSA/77-556---HGMVIAAGGWFAIAVVGALPF-LF----------------------------------------------TAWL..T
O83176_TREPA/103-567---HIQNITLGIFALIAFKAQKKF-A.----------------------------------------------.......
Y460_MYCPN/24-557---ISQRIFHFYIYCILLGAVLLF-L.----------------------------------------------.......
TRK1_SCHPO/316-816---LRPANTIDGIVRSSLSSSSLS-KD----------------------------------------------TEPS...
TRK2_YEAST/301-846---PSSQELNKLAQTKSFQKLLGL-RR----------------------------------------------DEGDHDY
TRK2_SCHPO/354-857---AHQNVVRGSAITIAPTPVPRH-NR----------------------------------------------R......
TRK1_YEAST/624-1180---KKPNFRKRGWNNKIFEHGPYA-SD----------------------------------------------SDRN..Y

PF03814

E3GJV8_EUBLK/5-557----ALTLALFVIIIFPLGTYIYH.IA.........TNK..KT.............F.ADPVFD.........RVDNAIY
R4KGK3_CLOPA/7-555----GIILLVFVLLCILVGKYIYK.VS.........EHE..RT.............F.LDPVLD.........RVDNFIY
X4ZCZ5_9BACL/10-554----AVTVLIALLLARPAGLYIAE.VF.........NYE..RT.............G.LDRWFG.........WLEKPVY
I2BB55_SHIBC/11-556----.SYLALLLALAKPLGSLLAR.QI.........EGI...................PLPGTA.........WLERPLL
D2B153_STRRD/14-551----..LVLALVLTHRPLGDYMYR.VY.........TGT..K..................HT...........AVERVVY
A7I6Q1_METB6/235-800----LLFIVIVALISIPLGAWMAK.IF.........TGK..PN.............F.LSPLIS.........WVETKVL
Q6F8C8_ACIAD/9-565----ITVFVLALILAYPLGHYLAD.VM.........QAK..PM.............K.SDRLFR.........WIEQPLY
ATKA_BACCR/7-552----IITMLLFILVAKPTGIYLEK.AF.........QGS..KT...............LDKVFG.........PFEKLIF
ATKA_PARD8/9-566----ALQILLLLVISYPLGKHIAK.VY.........KEG..ND.............C.MR.FMA.........PIERFIY
T0LA52_9EURY/11-544----AVVWGTVIVLSWFLSSYLLG.VF.........TGR..KS.............R.LDRILV.........PVENFIY
V5XQW1_ENTMU/10-555----.FFFFILLVLAAPLGWYIKL.IM.........TGE..TP.............K.YVRFIQ.........PIERFFY
Q4JUS0_CORJK/12-549----IMVIIALAACYVPLGNYMAA.TF.........TSK..K..................HN...........AFERGFY
I4D2C5_DESAJ/10-560----LFYVLILTVLAIPLGRYMAK.VF.........SQE..NT.............W.VDPLFR.........PLEKLIY
D3F9I8_CONWI/10-571----LVFFAVLTALTPLIGAYMHK.VF.........RGD..A..............I.LAPVLG.........PVERGFY
B8GER2_METPE/14-556----IVFVLLLTAVAFPLGKYMSR.LF.........FQD..RP.............P.A..IIR.........TLEAPVY
E3JBQ1_FRASU/12-552----AILVVALVLTYRPFGDYMAR.VF.........TSD..K..................HL...........RVERGIY
R4TDT9_AMYOR/13-552----.LLLVALAVVYRPLGDYMAR.VF.........STE..K..................HT...........KAERGLY
Q11TL6_CYTH3/25-575----LLMYALVIALAIPLGRYIGK.IF.........NYE..HT.............W.LDIIFD.........PLDKLFF
G8X3F4_STREN/12-552----LALVVALALVHRPLGDYMAA.VY.........TSR..R..................HL...........RAERWIY
D3UX96_XENBS/10-561----TSFLVILFILSRPLGSLIAN.LV.........EGE...................LPRWLT.........NAETSLW
ATKA_DESVH/10-561----ALFLGLLALMSPVLGRFIGRAVL.........RGE..QT.............W.MHSVLG.........PVERLIY
F9ZTB8_ACICS/11-575----..TIALSIVLAWPLGIYMRR.IY.........SDE..HC.............L.AKRLLG.........PVERAIY
A4FMI7_SACEN/14-552----..LVLAVVAVYRPFGDYMAR.VY.........TGA..E..................HW...........RVERALY
ATKA_MAGSA/10-548----LLFLALVLALTPILGRFMTW.LF.........QAP.......................VG.........RVEDGFY
L0DLW9_SINAD/14-575----.......IAASLPIGWSMFR.TLDVPTDRAGRGLD..................................ALPMFLC
ATKA_METPP/10-570----AVFLALLMLLAWPLGRWLAA.VA.........EGH..LP.............Q.GLAPFC.........RVETALY
H8KMI0_SOLCM/10-568----.FTYAITVLLAIPLGKYIAK.VF.........GGE..KT.............W.SD.FMA.........PMESLFF
F0S640_PEDSD/9-559----IAMFGVTLLLAIPLGKYIAK.VY.........AGE..RT.............F.LDPVFN.........PIERLFY
A0LLJ6_SYNFM/11-602----.LLLATATLAAFPLSRYLAW.IM.........DGK..YR..............................PAPFFRW
ATKA_PECAS/12-556----..LLLTVLIVAQPLGSGLAR.LI.........EGE...................TGTLLQ.........KFETKTA
I3VXZ2_THESW/9-560----LIFICLLVIITIPLGSYIAK.VF.........TNQ..HT.............F.FDFVAK.........PIEKFVY
ATKA_THEAC/28-571----LIYLIIASVLAYILSFHIAK.IY.........LDE..KT.............V.FSKITG.........RIISFFE
R6BHA4_9CLOT/5-583----VLTILIYLIMVIPVGSYLYH.IA.........AGK..HT.............F.ADPVLN.........RVDDVIY
K9VF82_9CYAN/9-558----ALTLIIVVAIAPIFGNYMAR.VY.........MGE..PT.............I.LDPAIK.........PVEQLIY
ATKA_DESMR/10-578----LFFLSVLLVLSWPLGLYAAR.VY.........QGQ..PC.............V.MDKILG.........PLERLLY
ATKA_DEIRA/9-559----VVLLGVMAALVVPVGNWLYG.VA.........TGQ..KD.............T................ALERLTY
N0BB32_9RHIZ/10-561----ALVLGAVLAAAWPLGLYMAR.VF.........AGE..RT.............A.LSTVMR.........PVERGLY
K9Q855_9NOSO/9-574----GLTLLILVAITPFFGRYMAR.VY.........QEQ..RT.............F.FDPILN.........PIERILY
K9V7P3_9CYAN/9-555----GLTLLIVIAIAPFFGKYLAK.VF.........LGE..NT.............P.FDFIFS.........PIEKILF
F8L2P0_PARAV/10-555----LVFLALLLIVTPLLGQYIAA.IF.........SEK..DP.............L.MKRVLG.........RLEDGCY
ATKA_LISMO/10-557----.FFVVLLLVLAVPLGIYMYK.VM.........IGE..KV.............F.LSRVLE.........PVERFGY
Q6L2R0_PICTO/23-567----FIYIFLALLFGYLISNYISK.LY.........MDEEDKT.............W.LYPISG.........RVTNFFE
D1Z017_METPS/13-542----..IILLALILAIPLGEYLAL.VF.........SGK..RA.............P.LEPAFS.........PIEKALS
E3GWW4_METFV/10-558----IAFYILLTFLAWPLGKYMAR.VF.........TGK..KT.............F.ITPIVR.........PIENFIY
I3THP9_TISMK/10-558----ALYLAILALIAVPLGRWT...VA.........AAS..SSG............R.LGRVFA.........PVEAGIL
C6VYG5_DYAFD/9-559----IALFVGTVALAVPFGKYIAK.VY.........GGE..KT.............L.LDPVLG.........PLEKGFY
ATKA_PSESM/10-560----LAFLVLLLAPAPWLGRFFYR.VM.........EGE..RT.............W.LSPVLG.........PVERACY
U5QJ68_9CYAN/10-567----AVTIALMVAIVPLFGTYMAR.VF.........QFE..RT.............W.LDPLFD.........PIEGLVY
D9R2J7_CLOSW/10-558----.IYMAVLVGLSIPLGIYIYK.VM.........TGQ..RV.............F.LTPVLA.........PVERVIY
ATKA_CLOBB/10-575----.LYILILVVLAIPLGNYIGK.IM.........NGE..KV.............F.LSKILT.........PCENFIY
G7M3P7_9CLOT/7-555----IITLLLFMLIVVPLGKYLYY.VS.........TGE..KT.............V.VDKVFN.........PIDNFIY
Q4K7X6_PSEF5/9-559----AVILGLMTGLAALMGQWLAR.VF.........SGR..GH.............A................LPERATY
F4KRB0_HALH1/9-568----VATLILTIVLAIPLGRYLAK.VY.........QGE..RV.............W.TD.FLR.........PFERLLY
J7QUT1_METSZ/10-561----AIVLVAVIVAAIPLGGYVAR.VL.........AGE..QN.............L.LTPALA.........PIERVFY
L0J1B4_MYCSM/12-554----ALLIVALAVVHVPFGDYMYR.VY.........SSD..K..................HS...........RVERVIY
T0N7P9_9EURY/29-575----ALYLIIISFFGYMIAPYIKK.LY.........TGE..NT.............K.LRKYTD.........PIIGFIE
I4ETN2_MODMB/13-566----.LLVLALALVHRPLGDAMAR.AFSTDPPLPPKARS..RRN............S.GGHW...........RVERLVY
ATKA_LEPIN/9-549----LIFLFALLIFSPLFGLGLYK.VY.........LYK..TS..............................GFEKFLY
C7Q1T1_CATAD/12-560----AALVLMLAVSYRPLGDYMAH.IL.........TSR..K..................HL...........RAELALY
F5XJD1_MICPN/12-552----AALIVLLALAYVPLGDYLAA.VL.........TPT..R..................HT...........RLERGLY
R5EPZ2_9BACE/10-566----.AQIVLMVVLAYPIGKYISK.VF.........KGE..KV.............W.SD.FMT.........PIEKIMY
A7HRV4_PARL1/16-556----......TALLSWPLGRYMKW.AMD.PAASASRSAD..................................RFTHMFQ
R7I6C6_9BURK/13-562----..LFAVIFTLSVSIGIYMSA.VF.........DGT...................LSQKFPWMY......RVESIFL
ATKA_STAA8/4-555----ILFLTMMVMITYVFSGYLYR.VA.........LVQ..SS.............R.VDLIFT.........RFENMCF
R5UVN1_9PORP/10-563----.LQVVAMVVLAYPLGRYMAK.VY.........KGE..RT.............W.SD.FMA.........PIEKWIY
C7LZF2_ACIFD/8-557----IVLAVALAVTWRVLGAYMAG.VY.........EGR....................YSLLV.........RLERPVL
E8SI98_STAPH/4-555----VIFLITFFLCAFLLSRYLYS.VA.........LLT..PT.............P.ADKVFS.........GVEKGIY
I3TDE3_THEC1/12-531----..IFLVTVMTGYVLSGVIRKMVV.........EWH..KK.............P.P..............RVLEVVY
R7C503_9BURK/9-553----TVFSIVLFLITKPLGLWLTP.LA.........KGR...................APAVVE.........PADRAVL
J7U1A2_MORMO/10-556----AGFLIVLLIAAKLLSNLLVC.FI.........DGT...................PLPVLR.........RVEGVLW
E8N7S4_MICTS/9-553----.TLLVALGLAYRPLGDYIAR.IY.........TGR..R..................DL...........AVERGTY
ATKA_METNO/10-559----TLYGAVVLALVKPLGWYMTR.VF.........TGE..RT.............L.LSPVLA.........PIERGLY
K7WVS0_9NOST/9-560----ALTLIIVIATTPLLGRYIAC.VF.........LGE..ST.............L.LDSVLN.........PIERIIF
C6X587_FLAB3/9-559----IVMFAVSVALAIPFGKYIAK.VY.........GGE..KT.............L.PDPLFN.........PIEKLFY
ATKA_CAUCR/10-560----ALTLSLAVAIGWPLGVFLSR.VW.........NGE..KT.............F.LDPVMR.........PVEGLFY
S5Z0Q6_PARAH/9-553----ALFLAGLTVVGLGLGAYMER.VF.........TGR....................FMLFN.........PVERRLL
X2GUB6_9BACI/5-560----AIVCIIYLPLVILTGHYLFR.VT.........MHK..KT.............W.LDPLMD.........KVDHVIY
ATKA_SOLUE/10-559----LAFTAIIWALAKPIGGFMAK.VF.........AGE..RT.............W.LHRILR.........PVEVAIY
E0UCQ4_CYAP2/9-555----VLTLIILVVIVPFLGNYLAR.VF.........LFK..KT.............I.LDPILN.........PIERIIY
R5SY62_9CLOT/9-579----ILYCAVLIVLAIPLGRYIGK.VM.........NGE..KT.............V.LTRLLS.........PVENGIY
D7BJD8_MEISD/5-565----ILILLLVLLLAWPLGGYLAR.VF.........SGE..RT...............LLDFLA.........PLERGIY
T0LT74_9EURY/28-573----LIYLIVISIFGFIIADHIKK.IY.........LGQ..RT.............I.LTGFSE.........KAIYFIE
B1WPS5_CYAA5/10-555----.FTLLILIIIVPIFGNYMAK.VY.........LRE..KT.............I.LDSLLS.........PIEKLIY
R7GCL6_9FIRM/7-576----..TLLIFLILIFPIGNYVYH.IA.........TGK..KS.............F.VDPLFD.........RIDNTLY
D7A9S5_STAND/10-561----ATILALVVAAAVPLGNYMAR.VY.........AGE..RT.............L.LSTVLG.........PVERGFY
ATKA_RHOCS/10-561----LLYLGLLAAVTPLLGRYMAR.VF.........EGE..RT.............L.PGIVLG.........PLERGLY
V6F0K6_9PROT/10-558----LIYILLIVAVTPLLGGFMAR.LF.........GGE..RV.............L.LSPVLG.........PIERSLY
ATKA_GLOVI/10-566----VATLVLMVAIVPFFGTYMAR.VF.........QGE..ST.............W.LDRVLG.........PIENLVY
A0JW40_ARTS2/13-553----AALILALTAAHKPLGVYLAR.VF.........EGK..T..................ST...........RTERLFY
W0JFF5_DESAE/10-566----LVFIVLVSLLVKPLGSYMAN.VF.........NGE..KT.............V.LSLVFR.........PIEIFIY
M4V8V0_9DELT/10-555----ILFVGVLFLLTPPLGKFMAA.VF.........KGE..TT.............W.LHKPLG.........WLERLTY
ATKA_AGRVS/10-560----GLLLALVFLTIKPLGLYIAC.VF.........EGQ..RT.............F.LSPILG.........PLERLLL
K9PBZ4_CYAGP/8-552----ALTLTVAVLTAFPLGRHLWQ.VF.........DDR..PQ.............PGWDPWLL.........PLETALL
M1E4S0_9FIRM/11-558----ALFIILLTLCVKPFGLYIAK.VF.........QGE..KI.............F.ISKIIS.........PIEQFVY
D2UFZ8_XANAP/7-575----..VYALALLLGWPLGLYLAK.VM.........RGA..PM.............C.GDALFG.........WIERPLY
E8U851_DEIML/5-570----.FTYLLVFALAWPLGGYIAR.VF.........RGE..RT...............LTDALA.........PLERALV
J9Z8M5_LEPFM/10-559----LVSLGLIVLLSPLVGRYLAW.IF.........QSP..HL..............................SIEKGLY
ATKA_STRCO/12-552----LALTAALALAHVPLGNYLAR.VY.........SSP..K..................HL...........RIEKWIY
I0K505_9BACT/9-568----VATYLITMLLAIPLGKLYAK.VF.........ANK..PN.............A.LD.FMA.........PLERLLY
C8XB13_NAKMY/15-551----...VLALALAHRPVGDYLYR.VL.........EPG..R..................PA...........RVERGIY
E4T7V0_PALPW/11-556----IIFLGLLIGLTPVLGNYMYK.VF.........TGE..KH.............L.MSAPLG.........WLERLTY
ATKA_CLOAB/7-555----AIILIVFVLLCIPIGRYMYK.VS.........EHK..KT.............L.LDPVLD.........KIDGFIY
ATKA_LARHH/11-562----.LYLLVLLALAWPLGRYLAA.LL.........EGR..LA.............Q.RFAWMG.........RIERGIL
ATKA_ACIC5/10-582----GIFIAAVLLGAKPLGVYMAA.VF.........ERR..HT.............W.LDPVLV.........PVEKLLY
E3I291_RHOVT/10-561----LVFCAIVVASAKPLGAYMTH.VF.........AGE..RT.............F.LSFILS.........PVERIFY
B2FJX0_STRMK/5-564----LVIIAASLLLAWPLGLYLAR.VM.........RGT..PM.............K.VDVLFH.........WIEKPLY
E4NDZ7_KITSK/13-552----.ALVGALALCYRPLGDHIAK.LL.........TSA..R..................HL...........RAEKALY
F8AWS9_FRADG/16-552----....VALGLTYRPFGDYLAR.VY.........TSE..R..................HL...........RAEKMTY
V5XHA6_MYCNE/12-554----AALVLVLALTHVPLGDYMYR.VY.........TRA..E..................DS...........RLERGIY
S6C6G0_9ACTN/14-591----.VLVALVVACALPLSGYLVD.VM.........EGR..PL.............L.IRRALG.........PLERSAC
ATKA_EDWI9/11-556----.LLILLLLILAPLLGSLLSR.LI.........DGE...................PYRAMA.........RTENTLW
W0PFX0_9BURK/11-559----..ILVLTTCLAVVLGKWIAR.VF.........TGE..KD.............T................ILESGTY
F8I8V0_SULAT/10-560----AVLLVLMMGIGLGVGTYLER.VL.......PVQGE.................VRPRSLFG.........RLETAIY
ATKA_YERPE/10-556----ASFMLVLFVLSRPLGGFLAR.LI.........EGE...................PFSALQ.........KVEAGLW
E6STC1_BACT6/10-566----.LQILLMVALSYPLGKYIAK.IY.........KGE..KT.............W.SD.FMK.........PMEKLIF
A9HGI8_GLUDA/24-574----AAFLFATVLLAPVAGNAMTR.VM.........GGA..RG.............A.IGRFFG.........PFEAGLY
ATKA_KINRD/13-552----.LLLLLLAAVHVPLGDFLAR.TF.........AGT..R..................HL...........RLERGIY
ATKA_KORVE/10-583----LLFLGLILAVTKPLGVFMAR.VF.........NRE..RT.............F.LDPVLR.........PIERLIY
G7ZDN7_AZOL4/10-561----LVFLALVVAVTRPLGGFMTR.VF.........TGE..RT.............L.LSPIVG.........PVERGLY
ATKA_SORC5/10-576----ALYLAVLIGLSVPLGTYMAR.VY.........QGE..RG.............L.MASVLG.........PLERLAY
S0ART7_FERAC/11-546----ALVWAIVVLLAWILAKYLQG.VY.........DSG..KT.............I.FDKIMD.........PVDNVIY
B7J712_ACIF2/10-575----.AVLLLTILLALPLGRYMHR.VY.........AGE..RF.............W.ATRLMS.........PVERGLY
H1YB12_9SPHI/10-568----.LTYLLTLIIAVPLGLYMAK.VF.........KGE..KT.............W.LD.FMA.........PVERLIF
R6ULB1_9FIRM/11-565----.VYVVALLAIGYPLGCYIYK.IY.........NGE..RV.............A.LMRIFA.........PLEQLLY
C7PUT0_CHIPD/9-567----ILTFILTLVIAFPLGKYIAR.VF.........QGE..RT.............F.TD.FLN.........PVERFIY
ATKA_DESDA/9-579----LLYLSLLTALAWPLGKYIGK.VM.........DGE..PF.............W.LQRALA.........PCERALY
K9RWG4_SYNP3/9-555----SLILIILVLVAPPLGYYMAG.VF.........SGE..QA.............K.LGRIFQ.........PVERLLF
ATKA_STAEQ/4-554----VLFLIVFILLSLIVSRYLYS.VA.........LNV..PS.............K.IDVVFN.........PIEKLIY
ATKA_CLAMS/12-556----.SVVLVLVLVHRPLGDLMAR.MY.........ESR..H..................DT...........RVERGIY
ATKA_SYNY3/9-555----ALILAILVATAPLLGRYMAR.VF.........LGQ..ST.............W.LDKIAR.........PLESLIF
ATKA_KLEP7/11-556----.SYLLVLLVLARPLGMCLAR.MV.........NDI...................PLPGLA.........GVERVLW
K9Z7H8_CYAAP/9-557----ILTLVLVVIITPILGNYMAC.VF.........LGK..PT.............F.LDRFLK.........PIESRLY
D1CGX3_THET1/8-561----.AFLLVLLAITKPLGSYMAR.VY.........QGE..RT.............F.LSPALA.........PLERAIY
E2Q1F7_STRC2/12-553----LALVAALALSHRPLGDHIAR.CL.........TDG..R..................HL...........RAERVVH
W8EUK3_9BACT/12-563----...YLITLVLALPLGAYLAR.VF.........RGE..KN.............L.LD.FMR.........PVENGIY
K9TR50_9CYAN/9-555----TLTLGILVAIVPFFGRYMAA.VY.........LEE..RT.............F.LDGGCR.........PIERWIY
W0EX99_9SPHI/9-563----ILMYGLAVLLAIPLGRYIGK.VY.........SND..KT.............W.SDRIFK.........PVDTIFY
C6D691_PAESJ/7-556----IIVVGVLILLVKPLGTYVYH.VY.........SDQ..PN.............R.TDRLFG.........GIERFIY
ATKA_VARPS/10-571----ALFLAALLVLAWPVGKFLAA.LC.........NER...................VPRWMQ.........RVEAPLY
B3EAQ3_GEOLS/13-570----.FLLLILLALVRPLGSFMAR.VY.........QGE..RN.............L.FLPLLA.........PVERLIY
K9VVM6_9CYAN/9-559----VLTLLILIAIVRPFGSYIAH.IF.........LGE..KT.............F.LDSVIN.........PVDSMIY
K9X7N8_9CHRO/9-556----ALTLVILVAITPIFGKYMAR.VF.........LEK..SV.............L.LNRVIN.........PIERTIF
I3Y5A2_THIV6/11-568----.LYLLVLLLAAKPLGSYIAA.VM.........EGR..PI.............L.ALRLGG.........GLESLLY
W5WRB9_9PSEU/12-552----ALLLAALAVVYRPLGDYMAR.AF.........TSK..G..................HW...........KLERALY
F4C4K6_SPHS2/10-559----.FMFLLTCVLAIPLGKYIAK.VY.........SGE..RT.............W.LDFLFG.........NIENTIY
D9QG06_BRESC/10-560----ALTLGLSVALGWPLGLYLSR.VW.........NGE..RT.............W.LDPVLR.........PVEKVFY
A8HY16_AZOC5/10-561----IVLFAVVIATAIPLGRFMAR.VY.........AGE..RT.............F.LSPVLG.........PVERGLY
Q186E7_PEPD6/11-560----VIVLAIFMILVIPMGKYLYH.IA.........TNQ..KT.............F.GDRLFD.........KVDNFIY
B1XRB5_SYNP2/9-555----AIALAILLSVAPFLGRYMAR.VF.........MGQ..KT.............L.LDPIAI.........PLERLLF
ATKA_TOLAT/12-560----..YMLVLLLLAWPLGIALTR.LV.........DDR...................LPLWLI.........RVESHIK
U5LJM5_9BACI/9-555----IVTMAAVILIAKPAGIYLAK.AF.........DYS..QT.............G.LDKVFG.........PIENILF
E6WH85_PANSA/10-554----AVFLLVLMVLAQPLGRFLAL.MI.........ADK.....................PLLP.........RTERALW
ATKA_BEII9/10-560----AFILGLTVALGWPLGLFLAR.LW.........EGE..QT.............W.LDPVLK.........PVERLVY
R5F2L1_9CLOT/9-579----IIYCVILVVLAIPLGSYMGK.VM.........NGE..RV.............F.LSRLLL.........PVENLIY
ATKA_ANADE/10-573----AAFFGLLTAAAVPLGAYAAR.VL.........STA..PP.............H.GRGPVA.........RLERGLY
G8M758_9BURK/10-579----AIFIVVLIALALPLGRYMAN.VF.........EGT..SV.............V.VRRIGR.........PVESVFY
ATKA_MYCA9/14-570----..VILALAIAYVPLGDYMAR.VF.........TGP..H..................SLRASGLSTIKHSRVERLIY
E8X5C7_ACISM/10-587----LFFFALVLVSAKPVGVYMAR.VF.........ERE..RT.............L.VDILFR.........PVERALY
D6E871_9ACTN/9-587----.IYLALLVALAIPLSGYINK.VM.........AGE..RVA............V.LSRVLV.........PVENVVY
C5C4A0_BEUC1/16-557----ALVLAVLAAVHVPFGAYMAR.VY.........SSP..K..................HL...........RVERAGY
K8GCZ3_9CYAN/9-558----AITLLIVVVITPFLGRYMAR.VF.........MGQ..QT.............L.LDPVLN.........PLEQVIF
D0IYN9_COMT2/9-559----AAVLTAATLLTIPMGQWLAR.CF.........TSE..RH.............G................WLERLSY
E0SEX9_DICD3/10-555----VSLFAILLVLAQPLGQFMAR.LV.........EGE....................TGALR.........RYELGVA
R6RMK4_9FIRM/8-574----VLYLVILAALAIPLGKYIGK.IM.........DGE..KV.............F.LSRLLR.........PVEHGIY
F4F4Y7_VERMA/14-551----..LVVALAVVHRPLGDYLYR.VV.........CAE..R..................HS...........RVERGIY
A8KYG3_FRASN/13-567----.LLVGALATTYRPFGDYMFR.VY.........TSE..K..................HL...........PVERAIY
F7UZ80_EEGSY/10-588----.IYLALLVALAIPLSGYINR.VM.........AGE..RVA............V.LSRVLV.........PVENFIY
E1VQU5_9GAMM/5-576----LLFLALLVALAWPLGRYLAA.VM.........RGA..PM.............R.SDALFQ.........WIERPLY
C6XZL6_PEDHD/9-568----VATYLLTLVIAIPLGKYLAK.VF.........AGE..KV.............W.TD.FLK.........PLENGIF
B7J714_ACIF2/9-575----VAVLALSVFLALPLGHYMYR.VV.........EGH..RF.............W.ATRFLG.........PLEKRIY
E8RRM4_ASTEC/14-564----VLFMAALTALAVPLGDYVAR.VL.........SGQ..RT.............W.LSPVFT.........PVEGLIY
K0CGH7_ALCDB/5-555----ALIYLVTLGLAWPLGRYLSW.LF..........GE..RS...............VSGGIA.........TVENGLL
K8E2F1_CARML/9-558----ILFLVILIGLGIPLGIYSYR.VM.........SGK..KV.............F.LSRVIE.........PIENQVY
D3EAK4_GEOS4/7-556----AIVILVLVLLVKPLGTYLYQ.VF.........RYE..SN.............G.TDRWFS.........WAEKRIF
D5WU10_KYRT2/12-563----VLLLAAVLLAAWPLGRYMAR.VF.........QGE..RT.............F.LDPVLR.........PLERGLY
G8TDF8_NIAKG/9-568----IITFLLTVLLAWPLGKYIAR.VF.........KGE..RT.............I.TD.FMN.........PVERFIF
ATKA_HYDS0/11-568----ILFFGILTIISPILGKYMAD.IY.........EGR..VH.............P.SLKPIR.........YVEKTIY
D7DKK2_METV0/11-584----.LYLTVLLLLTKPMGLWIAK.VM.........NGE..SV.............I.ANKLGG.........PIERIIY
R6PVD9_9CLOT/5-571----IATLAIFLILVIPMGKYMYH.IA.........TYQ..KT.............F.ADKVFN.........PIDHFIY
F2IFU1_FLUTR/9-571----IAMFILTVAIAIPLGRYIGK.VY.........LGE..KT.............L.LDPIFN.........PIERFFF
B1YM42_EXIS2/11-544----.ILLVIALGAAVLLGRYIGT.VF.........APV..GIR............K.TDWIGK..........LERRLL
F7QKE7_9BRAD/10-559----FVFCAIIVALTPVVGGYMTR.VF.........AGE..RT.............F.LSPILR.........PVEAVLY
ATKA_MICAN/9-574----ALTILIIVAITPFFGRYMAR.VF.........MER..RT.............L.LDPLCD.........RVESLLY
S0EVD3_CHTCT/10-589----LLFFLLILVFTKPLGSYMAR.VF.........QGE..RT.............L.LHPILR.........PLEVGLY
ATKA_RHIME/11-561----.LLFLAVLVVVKPLGLYMAG.VL.........SGE..PN.............V.LSPILG.........PVERGLY
D5AKZ2_RHOCB/10-560----AAVLLFTLATAVPLGRYMAR.LF.........SGE..RT.............F.LHPLLH.........PVERGFY
C9R8E6_AMMDK/12-560----..FAAVLTALAVPLGFYMAR.VF.........EGE..RT.............L.LSPLLR.........PIEGVVY
D2QBF3_SPILD/9-570----IVMYGLTVLLAIPLGKYIAN.VF.........RPESANG..............................PLERFIY
C6W8P0_ACTMD/12-539----ALLIAALAAAYRPFGDYMAR.VY.........TDA..K..................HT...........RVERLLY
Q09AH8_STIAD/10-563----LVFFALVLALTKPLGGYLYR.VF.........EG...RP.............P.LPQVLG.........PVERGLF
I0DX89_PROSM/10-561----ASFLLVLFVLAKPLGLFIAR.LI.........EGD...................MPHFIA.........KTETIIW
C4KYL4_EXISA/11-542----.LLIAITMTASALLGGYVGR.RFVPIQERPNYVGK..................................ALETRIT
ATKA_PSEAE/10-560----LAFFALVLVPAPFLGRYCFK.VM.........EGQ..RN.............L.LSAPLA.........PLERVCY
F8EK12_RUNSL/9-581----VLLFVLTVLLALPLGRYIAK.VY.........LGQ..PT.............W.LD.FMS.........PLEHFIY
A0KED5_AERHH/10-553----.AFVLLVLLPAPLLGNYLYR.VF.........EGK....................SRWLA.........PLERATL
E9T4H3_COREQ/12-565----ALVVAVLAILYVPVGDYMAK.VY.........TTD..T..................DFRSGDL......RIETVVY
Q31MM1_SYNE7/10-552----..TLLPVILMTPLLGNYLWR.VF.........SDQ..SS.............L.LDRLCT.........PWEQRLF
ATKA_NOSS1/9-555----GLTLCIVIAITPVLGRYIAR.VF.........LGE..RT.............I.LDRVMN.........PIERSVY
F6D4T7_METSW/10-559----ILFFVVAILLAWPLGKYMSK.VF.........SGE..KN.............F.MTPLVR.........PVEKFIY
K9UDW3_9CHRO/9-563----GLTLVLIVAITPIFGGYIAR.VY.........LGQ..RT.............L.LDRVLH.........PVERLIF
ATKA_HALSA/11-578----AVFFTILAVLVFVAGEYLAW.VY.........REQ..ANSDHRPPGYLSWFER.LDEIFT.........PIENGLY
W0A4I8_9SPHN/10-559----LVFVAILIALAKPMGLWLHA.LY.........EGR..RT.............P.LHVVLG.........PVEAGFY
ATKA_RHORT/10-561----VLFCAIILGLTPLLGGYMAR.VF.........SGE..RV.............L.LSVVFG.........PLERGLY
R6NNJ3_9FIRM/5-564----VLTLAIFMILVIPMGTYMYH.IA.........TKQ..KT.............F.ADKIFN.........PLDNTIY
D3RSD8_ALLVD/5-565----LLIYAAALLLAWPLGRYLAA.IY.........SAT..PT.............A.LDQVFG.........PVEWVIY
I0H1S8_ACTM4/10-547----..LVAAIVVVHRPFGDYMYR.VV.........SGT..R..................HT...........VVERAVY
ATKA_GEOKA/9-557----TLIFLLLIVIAVPLGKYLYV.AF..........FE..KG.............K.IDRFFS.........PIEAVIY
ATKA_THETN/9-558----.TMIAIIVLLTKPLGTYMYN.IF.........EYK..PM.............R.SDKIFL.........PVENFIY
D2Q289_KRIFD/12-553----ALLLLLLAAAYRPLGGYLAR.VY.........TAG..R..................DT...........RVERGAY
K9RK69_9CYAN/10-555----.LTLLLVLIVTPTFGKYIAK.VF.........MGR..TT.............L.LDRVMN.........PLELLIY
ATKA_ALIAD/10-559----FLVVLALVACAWPLGGYIYR.TF.........VGE..RV.............R.PDAVMV.........PVERAIY
B6JA58_OLICO/10-557----LVFLGIVIALVKPLGGYITR.VM.........NGE..RT.............F.LSPVLG.........PVERGLY
W6EHN8_SULMU/10-557----.SFLILLIGAAKAYSGFFTK.VL.........VGE..KN.............V.LTPLLS.........PVEKSLY
D3PV93_STANL/12-552----VAMVVALAIVHRPLGDYVYR.VV.........TRK..R..................DR...........KVERGVY
H1ZCI8_MYROD/9-559----LVTFLVAIGISIPLGKYIAK.VY.........AGQ..PT.............F.LDTIMS.........PLEQFCY
H9ZZC9_FERFK/11-532----.AIFIAVSLLGYELSRLLKKMVL.........EWN..FE.............P.P..............KLLKKVF
ATKA_FLAPJ/10-570----.SIFIVSIVLAIPLGRYIAK.IY.........SND..KT.............L.LDPIFN.........PIEKFIF
A5FU08_ACICJ/10-556----ALALALVFGAAFPLGAYLAR.LY.........RGD..L..................RFLA.........AIEAPIY
K9Y0M2_STAC7/9-555----ALTLLIVVLIVPWFGNYMAR.IF.........LAQ..KT.............I.LEPIAQ.........PLEKLIY
C0ZIZ1_BREBN/7-554----ALVLVVLFVLAIPMGRYLAR.SF.........SLE..TT.............R.LDRVFG.........GLEKAIY
D6ZE64_SEGRD/12-555----LFILGVLAAVYVPLGDFMAR.VY.........TST..E..................DL...........AVERVLY
H7C701_ENTFA/10-555----.FFLFILLLLAVPLGWYIKE.IM.........QGE..IP.............K.GVSFLQ.........PVERLFY
F4CT92_PSEUX/12-552----AALLVLLGVCYVPLGDYMAR.VF.........TAE..R..................HW...........RIESMLY
E8V6X7_TERSS/10-579----VLFIAAVLLLAKPMGSYLTR.VF.........ERR..RT.............F.LDPLLA.........PCERLLY
ATKA_PHOLL/10-561----TSFLLILMLLAKPLGNIIAN.LI.........DGD...................IPRWLT.........KIESGLW
ATKA_MYCTU/10-568----AALIAVLLLTAPALGGYLAK.IY.........GDE..AKK............P.GDRVFG.........PIERVIY
J7J1Q1_DESMD/10-560----IVFFVVLFALAIPLGLYMAK.VF.........QGE..KT.............F.LDPIMG.........PLEAFIY
D5UVP7_TSUPD/12-549----VTLVAALAICYRPLGDYLAH.VV.........TTT..R..................HW...........RVERAVY
U5RTG7_9CLOT/7-555----GIILVIFVLLCIPTGKYIYK.VA.........EHE..KT.............F.LDPVLD.........KVDNFIY
ATKA_METI4/11-566----.LFIALLAVLNIPLGTHLYK.VL.........DKE..GKT............V.FDPILK.........PLENLTY
D1BAQ9_SANKS/14-555----SLLVAALAAVHLPLGAYLAH.VY.........TSP..R..................HL...........RVERLGY
L0ABX1_CALLD/9-533----VIIVAISLMVSYLLSMPI.SYFI.........KYE..KD.............L.PNTKLN.........KIENFIF
ATKA_GRABC/10-560----GIFFLCVLALTRPLGGFLVS.VL.........EGR..RT.............F.LSPILG.........PVERALY
C9A6Y5_ENTCA/10-555----.LFLLILLAAAVPLGWYIKE.IM.........QGK..TP.............R.FVRFIQ.........PIERLTY
W0I187_9ENTR/10-555----ASFLAVLLLLAQPLGRLMTG.LV.........LDR...................PLPLTA.........GFERTLW
ATKA_RHILO/10-559----LVFCGIIGLLTKPLGFYMHR.VF.........NGD..RT.............P.LSPIFG.........PLERGLY
B8ESF4_METSB/10-566----VILLVVLVLTIRPLGGYMAW.VF.........AGR..HT.............S.IHP.LK.........FIEDSLF
ATKA_METB6/11-574----.LIGVILALLLIPTGEFMFR.VY.........TGK..KT.............F.LSPLFV.........PVEAWIL
C3AK38_BACMY/16-560----.ITIGLFVIVAKPMGDYIYN.AF.........QRK..EP...............FQKVFG.........PLENILF
D5SYH3_PLAL2/10-576----AIYLGVLLACVKPLGFYMAR.VY.........SGS..AT.............F.LDRFIG.........PLERLLY
D7B3X9_NOCDD/11-556----AALALILALLYRPVGDYTAR.VF.........TSP..K..................DL...........RIERGFY
E3EDK0_PAEPS/7-556----GVVIVILLLLVKPVGTYMYH.VF.........SNE..PN.............R.TDRIFG.........ETEKPIY
ATKA_PROAC/12-555----.LLAIALGIAQHHLGTYMAR.VF.........TSD..K..................DT...........RVETWCY
B8GSR6_THISH/5-564----LLVFALAIGLGWPLGRYLAA.VM.........RGA..PM.............R.GDRLFL.........WLERPLY
A5N882_CLOK5/5-568----ILTLAIFIVLVIPMGKYLYH.IA.........ARK..HT.............F.LDPVFD.........PIDGMIY
W5WRG8_9CORY/12-549----AVVIIALAALYLPMGKYMAW.AL.........NNP..K..................DT...........RIESGFY
H6NGX7_9BACL/8-552----VVTLLLVLVLARPVGLYMAQ.VF.........DYE..KS.............K.WDKWFG.........WIEKPIY
ATKA_ECOLI/10-556----ATFLLVLMVLARPLGSGLAR.LI.........NDI...................PLPGTT.........GVERVLF
R5W702_9BACT/12-563----...WVCLVVLCYPLGRHIAK.VY.........KGE..KN.............I.MD.FMA.........PVERFIY
G2I8K8_GLUMN/10-560----MAFFICVVAMTRPLGGFLKR.VL.........EGE..RH.............V.LGQIFS.........PVERGIY
ATKA_HERA2/10-575----GIFLVVLMACVVPLGRYMAK.VY..........GE..NP.............P.LQGFFG.........PIERLIY

PF08016

PKD1_MOUSE/3701-4103NW--------------------LDSRSRAVFVELTRYSPAVGLHAAVTLRL-----EF-PV-------------------
PKD2_MOUSE/265-685FW--------------------LDRGTRAAFIDFSVYNANINLFCVVRLLA-----EF-PA-------------------
Q8T8Z2_DROME/169-596SW--------------------LDKNTSALFIDLTMYNADANLFTLITLRV-----EN-SP-------------------
PKDRE_MOUSE/1621-2051NW--------------------LDELTWAVIVELTTLNPDTSLMCSISVVF-----EV-SP-------------------
Q95V80_STRPU/2211-2645RW--------------------LDARTRALFVEWTSYNANTNLFCVVTFLM-----ET-PA-------------------
PKD2_CAEEL/119-538RW--------------------IDRGSRAIIVDFALYNANINLFCVVKLLF-----EL-PA-------------------
Q9VVZ8_DROME/165-591NW--------------------LDANTTALFMDFSLYNADANTFTVCTLWV-----EK-FP-------------------
PKDRE_HUMAN/1748-2178NW--------------------LDEKTWAVVLELTTFNPDINLFCSISVIF-----EV-SQ-------------------
Q9VK95_DROME/402-803HW--------------------LDRGSRLCLVEFNLFNENTDIFQSIKLIA-----EI-PP-------------------
PK2L1_MOUSE/147-567LW--------------------LDRGTRVVFIDFSVYNANINLFCILRLVV-----EF-PA-------------------
F7APR1_MACMU/91-490NW--------------------LDNRSRAVFVELTRYSPAVGLHAAVTLRL-----EF-PA-------------------
Q9W4X5_DROME/170-595HW--------------------LTLNTSAVFIDFTLYNVDVNLFSICTLRV-----EK-TP-------------------

PF00520

TRPC5_RABIT/372-636SY----------------....LTFLFMLLLA..........SQHIVRTDL.....HV-QG-------------------
O46129_LOLFO/351-636SY----------------....LSFLV.LLIL..........VSQRIENPF.....FF-LF-------------------
TRPG_DROME/361-664SY----------------....FTFLF.LLMLASQRIET...FIGGWFFAD.....SS-GM-------------------
TRPL_DROME/382-680SY----------------...LFFLFI.LILVSQRADDDFVRIFGTTRMKK.....EL-AE-------------------
Q94447_CALVI/372-670SY----------------....MFFLMLLGAA..........SLRVVQITF.....EL-LA-------------------
TRPC2_MOUSE/670-932S.----------------....YLWFL.IFLL..........GESLVMETQ.....LS-TF-------------------
TRPC3_HUMAN/379-670..----------------....ASFII...............FLGLLVFNA.....SD-RF-------------------
TRPC6_MOUSE/447-738AS----------------....FTIFLGLLVMNAADR.....FEGTKLLPN.....ET-ST-------------------
TRPM2_HUMAN/801-1060NI----------------....LSYFA.FLCL..........FAYVLMV.......DF-QP-------------------
TRPM1_HUMAN/833-1087YT----------------....ISYLG.YLLL..........FNYVILVRM.....DG-W.-------------------
Q20766_CAEEL/902-1141..----------------....WCIAF.LIFL..........TTQTCILLL.....ET-SL-------------------
TRPG_CAEEL/1312-1567.S----------------....WTISF.ILFI..........TFFTYTLLV.....KT-PP-------------------
TRPV5_RABIT/332-590..----------------....LASLY.ILYM..........ICFTTCCIY.....RP-LK-------------------
Q9VUD5_DROME/475-730FW----------------....LNFTE...............YYDPSEVEVLPAWWES-YA-------------------
Q6JGX2_9RODE/387-652FF----------------....FNFAC.YLVY..........MIIFTIVAYHQPSLEQ-PA-------------------
O61220_CAEEL/519-775LV----------------....FELFV.VIGI.............CVQVFL.....DF-RD-------------------
Q9W3W0_DROME/459-665YC----------------....AEFAT.LVGV..........LSYVIFQQG.....DE-IK-------------------
PAIN_DROME/494-746FY----------------....LNFLI.YSLF..........TASIITYTL.....LK-FH-------------------
TRPA1_DROME/793-1039MG----------------....WEQLT.MNLS..........QNPSVASQI.....RL-DS-------------------
TRPA1_HUMAN/720-972MN----------------....LGSYC.LGLI..........PMTILVVNI...KPGM-AF-------------------
TRPA1_CAEEL/813-1080YY----------------....FALFMYLVFIVSLTQ.....YVRHTKAPYNVWNEES-YY-------------------
Q9VHY7_DROME/551-812LI----------------FCFSFVLFL.TLYV..........LTALAHNCYNGSKNDN-TT-------------------
PYX_DROME/496-735LA----------------....YHTLFVILFT..........FYVIWVYVRCCKKEEL-CV-------------------
O13054_MAKNI/4778-4992RI----------------..........AELL..........GVDLASLDV.....SQ-QH-------------------
O61567_HOMAM/1212-1418AI----------------....SNLLG...............METTMSFKQ.....EE-AS-------------------
O96310_HELVI/229-436SI----------------....SNMLG...............MEKTSFSAQ.....EE-EG-------------------
ITPR_DROME/2408-2692TI----------------....FSLVI.VLALPRESGIRT..FIGSVILRF.....IF-LL-------------------
O77089_PANAR/2326-2624LA----------------IVVSFQQQI.FIYL..........LGSISVVRL.....IF-SV-------------------
ITPR1_MOUSE/2315-2600ML----------------....ISLAI.VIALPKPHGIRA..LIASTILRL.....IF-SV-------------------
ITPR2_HUMAN/2270-2552VA----------------ICTSMLFFF.SKPV..........GIRPFLVSI.....ML-RS-------------------
Q9VW35_DROME/351-581SV----------------....LNIFV.LLTCALSFALCTRALWRAYLLRC...TTVN-FF-------------------
N1P4B6_YEASC/769-1010SH----------------....VEFIF.VILI..........ICDIGMRAS.....VK-VS-------------------
NALCN_RAT/35-333PW----------------....VHSLL.RICA..........IISVIPVCM.....NT-PM-------------------
CCH1_SCHPO/514-755LF----------------....YSNFIWISFI..........VAQFVTLCT.....QT-YD-------------------
B9DFD5_ARATH/429-683PN----------------....FGYAI.SFIL..........IINFIAVVV.....ET-TL-------------------
TPC1_HUMAN/440-698KA----------------....FQYFM.YLVV..........AVNGVWILV.....ET-FM-------------------
B9DFD5_ARATH/103-316RD----------------....YYYLG.ELPY..........LTNAESIIY.......-..-------------------
CCH1_SCHPO/1272-1517TF----------------....TGLYI.VHLL..........FLLTIFYPC.....PI-AY-------------------
N1P4B6_YEASC/1529-1779FY----------------....YASFL.QVVL..........YLHIIMLLS.....RS-YN-------------------
N1P4B6_YEASC/1209-1484FI----------------....FALAT.ILLI..........VCSCYVTPL.....YR-MH-------------------
CCH1_SCHPO/941-1224RV----------------....IQVFI.YACI..........LTAVIIECI.....AT-PI-------------------
CCH1_SCHPO/184-493PL----------------....YNIFI.FVVI..........VLHAVLLMI.....RS-DD-------------------
TPC1_HUMAN/105-331HL----------------....FYLME.LATA..........LLLLLLSLC.....EA-PA-------------------
NALCN_RAT/1209-1458PF----------------....FKRTI.ALLV..........LAQSVLLSV.....K.-WD-------------------
NALCN_RAT/383-610SV----------------....FHMFI.LSMV..........TVDVIVAAS.....NY-YK-------------------
NALCN_RAT/885-1167TY----------------....LDWVM.ITVT..........ICSCISMMF.....ES-PF-------------------
CAC1E_DIPOM/1104-1385RY----------------....FEMCI.LLVI..........AASSVALAA.....ED-PI-------------------
Q17354_CAEEL/340-623KY----------------....FEMMV.MTVI..........CLSSVSLAA.....ED-PV-------------------
M9NDV1_DROME/768-1051PY----------------....FDFFI.MVVI..........SMSSIALAA.....ED-PV-------------------
P91744_HETBL/894-1174RY----------------....FDLFI.MIVI..........CASSIALAA.....ED-PV-------------------
O02038_CYACP/868-1147KI----------------....FINSI.LVLI..........IMSSVALAA.....ED-PI-------------------
O97017_9CNID/849-1127TY----------------....FVNFI.LCLI..........IVSSILLAA.....ED-PL-------------------
O96057_HALRO/803-1082NW----------------....FNNAI.LACI..........ILSSIALAC.....ED-PV-------------------
CAC1D_DROME/1343-1621SN----------------....FGNII.LCCI..........MFSSAMLAA.....EN-PL-------------------
CAC1S_CYPCA/814-1092TT----------------....FTNII.LLFI..........LLSSISLAA.....ED-PI-------------------
CAC1S_HUMAN/798-1076TW----------------....FTNFI.LLFI..........LLSSAALAA.....ED-PI-------------------
CAC1C_HUMAN/899-1197TI----------------....FTNLI.LFFI..........LLSSISLAA.....ED-PV-------------------
CAC1D_HUMAN/885-1163HI----------------....FTNLI.LVFI..........MLSSAALAA.....ED-PI-------------------
CAC1G_RAT/1254-1527KM----------------....FDHVV.LVII..........FLNCITIAM.....ER-PK-------------------
Q9W433_DROME/2144-2418KW----------------....FDNVV.LLFI..........ALNCITLAM.....ER-PN-------------------
O44930_AIPPA/1046-1318KY----------------....FEWTI.LAII..........MASSIALTF.....ED-IN-------------------
O62604_POLPE/908-1178KY----------------....FEGVI.LFLI..........AFSSLTLVF.....ED-ID-------------------
Q17314_CYACP/963-1231KY----------------....FEFMI.LFLI..........AFSSLTLVF.....ED-IH-------------------
P97706_RAT/954-1225SW----------------....FECFI.GLVT..........LLCTGTLAL.....ED-IY-------------------
SCN7A_HUMAN/933-1204NW----------------....FKCFI.GLVT..........LLSTGTLAF.....ED-IY-------------------
SCN1_HETBL/781-1052KY----------------....FETGV.LVII..........FASSILLAF.....ED-IY-------------------
O02037_BDECA/985-1259KY----------------....FETFI.LFMI..........AFSSLTMTL.....ED-KY-------------------
SCNBA_RAT/1033-1299SW----------------....FESFI.IFVI..........LLSSGALIF.....ED-VN-------------------
SCNBA_HUMAN/1055-1319SW----------------....FESFI.IFVI..........LLSSGALIF.....ED-VH-------------------
Q25150_HALRO/1260-1547AW----------------....FESFI.ILMI..........MLSSGALAF.....ED-VY-------------------
SCNAA_CANFA/1158-1436SW----------------....FESFI.IFMI..........LLSSGSLAF.....ED-YH-------------------
SCNA_ELEEL/999-1275DY----------------....FETFI.IFMI..........LLSSGVLAF.....ED-IY-------------------
SCN4A_HORSE/1027-1303HW----------------....FKTFN.SSLI..........LLNSGTLAF.....ED-IY-------------------
SCN8A_RAT/1195-1473NW----------------....FETFI.IFMI..........LLSSGALAF.....ED-IY-------------------
P90670_APLCA/1177-1452KY----------------....FDSFI.IAMI..........LASSCALAL.....ED-AY-------------------
Q25377_DOROP/1022-1296EY----------------....FETFI.ITMI..........LASSLALAL.....ED-IH-------------------
SCNA_DROME/1300-1571KY----------------....FETAV.ITMI..........LMSSLALAL.....ED-VH-------------------
Q9XZC1_RHIMP/461-733KY----------------....FETIV.VVLI..........LTSSLALAL.....ED-VN-------------------
Q9W433_DROME/300-623PW----------------....FERVS.ILVI..........LLNCITLGM......Y-QP-------------------
CAC1I_RAT/76-407PW----------------....FECVS.MLVI..........LLNCVTLGM......Y-QP-------------------
CAC1G_RAT/80-406PW----------------....FERVS.MLVI..........LLNCVTLGM......F-RP-------------------
CAC1H_HUMAN/99-430PW----------------....FEHVS.MLVI..........MLNCVTLGM......F-RP-------------------
CAC1E_DIPOM/101-374PP----------------....FEYMI.LATI..........IANCVVLAL.....EQ-HL-------------------
M9NDV1_DROME/37-324PP----------------....FEYAV.LLTI..........IANCVVLAL.....EE-HL-------------------
P91744_HETBL/64-348GP----------------....FEYMV.LLTI..........IANCIVLAL.....EE-HL-------------------
O02038_CYACP/112-392KP----------------....FDFFI.LASI..........FANCAALAA.....YE-PL-------------------
O97017_9CNID/80-362KP----------------....FDVMI.LITI..........FANCAALAA.....FE-PL-------------------
O96057_HALRO/46-328RP----------------....FDVLI.LLTI..........LANCVALAV.....YV-PF-------------------
CAC1D_DROME/614-889KP----------------....FEFLI.LLTI..........FANCIALAV.....YT-PY-------------------
CAC1S_CYPCA/69-362KP----------------....FEIII.LLTI..........FANCVALAV.....FL-PM-------------------
CAC1F_HUMAN/91-383KP----------------....FDILI.LLTI..........FANCVALGV.....YI-PF-------------------
CAC1D_CHICK/120-412KP----------------....FDIFI.LLSI..........FANCVALAV.....YI-PF-------------------
CAC1S_HUMAN/50-345KP----------------....FETII.LLTI..........FANCVALAV.....YL-PM-------------------
CAC1S_LITCT/50-343KP----------------....FEMII.LLTI..........FANCVALAI.....FL-PM-------------------
P97706_RAT/117-405PL----------------....LRLLI.LISV..........LTDSILMCM.......-SN-------------------
SCN7A_HUMAN/117-405PF----------------....FQLFI.LISV..........LIDCVFMSL.......-TN-------------------
O02037_BDECA/134-418PL----------------....FSIVV.LLTI..........ITNCIIMAL.......-..-------------------
SCNBA_RAT/128-406SV----------------....FSMFI.ICTV..........IINCMFMANSMERSFD-ND-------------------
SCNBA_HUMAN/128-411SL----------------....FSMFI.IGTV..........IINCVFMAT.......-..-------------------
SCNA_DROME/152-440PL----------------....FSLFI.ITTI..........LVNCILMIM.......-.P-------------------
P90670_APLCA/137-431PI----------------....FSLLV.MMTI..........LVNCVFMAI.....TS-YT-------------------
Q25377_DOROP/131-412PI----------------....FSLVV.ILTI..........VCNCVFMTM.....KE-NP-------------------
Q25150_HALRO/130-477SV----------------....FNSVI.MLTI..........LVNCGFMAY.......-..-------------------
SCNAA_CANFA/129-417SW----------------....FSLFI.TVTI..........LVNCVGMTQ.....TE-LP-------------------
SCNA_ELEEL/121-413SA----------------....FNFFI.MFTI..........FSNCIFMTI.......-SN-------------------
SCN4A_HUMAN/130-458AL----------------....FSMFI.MITI..........LTNCVFMTM.......-SD-------------------
SCN5A_HUMAN/130-424SL----------------....FNMLI.MCTI..........LTNCVFMAQ.......-HD-------------------
Q90518_TAKRU/128-427SM----------------....FSMLI.MFTI..........LTNCAFMTL.......-SN-------------------
SCN1_HETBL/54-345VC----------------....FDYFL.MFTI..........MINCVFLAM.......-..-------------------
O44930_AIPPA/112-392QF----------------....FEFFI.LLTI..........IVNCIFLAL....RDA-PE-------------------
Q17314_CYACP/142-419QI----------------....FEIFI.LLTI..........ITNCVFMAL.....SD-PP-------------------
CAC1G_RAT/1578-1830HY----------------....LDLFI.TGVI..........GLNVVTMAM.....EH-YQ-------------------
Q17354_CAEEL/666-920PP----------------....FEYFI.MTMI..........CCNTLILMM.....KY-YN-------------------
P91744_HETBL/1217-1468PK----------------....FECVV.MVLI..........ALNTLVLMM.....KY-YG-------------------
M9NDV1_DROME/1094-1348TP----------------....FEYFI.MMLI..........VFNTLLLMM.....KY-HN-------------------
CAC1B_DIPOM/1467-1716PP----------------....FEYLI.MALI..........ALNTIVLMM.....KF-YN-------------------
CAC1E_DIPOM/1428-1674PS----------------....FEYTI.LTMI..........ALNTVVLMM.....KH-HS-------------------
CAC1E_HUMAN/1477-1734PS----------------....FEYTI.MAMI..........ALNTVVLMM.....KY-YS-------------------
O02038_CYACP/1188-1437RL----------------....FEYMI.FGFI..........LGNTIVLAA.....QY-HN-------------------
O97017_9CNID/1168-1422QA----------------....FEYLI.FAFI..........VCNTVVLMM.....QY-YQ-------------------
CAC1M_MUSDO/1108-1378SS----------------....FEYSI.FVLI..........MINTVTLAM.....KF-YK-------------------
O96057_HALRO/1123-1384TY----------------....FEYFM.LVLI..........LLNTVCLAV.....QH-HQ-------------------
CAC1S_CYPCA/1133-1413CY----------------....FEYLM.FFLI..........MLNTLCLGI.....QH-CN-------------------
CAC1S_RABIT/1117-1392SY----------------....FEYLM.FALI..........MLNTICLGM.....QH-YH-------------------
CAC1C_HUMAN/1238-1535TY----------------....FEYLM.FVLI..........LLNTICLAM.....QH-YG-------------------
O02037_BDECA/1306-1555KN----------------....FDIVI.MGFI..........VLNTLTMCI.....EF-QD-------------------
SCN7A_HUMAN/1250-1507QA----------------....FNVIV.MVLI..........CFQAIAMMI.....DT-DV-------------------
P90670_APLCA/1499-1743QK----------------....FDIAI.MVII..........ILNMLTMMF.....EH-HG-------------------
Q25377_DOROP/1343-1600QK----------------....FDVAI.MMVI..........LLNMITMAM.....EH-YN-------------------
SCNA_DROME/1618-1871KK----------------....FDIII.MLFI..........GLNMFTMTL.....DR-YD-------------------
Q9XZC1_RHIMP/780-1031KM----------------....FDMAI.MIFI..........VLNMTVMAL.....DH-YK-------------------
SCNBA_RAT/1345-1595QV----------------....FDVII.LGLI..........VLNMIIMMA.....ES-AD-------------------
SCNBA_HUMAN/1365-1615QI----------------....FDIII.ISLI..........ILNMISMMA.....ES-YN-------------------
Q25150_HALRO/1593-1850QT----------------....FEIAI.MILI..........VTNMFTMMI.....EY-HD-------------------
SCNA_ELEEL/1321-1578PF----------------....TDIFI.MALI..........CINMVAMMV.....ES-ED-------------------
SCN1A_HUMAN/1540-1797QV----------------....FDISI.MILI..........CLNMVTMMV.....ET-DD-------------------
SCN5A_HUMAN/1527-1783QA----------------....FDVTI.MFLI..........CLNMVTMMV.....ET-DD-------------------
SCN1_HETBL/1100-1362NQ----------------....FEIFI.TTII..........ITNMIFMAF.....EH-YN-------------------
O44930_AIPPA/1367-1619SR----------------....FETLI.MFFI..........CLNILVMMI.....QH-YG-------------------
O62604_POLPE/1225-1481KY----------------....FEFFI.MSVI..........LLNMLTMMI.....QH-HG-------------------
Q17314_CYACP/1278-1536KQ----------------....FELFI.MSVI..........IANMLTMMI.....QH-YD-------------------
O62604_POLPE/486-725SA----------------....FEGFI.TFCI..........MLNTCLMAS.....EH-YK-------------------
Q17314_CYACP/509-745TW----------------....FEGFI.TGCI..........MVNTIAMAA.....EH-FE-------------------
P97706_RAT/526-760PL----------------....FDLFL.VICI..........ILNICFLAL.....EH-FP-------------------
SCN7A_HUMAN/504-739PF----------------....TDLFL.IICI..........ILNVCFLTL.....EH-YP-------------------
SCNBA_RAT/571-809PF----------------....TELAI.TICI..........IINTVFLAV.....EH-HN-------------------
SCNBA_HUMAN/576-822PF----------------....TELAI.TICI..........IINTVFLAM.....EH-HK-------------------
Q25150_HALRO/798-1033PF----------------....LDLFI.TICI..........IVNTAFMTA.....EY-QP-------------------
SCNAA_CANFA/673-910PF----------------....AELTT.TLCI..........VVNTVFMAM.....EH-HG-------------------
SCNA_ELEEL/565-801PF----------------....TDLFI.TLCI..........ILNTLFMSI.....EH-HP-------------------
SCN5A_RAT/717-953PF----------------....ADLTI.TMCI..........VLNTLFMAL.....EH-YN-------------------
SCN4A_HORSE/571-807PF----------------....VDLGI.TICI..........VLNTLFMAM.....EH-YP-------------------
SCN1A_RAT/767-1003PF----------------....VDLAI.TICI..........VLNTLFMAM.....EH-YP-------------------
P90670_APLCA/753-995AF----------------....VDLFI.TICI..........LVNTAFMAM.....EH-YD-------------------
Q25377_DOROP/591-824AF----------------....VDLFI.TLCI..........VLNTVFMAI.....DH-YD-------------------
SCN1_HETBL/410-640SF----------------....TEVFI.IFII..........VLNTVFLAM.....EH-HG-------------------
O44930_AIPPA/622-858GY----------------....MDTFI.TFCT..........MVNTLFLSL.....EY-HN-------------------
CAC1G_RAT/743-976KY----------------....FGRGI.MIAI..........LVNTLSMGI.....EY-HE-------------------
Q9W433_DROME/1230-1471KY----------------....FQQGI.LLAI..........LINTLSMGI.....EY-HN-------------------
Q17354_CAEEL/9-248QI----------------....FYWSV.ITLV..........FLNTCCVAS.....EH-YG-------------------
P91744_HETBL/480-720QG----------------....FYWFV.IILV..........FLNTLCVAS.....EH-YG-------------------
CAC1A_RAT/488-727QA----------------....FYWTV.LSLV..........ALNTLWLAI.....VH-YN-------------------
M9NDV1_DROME/440-678QW----------------....FYWFV.IVLV..........FLNTVCVAV.....EH-YG-------------------
O02038_CYACP/496-738QT----------------....FYWMV.IIAV..........FLNSLVLAV.....EH-YD-------------------
O97017_9CNID/468-710QA----------------....FYWIV.IVVV..........FLNSLTLAL.....EH-YD-------------------
CAC1D_DROME/984-1226QA----------------....FYWLI.IVLV..........FLNTGVLAT.....EH-YG-------------------
O96057_HALRO/428-670KS----------------....FYWLV.IVLV..........FCNTLSLAT.....EH-YR-------------------
CAC1S_CYPCA/446-687KF----------------....FNWWV.LLVV..........LLNTLVIAM.....EH-HN-------------------
O73697_TAKRU/439-680KS----------------....FYWLV.MFLV..........FLNTLTIAT.....EH-HH-------------------
CAC1C_HUMAN/523-764NV----------------....FYWLV.IFLV..........FLNTLTIAS.....EH-YN-------------------
CAC1S_LITCT/430-671RF----------------....FYWLV.IIII..........LLNTVIIAT.....EH-HH-------------------
CAC1S_HUMAN/431-672KV----------------....FYWLV.ILIV..........ALNTLSIAS.....EH-HN-------------------
CNGC3_ARATH/80-406QS----------------....WNKIF.LLLS..........VVALAFDPL.....FF-YI-------------------
CNGC6_ARATH/111-443LL----------------....CNKLF.VASC..........ILAVSVDPL.....FL-YL-------------------
CNGC7_ARATH/98-431LV----------------....WNRLF.VISC..........ILAVSVDPL.....FF-YL-------------------
CNG16_ARATH/52-386TR----------------....WNHIF.LITC..........LLALFLDPL.....YF-YL-------------------
CNG14_ARATH/84-410RV----------------....FLFWC.LVAL..........YVDPLFFFL.....SS-VK-------------------
HCN4_MOUSE/262-525FY----------------....WDLTM.LLLM..........VGNLIIIPV.....GI-TF-------------------
O96385_PARTE/140-383FL----------------....WDLLM.MLVT..........IVNIFYVPL.....QL-SF-------------------
Q27170_PARTE/142-388IW----------------....WNIYI.LTIL..........NINVLYVSI.....KI-AF-------------------
SKOR_ARATH/82-334KA----------------....WTMFI.LIWA..........LYSSFFTPL.....EF-GF-------------------
KAT3_ARATH/86-336RL----------------....WELFL.VILV..........GYSAWASLF.....EL-AF-------------------
Q9XH40_SAMSA/77-327RC----------------....WESLM.VVLV..........GYSAWVYPF.....EI-GF-------------------
Q9SM12_MAIZE/69-319RW----------------....WDTFM.VVLV..........AYSAWVYPF.....EV-AF-------------------
AKT2_ARATH/75-324RC----------------....WEFYM.VLLV..........AYSAWVYPF.....EV-AF-------------------
O04703_SOLTU/88-338RC----------------....WETLM.VLLV..........AYCAWVCPF.....EI-AF-------------------
O24538_VICFA/55-305RC----------------....WESFM.VVLI..........AYSAWAYPF.....EV-AF-------------------
AKT5_ARATH/78-324RA----------------....WDWFL.VILV..........LYTAWASPF.....EF-GF-------------------
O04242_MAIZE/64-310RC----------------....WETFL.IILV..........VYSAWVSPF.....EF-GF-------------------
O24382_SOLTU/63-309RL----------------....WETFL.IVLV..........VYTAWVSPF.....EF-GF-------------------
B9DI19_ARATH/57-300RI----------------....WEAFL.VVLV..........VYTAWVSPF.....EF-GF-------------------
KAT2_ARATH/59-307RG----------------....WEMWL.VILV..........IYSAWICPF.....EF-AF-------------------
Q41461_SOLTU/60-311RC----------------....WEMFL.VVMV..........IYTAWISLF.....EV-AF-------------------
KCNH5_RAT/214-479TT----------------....WDWVI.LILT..........FYTAIMVPY.....NV-SF-------------------
O44164_CAEEL/216-496TI----------------....WDWSI.LALT..........FYTAFMVPF.....NI-AF-------------------
KCNAE_DROME/236-500AI----------------....WDWVI.LCLT..........FYTAIMVPY.....NV-AF-------------------
KCNH6_RAT/256-523AV----------------....WDWLI.LLLV..........IYTAVFTPY.....SA-AF-------------------
Q23974_DROME/267-516GI----------------....WDWVI.LVAT..........FYVALMVPY.....NA-AF-------------------
KCNH3_RAT/224-515AT----------------....WDGFI.LLAT..........LYVAVTVPY.....SV-CV-------------------
KCNH8_RAT/221-481AG----------------....WDWLI.LLAT..........FYVAVTVPY.....NV-CF-------------------
Q9U5E2_DROME/125-365FY----------------....WLMML.TVCV..........LYNLWTLIV.....RQ-SF-------------------
CNG_CAEEL/165-422ST----------------....TQVEC.TYNM..........LTNMKEMPT.....YS-QY-------------------
CNGA4_RAT/34-277YW----------------....WLNTM.VFPI..........MYNLIIVVC.....RA-CF-------------------
CNGA_DROME/107-358YR----------------....WLAIV.SLAV..........LYNIIFVVG.....RA-VF-------------------
CNG_ICTPU/138-376YY----------------....WLFFI.ALAS..........LYNWIMLVA.....RA-CF-------------------
CNGA1_BOVIN/163-406YN----------------....WLFCI.TLPV..........MYNWTMIIA.....RA-CF-------------------
CNG1_CHICK/210-453YN----------------....WLTII.AAPV..........FYNWCMLIC.....RA-CF-------------------
CNGA2_BOVIN/140-383YR----------------....WLFLI.ALPV..........LYNWCLLVA.....RA-CF-------------------
CNGB1_BOVIN/770-1005IL----------------....WLFFV.VLAW..........NWNCWLIPV.....RW-AF-------------------
Q9W2D5_DROME/468-704IS----------------....WLCVV.SLSF..........LYNAWVIPL.....RA-SF-------------------
KCMA1_RAT/178-400RV----------------....LVVLV.FALS..........IGALVIYFI.....DS-SN-------------------
SLO_DROME/126-348RI----------------....LVVLV.FILS..........IASLIIYFV.....DA-SS-------------------
SLO1_CAEEL/138-363RF----------------....LVLLV.FILS..........IGSLIIYFY.....DA-SF-------------------
KCNQ1_HUMAN/122-359FV----------------....YHFAV.FLIV..........LVCLIFSVL.....ST-IE-------------------
Q9XWG9_CAEEL/76-313FL----------------....YHFSV.FLIV..........LICLILSVLSTVEEHS-HF-------------------
KCNQ3_HUMAN/122-363LL----------------....YHALV..FLI..........VLGCLILAV.....LT-TF-------------------
KCNQ2_HUMAN/92-324FI----------------....YHAYV.FLLV...........FSCLVLSV.....FS-TI-------------------
KCNQ4_HUMAN/98-330FV----------------....YHVFI.FLLV...........FSCLVLSV.....LS-TI-------------------
Q9RW39_DEIRA/33-252RA----------------....YDKIV.IVLI..........VASVLAVTL.....ES-VP-------------------
Q16976_APLCA/213-469MI----------------....YGVTS.FLFV..........VTSIAGFCL.....ET-LP-------------------
Q9XXD1_CAEEL/229-477QA----------------....FAVCS.VVFV..........LISISGLVL.....GS-LP-------------------
KCNG2_CHICK/216-464KI----------------....FACIS.ISFV..........AITAVSLCI.....ST-MP-------------------
G1R5R7_NOMLE/226-471KV----------------....FACLS.VLFV..........TVTAVNLSV.....ST-LP-------------------
KCNAL_DROME/184-417LV----------------....FYYVT.GFFI..........AVSVMANVV.....ET-VP-------------------
P91784_POLPE/201-427RI----------------....LYYIT.GFFI..........AVSVGSTII.....ET-ID-------------------
KCNV1_RAT/212-442RI----------------....FGVIS.IIFV..........AVSIVNMAL.....MS-AE-------------------
KCNS3_HUMAN/184-417KL----------------....IAISS.LSVV..........LASIVAMCV.....HS-MS-------------------
KCNS1_MOUSE/188-439KL----------------....FSCVS.IGVV..........LASIAAMCI.....HS-LP-------------------
KCNS2_MOUSE/186-421RV----------------....FSVLS.ILVV..........LGSIITMCL..NSLPD-FQ-------------------
F7H076_MACMU/181-417RV----------------....VAVLS.FLLI..........LVSSVVMCM.....GT-IP-------------------
KCNAB_DROME/434-670RV----------------....IAVIS.ILFI..........VLSTIALTL.....NT-LP-------------------
Q26344_APLSP/314-551RV----------------....VAIIS.ILFI..........VLSTIALTL.....NT-IP-------------------
KCNAG_CAEEL/203-453KL----------------....IAGIS.VLFI..........FISIFSFCL.....KT-HQ-------------------
O76457_APLCA/173-421KI----------------....IAVIS.VFFI..........VISILSFCL.....KT-HP-------------------
B3N373_DROER/173-424KT----------------....IGVVS.VFFI..........CISILSFCL.....KT-HP-------------------
KCNSK_CAEEL/274-519RI----------------....IAFIS.IAVI..........ALSIISFCW.....ET-VP-------------------
O76266_HIRME/209-446YA----------------....VAFIS.VIMT..........TISIILFCV.....ET-LE-------------------
Q26094_POLPE/173-409KI----------------....FAILS.VVII..........VVSLIMFVI.....ET-LP-------------------
Q26095_POLPE/181-410KI----------------....VAIIS.VLVI..........LISIVVFCL.....ET-IP-------------------
KCNA6_RAT/230-470DS----------------....YAFPG...............SIPSGGLGT.....GG-TS-------------------
Q25376_DOROP/169-415RV----------------....IAIVS.VSVI..........VISIVTFCL.....ET-LP-------------------
KCNA1_HUMAN/166-419RV----------------....IAIVS.VMVI..........LISIVIFCL.....ET-LP-------------------
KCNAS_DROME/226-489RV----------------....VAIIS.VFVI..........LLSIVIFCL.....ET-LP-------------------

PF07885

Q8IG65_CAEEL/164-235----------------------------EIFD------------------------------------------------
YUGO_BACSU/22-99----------------------------IILC------------------------------------------------
Q8IKI3_PLAF7/284-373----------------------------GVLL------------------------------------------------
Q22426_CAEEL/285-360----------------------------TIIL------------------------------------------------
Q21094_CAEEL/108-184----------------------------EMVR------------------------------------------------
Q21094_CAEEL/246-329----------------------------SMCL------------------------------------------------
Q22042_CAEEL/196-277----------------------------EKRC------------------------------------------------
Q22042_CAEEL/336-411----------------------------LVIV------------------------------------------------
Q92XJ4_RHIME/49-134----------------------------AHLF------------------------------------------------
TWK9_CAEEL/141-217----------------------------KKIK------------------------------------------------
TWK9_CAEEL/321-397----------------------------ITFT------------------------------------------------
UNC58_CAEEL/260-344----------------------------RVSE------------------------------------------------
KCNK2_HUMAN/233-313----------------------------GCVL------------------------------------------------
Q94253_CAEEL/147-219----------------------------NMFD------------------------------------------------
O28600_ARCFU/13-88----------------------------IFLS------------------------------------------------
O29543_ARCFU/11-91----------------------------IFIF------------------------------------------------
YDJJ_BACSU/70-156----------------------------VIWI------------------------------------------------
O44773_CAEEL/33-118----------------------------VFLF------------------------------------------------
O45891_CAEEL/89-166----------------------------RVLS------------------------------------------------
O45891_CAEEL/231-305----------------------------IVLF------------------------------------------------
O45894_CAEEL/291-370----------------------------LMKL------------------------------------------------
O53346_MYCTU/46-130----------------------------VAVV------------------------------------------------
O54192_STRCO/97-179----------------------------LIVL------------------------------------------------
E9AC73_LEIMA/284-359----------------------------VVGI------------------------------------------------
O66650_AQUAE/33-110----------------------------LMLH------------------------------------------------
O76788_CAEEL/150-235----------------------------SLSR------------------------------------------------
O86498_STRCO/99-182----------------------------TLVL------------------------------------------------
P73132_SYNY3/31-106----------------------------ITLA------------------------------------------------
TWK18_CAEEL/92-170----------------------------KVLT------------------------------------------------
TWK18_CAEEL/232-307----------------------------LITV------------------------------------------------
Q19525_CAEEL/88-163----------------------------ITAE------------------------------------------------
Q19671_CAEEL/76-156----------------------------VALI------------------------------------------------
Q19671_CAEEL/157-246----------------------------ICNI------------------------------------------------
TWK12_CAEEL/92-168----------------------------WLLD------------------------------------------------
TWK12_CAEEL/248-324----------------------------IMLI------------------------------------------------
Q21529_CAEEL/110-189----------------------------MLED------------------------------------------------
Q22043_CAEEL/365-448----------------------------FIVF------------------------------------------------
Q23297_CAEEL/158-233----------------------------EAID------------------------------------------------
Q23297_CAEEL/322-397----------------------------GITV------------------------------------------------
Q55509_SYNY3/13-88----------------------------LFFV------------------------------------------------
Q814N2_BACCR/16-91----------------------------ICMT------------------------------------------------
Q81I81_BACCR/43-132----------------------------IYTT------------------------------------------------
Q81K77_BACAN/22-99----------------------------FIVV------------------------------------------------
Q81V28_BACAN/29-104----------------------------VLTF------------------------------------------------
Q82GY7_STRAW/111-194----------------------------TVPL------------------------------------------------
Q87FU6_VIBPA/136-225----------------------------LFLL------------------------------------------------
Q87QT5_VIBPA/25-105----------------------------VISI------------------------------------------------
Q886B6_PSESM/51-136----------------------------AHAI------------------------------------------------
Q89PL5_BRADU/59-133----------------------------AHTM------------------------------------------------
Q8A4M7_BACTN/145-224----------------------------MLLA------------------------------------------------
Q8BUW1_MOUSE/240-321----------------------------GCIV------------------------------------------------
Q8CV55_OCEIH/53-143----------------------------VYIT------------------------------------------------
Q8DJ50_THEEB/18-93----------------------------TLFV------------------------------------------------
Q8E842_SHEON/30-105----------------------------FLLV------------------------------------------------
Q8ELF1_OCEIH/22-99----------------------------STIV------------------------------------------------
Q8ENY9_OCEIH/22-99----------------------------IVLV------------------------------------------------
Q8FRG9_COREF/43-123----------------------------YALL------------------------------------------------
Q8HZT2_BOVIN/94-171----------------------------GIIE------------------------------------------------
Q8I4G4_CAEEL/424-508----------------------------FTAF------------------------------------------------
Q8KG47_CHLTE/19-94----------------------------ISVA------------------------------------------------
KCO2_ORYSJ/70-152----------------------------LLLV------------------------------------------------
Q8NSA2_CORGL/24-104----------------------------YAMV------------------------------------------------
Q8TN45_METAC/34-111----------------------------LLII------------------------------------------------
Q8TNR4_METAC/28-103----------------------------YITA------------------------------------------------
Q8TQJ3_METAC/29-108----------------------------TILS------------------------------------------------
Q8TQL3_METAC/32-111----------------------------SVLS------------------------------------------------
Q8TXQ4_METKA/19-94----------------------------VVLS------------------------------------------------
Q8U058_PYRFU/403-481----------------------------LWLG------------------------------------------------
Q8WMG4_PIG/210-290----------------------------LTLG------------------------------------------------
Q8YXX7_NOSS1/5-80----------------------------IALG------------------------------------------------
KCNK2_RAT/120-198----------------------------QIVT------------------------------------------------
Q92ZS8_RHIME/63-137----------------------------PIAL------------------------------------------------
Q93732_CAEEL/112-187----------------------------AAAI------------------------------------------------
Q93732_CAEEL/216-292----------------------------FIVL------------------------------------------------
Q988Q8_RHILO/59-133----------------------------VITA------------------------------------------------
Q9A7V3_CAUCR/24-99----------------------------AFVL------------------------------------------------
Q9BJ49_LEIMA/261-340----------------------------LFIC------------------------------------------------
Q9CH27_LACLA/24-98----------------------------IAVA------------------------------------------------
Q9HP16_HALSA/160-242----------------------------TGLI------------------------------------------------
Q9HPA3_HALSA/494-584----------------------------TVAL------------------------------------------------
Q9I5I7_PSEAE/12-98----------------------------LYLQ------------------------------------------------
Q9JK62_MOUSE/63-139----------------------------VVSD------------------------------------------------
Q9K7M1_BACHD/23-100----------------------------IIFV------------------------------------------------
Q9KBF6_BACHD/24-100----------------------------FGIL------------------------------------------------
Q9KEA6_BACHD/47-136----------------------------VYTT------------------------------------------------
Q9PPR6_UREPA/224-315----------------------------ILVL------------------------------------------------
Q9RRZ3_DEIRA/10-85----------------------------GLLL------------------------------------------------
Q9VE68_DROME/115-197----------------------------DVLR------------------------------------------------
Q9X0E7_THEMA/41-116----------------------------LMIV------------------------------------------------
Q9XA52_STRCO/42-126----------------------------IALL------------------------------------------------
Q9XX01_CAEEL/207-283----------------------------EVFI------------------------------------------------
Q9XX01_CAEEL/347-423----------------------------LICV------------------------------------------------
Q9XXF6_CAEEL/162-241----------------------------VLFT------------------------------------------------
Q9XXF6_CAEEL/312-388----------------------------ILFL------------------------------------------------
G3GXR2_CRIGR/72-153----------------------------.SCI------------------------------------------------
G3V8R8_RAT/180-259----------------------------IVAI------------------------------------------------
M1B592_SOLTU/194-267----------------------------.TLV------------------------------------------------
M1B592_SOLTU/73-153----------------------------.YLV------------------------------------------------
M1C0Y6_SOLTU/84-157----------------------------.FLI------------------------------------------------
KCNK4_MOUSE/181-259----------------------------.CLL------------------------------------------------
KCH_ECOLI/149-221----------------------------.TLL------------------------------------------------
Q7MJ92_VIBVY/25-103----------------------------ILLV------------------------------------------------
Q7MND5_VIBVY/236-324----------------------------.SLF------------------------------------------------
Q7RZF3_NEUCR/370-446----------------------------.WLV------------------------------------------------
W5K2Z9_ASTMX/155-233----------------------------..IS------------------------------------------------

PF01007

Q17KL4_AEDAE/26-358TL----------------VEEQWRYTLTAFML----------SFFSSWILFAILWYLV-AY-------------------
E4WZQ3_OIKDI/115-447TF----------------VDAHWYYVLIAFFA----------SFFGLWLLFGLFYWAI-AW-------------------
F6SPD2_XENTR/30-357TV----------------IDMKWRYKLTLFAA----------TFFLTWCFFGVIYFVV-AF-------------------
H2ZYX1_LATCH/30-357TV----------------IDMKWRYKLTLFSA----------TFVMTWFFFGIIYYGI-AF-------------------
W5M8R3_LEPOC/3-329SF----------------VDLKYRWFLFVFMM----------CYVVTWVGFATLYFLD-AL-------------------
F7FJC1_MONDO/157-485TC----------------VDIRWRYMLLIFSL----------AFLVSWLLFGVIFWVI-AI-------------------
T1EE13_HELRO/114-441TL----------------VDIKWRWNLLNFVL----------AFMLSWFIFALLWWLI-AF-------------------
H3B1J1_LATCH/31-362TF----------------IDMKWRYKLLLFSM----------TFVGTWFLFGMIWYLI-AL-------------------
U3II41_ANAPL/29-354TL----------------VDLKWRWNLLIFLL----------TYTVAWLVMASMWWGI-AY-------------------
B4KG98_DROMO/94-428TL----------------IELDWKYMLTIFLG----------SYFLSWLFFGVLCYMV-AY-------------------
V8NV91_OPHHA/467-790TC----------------VDIRWRWMLLIFCL----------AFILSWLFFGCVFWLI-AL-------------------
A5PJL2_BOVIN/30-357TV----------------IDMKWRYKLTLFAA----------TFVMTWFLFGVIYYAI-AF-------------------
H3BAR9_LATCH/36-360TL----------------VDLKWHYTLLIFTM----------SFLCSWLLFSMIWWLI-AF-------------------
U3JLS4_FICAL/37-368TL----------------VDLKWRHTLVIFTM----------SFLCSWLLFAMMWWLV-AF-------------------
H2T749_TAKRU/56-383TC----------------VDIHWRYLLLIFCT----------SFLVSWLFFGIIFYCV-SL-------------------
H3A9C1_LATCH/46-374TC----------------VDIRWRYMLIIFSM----------AFLFSWLLFGLVFWCI-AV-------------------
Q1L8I6_DANRE/24-353TF----------------VETRWRFIILYFVA----------SFTLSWFIFGLIWYWL-AR-------------------
W4YAR4_STRPU/79-411TF----------------VDLRWRWNLMVFTF----------AYVVGWFLFGLVWFVI-AA-------------------
J0XL15_LOALO/80-413TM----------------IDVKWRYMLVIFAI----------VFISSWTMFASFYYVI-SV-------------------
M3XYC0_MUSPF/50-375TC----------------VDVRWRWMCLLFSC----------SFLASWLLFGLAFWLI-AS-------------------
Q5TQ25_ANOGA/25-357TL----------------VEEQWRYVLFVFVA----------SYVGSWVFFAGLWYIL-SY-------------------
H2MFJ0_ORYLA/42-360TL----------------VEIKWRIMFLMFTL----------SYILSWLFFGILFWVI-AI-------------------
U3KL94_FICAL/39-359TL----------------VDIKWRHMFVIFSL----------SYVLSWLLFGLAFWLI-AV-------------------
KCJ10_RAT/31-363TF----------------IDMQWRYKLLLFSA----------TFAGTWFLFGVVWYLV-AV-------------------
E7F2Q1_DANRE/50-373TC----------------VDIRWRWMMVLFFL----------SFLLSWLIFGLIFWLV-AY-------------------
K1QHC7_CRAGI/79-409TL----------------VDIKWRYNLLLFAL----------AFILSWLIFAVIWWLI-CF-------------------
H2US08_TAKRU/8-335TC----------------VDIRWRWMLVIFTL----------SFLLSWLLFGFAFWLI-AS-------------------
KCJ16_MOUSE/37-357TL----------------VDTKWRHMFVIFSL----------SYILSWLIFGSIFWLI-AF-------------------
H2Q537_PANTR/31-359TV----------------LDLKWRYKMTIFIT----------AFLGSWFFFGLLWYAV-AY-------------------
B0W1P8_CULQU/118-451TL----------------VDVRWRYLLLAFGL----------SFFGSWILFATLWFLI-AY-------------------
H2T950_TAKRU/46-374TC----------------VDIRWRYMFLLFSL----------VFVVSWLMFGLAFWLI-GL-------------------
I3K6N4_ORENI/30-360TF----------------VEIRWRFVLLLFVA----------VFTGSWFIFSLLWYWI-AK-------------------
H9JWA7_BOMMO/187-510TV----------------INSKWRFIILLMIC----------AHFVFWFIFAGIWYAV-AT-------------------
M3XLP7_LATCH/62-390TC----------------VDIRWRWMFVIFSL----------SFIVSWLAFGFTFWLI-AS-------------------
W4YRL0_STRPU/65-403TL----------------IDLKWRWLLIIFSL----------AYVLGWMGFTFVWYAL-IW-------------------
B0W1P7_CULQU/12-344TL----------------VEVQWRYTLAAFVL----------SFAVSWFFFAILWYLV-AY-------------------
B0XCY9_CULQU/27-361TL----------------VDAQWRWTLLVFAF----------SFIGSWLFFAVIWWLI-AF-------------------
IRK1_CAEEL/76-406TM----------------IDVKWRWMLMLFAS----------AFVLSWSIFGTTYYLI-AL-------------------
H2TK24_TAKRU/37-368TL----------------VDLKWRFTLVIFTT----------TFVSSWLLFAMCWWLV-AF-------------------
H2LGJ6_ORYLA/48-374TC----------------VDIRWRYLLLIFTT----------TFLLSWLLFGLIFWGV-AL-------------------
K1QR55_CRAGI/39-367TL----------------IDLKWRYALAVLFN----------VHLLSYFFFALMWYWM-MY-------------------
H2TFE7_TAKRU/4-329TV----------------VDMKWRYKLTLFAS----------TFVMTWFIFGVIFYFI-GM-------------------
Q7PX90_ANOGA/27-353TL----------------VDIQWRWTLFVFAC----------SFILSWLGFGAIWYLI-AL-------------------

PF00060

Q9VIA5_DROME/402-665------------------SNQVWWCV.LALVT----------GSTILLLFHVRLER..-.....................
Q9VVU7_DROME/386-644------------------ENDVWVSI.LMLLI----------ITTVVLVLELFFSPHN-.....................
Q8T0V7_DROME/343-610------------------TVETWFCL.MGIIL----------LTAPTLYAINRLAPLK-EM...................
Q19693_CAEEL/134-404------------------SWEVWVIT.AAVIL----------ISGVIFLVMTNIIRKV-YE...................
GLR11_ARATH/540-781------------------EKSLWLAS.GAFFV----------LTGIVVWLVERSVNPE-FQ...................
GLR14_ARATH/568-810------------------TLSLWLTI.ASFFI----------LTGAIVWLIERHDNAD-FQ...................
GLR37_ARATH/578-833------------------TSRLWCVV.LVSFL----------VIAVVIWILEHRINED-FR...................
Q53YX3_ARATH/613-869------------------TIEMWAVT.GGFFL----------FVGAMVWILEHRFNQE-FR...................
GLR31_ARATH/587-839------------------TLPMWAVT.ASFFV----------IVGAAIWILEHRINDE-FR...................
GLR27_ARATH/582-833------------------SLDLWVTT.ACFFV----------FIGFIVWILEHRVNTD-FR...................
GLR29_ARATH/566-820------------------SLELWVTT.GCFFV----------FIGFVVWLFEHRVNTD-FR...................
GLR28_ARATH/577-828------------------GLDLWVTT.ACFFV----------LIGFVVWLFEHRVNTD-FR...................
GLR21_ARATH/574-835------------------TLALWLIS.LLSFF----------IIGLVVWVLEHRVNPD-FD...................
GLR22_ARATH/580-842------------------SIELWLTT.LVFFF----------LVGISVWTLEHRVNSD-FR...................
NMD3B_HUMAN/574-842------------------HWSTWLGV.FAALH----------LTALFLTVYEWRSPYG-LT...................
NMD3A_RAT/674-942------------------HWTMWLGI.FVALH----------ITAIFLTLYEWKSPFG-MT...................
O76903_DROME/477-751------------------DTASWMLVGIVAIQ----------AATFMIFLFEWLSPSG-YD...................
NMDE1_RAT/554-828------------------SASVWVMMFVMLLI----------VSAIAVFVFEYFSPVG-YN...................
NMDE3_RAT/552-826------------------SPAVWVMMFVMCLT----------VVAITVFMFEYFSPVS-YN...................
Q9W365_DROME/518-818------------------RLEVWLSI.VAALV----------GTAIMIWFMDKYSPYS-SR...................
C7G3M1_PANTR/559-824------------------QSTLWLLV.GLSVH----------VVAVMLYLLDRFSPFG-RF...................
NMDA1_DROME/573-843------------------SNTLWILV.MVSVH----------VVALVLYLLDRFSPFG-RF...................
GRID1_HUMAN/562-842------------------DFAVWACI.AAAIP----------VVGVLIFVLNRIQAVR-AQ...................
GRID2_RAT/566-842------------------DLSLWACI.AGTVL----------LVGLLVYLLNWLNPPR-LQ...................
GLRK_ANAPL/168-431------------------SKETWTGL.LFAYI----------LTCFCLFLVARLSPCE-WN...................
GLRK_LITBE/161-425------------------SKELWIGI.IISYV----------ITSLCLFLVGRLSPCE-WT...................
B7ZPS4_XENLA/162-426------------------SKETWIGI.LVAYM----------VTSLCLFLVGRLSPCE-WT...................
Q90278_CARAU/149-409------------------SGETWFGI.LIAYF----------VTAVCICIVGRLSPCE-WS...................
Q90279_CARAU/144-405------------------STEMWMGV.LVAYL----------LTSVCIFLVSRISPCE-WK...................
O01623_CAEEL/566-855------------------SWQIWTAI.ATSII----------TVTLGMYFVANVTPYE-WNLNFS...............
Q9VMP4_DROME/554-829------------------AVEVWIYM.IFAQL----------IMTLAFVFIARLSYRE-WL...................
O45028_DROME/553-829------------------NAEVWLFV.MIAMM----------ITAFALIFTGRIDQYE-WD...................
Q9TVI0_DROME/547-823------------------SSEVWLYL.GIAYL----------GVSLCFFIIGRLSPIE-WD...................
B4II60_DROSE/545-823------------------SLDVWIYM.ATAYL----------GVSVLLFILAKFTPYE-WP...................
C7G3L5_PANTR/560-831------------------SPDIWMYI.LLAYL----------GVSCVLFVIARFSPYE-WY...................
Q9V4A0_DROME/553-829------------------AIEIWLYV.LAAYI----------LVSFALFVMARFSPYE-WK...................
Q25412_LYMST/545-818------------------AVEIWLYV.IGAYL----------IVSFTIFTLARFSPYE-WY...................
GLR1_CAEEL/591-867------------------STEIWMYI.IFAYI----------GVSVVIFLVSRFSPYE-WR...................
GLR2_CAEEL/619-910------------------GMTIWIFT.LSSYF----------GVSLTIFLVSWFSPYE-KR...................
GLR1_DROME/610-907------------------SQEIWISV.ILSYV----------GVSFVLYFVTRFPPYE-WR...................
Q9VSV5_DROME/630-967------------------SQEIWVSV.IFSYI----------GVSIVLFFVSRFSPHE-WRLVQQQPQQSQSPDPHAHHE
G1R3B7_NOMLE/543-824------------------AYEIWMCI.VFAYI----------GVSVVLFLVSRFSPYE-WH...................
GLRK_LYMST/556-830------------------SSEIWMCI.VFAYI----------GVSVVLFLVSRFSPNE-WH...................
Q9U0T0_DOROP/568-841------------------SYEIWMCI.LFAFI----------GVSVVLFLVSRFSPSG-WH...................

PF02386

TRKG_ECOLI/38-485QL-----RTR--------DGFIIIVMFWILFS----------VISAFPLWID....SE-LN-------------------
TRKH_HAEIN/35-487EL-----RSR--------DGFLIVVAFWLVLG----------SLATLPLLLF....DS-PH-------------------
Q9HPA9_HALSA/77-556PP-----AAM--------ARFVPTDATWTAVS----------VGNTTTL.........-SS-------------------
O83176_TREPA/103-567ER-----AVS--------NPSQTLIVSFLVVI----------FIGTHLLMFPGATPHS-QP-------------------
Y460_MYCPN/24-557PF-----ALK--------TDYQKVISYEVDLQ----------GHTISKQT........-AS-------------------
TRK1_SCHPO/316-816TV-----DMH--------IAFTGLNKPTIERE----------RNLKLR..........-KK-------------------
TRK2_YEAST/301-846FD-----GAP--------HKYMVTKKKKISRT----------QSCNIPTYT.....AS-PS-------------------
TRK2_SCHPO/354-857PI-----YFA--------DDTNGAEQEKGAHR----------LDGRGRKR.......G-KS-------------------
TRK1_YEAST/624-1180PD-----NSN--------TGNSILHYAESILH----------HDGSHKNGS.....EE-AS-------------------

PF03814

E3GJV8_EUBLK/5-557KV.C...GVD..MD....RQMNWKQYAVALVV----------TNAFMIFIGYIILRIQ.FL-------------------
R4KGK3_CLOPA/7-555RI.S...GIK...K....EDMSWKQYIFALIS----------CNAVAAFLAFLILRLQ.SI-------------------
X4ZCZ5_9BACL/10-554AL.G...GIR...K....ENQSWKEYALALLL----------SNSVMILLVYLIFRFQ.GV-------------------
I2BB55_SHIBC/11-556RL.V...GAD..N.....REMDWRQYLLAIVL----------FNLLGLVVLFTLLTSQ.AS-------------------
D2B153_STRRD/14-551RA.I...GVR..PD....TEQRWSVYARGVLA----------FSLISVLFLYGLQRLQ.DK-------------------
A7I6Q1_METB6/235-800TA.C...GIA..PG....EEMDWKEFAVAVMV----------FTVPCIAAVFILQEIQ.QF-------------------
Q6F8C8_ACIAD/9-565RV.L...GVR...Q....TGMNWRQYLGAFVI----------SNVVLFVVSVVILMTQ.AW-------------------
ATKA_BACCR/7-552KI.T...GVK...A....YNQTWKQYALSLVL----------LNGFMIVVVYFIFRLQ.GV-------------------
ATKA_PARD8/9-566KL.A...GIN..PN....EEMDWKAFLKSLLI----------INVFWFFWGMILLVSQ.GY-------------------
T0LA52_9EURY/11-544LL.A...GID..SS....KNMGWKEYFKTLLY----------LNAGEAILAFFILMFQ.QS-------------------
V5XQW1_ENTMU/10-555QL.I...GPE..SQ....KKMTAKRYLAHVLG----------IGICSLLFLTGLLMVQ.GW-------------------
Q4JUS0_CORJK/12-549RL.I...GVN..PD....GQQKWTRYCASLLA----------FSAISVVFVYLLQRVQ.QA-------------------
I4D2C5_DESAJ/10-560RL.T...GTD..EQ....SEMDWKSYAGALLI----------FNFCGFFVLFLLQLLQ.KY-------------------
D3F9I8_CONWI/10-571KL.L...RVD..PR....QEQDWKAYARAVLF----------FSLGSWLLLYAILRLQ.GS-------------------
B8GER2_METPE/14-556RL.L...GVD..PT....AEETWRGYARDLLI----------FNGIGVAFLFVLLLLQ.GF-------------------
E3JBQ1_FRASU/12-552RL.V...GVD..PD....SEQRWPVYARSVLA----------FSAVSVLFLYLFQRLQ.NH-------------------
R4TDT9_AMYOR/13-552RL.F...RVN..PG....SEQHWKTYASAVIG----------FSFVSVVLLYLLQRLQ.AI-------------------
Q11TL6_CYTH3/25-575KL.S...AID..PT....KEMNWKQHLIALLT----------INLVWFIMAMLVLTNM.SW-------------------
G8X3F4_STREN/12-552RC.I...GAD..PD....AEMRWPAYLRGVLA----------FSVVSVLFLYLLQRVQ.NH-------------------
D3UX96_XENBS/10-561RC.C...GLQ..KPGGNVKEMNWWQYALAIIT----------FNIMGLLLLFMLLISQ.EH-------------------
ATKA_DESVH/10-561RA.S...GIR..PE....ARQSWRQYAASLCA----------FSAAGFLMTFGVLMLQ.DK-------------------
F9ZTB8_ACICS/11-575VV.A...GID..AK....ADMGWKQYALLWIL----------FNVVGGVFLYVLLYFQ.NY-------------------
A4FMI7_SACEN/14-552RA.V...RID..GD....APQRWTTYAAGVLG----------FSFVSIVLLYLLQRLQ.HL-------------------
ATKA_MAGSA/10-548RL.L...GID..PT....REQGWAAYAVSLLI----------FHLLAVFGLYALQRFQ.GM-------------------
L0DLW9_SINAD/14-575RL.I...GRR..EP....ARMDWKKYAVAFIV----------FNLALFILTFGLLYAQ.PR-------------------
ATKA_METPP/10-570RA.A...GID..AA....VGMGWKAYALALLA----------FNALGALAVYALQRLQ.GG-------------------
H8KMI0_SOLCM/10-568KL.S...GIN..PK....QEMNWKQFLKALLT----------INMVWFVFGFLLLLFQ.GA-------------------
F0S640_PEDSD/9-559KV.S...GIN..PD....NEMNWKQHLVALLT----------INLLWFLMSMGILMNM.ES-------------------
A0LLJ6_SYNFM/11-602FE.E...RLD...S....GPQNWKQYAGSLLA----------FNTLLFAFGFLVLALQ.PW-------------------
ATKA_PECAS/12-556RF.F...ALD..T.....TEMRWQQYAAAILA----------LNLIGIVVLFVLLMAQ.GN-------------------
I3VXZ2_THESW/9-560KI.T...GID..ES....HEMNWKEYALSLVI----------FNFLGMIFLFILLVSQ.GK-------------------
ATKA_THEAC/28-571RM.I...GES..PD....HGMTFKEYFINLLL----------FNFFAGLISFLVIMFQ.KY-------------------
R6BHA4_9CLOT/5-583KI.S...GID..PH....KKMDWKKYALALLG----------TNAVMILLGYMILRIQ.SI-------------------
K9VF82_9CYAN/9-558KA.S...NIR..SV....DSMTGWQYTRSLLY----------SNAAMGIFVYLIFMLQ.GV-------------------
ATKA_DESMR/10-578RI.S...GVD..AS....REMDWKIYALVMLG----------LNAFGMVFVYVLERLQ.GG-------------------
ATKA_DEIRA/9-559RV.I...GIN..PR....ERMDWKRYGLAIVV----------SNLVMLLLAYLLIRLQ.GA-------------------
N0BB32_9RHIZ/10-561AF.A...HVQ..HG....SEQNWLSYTLSMLI----------FNGAGFLFLYALMRLQ.HA-------------------
K9Q855_9NOSO/9-574SL.V...GVQ..TK....AEMTGWQYARAILY----------SNLVMGLLIFLIIMNQ.GW-------------------
K9V7P3_9CYAN/9-555AL.G...GIR..RR....ENMTGGQYARAVLY----------TNTIMGILVYFLLVTQ.KY-------------------
F8L2P0_PARAV/10-555QM.G...GVD..PH....LEMTWQEYAKVLGI----------FNLLGFIFLFFLLLLQ.GI-------------------
ATKA_LISMO/10-557RL.M...GVS...E....VGMSAKRYAVSVLA----------FSAVGFVFVMAVLMLQ.GF-------------------
Q6L2R0_PICTO/23-567KL.L...GED..KN....KKMKFKDYFLNLLI----------FNAAAGVIAFIAIYFQ.RF-------------------
D1Z017_METPS/13-542RLLM...GMD...R....HPMDWKEYALSLLA----------LNALLWAVAFAILYSA.G.-------------------
E3GWW4_METFV/10-558KI.C...NID..EK....REMNWKEYAIAFTI----------FNTVMLTALFLLQEIQ.AF-------------------
I3THP9_TISMK/10-558GL.S...GVR..AG....RESSWLGYALGLIT----------FNYAGFLLLYGVLRLQ.GV-------------------
C6VYG5_DYAFD/9-559RL.S...GIR..PN....VEMSWKEHLFALLT----------INMVWFFLGMLVLMNQ.GW-------------------
ATKA_PSESM/10-560LI.S...GVD..PK....TEQSWKQYAWALLA----------FNLAGFVVLFAMLMLQ.GL-------------------
U5QJ68_9CYAN/10-567RL.G...GVD..SA....ADMDWWTYARAVLV----------SNLAMFVPVFTILLFQ.GS-------------------
D9R2J7_CLOSW/10-558KL.M...GTA..AG....EEMNAGKYAVSVLL----------FSGVGFVFLFLLLMLQ.GA-------------------
ATKA_CLOBB/10-575KI.L...HID..KD....EDMSWKKYSFSVLA----------FSIISLIVLFLLHIFQ.GF-------------------
G7M3P7_9CLOT/7-555KI.C...GIN..KE....EKMNWKEYVFSIIA----------VNAVMVFIGYIILRAQ.GL-------------------
Q4K7X6_PSEF5/9-559RL.L...GID..PA....ETMGWARYGSALLL----------SNAAMMLLGYLLLRLQ.GS-------------------
F4KRB0_HALH1/9-568RL.G...GIN..PA....EEMSWQRFLRALLT----------INMLWLVYGFIMLFYQ.GV-------------------
J7QUT1_METSZ/10-561RL.A...GVD..PA....REQNWLAYTMAMLA----------FSVIGFVSLYALQRLQ.AY-------------------
L0J1B4_MYCSM/12-554RL.M...GAD..PK....SEQSWGAYARSVLA----------FSAISVLFLFIFQLIQ.GK-------------------
T0N7P9_9EURY/29-575KV.A...GVD..RN....KTYSFKGYFISLII----------FNFVAGTISFLFLIFQ.GY-------------------
I4ETN2_MODMB/13-566RA.V...GVD..AD....AEQRWPTYLRSVLA----------FSLVSVLFLYLLQRVQ.QW-------------------
ATKA_LEPIN/9-549KI.C...GID..PN....RNMDWKEYALSLLV----------FNFFGFLLLFLILFFQ.NY-------------------
C7Q1T1_CATAD/12-560KT.M...GVD..AE....ADQTWGTYLRSVFA----------ISAVGILLLYLLLRVQ.HH-------------------
F5XJD1_MICPN/12-552RL.F...GVN..PD....GEQNARSYATAVLA----------FSLVSILLLVAILSWQ.PL-------------------
R5EPZ2_9BACE/10-566KL.G...GVD..PT....EEMNWKQFLKALLV----------INLFWFFWGMILLVSQ.GV-------------------
A7HRV4_PARL1/16-556TI.G...GGV..AR....QSQDWKRYLTAMLV----------FNAIMFVVSFAILALQ.QY-------------------
R7I6C6_9BURK/13-562WP.L...GKS..GR....EPMDWKEYCVSLIA----------LTVVGTVIGYLIFRFQ.GY-------------------
ATKA_STAA8/4-555KI.I...GTD...L....EHMSAKTYVKHFLA----------FNGFMGFITFVLLIVQ.QW-------------------
R5UVN1_9PORP/10-563KL.C...GIN..PQ....EEMNWKKFLVALLT----------INVFWFFWGMILLVCQ.GW-------------------
C7LZF2_ACIFD/8-557AL.V...GVS..AS....EEQSWQRYARSLLV----------FSGVSIVVTYLIIVSQ.AH-------------------
E8SI98_STAPH/4-555KV.L...GTQ...L....EHMSGKTYLKHFLL----------FNGLMGALTFVLLLIQ.QW-------------------
I3TDE3_THEC1/12-531RC.LDRIGL...DT....TNKSFTDYAKDLLF----------FNFILIAIDTVLLAKQ.G.-------------------
R7C503_9BURK/9-553HF.L...GLT...N....TPQTWAAYAASAVV----------FNMAGAVFLYLILRFQ.GW-------------------
J7U1A2_MORMO/10-556RF.A...GIG..R.....DEMRWQGYLTALLL----------FNALGLIFLTAILMLQ.AD-------------------
E8N7S4_MICTS/9-553RL.I...GVD..PR....SAQTWAAYLRSVLL----------FSFVGVVLVYALMRLQ.AV-------------------
ATKA_METNO/10-559RA.A...GID..AR....QEQTWLGYAGALLL----------FHVFGFLVLYAILRLQ.AA-------------------
K7WVS0_9NOST/9-560VL.I...GVR..PQ....DEMTGWQYAKAVLY----------SNIVMGILVFTILITQ.AW-------------------
C6X587_FLAB3/9-559KI.S...GIV..PT....REMNWKEHMTALLT----------INLVWFLLGIGILMTQ.QW-------------------
ATKA_CAUCR/10-560KA.C...GVD..PS....KSQSWHAYALALLA----------FNLIGFVFVYAVLRLQ.GV-------------------
S5Z0Q6_PARAH/9-553QL.A...GVS...G....RGQRWTSFAMSLLA----------FNAAGFALLYLVLRLQ.GW-------------------
X2GUB6_9BACI/5-560KV.C...GIK...Q....VDMTGKQYVLSLII----------SNAFMVFIGYILLRIQ.SF-------------------
ATKA_SOLUE/10-559KL.C...GVD..EA....AEQRWTGYAGSLLA----------FSLVSLLFTYLIQRVQ.QW-------------------
E0UCQ4_CYAP2/9-555AG.I...GTN..PN....KNMTAAQYIKAVLW----------SNLVMAILVYLIFMIQ.GS-------------------
R5SY62_9CLOT/9-579KV.L...KIN..RE....EEMDWKKYAVCAGV----------FSVISLAVLWLILMLQ.NI-------------------
D7BJD8_MEISD/5-565RL.L...GVN..PE....RGMDWRGYAKALLG----------SNLLLALAAYGVLVLQ.GK-------------------
T0LT74_9EURY/28-573KI.S...GVD..EN....ESHTFKGYFFSLLF----------FNLMAGVFTLFFLLIQTNY-------------------
B1WPS5_CYAA5/10-555AL.S...GVR..SQ....REMTGWQYAKNVIF----------SNLVMGIFVFLIFSFQ.AI-------------------
R7GCL6_9FIRM/7-576KV.L...RIH...T....ASMGWKTYALSLLL----------VNACLIFVGYLILRLQ.AT-------------------
D7A9S5_STAND/10-561RL.A...GVD..ET....REQGALAYTLGMLA----------FNAAGVVLLYAILRLQ.GF-------------------
ATKA_RHOCS/10-561RI.A...GID..PA....REQHWTGYTLALLS----------FNLLGLLLLYALLRFQ.AL-------------------
V6F0K6_9PROT/10-558KI.C...GVN..AA....REQHWAAYALSLLM----------FNLAGVLVLYGLQRLQ.AH-------------------
ATKA_GLOVI/10-566RL.G...GVR..PE....LTMDWWSYARAVLA----------SNAAMFVPVFAVLLLQ.GS-------------------
A0JW40_ARTS2/13-553RL.A...GLD..AS....TEQTWPVYLRSVLA----------FSAVSILAVFGLQRLQ.RV-------------------
W0JFF5_DESAE/10-566KI.A...NID..ET....YEMNWKEFAISMLI----------FNAIGFVVLFLILVLQ.QF-------------------
M4V8V0_9DELT/10-555KI.S...GID..SK....KDMGWKEYALCLMA----------FNILGIVVLFLLQLIQ.GG-------------------
ATKA_AGRVS/10-560RI.S...GVD..AR....REQGWLAYTLAMLA----------FNAAGFLALYGILRLQ.AY-------------------
K9PBZ4_CYAGP/8-552RW.I...GDR..GQ....PAATAWAYLQPFLV----------ANACFGGLAFLLLAFQ.PA-------------------
M1E4S0_9FIRM/11-558KL.S...FVN..PE....NQMDWKEYAVSMLL----------FNMIGFIFLFLLLLTQ.QL-------------------
D2UFZ8_XANAP/7-575RL.L...GTD..PA....RGMHWRGYTAAFLL----------SNLVLGVLVFVLFVTQ.AW-------------------
E8U851_DEIML/5-570RL.I...GAN..PD....RGMTWQAYGRALLL----------SNIPLALLAFLVYAFQ.AP-------------------
J9Z8M5_LEPFM/10-559RL.L...GLD..AD....REMGWKEYASTLLV----------SNGFFFVAGYLVLWAQ.GG-------------------
ATKA_STRCO/12-552KS.I...GAD..PD....TEMRWPAYLRGVLA----------FSLAGVLFLYLLQRLQ.GV-------------------
I0K505_9BACT/9-568RV.G...GVD..PN....RDMTWKENLVALLT----------INLVWLVYAFVLLLTQ.GS-------------------
C8XB13_NAKMY/15-551RL.V...GVD..AG....SEQSWGVYARSVLA----------FSAVSVLALYALQRVQ.QH-------------------
E4T7V0_PALPW/11-556KL.V...GVD..AT....EETNWKTYTFGLLL----------FNFIGFLFVFLLQLTQ.AY-------------------
ATKA_CLOAB/7-555KL.S...GIQ..KE....EEMNWKQYIFALLM----------CNAVPAIIGYIILRIQ.AV-------------------
ATKA_LARHH/11-562WL.M...GAA..PD....EEMGWKRYAAAILL----------FNLAGVVLLFLLQRWQ.GM-------------------
ATKA_ACIC5/10-582RL.T...AVK..AE....EEMHWTAYCASMLI----------FSAATMLLTYLIERVQ.QF-------------------
E3I291_RHOVT/10-561AL.A...GVD..PK....AEQRWSAYALSMLA----------FNFAGFLLLYAILRLQ.DL-------------------
B2FJX0_STRMK/5-564KV.L...GVD..PS....RAMSWRGYVLAFVL----------SNVVVAVLTQAVFMTQ.AW-------------------
E4NDZ7_KITSK/13-552KV.V...GVD..AD....ADQRWPVYLRSVLA----------FSALSVLFLYGLIRLQ.TH-------------------
F8AWS9_FRADG/16-552RL.V...GVD..PD....ADQRWSVHLRAVLA----------FSCVSALFLYVFLRLQ.GR-------------------
V5XHA6_MYCNE/12-554RL.I...GAD..PK....AEQTWGAYARSVLA----------FSAVSIVFLFVFQLVQ.GK-------------------
S6C6G0_9ACTN/14-591RL.V...GAR..ED....DGMDWRRFLASALA----------FTAVSFIGLFILLICQ.GA-------------------
ATKA_EDWI9/11-556RL.C...GVT..P.....HEMDWRHYLLAILA----------FNLLGIVLLFALLMAQ.GL-------------------
W0PFX0_9BURK/11-559AL.L...GVD..PH....QKMNWTTYGLALLL----------SNAAMMLLGYFLLRIQ.QT-------------------
F8I8V0_SULAT/10-560RA.A...AIN..PR....VEMDWKTYMKSVLA----------ANLMMALVGYLLLRLQ.GR-------------------
ATKA_YERPE/10-556RC.S...GVK..N.....AEMNGWQYALAILC----------FNLLGIVLLFVLLMTQ.GS-------------------
E6STC1_BACT6/10-566KA.G...GID..PE....EEMDWKLFLKTFLM----------LNAFWFVWGMLLLVTQ.HW-------------------
A9HGI8_GLUDA/24-574RL.A...GID..AA....REQSWWGYAVAMLV----------FKLLCFLTVYALLRFQ.VH-------------------
ATKA_KINRD/13-552RV.L...RVD..AD....ADTRWPTYALSVLG----------FSTVSILFLYAFLRLQ.GF-------------------
ATKA_KORVE/10-583RC.T...AVD..ES....QEMKWTEYAIAMLL----------FSAVSMLMLYIMQRVQ.LH-------------------
G7ZDN7_AZOL4/10-561RL.A...GVD..ER....TEQHWVSYAVSMLL----------FSAAGMLLLYALQRLQ.AV-------------------
ATKA_SORC5/10-576RA.A...GVR..PD....QEMRWKDYAFAVLA----------FNLAGLLVLYALQRLQ.GV-------------------
S0ART7_FERAC/11-546KI.L...GID..KN....QEMGWKEYFLSLFI----------FSIFTAIISFLVLSFQ.GV-------------------
B7J712_ACIF2/10-575RV.I...GVS..AS....EEMDWKRYAIALLI----------FNLIGGVFLYALLLAQ.GA-------------------
H1YB12_9SPHI/10-568RL.S...GID..AQ....REMNWKQHLYAMLT----------VNAVWLFYAFFCLLYQ.SH-------------------
R6ULB1_9FIRM/11-565RV.M...GVD..EE....QQMHAKKYASSVLW----------FSLFGFLIVMGLHLVQ.AW-------------------
C7PUT0_CHIPD/9-567RI.C...GID..PH....KEMNWKQHMAALLS----------INLVWLIYAFFILLFQ.SH-------------------
ATKA_DESDA/9-579RL.M...GVD..PA....EQMGWKCYMACVIA----------FSAVSLVALTALLMAQ.HL-------------------
K9RWG4_SYNP3/9-555QA.S...GIN..PH....ISMTAWQYIRALLM----------SNLVMGLFVFVLQLAQ.GF-------------------
ATKA_STAEQ/4-554QL.I...GTK...L....EHMSGKTYIKHFLL----------FNGLMGGLSFVLLLIQ.QW-------------------
ATKA_CLAMS/12-556RL.I...GVD..PR....SEQTWPAYLRAVLA----------FSLVGVLVVYGMQRLQ.AF-------------------
ATKA_SYNY3/9-555AG.S...GIT..KH....PSMGATQYVSAALI----------SNLVMGVFVFLILMFQ.GS-------------------
ATKA_KLEP7/11-556RV.A...GIR..A.....EEMGWLQYLLAILL----------FNALGGLALFALLMLQ.GV-------------------
K9Z7H8_CYAAP/9-557SL.F...GLRILEA....TNSNGYQYVKDVIA----------SNLVMGILVYLILMTQ.GF-------------------
D1CGX3_THET1/8-561RV.A...RVD..PD....REQDWRGYALALLL----------FNLSGMLALYALQRLQ.AW-------------------
E2Q1F7_STRC2/12-553RA.A...GVP..PD....ADQTWPAYLRSVLA----------FSLVSLALLYVLLRAQ.HL-------------------
W8EUK3_9BACT/12-563RL.S...GID..AR....REMTWQQHMVALLT----------INLVWFLLAMLVLCTQ.GS-------------------
K9TR50_9CYAN/9-555QI.G...GIS..SW....ESMTGWQYARAVLI----------SNLMMGILVFLIFMFQ.GI-------------------
W0EX99_9SPHI/9-563RL.G...GID..PS....KEMNWKQHLIALLT----------INLFWFLGCMFVLMNM.SW-------------------
C6D691_PAESJ/7-556KV.I...GLK..SR....EGMTWKKYALSFLL----------TNIVLVALSYLILRLQ.GS-------------------
ATKA_VARPS/10-571KI.A...GTR..PE....QSMHWLRYAIALLA----------FNAVGAVFVYALQRLQ.GW-------------------
B3EAQ3_GEOLS/13-570RS.C...GVQ..PD....EEMGWKRYAAAMLF----------FNLVLFAGLFVLLMTQ.HL-------------------
K9VVM6_9CYAN/9-559KL.G...GLR...T....ESMTGWQYARAVLY----------SNLVMGIFVYLILMLQ.GI-------------------
K9X7N8_9CHRO/9-556AI.N...GTR..YK....DNMTGRQYIQAVII----------SNLVMSIFVFSILMLQ.GV-------------------
I3Y5A2_THIV6/11-568RL.C...GVR..QN....KEMGWLHYALAILL----------FNLLGALAVYALQRLQ.VW-------------------
W5WRB9_9PSEU/12-552KV.V...RVN..PD....SEQRWSTYAYGVLG----------FSFVSVLFLYLLQRLQ.TV-------------------
F4C4K6_SPHS2/10-559RL.G...KID..SK....HEMSWKQHLVALLT----------INSIWFLVGMFILMNQ.DW-------------------
D9QG06_BRESC/10-560GL.A...GVN..PD....RSQGWVGYAGALVV----------FNAMGFGLLYAILRLQ.GG-------------------
A8HY16_AZOC5/10-561RV.A...GVD..PK....LDQSWIGYTLAMLA----------FNGAGAVLLYAILRFQ.DF-------------------
Q186E7_PEPD6/11-560KV.C...SID..KK....KEMNWKQYALALLF----------TNAVMVFIGYIILRTQ.SM-------------------
B1XRB5_SYNP2/9-555TI.G...GFA..NQ....SSMTGRKYVSAVLV----------SNLVMGILVFFIFLLQ.RA-------------------
ATKA_TOLAT/12-560FL..........EN....SQMKWQTYAAAILV----------FNLLGAALLFLLMLFQ.GS-------------------
U5LJM5_9BACI/9-555KI.S...GIK...K....INQTWKQYAMTLVL----------ANGFMILLVYMVFRLQ.GI-------------------
E6WH85_PANSA/10-554RL.A...GVD..G.....DAMRWPHYLLAILL----------FNALGVVLLLVMLMMQ.GA-------------------
ATKA_BEII9/10-560RA.C...GID..PR....QSQTWSSYALALLA----------FSAASFILLYAILRLQ.GW-------------------
R5F2L1_9CLOT/9-579RG.L...RID..KE....EEMDWKKYSVCTAV----------FSVMSLAVLWAILCFQ.NL-------------------
ATKA_ANADE/10-573RL.A...GVD..PA....EQMGWRRYAAAALT----------FNAAGLLAVFALERLQ.AA-------------------
G8M758_9BURK/10-579RL.A...GVD..PE....SEMSWKQYALAVLL----------FNALGALVLYAILRLQ.GM-------------------
ATKA_MYCA9/14-570RV.G...RVD..PE....TEQTWVGYTLSLLG----------FSFASVIFLYVLQRIQ.GV-------------------
E8X5C7_ACISM/10-587KL.S...GID..ES....YEMRWTEYAISMLL----------FSLVTLLLTYMIERLQ.QW-------------------
D6E871_9ACTN/9-587RC.I...RVD..RA....DVMGWKRYLISALV----------FSALSLAGLFAILMLQ.GV-------------------
C5C4A0_BEUC1/16-557RL.A...RVD..PD....ADQTWSTYLLSLLG----------FSLVSVLFLFGLGRLQ.EY-------------------
K8GCZ3_9CYAN/9-558SL.S...GIR..SN....EEMTGWQYARAVVY----------SNTVMLVFIFSIFMFQ.GV-------------------
D0IYN9_COMT2/9-559RV.M...GVN..PQ....ERMGWQRYGTALVL----------SNALMMLLGYLLLRLQ.GA-------------------
E0SEX9_DICD3/10-555RL.C...GFS..T.....REMGWQHYAGAILV----------FNLLGIVLLFLMLAYQ.DR-------------------
R6RMK4_9FIRM/8-574KI.M...HVK..EE....EEMGWKRYAGSVFM----------FSITALIVLMLIHMFQ.GV-------------------
F4F4Y7_VERMA/14-551RL.I...GVN..PA....AEQSWGVYARAVLA----------FSAVSVLFLYAFLRLQ.NH-------------------
A8KYG3_FRASN/13-567RL.T...GVN..PN....AGQRWTVYARSVLA----------FSAVSVLFLYLLQRVQ.DH-------------------
F7UZ80_EEGSY/10-588RS.I...RVD..KY....ENMGWKTYLVSALA----------FSAVSLAGLFAILMLQ.GV-------------------
E1VQU5_9GAMM/5-576AL.L...GAR..PE....AGMSWRGYAGAFLL----------SNLVLAVVVWIIFMTQ.AW-------------------
C6XZL6_PEDHD/9-568KL.S...GIN..PK....EEMNWKQHMKALLT----------INLVWLVYGFFVLIYQ.DK-------------------
B7J714_ACIF2/9-575RL.T...GVP..VD....DEMGWKRYSLSLLL----------FNILGVLFMYFIFQAQ.GA-------------------
E8RRM4_ASTEC/14-564SM.G...DVR..PD....QDMRWTDYATAVIL----------FSFGGFALLFGLLLTQ.GV-------------------
K0CGH7_ALCDB/5-555RL.A...GIN..PN....ADMSWSDYARVLLK----------LHLLLAIVIFLVLTLQ.QW-------------------
K8E2F1_CARML/9-558KF.I...GKP..AK....LEMTAKKYALAIVS----------FSLFSFLAVFLLMLGQ.GF-------------------
D3EAK4_GEOS4/7-556AL.I...GLK..ER....KGMTWKGYAVSFVL----------TNIVLVAAGYLILRLQ.KV-------------------
D5WU10_KYRT2/12-563RL.F...GLN..AS....REMSWKTYAWAVIA----------FNAVGMAVLFVLQLVQ.GW-------------------
G8TDF8_NIAKG/9-568RV.S...GIN..PN....ASMDWKQFLKAMLS----------INLLWFVYAFFALLFQ.DK-------------------
ATKA_HYDS0/11-568KI.L...GID..ES....KEMNWKEYLYALLS----------FNFLGFLVLFLTLLFQ.KY-------------------
D7DKK2_METV0/11-584RA.L...GIK..PE....TEMGWKHYAVALLL----------FNVIGIVFVYVLQRLQ.VW-------------------
R6PVD9_9CLOT/5-571KI.C...GIK...D....EEMGWKKYALTLVM----------VNAVMVFVGYLILRIQ.NV-------------------
F2IFU1_FLUTR/9-571RI.S...GLD..GT....REMNWEQHIYALLG----------INLVWFFICFLLLLNQ.GW-------------------
B1YM42_EXIS2/11-544LL.L...GVD.ERK....QDQSWVGYSKSLLL----------VNLLFFVGGYLLLRFQ.GS-------------------
F7QKE7_9BRAD/10-559RL.G...GVD..EK....HEQHWLTYTVAMLL----------FHVGGFVLLYTLIRLQ.GV-------------------
ATKA_MICAN/9-574TF.V...GVK..GK....ENMTGWQYTRAVLY----------SNAVIAILVFSLIAGQ.GV-------------------
S0EVD3_CHTCT/10-589RL.F...GIE..EE....VEMPWTTYALAFVL----------FSVVGLLLTYILLRLQ.GH-------------------
ATKA_RHIME/11-561GA.A...GID..PT....REQGWLAYTLSMLA----------FSIAGFLLLFAILRLQ.AW-------------------
D5AKZ2_RHOCB/10-560RL.A...GVT..PE....REQGWLGYALAMLA----------FSAAGFAALYLILRAQ.GL-------------------
C9R8E6_AMMDK/12-560RL.A...GVN..PY....AEMSWTRYLGSLLL----------FNFWGLLAGYLLLRWQ.NH-------------------
D2QBF3_SPILD/9-570RV.G...GID..PT....REMSWKENLTALLT----------INAVWLAFSFTLLLLQ.GM-------------------
C6W8P0_ACTMD/12-539RA.A...RVD..PD....SQQRWGTYAQGVLG----------FSLVGVALLYLMQRVQ.PW-------------------
Q09AH8_STIAD/10-563RL.C...GVD..PS....REQTWGQYTRALLA----------FSLFGVLLLDALQRLQ.HV-------------------
I0DX89_PROSM/10-561RF.S...GLK..QPGREMAEMNWSRYAFAILL----------FNALGFALLFILLLFQ.GN-------------------
C4KYL4_EXISA/11-542RR.L...RIN..ER....EKQSWFGYAKDFLT----------LNLLFLLIGYVLLRFQ.GV-------------------
ATKA_PSEAE/10-560RL.F...GVD..PA....SEQDWKTYTLALLA----------FNLAGLVLLFSILMLQ.GS-------------------
F8EK12_RUNSL/9-581KV.C...RIN..PK....KEMTWQEHLTALLT----------INFLWFFWMMFILMNQ.GW-------------------
A0KED5_AERHH/10-553AC.C...GTD...G....REQDWKSYALSLLA----------FNGAGFGLLFLILLAQ.GL-------------------
E9T4H3_COREQ/12-565RL.C...RIN..PR....TEQTWYGYAGSLLG----------FSAASVLLLYFLQRIQ.GV-------------------
Q31MM1_SYNE7/10-552RW.I...TVD..SS....QSMPTGQYLRSLLW----------VNAVTAVLSWGLLSLQ.AW-------------------
ATKA_NOSS1/9-555VI.S...GVR..PK....DEMTGWQYIRAILY----------TNLFMGILVYSLIYFQ.RL-------------------
F6D4T7_METSW/10-559RI.C...GVD..EA....EEMTWKGYAKALIL----------FNILAILFVFIIQLIQ.GI-------------------
K9UDW3_9CHRO/9-563GL.S...GVK..PE....VQMTGWQYARAILY----------SNLAMAILLFAILMLQ.GV-------------------
ATKA_HALSA/11-578RL.S...GIN..PR....REMTWKGYLKAVLV----------FNVCIWVLLFVVLMFQ.DA-------------------
W0A4I8_9SPHN/10-559RL.A...GID..PA....AEQSWRRYAVHMLI----------FNVALLLLTYAVLRLQ.GL-------------------
ATKA_RHORT/10-561RL.S...GVR..PK....EEQHWAAYALSMLV----------FNLAGLLGLYLILRVQ.GW-------------------
R6NNJ3_9FIRM/5-564KI.C...HIG...R....EGMNWKQYALHLLT----------TNAVMVFIGYLVLRLQ.GI-------------------
D3RSD8_ALLVD/5-565RA.I...GVD..PL....APMSWKAYGKALLK----------LHLIIALIALVILVQQ.GW-------------------
I0H1S8_ACTM4/10-547RT.V...GVD..AA....AGQTWGVYARSVLA----------FSAVSLLFLYLFLRVQ.DA-------------------
ATKA_GEOKA/9-557RL.S...GIR..SL....EEMTWKSYCTALLI----------VNAALLGISYGLLRIQ.HY-------------------
ATKA_THETN/9-558KI.T...GIN..PE....EEMDWKKYALTFLL----------VNMVMMIITYFILRVQ.QF-------------------
D2Q289_KRIFD/12-553KM.L...GVD..AK....ADQTWAVYARSVLA----------FSVVGLVLLYLLQRLQ.AY-------------------
K9RK69_9CYAN/10-555KL.A...DVN..PQ....ENMRGKEYAYCVLQ----------SNLFIGLLVYLFISFQ.KF-------------------
ATKA_ALIAD/10-559RL.I...GVN..PE....VEMDWKAYLRAMMV----------SNLVMALFAYAVFRLQ.GV-------------------
B6JA58_OLICO/10-557GM.A...GTS..EK....EEQHWTTYLGAMLL----------FNLAGFALLYLLQRVQ.GG-------------------
W6EHN8_SULMU/10-557RL.C...GIN..PQ....LEMNWKKYALALML----------FNGAGIVLVLAVLLSQ.HL-------------------
D3PV93_STANL/12-552RL.V...GVK..SD....VEQTWGGYARSVLA----------FSAVGVFFLYGFQRLQ.PL-------------------
H1ZCI8_MYROD/9-559KS.S...RIK..PE....EGMNWKQHLVALLT----------LNAVWFVVAFILLLTQ.GS-------------------
H9ZZC9_FERFK/11-532DV.LDIIGLG..SS....SEKSFLKYIADAFL----------LNFILIAIDTIMLMKQ.S.-------------------
ATKA_FLAPJ/10-570KI.S...GIN..AT....EVMNWKQHLKALLS----------INMVWFFLCFFILLFQ.GS-------------------
A5FU08_ACICJ/10-556RL.C...GID..PQ....RQMAWGAYAVGLLL----------LSLIHFLLLYAILRLQ.YF-------------------
K9Y0M2_STAC7/9-555TV.G...GIN..YQ....KNMTGWRYARSVLI----------SNLVMLVFVFLILIFQ.GL-------------------
C0ZIZ1_BREBN/7-554KL.S...GIR...V....ADMTWKQYAMAVLV----------SNISMVAIAYLLLRLQ.GM-------------------
D6ZE64_SEGRD/12-555KA.A...RVN..AA....AEQTWQWYTLSLLG----------FSFVSVFFLYALQRLQ.GV-------------------
H7C701_ENTFA/10-555KA.I...GPI..SK....KEMSAKRYALNVLL----------LSFFSIVLLIAILMTQ.HF-------------------
F4CT92_PSEUX/12-552RL.V...RVD..AS....SGQRWPTYAAGVLG----------FSFVSCALLYLLQRLQ.PV-------------------
E8V6X7_TERSS/10-579RL.T...GVK..PE....EEMRWTEYAVAMLA----------FSTATLVLTYAIERLQ.HL-------------------
ATKA_PHOLL/10-561RC.C...GLQ..KPGGTVKEMNWWQYALAITI----------FNLTGLLLLFTLLVTQ.HA-------------------
ATKA_MYCTU/10-568QV.C...RVD..PG....SEQRWSTYALSVLA----------FSVMSFLLLYGIARFQ.GV-------------------
J7J1Q1_DESMD/10-560RI.C...GID..AQ....KEMNWWEYALSLLV----------FSFVGLFTLFILQLGQ.GY-------------------
D5UVP7_TSUPD/12-549KI.V...GAD..PE....AEQGYRTYAVAALA----------FSAVSIIALTILLLAQ.GL-------------------
U5RTG7_9CLOT/7-555KI.S...GIT...K....EEMTWKQYIGALLL----------CNLVPAILAYIILRIQ.FM-------------------
ATKA_METI4/11-566KL.C...SID..RS....KEQSWIEYAVGLLC----------FNFVGILVSYLILRLQ.SI-------------------
D1BAQ9_SANKS/14-555RV.M...RVD..AD....AEQRWTSYLFSLLG----------FSLVSLLALYAMGRLQ.EH-------------------
L0ABX1_CALLD/9-533KT.L...GIN..KE....NSMNYKEYLLSLLS----------LNIIFIVFDTVFLMFQ.NH-------------------
ATKA_GRABC/10-560RF.S...GVR..PE....EEQSWSHYALALLS----------FKIVCFVAVYAILRLQ.AY-------------------
C9A6Y5_ENTCA/10-555RV.I...GSV..SK....KEMTAKTYLFSVLA----------VSVFSIIGLTGLLMVQ.HW-------------------
W0I187_9ENTR/10-555RL.C...GIG........GAMHWRHYLCAILL----------FNLLGGALLLAILLLQ.GL-------------------
ATKA_RHILO/10-559RI.C...GTS..ER....EEQHWTAYAVALLL----------FNLAGFLVLYALQRLQ.GS-------------------
B8ESF4_METSB/10-566RL.T...GVD..PE....SEQNWLNYAAALII----------FNLAGILLLFAFLLLQ.DA-------------------
ATKA_METB6/11-574KA.C...GAG..SD....EEMDWKSFAVAMMI----------FSVIGIVFVFILQEVQ.QF-------------------
C3AK38_BACMY/16-560KV.A...GIK...G....HGQTWKQYMFCLMS----------TNFFCILVVYSIFRLQ.GI-------------------
D5SYH3_PLAL2/10-576RL.C...GID..KS....AEMTWRQYSVAAMS----------FSLVSFLAVYAFQRTQ.GW-------------------
D7B3X9_NOCDD/11-556RL.V...GVD..PR....SEQSWPAYLRAVLA----------FSAVGLVLLYLLQRLQ.HV-------------------
E3EDK0_PAEPS/7-556KV.V...GLK..KQ....DSMRWTTYAMSFIA----------TNVVLVGISYLLLRLQ.AI-------------------
ATKA_PROAC/12-555RV.M...GVN..PR....AGQTWKSYARAVLA----------FSFCGVVFLYALQRLQ.PW-------------------
B8GSR6_THISH/5-564AL.I...GTN..PE....RGMSWRGYAGAFLL----------SNLVLAVIVWLILMTQ.AW-------------------
A5N882_CLOK5/5-568RI.C...GID...K....KEMNWKQYITALLV----------TNAFMVLIGYFILRLQ.AL-------------------
W5WRG8_9CORY/12-549RL.I...GVK..AD....GKQHWVKYSASVMA----------FSAVSVVFLYLLQRTQ.QF-------------------
H6NGX7_9BACL/8-552TI.S...GIC...R....DNQTWKQYALAVVF----------SNLVMIILVYLIFRFQ.KF-------------------
ATKA_ECOLI/10-556RA.L...GVS..D.....REMNWKQYLCAILG----------LNMLGLAVLFFMLLGQ.HY-------------------
R5W702_9BACT/12-563KV.C...GID..PE....REMNWKQFLKALLT----------VNLFWFIWGMVLLVCQ.GW-------------------
G2I8K8_GLUMN/10-560RI.A...GIQ..QD....REQSWSQYAIAVIV----------FKIICFIAVYALLRFQ.GF-------------------
ATKA_HERA2/10-575RL.L...GID..AK....SEMHWKHYALALLG----------FNAMGMLLLYGLQRMQ.AW-------------------

PF08016

PKD1_MOUSE/3701-4103--------------------AG---------------------HALAAFSVRPFALRRLSTGLSLPLLT.SVCLLLFA--
PKD2_MOUSE/265-685--------------------TG---------------------GVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFI--
Q8T8Z2_DROME/169-596--------------------FG---------------------IQLPRVHVDSVSMLGNVETRSNSELLILFVYTVLV--
PKDRE_MOUSE/1621-2051--------------------LG---------------------VVNSSLSVYSFSLADFNRKTSSEIYL.YAAILIFF--
Q95V80_STRPU/2211-2645--------------------SG---------------------GLLKLPEVQAVRLHRYAANYKLFVILCEILFVVAL--
PKD2_CAEEL/119-538--------------------SG---------------------GVITTPKLMTYDLLTYQTSGGTRMMIFEGIFCGFI--
Q9VVZ8_DROME/165-591--------------------YQ---------------------YPDGHTRIESHTFVEQLREFTKFGMLMVFVFVVTW--
PKDRE_HUMAN/1748-2178--------------------LG---------------------VVNTSISLHSFSLADFDRKASAEIYL.YVAILIFF--
Q9VK95_DROME/402-803--------------------TG---------------------GVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMV--
PK2L1_MOUSE/147-567--------------------TG---------------------GTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFCVFI--
F7APR1_MACMU/91-490--------------------AG---------------------RALAALSVRPFALRRLSAGLSLPLLT.SVCLLLFA--
Q9W4X5_DROME/170-595--------------------FG---------------------GIVPDVQVDSAKLLENVDQMPYTGLLALLIYVLVF--

PF00520

TRPC5_RABIT/372-636--------------------PP..........................................PTVVEWM..ILPWV..
O46129_LOLFO/351-636--------------------PM................................KEEKKISELRGSPATIV..ELMILGY
TRPG_DROME/361-664--------------------LN..............................TMEELPTKRGAKPTFIEWL..ILAWV..
TRPL_DROME/382-680--------------------QE..................................LRQRGQTP.SKLELI..VVMYV..
Q94447_CALVI/372-670--------------------FP.........................WMIEMLDDWRKHERGSLPGPIELG..IITYI..
TRPC2_MOUSE/670-932--------------------KG..................................RSQS.....VWETSL..HMIWV..
TRPC3_HUMAN/379-670--------------------EG....................................ITTLPNITVTDYP..KQIFRVK
TRPC6_MOUSE/447-738--------------------DN..............................ARQLFRMKTSCF.SWMEML..IISWV..
TRPM2_HUMAN/801-1060--------------------VP...........................................SWCECA....IYL..
TRPM1_HUMAN/833-1087--------------------.......................................P.....SLQEWI..VISYI..
Q20766_CAEEL/902-1141--------------------KP...........................................SKYEWI..TFIYT..
TRPG_CAEEL/1312-1567--------------------RP...........................................TVIEYI..LIAYV..
TRPV5_RABIT/332-590--------------------LRDDNRTDPRDITILQQKLLQEAYVTHQDNIRLVGELVTV.....TGAVII..LLLEI..
Q9VUD5_DROME/475-730--------------------QC..................................PLMNLESDLAKLRIM..AELLNFV
Q6JGX2_9RODE/387-652--------------------IP................................SSKATFGDSM.LLLGHI..LILLG..
O61220_CAEEL/519-775--------------------IK...................................RIGRKKWWNVLTAFPAKITFK..
Q9W3W0_DROME/459-665--------------------NQ...........................................GLSAFL..KQLSHAP
PAIN_DROME/494-746--------------------ES..................................DQRALT...AFFGLL..SWLGI..
TRPA1_DROME/793-1039--------------------CE..................................ERINRTTAILFCAVV..IVVYI..
TRPA1_HUMAN/720-972--------------------NS..................................TGIINETS.DHSEIL..DTTNS..
TRPA1_CAEEL/813-1080--------------------DS..................................EYFDENETCPQINTTKPDVVWK..
Q9VHY7_DROME/551-812--------------------IP...................................AQELCQKQSILGDMLRNNPFVME
PYX_DROME/496-735--------------------AP...................................GYVSTIG.YLVIIL..NLILL..
O13054_MAKNI/4778-4992--------------------EK...........................................KQEEPD..NSVFA..
O61567_HOMAM/1212-1418--------------------TG.....................................................ILG..
O96310_HELVI/229-436--------------------SK...........................................GLIHYI.........
ITPR_DROME/2408-2692--------------------GP..................................ESTL.....CLLGVV..TVTLK..
O77089_PANAR/2326-2624--------------------GP..................................EPTL.....WLLGSA..NVLIK..
ITPR1_MOUSE/2315-2600--------------------GL..................................QPTL.....FLLGAF..NVCNK..
ITPR2_HUMAN/2270-2552--------------------IY...................................TIGLGPTLILLGAA..NLCNK..
Q9VW35_DROME/351-581--------------------RS..................................QFGKELSFDGRLEFV..NFWYI..
N1P4B6_YEASC/769-1010--------------------TS..................................ANCN.....NILLKT..DRGIS..
NALCN_RAT/35-333--------------------TF..................................EHYPPLQ..YVTFTL..DTLLM..
CCH1_SCHPO/514-755--------------------QT..................................SSTA.....NRYLIF..YACVD..
B9DFD5_ARATH/429-683--------------------DI..................................EESSAQ...KPWQVA..EFVFG..
TPC1_HUMAN/440-698--------------------LK..................................GGNFFSKH.VPWSYL....VFL..
B9DFD5_ARATH/103-316--------------------.....................................................EVITL..
CCH1_SCHPO/1272-1517--------------------TY............................................VRNSI..FLILS..
N1P4B6_YEASC/1529-1779--------------------PG...........................................NLIGYQGVYFMFS..
N1P4B6_YEASC/1209-1484--------------------HK..................................MGTW.....NWSSAL..DCAFI..
CCH1_SCHPO/941-1224--------------------YE................................RDHLLNDKQH.AWFVWT..EVAFA..
CCH1_SCHPO/184-493--------------------PH..................................DKS......QTIDYL..IIVIG..
TPC1_HUMAN/105-331--------------------VP..................................ALRLGI...YVHATL..ELFAL..
NALCN_RAT/1209-1458--------------------VE..................................DPVT.....VPLATM..SVVFT..
NALCN_RAT/383-610--------------------GE.....................................NFRRQYDEFYLA..EVAFT..
NALCN_RAT/885-1167--------------------RR..................................VMHA.....PTLQIA..EYVFV..
CAC1E_DIPOM/1104-1385--------------------HK..................................DSARN....QVLRYF..DYVFT..
Q17354_CAEEL/340-623--------------------DE..................................ENPRN....KVLQYM..DYCFT..
M9NDV1_DROME/768-1051--------------------RE..................................NSRRN....KILNYF..DYAFT..
P91744_HETBL/894-1174--------------------ND..................................ESVNN....QILNYF..DYVFT..
O02038_CYACP/868-1147--------------------GR..................................DVLRN....KILGYF..DIFFT..
O97017_9CNID/849-1127--------------------NA..................................SAKRN....QVLNYF..DYFFT..
O96057_HALRO/803-1082--------------------SA..................................HSARN....KVLEYF..DYVFT..
CAC1D_DROME/1343-1621--------------------RA.................................NDDLN.....KVLNKF..DYFFT..
CAC1S_CYPCA/814-1092--------------------DP..................................RSFRN....KVLAYA..DIVFT..
CAC1S_HUMAN/798-1076--------------------RA..................................DSMRN....QILKHF..DIGFT..
CAC1C_HUMAN/899-1197--------------------QH..................TSFRNHILFYFDIVFTTIFTIEIALKILGNA..DYVFT..
CAC1D_HUMAN/885-1163--------------------RS..................................HSFRN....TILGYF..DYAFT..
CAC1G_RAT/1254-1527--------------------ID..................................PHSAER...IFLTLS..NYIFT..
Q9W433_DROME/2144-2418--------------------IP..................................PSST.....ERLFLATANYVFT..
O44930_AIPPA/1046-1318--------------------LP..................................SRPKLK...EYLQYL..NIFFA..
O62604_POLPE/908-1178--------------------LP..................................KRPTLE...KFLQYC..NYFFA..
Q17314_CYACP/963-1231--------------------LS..................................KKVVLK...AFLDYC..NYFFA..
P97706_RAT/954-1225--------------------IH..................................QRKTIK...IFLEYG..DMIFA..
SCN7A_HUMAN/933-1204--------------------MD..................................QRKTIK...ILLEYA..DMIFT..
SCN1_HETBL/781-1052--------------------LN..................................EKPRLK...LAIFYL..DITFC..
O02037_BDECA/985-1259--------------------LP..................................NYPMLE...NTIYIL..DKVFT..
SCNBA_RAT/1033-1299--------------------LP..................................SRPQVE...KLLRCT..DNIFT..
SCNBA_HUMAN/1055-1319--------------------LE..................................NQPKIQ...ELLNCT..DIIFT..
Q25150_HALRO/1260-1547--------------------LK..................................DKIGLQ...RVLKYA..DRIFT..
SCNAA_CANFA/1158-1436--------------------LD..................................QKPTVK...ALLEYT..DRMFT..
SCNA_ELEEL/999-1275--------------------IW..................................RRRVIK...VILEYA..DKVFT..
SCN4A_HORSE/1027-1303--------------------IE..................................QRRVIR...TILEYA..DKVFT..
SCN8A_RAT/1195-1473--------------------IE..................................QRKTIR...TILEYA..DKVFT..
P90670_APLCA/1177-1452--------------------LH..................................EKPILK...EILEYL..DKVFT..
Q25377_DOROP/1022-1296--------------------LR..................................KKPILQ...LVLKYM..DKCFT..
SCNA_DROME/1300-1571--------------------LP..................................QRPILQ...DILYYM..DRIFT..
Q9XZC1_RHIMP/461-733--------------------LK..................................DRPTLK...AVLTYM..DKTFT..
Q9W433_DROME/300-623--------------------CV..................................DDACVTNRCKILQIF..DDIIF..
CAC1I_RAT/76-407--------------------CD..................................DMECLSDRCKILQVF..DDFIF..
CAC1G_RAT/80-406--------------------CE..................................DIACDSQRCRILQAF..DDFIF..
CAC1H_HUMAN/99-430--------------------CE..................................DVECGSERCNILEAF..DAFIF..
CAC1E_DIPOM/101-374--------------------PN..................................GDKTPMA..KSLEQT..EPYFI..
M9NDV1_DROME/37-324--------------------PG..................................GDKTVLA..QKLEKT..EAYFL..
P91744_HETBL/64-348--------------------PN..................................EDKTPLA..VQLEAT..EFYFL..
O02038_CYACP/112-392--------------------PA..................................GDMTSTN..QDLEVA..EYFFL..
O97017_9CNID/80-362--------------------PE..................................KDSSEIN..DNLEVA..EYVFL..
O96057_HALRO/46-328--------------------PG..................................DDSNRTN..EILEKV..EYIFL..
CAC1D_DROME/614-889--------------------PG..................................SDSNVTN..QTLEKV..EYVFL..
CAC1S_CYPCA/69-362--------------------PE..................................EDTNNTN..LTLESL..EYIFL..
CAC1F_HUMAN/91-383--------------------PE..................................DDSNTAN..HNLEQV..EYVFL..
CAC1D_CHICK/120-412--------------------PE..................................DDSNSTN..HNLEKV..EYAFL..
CAC1S_HUMAN/50-345--------------------PE..................................DDNNSLN..LGLEKL..EYFFL..
CAC1S_LITCT/50-343--------------------PE..................................DDTNSTN..SVLEKV..EYIFL..
P97706_RAT/117-405--------------------LP...........................................EWILAV..ENTCL..
SCN7A_HUMAN/117-405--------------------LP...........................................KWRPVL..ENTLL..
O02037_BDECA/134-418--------------------.N...........................................LDIKAL..EQSFT..
SCNBA_RAT/128-406--------------------IP...................................................EYVFI..
SCNBA_HUMAN/128-411--------------------.....................................GPAKNSNSNNTDIA..ECVFT..
SCNA_DROME/152-440--------------------TT...........................................PTVEST..EVIFT..
P90670_APLCA/137-431--------------------PP..............................................AFV..EHIFL..
Q25377_DOROP/131-412--------------------LP...............................................VS..EWIFT..
Q25150_HALRO/130-477--------------------GE.........................................DVD...IV..EKTFL..
SCNAA_CANFA/129-417--------------------DR................................................I..EYVFT..
SCNA_ELEEL/121-413--------------------PP...........................................AWSKIV..EYTFT..
SCN4A_HUMAN/130-458--------------------PP...........................................PWSKNV..EYTFT..
SCN5A_HUMAN/130-424--------------------PP...........................................PWTKYV..EYTFT..
Q90518_TAKRU/128-427--------------------PP...........................................EWAKNV..EYTFT..
SCN1_HETBL/54-345--------------------.P...........................................DISEFA..EYIFL..
O44930_AIPPA/112-392--------------------QP...................................................EYVFA..
Q17314_CYACP/142-419--------------------KE................................................S..EYVFA..
CAC1G_RAT/1578-1830--------------------QP..................................QILD.....EALKIC..NYIFT..
Q17354_CAEEL/666-920--------------------NP..................................LFYE.....EILRLF..NTALT..
P91744_HETBL/1217-1468--------------------SP..................................TEYK.....LLLQNL..NLAFS..
M9NDV1_DROME/1094-1348--------------------QG..................................DMYE.....KSLKYI..NMGFT..
CAC1B_DIPOM/1467-1716--------------------AP..................................DPYD.....RMLQYL..NILFT..
CAC1E_DIPOM/1428-1674--------------------PP..................................PGFA.....SVLKLM..NIAFT..
CAC1E_HUMAN/1477-1734--------------------AP..................................CTYE.....LALKYL..NIAFT..
O02038_CYACP/1188-1437--------------------AS..................................KLYE.....RVLDGF..NIGFT..
O97017_9CNID/1168-1422--------------------EP..................................KLYT.....RVLDGF..NIGFT..
CAC1M_MUSDO/1108-1378--------------------QP..................................EYYS.....EILDAL..NMIFT..
O96057_HALRO/1123-1384--------------------QS..................................KELT.....VILNHM..NYVFT..
CAC1S_CYPCA/1133-1413--------------------QS..................................DHIT.....KLSDTL..NLIFT..
CAC1S_RABIT/1117-1392--------------------QS..................................EEMN.....HISDIL..NVAFT..
CAC1C_HUMAN/1238-1535--------------------QS..................................CLFK.....IAMNIL..NMLFT..
O02037_BDECA/1306-1555--------------------QP..................................KLLT.....RVLDIV..GRVFL..
SCN7A_HUMAN/1250-1507--------------------QS..................................LQMS.....IALYWI..NSIFV..
P90670_APLCA/1499-1743--------------------MS..................................AQMK.....NILGIF..NLIFI..
Q25377_DOROP/1343-1600--------------------MS..................................RTFE.....DFLKYI..NMVFI..
SCNA_DROME/1618-1871--------------------AS..................................DTYN.....AVLDYL..NAIFV..
Q9XZC1_RHIMP/780-1031--------------------QS..................................RLFE.....SILERL..NIFFI..
SCNBA_RAT/1345-1595--------------------QP..................................KDVK.....KTFDIL..NIAFV..
SCNBA_HUMAN/1365-1615--------------------QP..................................KAMK.....SILDHL..NWVFV..
Q25150_HALRO/1593-1850--------------------MP..................................KNLM.....DVLEYI..NYVFI..
SCNA_ELEEL/1321-1578--------------------QS..................................QVKK.....DILSQI..NVIFV..
SCN1A_HUMAN/1540-1797--------------------QS..................................EYVT.....TILSRI..NLVFI..
SCN5A_HUMAN/1527-1783--------------------QS..................................PEKI.....NILAKI..NLLFV..
SCN1_HETBL/1100-1362--------------------QS..................................EVVT.....EVLATA..NIAFT..
O44930_AIPPA/1367-1619--------------------QK..................................PAVE.....QALMII..NLVFT..
O62604_POLPE/1225-1481--------------------QS..................................QQVS.....LALEYL..NFLFT..
Q17314_CYACP/1278-1536--------------------QT..................................KEVE.....VALNYL..NYLFT..
O62604_POLPE/486-725--------------------MP..................................KKLE.....DALNVF..NYIFT..
Q17314_CYACP/509-745--------------------QP..................................EVMT.....KMSDIL..NYIFT..
P97706_RAT/526-760--------------------MS..................................EELM.....SLLAIG..NLVFI..
SCN7A_HUMAN/504-739--------------------MS..................................KQTN.....TLLNIG..NLVFI..
SCNBA_RAT/571-809--------------------MD..................................DNLK.....TILKIG..NWVFT..
SCNBA_HUMAN/576-822--------------------ME..................................ASFE.....KMLNIG..NLVFT..
Q25150_HALRO/798-1033--------------------ME..................................ESYA.....RILEVA..NLVFT..
SCNAA_CANFA/673-910--------------------MS..................................SAFE.....AMLQIG..NIVFT..
SCNA_ELEEL/565-801--------------------MN..................................ESFQ.....SLLSAG..NLVFT..
SCN5A_RAT/717-953--------------------MT..................................AEFE.....EMLQVG..NLVFT..
SCN4A_HORSE/571-807--------------------MT..................................EHFD.....KVLTVG..NLVFT..
SCN1A_RAT/767-1003--------------------MT..................................EHFN.....HVLTVG..NLVFT..
P90670_APLCA/753-995--------------------ME..................................DDLK.....AVSNAA..NLVFT..
Q25377_DOROP/591-824--------------------MQ..................................EGLR.....VALEIG..NYVFT..
SCN1_HETBL/410-640--------------------MS..................................MELK.....NVLKVA..NYVFT..
O44930_AIPPA/622-858--------------------MD..................................SNYL.....MVLEIG..NKVFT..
CAC1G_RAT/743-976--------------------QP..................................EELT.....NALEIS..NIVFT..
Q9W433_DROME/1230-1471--------------------QP..................................PELT.....AIVETS..NVVFS..
Q17354_CAEEL/9-248--------------------QP..................................QWFT.....DFLKYA..EFVFL..
P91744_HETBL/480-720--------------------QA..................................EWHT.....EFLYVM..EFAFL..
CAC1A_RAT/488-727--------------------QP..................................EWLS.....DFLYYA..EFIFL..
M9NDV1_DROME/440-678--------------------QP..................................SFLT.....EFLYYA..EFIFL..
O02038_CYACP/496-738--------------------QP..................................DYIT.....MFLDRA..NYFFL..
O97017_9CNID/468-710--------------------QP..................................DWLT.....KFLDIA..NKLFL..
CAC1D_DROME/984-1226--------------------QL..................................DWLD.....NFQEYT..NVFFI..
O96057_HALRO/428-670--------------------QP..................................PWLT.....LAQDLA..NKILL..
CAC1S_CYPCA/446-687--------------------QT..................................EGLT.....SFQDTA..NVILL..
O73697_TAKRU/439-680--------------------QP..................................EWLT.....SLQDVA..SRVLL..
CAC1C_HUMAN/523-764--------------------QP..................................NWLT.....EVQDTA..NKALL..
CAC1S_LITCT/430-671--------------------QP..................................DSLT.....KAQDIA..NEVLL..
CAC1S_HUMAN/431-672--------------------QP..................................LWLT.....RLQDIA..NRVLL..
CNGC3_ARATH/80-406--------------------PY........VK..PERFCL.................NLDKKLQ.TIACVF..RTFID..
CNGC6_ARATH/111-443--------------------PF........IND.K.AKCV.................GIDRKLA.IIVTTI..RTVID..
CNGC7_ARATH/98-431--------------------PI...............................VDNSGSSCIGIDTKLAVT..TTTLRTI
CNG16_ARATH/52-386--------------------PI........VQ..AGTACM.................SIDVRFG.IFVTCF..RNLAD..
CNG14_ARATH/84-410--------------------RI.............................GRSSCMTTDLKLG.IVITFF..RTLAD..
HCN4_MOUSE/262-525--------------------FK..................................DENT.....TPWIVF..NVVSD..
O96385_PARTE/140-383--------------------NL..................................NEDNMG...SVFTLF..STLPS..
Q27170_PARTE/142-388--------------------KF..................................DEQSQD...DFYQAR..QIIFDVL
SKOR_ARATH/82-334--------------------FR........GLP.........................EN.......LFIL..DIAGQ..
KAT3_ARATH/86-336--------------------EK...................................AAE.....GALLTI..DLVVD..
Q9XH40_SAMSA/77-327--------------------LM..................................SSPT.....HKLYIV..DNIID..
Q9SM12_MAIZE/69-319--------------------MN..................................ASPK.....GGLEVA..DIVVD..
AKT2_ARATH/75-324--------------------LN..................................SSPK.....RNLCIA..DNIVD..
O04703_SOLTU/88-338--------------------MN..................................LNPN.....KKLYIA..DNIVN..
O24538_VICFA/55-305--------------------MH..................................SSPN.....RKLYIV..DNIID..
AKT5_ARATH/78-324--------------------LQ...................................TPR.....APLSIL..DNVVN..
O04242_MAIZE/64-310--------------------IQ...................................KPT.....GALAAV..DNVVN..
O24382_SOLTU/63-309--------------------LG...................................KPE.....GPLAKT..DNVVN..
B9DI19_ARATH/57-300--------------------LR...................................KPR.....PPLSIT..DNIVN..
KAT2_ARATH/59-307--------------------IT...................................YKK.....DALFII..DNIVN..
Q41461_SOLTU/60-311--------------------LS..................................YKKD.....DTLFIV..DNIVD..
KCNH5_RAT/214-479--------------------KT..................................KQNN.....IAWLVL..DSVVD..
O44164_CAEEL/216-496--------------------KN.........................SLRPFYLISSRENPGGGIDSVALM..DSIVD..
KCNAE_DROME/236-500--------------------KN..................................KTSED....VSLLVV..DSIVD..
KCNH6_RAT/256-523--------------------LL............................SDQDESQRGTCGYTCSPLTVV..DLIVD..
Q23974_DROME/267-516--------------------AK..................................AD.......RQTKVS..DVIVE..
KCNH3_RAT/224-515--------------------ST...................................AREPSAARGPPSVC..DLAVE..
KCNH8_RAT/221-481--------------------IG....................................NEDLSTTRSTTVS..DIAVE..
Q9U5E2_DROME/125-365--------------------PE..................................LQQSVP...TFWLIC..DSMTD..
CNG_CAEEL/165-422--------------------PD.................................LGWSKYWHFRMLWVFF..DLLMD..
CNGA4_RAT/34-277--------------------PD................................LQHSYL.....VAWFVL..DYTSD..
CNGA_DROME/107-358--------------------WE..................................INKSAP...AFWYTL..DYLCD..
CNG_ICTPU/138-376--------------------DQ..................................LQDENF...FLWVGL..DYLCD..
CNGA1_BOVIN/163-406--------------------DE................................LQSDYL.....EYWLAF..DYLSD..
CNG1_CHICK/210-453--------------------DE..................................LQIDHI...KLWLFL..DYCSD..
CNGA2_BOVIN/140-383--------------------SD.....................................LQKGYYIVWLVL..DYVSD..
CNGB1_BOVIN/770-1005--------------------PY..................................QTPDNI...HLWLLM..DYLCD..
Q9W2D5_DROME/468-704--------------------PF..................................QTKENT...NIWLAC..DFCAD..
KCMA1_RAT/178-400--------------------PI...................................ESCQNFYKDFTLQI..DMAFN..
SLO_DROME/126-348--------------------EE..................................VERCQKWSNNITQQI..DLAFN..
SLO1_CAEEL/138-363--------------------QN................................FQVETCIPWQDSPSQQI..DLGFN..
KCNQ1_HUMAN/122-359--------------------QY..................................AALAT....GTLFWM..EIVLV..
Q9XWG9_CAEEL/76-313--------------------AA...........................................ELLYIL..EIVLV..
KCNQ3_HUMAN/122-363--------------------KE..................................YETVSG...DWLLLL..ETFAI..
KCNQ2_HUMAN/92-324--------------------KE..................................YEKSSE...GALYIL..EIVTI..
KCNQ4_HUMAN/98-330--------------------QE................................H...QELAN..ECLLIL..EFVMI..
Q9RW39_DEIRA/33-252--------------------EL..................................SHAVR....ARLRQT..EWVFT..
Q16976_APLCA/213-469--------------------EL........RPKFLNVTTECEGGHS........RELGRVMTSH.EALNTL..DIICT..
Q9XXD1_CAEEL/229-477--------------------EL........QVATKQRNNLT.............GEEFTEMEPM.PILGYI..EYVCI..
KCNG2_CHICK/216-464--------------------DV................................REEEDRGECSQKCYDIFVLETVCV..
G1R5R7_NOMLE/226-471--------------------SL..............................REEEEQGHCSQMCHNVFIV..ESVCV..
KCNAL_DROME/184-417--------------------CG...........................HRPGRAGTLPCGERYKIVFFCL..DTACV..
P91784_POLPE/201-427--------------------CS.................................ANRPCGEVYNKIFFNI..EAVCV..
KCNV1_RAT/212-442--------------------LS...................................WLNL....QLLEIL..EYVCI..
KCNS3_HUMAN/184-417--------------------EF..................................QNEDGEVDDPVLEGV..EIACI..
KCNS1_MOUSE/188-439--------------------EY...................QAREAAAAVAAVAAGRSAEEVRDDPVLRRL..EYFCI..
KCNS2_MOUSE/186-421--------------------IP..................................DSQGNPGEDPRFEIV..EHFGI..
F7H076_MACMU/181-417--------------------EL........QV......................LDAEGNRVEH.PTLENV..ETACI..
KCNAB_DROME/434-670--------------------QL........Q.......................HIDNGTPQDN.PQLAMV..EAVCI..
Q26344_APLSP/314-551--------------------AL...............................QDRADPSLNQDNEDLAVV..EAVCI..
KCNAG_CAEEL/203-453--------------------SF........RLPVLIGQNITMPGGVV.....QPSIERVSTEPL.PIFGQI..EMLCN..
O76457_APLCA/173-421--------------------EM.............RVPVLKNATSRTVNGTYTWRLEKKETEPH.EAFFYI..ECASN..
B3N373_DROER/173-424--------------------DM..............RVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYI..ECVCN..
KCNSK_CAEEL/274-519--------------------SD........IEEKPINNSATA...........ELLDEMDEKHY.SPFFWI..ELMCI..
O76266_HIRME/209-446--------------------RF.............................AKSHCVADEAPNFLDPFFII..ETICT..
Q26094_POLPE/173-409--------------------VF......................APKELLTNNGTIYKTVYSEHATWMFTV..NTAVI..
Q26095_POLPE/181-410--------------------SL................................NPDKPEGSHMRVTWFII..NTICN..
KCNA6_RAT/230-470--------------------SF..................................STLGGSFFTDPFFLV..ETLCI..
Q25376_DOROP/169-415--------------------EF.......................KRYELLNDTIIVDDAMPKFGTPFFII..ETGCI..
KCNA1_HUMAN/166-419--------------------EL.................KDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIV..ETLCI..
KCNAS_DROME/226-489--------------------EF...................KHYKVFNTTTNGTKIEEDEVPDITDPFFLI..ETLCI..

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7MJ92_VIBVY/25-103--------------------------------------------------------------------------------
Q7MND5_VIBVY/236-324--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------
W5K2Z9_ASTMX/155-233--------------------------------------------------------------------------------

PF01007

Q17KL4_AEDAE/26-358--------------------AH--------------------------GDLIF..DPETGERLGDGAMPCVEGATTFA--
E4WZQ3_OIKDI/115-447--------------------HH--------------------------NDIQ....AYNSPQNFTDHTSCVDQVFDFT--
F6SPD2_XENTR/30-357--------------------IH--------------------------GDMN........IEPLSNHTPCVMNVDSFT--
H2ZYX1_LATCH/30-357--------------------MH--------------------------GDLE.......DHEPSFNHTPCVVNVNSLT--
W5M8R3_LEPOC/3-329--------------------LR--------------------------GDLD........APARRDPPPCYQNVDGFL--
F7FJC1_MONDO/157-485--------------------VH--------------------------GDLE.......RSPDERNYKPCILQVHGFM--
T1EE13_HELRO/114-441--------------------SH--------------------------GDLD.........AKSNDKKLCVQEVRDFL--
H3B1J1_LATCH/31-362--------------------VH--------------------------GDLL.......EFDPPSNHTPCVMQVHTLT--
U3II41_ANAPL/29-354--------------------LR--------------------------GDLH........RAHDDTYSPCVANVYNFP--
B4KG98_DROMO/94-428--------------------SH--------------------------GDFLF..DSVTDERLGEGQDPCIYGVRTFV--
V8NV91_OPHHA/467-790--------------------LH--------------------------GDLE............ETDKPCVSEVRSFT--
A5PJL2_BOVIN/30-357--------------------IH--------------------------GDLE.......PSEPPSNHTPCIMRVDSLT--
H3BAR9_LATCH/36-360--------------------AH--------------------------GDLD.........QNEDNFVPCVTSIHSFS--
U3JLS4_FICAL/37-368--------------------AH--------------------------GDMD...PSTENPSNSTKWTPCVTCVRSFT--
H2T749_TAKRU/56-383--------------------TH--------------------------GDFD.........EPSTQRMPCILHVQGFV--
H3A9C1_LATCH/46-374--------------------LH--------------------------GDLD........LSKPEGFKPCIMHINSFL--
Q1L8I6_DANRE/24-353--------------------SN--------------------------GDLL.......WQNPPPDHKPCVYSVYDMT--
W4YAR4_STRPU/79-411--------------------AH--------------------------GDLN......ASQRNLTDWEPCVYNMETFT--
J0XL15_LOALO/80-413--------------------LH--------------------------GDIR.....YHLKRNMLNHSVCIENIDSFF--
M3XYC0_MUSPF/50-375--------------------LH--------------------------GDLA..........APPPAAPCFSQVASFL--
Q5TQ25_ANOGA/25-357--------------------AH--------------------------GDLIQ..DSPTGERLGDGVMPCVQGATNFI--
H2MFJ0_ORYLA/42-360--------------------AH--------------------------GDVR...........DHHNDPCVYEVRSFT--
U3KL94_FICAL/39-359--------------------QH--------------------------GDVF..........GDEELTPCVANVHSFT--
KCJ10_RAT/31-363--------------------AH--------------------------GDLL.......ELGPPANHTPCVVQVHTLT--
E7F2Q1_DANRE/50-373--------------------TS--------------------------GDLD............NQVQICISNVDSFT--
K1QHC7_CRAGI/79-409--------------------SH--------------------------GDLE......QQTMKNPQHVPCVKEMHSFT--
H2US08_TAKRU/8-335--------------------AH--------------------------GDLS.......IGLPKGSGEPCFLQVNSFM--
KCJ16_MOUSE/37-357--------------------HH--------------------------GDLL..........SDPDITPCVDNVHSFT--
H2Q537_PANTR/31-359--------------------IH--------------------------KDLP.......EFHPSANHTPCVENINGLT--
B0W1P8_CULQU/118-451--------------------AH--------------------------GDLDF..DPDTGERLGDGDQPCVLNAKSFA--
H2T950_TAKRU/46-374--------------------LH--------------------------GDMD.......RSGMDDDFVPCVTQVSTFV--
I3K6N4_ORENI/30-360--------------------SN--------------------------GDMA.......GQNRTEGHIQCIDNVNGLT--
H9JWA7_BOMMO/187-510--------------------SY--------------------------AD...........DIGDGKEHCVTGTSSFA--
M3XLP7_LATCH/62-390--------------------AH--------------------------GDLA.......VPPVDHRPEPCFHQVNSFL--
W4YRL0_STRPU/65-403--------------------YH--------------------------GDLGYQDKMADNVTEYEDWEPCVYNVQNFI--
B0W1P7_CULQU/12-344--------------------AH--------------------------GDLNF..DPETGKRMGDGEQ