Sequence alignment for CL0030

PF08016

PKD1_MOUSE/3701-4103SQAFLAITRSDEFWPWMSHVFLPYV.....HGNQS............SPELGPPRLRQVRLQEA....FCPDPSSSEHM.
PKD2_MOUSE/265-685KTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHT.QADNRSFIFYENLLLGVPRLRQLRVRNG..SCSIPQDLRDEIKE
Q15142_HUMAN/3046-3448SRAFLAITRSEELWPWMAHVLLPYV.....HGNQS............SPELGPPRLRQVRLQEA....LYPDPPGPRVHT
Q8T8Z2_DROME/169-596TFGLSQVYFIYQVHSYMKITLVEAF.....YAQKT.NGYEGWWAMEQWQKIGVVRLRQMRPVD.................
O42181_TAKRU/3850-4245TPEYRGVS...SVLLWLNQSLFPRL.....LDDSALLRDTGS......VLLGTLRLRQIFDKQT.FHILPADDVVPEVGG
PKDRE_MOUSE/1621-2051SVDLATVMKLGDIYTWLHGVFLPLL.....HNDPNPTFLPDS....SSKILGLPLVRQVRARPSNKTCLLAKKFVQSSVA
Q95V80_STRPU/2211-2645NKDYHLMNDFRSFLKWADSTLLPGL.....LSENRWGAEKQS.....TLIGGGLRLRQVRVKPS..SCETHPLFVDLIND
PKD2_CAEEL/119-538APAFGSCTSMDNIWDWLSQVLIPGIYW.TETSNST...DNENMIYYENRLLGEPRIRMLKVTND..SCTVMKSFQREIKE
Q80ZH4_MOUSE/145-567GVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSLGRGSHSFIYYENLLLGAPRLRHVRVRND..SCVVHEDFREDILN
Q9VVZ8_DROME/165-591AFGLLSVGDVPDIYFFVVSSLVLAF.....TDGKNTSGGAPWIHAEGTRLLGVVRLRQLRTES.................
PKDRE_HUMAN/1748-2178SMDLATVTKLEDIYRWLNSVLLPLL.....HNDLNPTFLPES....SSKILGLPLMRQVRAKSSEKMCLPAEKFVQNSIR
Q9VK95_DROME/402-803VSGNYLKDDSDSI.................QANMSFHHLEGRVFLYENLLLGPPRLRQIRVRKE..SCYVNDAFIRYFNT
Q9U1K9_DROME/160-576YTGLQEVYFLNQLFDFIESTLVLAF.....NSNSTESGSPGWAHAEQSVLLGVMRLRHVRVSN.................

PF00520

KCNS1_MOUSE/243-427--------------------------------------------------------------------------------
KCNAL_DROME/231-405--------------------------------------------------------------------------------
TRPC6_MOUSE/495-726--------------------------------------------------------------------------------
TRPA1_HUMAN/775-960--------------------------------------------------------------------------------
CAC1C_HUMAN/161-404--------------------------------------------------------------------------------
CAC1C_HUMAN/558-752--------------------------------------------------------------------------------
CAC1C_HUMAN/955-1185--------------------------------------------------------------------------------
CAC1C_HUMAN/1273-1523--------------------------------------------------------------------------------
KCNS3_HUMAN/224-405--------------------------------------------------------------------------------
ITPR1_MOUSE/2362-2588--------------------------------------------------------------------------------
TRPC3_HUMAN/427-658--------------------------------------------------------------------------------
KAT2_ARATH/93-295--------------------------------------------------------------------------------
SCN4A_HUMAN/159-446--------------------------------------------------------------------------------
KCNQ4_HUMAN/134-318--------------------------------------------------------------------------------
SCN7A_HUMAN/146-393--------------------------------------------------------------------------------
SCN7A_HUMAN/539-728--------------------------------------------------------------------------------
SCN7A_HUMAN/970-1192--------------------------------------------------------------------------------
SCN7A_HUMAN/1285-1495--------------------------------------------------------------------------------
ITPR2_HUMAN/2317-2540--------------------------------------------------------------------------------
TRPC2_MOUSE/704-920--------------------------------------------------------------------------------
CAC1E_HUMAN/1512-1722--------------------------------------------------------------------------------
TRPA1_CAEEL/873-1068--------------------------------------------------------------------------------
TRPA1_DROME/932-1126--------------------------------------------------------------------------------
CAC1F_HUMAN/129-371--------------------------------------------------------------------------------
TRPM1_HUMAN/862-1075--------------------------------------------------------------------------------
KCNA1_HUMAN/223-407--------------------------------------------------------------------------------
CAC1S_HUMAN/88-333--------------------------------------------------------------------------------
CAC1S_HUMAN/466-660--------------------------------------------------------------------------------
CAC1S_HUMAN/834-1064--------------------------------------------------------------------------------
SCN5A_HUMAN/159-412--------------------------------------------------------------------------------
SCN5A_HUMAN/1241-1469--------------------------------------------------------------------------------
SCN5A_HUMAN/1562-1771--------------------------------------------------------------------------------
KCMA1_RAT/217-388--------------------------------------------------------------------------------
Q9W433_DROME/339-611--------------------------------------------------------------------------------
Q9W433_DROME/1265-1459--------------------------------------------------------------------------------
Q9W433_DROME/2181-2406--------------------------------------------------------------------------------
NALCN_RAT/73-321--------------------------------------------------------------------------------
NALCN_RAT/420-598--------------------------------------------------------------------------------
NALCN_RAT/920-1155--------------------------------------------------------------------------------
NALCN_RAT/1243-1446--------------------------------------------------------------------------------
TPC1_ARATH/154-304--------------------------------------------------------------------------------
TPC1_ARATH/466-671--------------------------------------------------------------------------------
TRPM2_HUMAN/830-1048--------------------------------------------------------------------------------
SCNA_DROME/180-428--------------------------------------------------------------------------------
SCNA_DROME/1337-1559--------------------------------------------------------------------------------
SCNA_DROME/1653-1859--------------------------------------------------------------------------------
SCNBA_HUMAN/611-810--------------------------------------------------------------------------------
SLO_DROME/166-336--------------------------------------------------------------------------------
Q20766_CAEEL/931-1129--------------------------------------------------------------------------------
TPC1_HUMAN/142-319--------------------------------------------------------------------------------
TPC1_HUMAN/477-686--------------------------------------------------------------------------------
Q18351_CAEEL/295-478--------------------------------------------------------------------------------
TRPV2_MOUSE/441-640--------------------------------------------------------------------------------
CAC1A_DROME/1129-1336--------------------------------------------------------------------------------
CAC1A_HUMAN/135-359--------------------------------------------------------------------------------
CAC1A_HUMAN/1279-1510--------------------------------------------------------------------------------
CAC1A_HUMAN/1600-1810--------------------------------------------------------------------------------
O02037_BDECA/160-406--------------------------------------------------------------------------------
O02037_BDECA/1022-1247--------------------------------------------------------------------------------
O02037_BDECA/1341-1543--------------------------------------------------------------------------------
O02038_CYACP/150-380--------------------------------------------------------------------------------
O02038_CYACP/531-726--------------------------------------------------------------------------------
O02038_CYACP/904-1135--------------------------------------------------------------------------------
O02038_CYACP/1223-1425--------------------------------------------------------------------------------
O04242_MAIZE/98-298--------------------------------------------------------------------------------
O04703_SOLTU/123-326--------------------------------------------------------------------------------
SCN9A_RAT/154-401--------------------------------------------------------------------------------
O08661_RAT/376-542--------------------------------------------------------------------------------
O13054_MAKNI/4820-4980--------------------------------------------------------------------------------
CCH1_SCHPO/218-481--------------------------------------------------------------------------------
CCH1_SCHPO/550-743--------------------------------------------------------------------------------
CCH1_SCHPO/982-1212--------------------------------------------------------------------------------
CCH1_SCHPO/1302-1505--------------------------------------------------------------------------------
O17535_CAEEL/261-439--------------------------------------------------------------------------------
O18324_BLAGE/4-195--------------------------------------------------------------------------------
TRPC1_BOVIN/457-645--------------------------------------------------------------------------------
KCNH1_BOVIN/252-498--------------------------------------------------------------------------------
O24382_SOLTU/97-297--------------------------------------------------------------------------------
O24538_VICFA/90-293--------------------------------------------------------------------------------
TRPC4_RAT/436-620--------------------------------------------------------------------------------
KCNS2_MOUSE/229-409--------------------------------------------------------------------------------
CAC1S_CHICK/92-278--------------------------------------------------------------------------------
O42421_CHICK/5-206--------------------------------------------------------------------------------
KCNQ3_HUMAN/158-351--------------------------------------------------------------------------------
KCNQ2_HUMAN/128-312--------------------------------------------------------------------------------
O44164_CAEEL/265-484--------------------------------------------------------------------------------
O44930_AIPPA/138-380--------------------------------------------------------------------------------
O44930_AIPPA/657-846--------------------------------------------------------------------------------
O44930_AIPPA/1083-1306--------------------------------------------------------------------------------
O44930_AIPPA/1402-1607--------------------------------------------------------------------------------
O46129_LOLFO/396-624--------------------------------------------------------------------------------
SCNAA_CANFA/155-405--------------------------------------------------------------------------------
SCNAA_CANFA/708-898--------------------------------------------------------------------------------
SCNAA_CANFA/1195-1424--------------------------------------------------------------------------------
O49846_9LILI/11-193--------------------------------------------------------------------------------
O54812_CAVPO/76-278--------------------------------------------------------------------------------
KCNH6_RAT/302-515--------------------------------------------------------------------------------
CAC1G_RAT/119-394--------------------------------------------------------------------------------
CAC1G_RAT/778-964--------------------------------------------------------------------------------
CAC1G_RAT/1291-1515--------------------------------------------------------------------------------
CAC1G_RAT/1613-1818--------------------------------------------------------------------------------
CAC1S_LITCT/88-331--------------------------------------------------------------------------------
CAC1S_LITCT/465-659--------------------------------------------------------------------------------
O61220_CAEEL/521-763--------------------------------------------------------------------------------
O61567_HOMAM/1241-1406--------------------------------------------------------------------------------
O62604_POLPE/521-713--------------------------------------------------------------------------------
O62604_POLPE/945-1166--------------------------------------------------------------------------------
O62604_POLPE/1260-1469--------------------------------------------------------------------------------
TRPC2_BOVIN/6-182--------------------------------------------------------------------------------
TRPC5_RABIT/405-624--------------------------------------------------------------------------------
O65816_HORVU/144-390--------------------------------------------------------------------------------
O70368_RAT/6-196--------------------------------------------------------------------------------
HCN4_MOUSE/297-513--------------------------------------------------------------------------------
KCNG2_CHICK/260-452--------------------------------------------------------------------------------
O73697_TAKRU/474-668--------------------------------------------------------------------------------
O73697_TAKRU/1162-1386--------------------------------------------------------------------------------
CAC1D_CHICK/158-400--------------------------------------------------------------------------------
CAC1D_CHICK/1260-1492--------------------------------------------------------------------------------
O76266_HIRME/254-434--------------------------------------------------------------------------------
O76457_APLCA/233-409--------------------------------------------------------------------------------
O77089_PANAR/2376-2612--------------------------------------------------------------------------------
CNGC6_ARATH/157-431--------------------------------------------------------------------------------
SCN8A_RAT/1232-1461--------------------------------------------------------------------------------
SCNBA_RAT/158-394--------------------------------------------------------------------------------
SCNBA_RAT/606-797--------------------------------------------------------------------------------
SCNBA_RAT/1070-1287--------------------------------------------------------------------------------
SCNBA_RAT/1380-1583--------------------------------------------------------------------------------
HCN2_MOUSE/219-431--------------------------------------------------------------------------------
HCN1_MOUSE/166-382--------------------------------------------------------------------------------
KCNH3_RAT/273-507--------------------------------------------------------------------------------
CAC1H_HUMAN/138-418--------------------------------------------------------------------------------
O96057_HALRO/84-316--------------------------------------------------------------------------------
O96057_HALRO/463-658--------------------------------------------------------------------------------
O96057_HALRO/839-1070--------------------------------------------------------------------------------
O96057_HALRO/1158-1372--------------------------------------------------------------------------------
O96310_HELVI/265-424--------------------------------------------------------------------------------
O96385_PARTE/190-371--------------------------------------------------------------------------------
O97017_9CNID/118-350--------------------------------------------------------------------------------
O97017_9CNID/503-698--------------------------------------------------------------------------------
O97017_9CNID/885-1115--------------------------------------------------------------------------------
O97017_9CNID/1203-1410--------------------------------------------------------------------------------
SCNA_ELEEL/150-401--------------------------------------------------------------------------------
SCNA_ELEEL/600-789--------------------------------------------------------------------------------
SCNA_ELEEL/1036-1263--------------------------------------------------------------------------------
SCNA_ELEEL/1356-1566--------------------------------------------------------------------------------
SCN1A_RAT/156-422--------------------------------------------------------------------------------
SCN1A_RAT/802-991--------------------------------------------------------------------------------
SCN1A_RAT/1254-1482--------------------------------------------------------------------------------
CAC1S_RABIT/1152-1380--------------------------------------------------------------------------------
KCNAS_DROME/281-477--------------------------------------------------------------------------------
SCN5A_RAT/752-941--------------------------------------------------------------------------------
KCNA6_RAT/266-458--------------------------------------------------------------------------------
KCNAB_DROME/476-658--------------------------------------------------------------------------------
KCNAW_DROME/233-412--------------------------------------------------------------------------------
CAC1S_CYPCA/107-350--------------------------------------------------------------------------------
CAC1S_CYPCA/481-675--------------------------------------------------------------------------------
CAC1S_CYPCA/850-1080--------------------------------------------------------------------------------
CAC1S_CYPCA/1168-1401--------------------------------------------------------------------------------
ITPR_DROME/2410-2680--------------------------------------------------------------------------------
SCN1A_HUMAN/1575-1785--------------------------------------------------------------------------------
TRPL_DROME/432-668--------------------------------------------------------------------------------
CCH1_YEAST/804-998--------------------------------------------------------------------------------
CCH1_YEAST/1244-1472--------------------------------------------------------------------------------
CCH1_YEAST/1563-1767--------------------------------------------------------------------------------
KCNQ1_HUMAN/158-347--------------------------------------------------------------------------------
CAC1A_RAT/523-715--------------------------------------------------------------------------------
CNG_ICTPU/175-364--------------------------------------------------------------------------------
CAC1B_DISOM/1502-1704--------------------------------------------------------------------------------
CAC1E_DISOM/139-362--------------------------------------------------------------------------------
CAC1E_DISOM/1140-1373--------------------------------------------------------------------------------
CAC1E_DISOM/1463-1662--------------------------------------------------------------------------------
P90670_APLCA/165-419--------------------------------------------------------------------------------
P90670_APLCA/788-983--------------------------------------------------------------------------------
P90670_APLCA/1214-1440--------------------------------------------------------------------------------
P90670_APLCA/1534-1731--------------------------------------------------------------------------------
P91256_CAEEL/249-433--------------------------------------------------------------------------------
CAC1A_DROME/75-312--------------------------------------------------------------------------------
CAC1A_DROME/475-666--------------------------------------------------------------------------------
CAC1A_DROME/804-1039--------------------------------------------------------------------------------
P91744_LOLBL/102-336--------------------------------------------------------------------------------
P91744_LOLBL/515-708--------------------------------------------------------------------------------
P91744_LOLBL/930-1162--------------------------------------------------------------------------------
P91744_LOLBL/1252-1456--------------------------------------------------------------------------------
P91783_POLPE/220-401--------------------------------------------------------------------------------
P91784_POLPE/242-415--------------------------------------------------------------------------------
KAT3_ARATH/120-324--------------------------------------------------------------------------------
KCNV1_RAT/247-430--------------------------------------------------------------------------------
P97706_RAT/146-393--------------------------------------------------------------------------------
P97706_RAT/561-749--------------------------------------------------------------------------------
P97706_RAT/991-1213--------------------------------------------------------------------------------
CNGA1_BOVIN/200-394--------------------------------------------------------------------------------
CAC1D_HUMAN/921-1151--------------------------------------------------------------------------------
KCNAE_DROME/272-488--------------------------------------------------------------------------------
CNGA2_BOVIN/177-371--------------------------------------------------------------------------------
CNG_CAEEL/206-410--------------------------------------------------------------------------------
SCN1_LOLBL/80-333--------------------------------------------------------------------------------
SCN1_LOLBL/445-628--------------------------------------------------------------------------------
SCN1_LOLBL/818-1040--------------------------------------------------------------------------------
SCN1_LOLBL/1135-1350--------------------------------------------------------------------------------
Q09658_CAEEL/273-452--------------------------------------------------------------------------------
KCNH2_HUMAN/454-659--------------------------------------------------------------------------------
Q16976_APLCA/270-457--------------------------------------------------------------------------------
Q17314_CYACP/168-407--------------------------------------------------------------------------------
Q17314_CYACP/544-733--------------------------------------------------------------------------------
Q17314_CYACP/1000-1219--------------------------------------------------------------------------------
Q17314_CYACP/1313-1524--------------------------------------------------------------------------------
Q17354_CAEEL/44-236--------------------------------------------------------------------------------
Q17354_CAEEL/376-611--------------------------------------------------------------------------------
Q17354_CAEEL/701-908--------------------------------------------------------------------------------
Q19464_CAEEL/235-414--------------------------------------------------------------------------------
Q23974_DROME/300-504--------------------------------------------------------------------------------
CAC1D_DROME/652-877--------------------------------------------------------------------------------
CAC1D_DROME/1019-1214--------------------------------------------------------------------------------
CAC1D_DROME/1379-1609--------------------------------------------------------------------------------
CAC1D_DROME/1697-1925--------------------------------------------------------------------------------
CNG_DROME/144-346--------------------------------------------------------------------------------
Q25150_HALRO/156-465--------------------------------------------------------------------------------
Q25150_HALRO/833-1021--------------------------------------------------------------------------------
Q25150_HALRO/1297-1535--------------------------------------------------------------------------------
Q25150_HALRO/1628-1838--------------------------------------------------------------------------------
Q25376_LOLOP/220-403--------------------------------------------------------------------------------
Q25377_LOLOP/158-400--------------------------------------------------------------------------------
Q25377_LOLOP/626-812--------------------------------------------------------------------------------
Q25377_LOLOP/1059-1284--------------------------------------------------------------------------------
Q25377_LOLOP/1378-1588--------------------------------------------------------------------------------
CAC1M_MUSDO/1143-1366--------------------------------------------------------------------------------
Q26039_PANIN/184-355--------------------------------------------------------------------------------
Q26094_POLPE/225-397--------------------------------------------------------------------------------
Q26095_POLPE/223-398--------------------------------------------------------------------------------
Q26344_APLSP/357-539--------------------------------------------------------------------------------
Q27170_PARTE/196-376--------------------------------------------------------------------------------
CNGB1_BOVIN/807-993--------------------------------------------------------------------------------
SCN4A_HORSE/606-795--------------------------------------------------------------------------------
SCN4A_HORSE/1064-1291--------------------------------------------------------------------------------
AKT2_ARATH/110-312--------------------------------------------------------------------------------
AKT1_ARATH/91-288--------------------------------------------------------------------------------
Q41461_SOLTU/95-299--------------------------------------------------------------------------------
Q63541_RAT/162-411--------------------------------------------------------------------------------
CNGA4_RAT/71-265--------------------------------------------------------------------------------
Q90518_TAKRU/157-415--------------------------------------------------------------------------------
Q90519_TAKRU/5-205--------------------------------------------------------------------------------
CNG1_CHICK/247-441--------------------------------------------------------------------------------
Q93135_BLAGE/4-216--------------------------------------------------------------------------------
TRPG_CAEEL/1341-1555--------------------------------------------------------------------------------
Q94447_CALVI/422-658--------------------------------------------------------------------------------
SLO1_CAEEL/180-351--------------------------------------------------------------------------------
KCNH5_RAT/249-467--------------------------------------------------------------------------------
KCNF1_HUMAN/224-405--------------------------------------------------------------------------------
SKOR_ARATH/116-328--------------------------------------------------------------------------------
SCN3A_HUMAN/156-423--------------------------------------------------------------------------------
Q9PRI8_XENLA/442-630--------------------------------------------------------------------------------
KCNH8_RAT/269-473--------------------------------------------------------------------------------
TRPV2_RAT/446-645--------------------------------------------------------------------------------
TRPV6_RAT/395-577--------------------------------------------------------------------------------
KCNH4_RAT/276-479--------------------------------------------------------------------------------
Q9RW39_DEIRA/69-240--------------------------------------------------------------------------------
CNGC7_ARATH/145-419--------------------------------------------------------------------------------
AKT5_ARATH/112-312--------------------------------------------------------------------------------
CNG14_ARATH/128-398--------------------------------------------------------------------------------
CNGC3_ARATH/130-394--------------------------------------------------------------------------------
Q9SM12_MAIZE/104-307--------------------------------------------------------------------------------
CNG16_ARATH/98-374--------------------------------------------------------------------------------
Q9U5E2_DROME/162-353--------------------------------------------------------------------------------
SCNBA_HUMAN/161-399--------------------------------------------------------------------------------
SCNBA_HUMAN/1092-1307--------------------------------------------------------------------------------
SCNBA_HUMAN/1400-1603--------------------------------------------------------------------------------
KCNG1_HUMAN/270-459--------------------------------------------------------------------------------
Q9VHY7_DROME/610-800--------------------------------------------------------------------------------
TRPG_DROME/412-652--------------------------------------------------------------------------------
Q9VUD5_DROME/520-718--------------------------------------------------------------------------------
Q9VW35_DROME/377-569--------------------------------------------------------------------------------
PYX_DROME/536-723--------------------------------------------------------------------------------
PAIN_DROME/531-734--------------------------------------------------------------------------------
Q9W2D5_DROME/505-692--------------------------------------------------------------------------------
Q9W3W0_DROME/513-653--------------------------------------------------------------------------------
Q9XH40_SAMSA/112-315--------------------------------------------------------------------------------
TRPV5_RABIT/393-578--------------------------------------------------------------------------------
Q9XSP9_RABIT/139-264--------------------------------------------------------------------------------
Q9XWG9_CAEEL/112-301--------------------------------------------------------------------------------
Q9XXD1_CAEEL/281-465--------------------------------------------------------------------------------
Q9XZC1_BOOMI/498-721--------------------------------------------------------------------------------
Q9XZC1_BOOMI/815-1019--------------------------------------------------------------------------------
TRPV2_HUMAN/444-645--------------------------------------------------------------------------------
CAC1I_RAT/115-395--------------------------------------------------------------------------------
Q9ZPL4_SAMSA/115-318--------------------------------------------------------------------------------

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
Q94253_CAEEL/253-318--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC72_LEIMA/202-273--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O82065_SOLTU/193-268--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRAJA/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8AVI5_XENLA/81-158--------------------------------------------------------------------------------
Q8AVI5_XENLA/191-273--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DAL9_VIBVU/25-105--------------------------------------------------------------------------------
Q8DF13_VIBVU/235-325--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8I6M6_APLCA/77-154--------------------------------------------------------------------------------
Q8J0H6_NEUCS/369-447--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8PI92_XANAC/49-128--------------------------------------------------------------------------------
Q8PT60_METMA/20-95--------------------------------------------------------------------------------
Q8QZZ6_CAVPO/69-146--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8X557_ECO57/148-226--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
Q90ZP4_ONCMY/461-543--------------------------------------------------------------------------------
Q920B6_RAT/120-198--------------------------------------------------------------------------------
Q924I4_RAT/64-145--------------------------------------------------------------------------------
Q924I4_RAT/180-260--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93531_CAEEL/115-196--------------------------------------------------------------------------------
Q93531_CAEEL/236-312--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9AR58_SOLTU/72-154--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9CX88_MOUSE/130-208--------------------------------------------------------------------------------
Q9ERU4_RAT/46-128--------------------------------------------------------------------------------
Q9ERU5_RAT/65-147--------------------------------------------------------------------------------
Q9ESM4_RAT/55-138--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9LLM5_EUCCA/71-153--------------------------------------------------------------------------------
Q9LLM5_EUCCA/192-267--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9V1D2_PYRAB/403-481--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
Q9ZP53_SOLTU/193-268--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/72-154--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/193-268--------------------------------------------------------------------------------

PF01007

IRK5_HUMAN/54-390--------------------------------------------------------------------------------
IRK10_HUMAN/31-369--------------------------------------------------------------------------------
IRK1_CAEEL/77-422--------------------------------------------------------------------------------
IRK1_HUMAN/43-380--------------------------------------------------------------------------------
IRK3_CHICK/39-385--------------------------------------------------------------------------------
IRK4_HUMAN/22-377--------------------------------------------------------------------------------
IRK12_HUMAN/47-381--------------------------------------------------------------------------------
IRK15_HUMAN/30-365--------------------------------------------------------------------------------
IRK8_HUMAN/37-380--------------------------------------------------------------------------------
IRK9_HUMAN/25-362--------------------------------------------------------------------------------
IRK2_CAVPO/48-380--------------------------------------------------------------------------------
IRK16_RAT/37-358--------------------------------------------------------------------------------
IRK11_HUMAN/36-366--------------------------------------------------------------------------------

PF00060

GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR34_ARATH/613-869--------------------------------------------------------------------------------
Q9VIA5_DROME/402-665--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
Q8T0V7_DROME/343-610--------------------------------------------------------------------------------
Q9U0T0_LOLOP/568-841--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
Q9VVU7_DROME/338-596--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
GLK1_DROME/610-907--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
NMDZ1_HUMAN/559-824--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR31_ARATH/587-839--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
GLRK_ANAPL/168-431--------------------------------------------------------------------------------
GLRK_XENLA/162-426--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
GRIA2_HUMAN/543-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
Q9VDH5_DROME/545-823--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GRIK2_HUMAN/560-831--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------

PF15249

B5X552_DROME/1418-1521--------------------------------------------------------------------------------
F8NSX7_SERL9/93-213--------------------------------------------------------------------------------
H3AYR2_LATCH/719-823--------------------------------------------------------------------------------
Q55QM7_CRYNB/131-237--------------------------------------------------------------------------------
H2NZE3_PONAB/668-773--------------------------------------------------------------------------------
Q01LC1_ORYSA/286-403--------------------------------------------------------------------------------
Q4RYD4_TETNG/1-136--------------------------------------------------------------------------------
G3HR60_CRIGR/731-835--------------------------------------------------------------------------------
C3Z068_BRAFL/1333-1438--------------------------------------------------------------------------------
A3CH67_ORYSJ/186-306--------------------------------------------------------------------------------
I1LP29_SOYBN/125-245--------------------------------------------------------------------------------
Q7XVN3_ORYSJ/354-483--------------------------------------------------------------------------------
A8PYV1_BRUMA/646-751--------------------------------------------------------------------------------
D8U255_VOLCA/23-147--------------------------------------------------------------------------------
Q9SRQ0_ARATH/121-240--------------------------------------------------------------------------------
F6Q7W8_XENTR/676-780--------------------------------------------------------------------------------
I1PKQ5_ORYGL/94-212--------------------------------------------------------------------------------
I0Z4J2_9CHLO/35-157--------------------------------------------------------------------------------
H2TKN1_TAKRU/1011-1116--------------------------------------------------------------------------------
D6RLC3_COPC7/97-215--------------------------------------------------------------------------------
H3A9A7_LATCH/1063-1168--------------------------------------------------------------------------------
E7FC48_DANRE/828-933--------------------------------------------------------------------------------
B6U5Z5_MAIZE/33-158--------------------------------------------------------------------------------
E2AU32_CAMFO/2003-2108--------------------------------------------------------------------------------
G0NU71_CAEBE/708-810--------------------------------------------------------------------------------
A8X0V1_CAEBR/811-928--------------------------------------------------------------------------------
B3M7G6_DROAN/504-627--------------------------------------------------------------------------------
A6ZJ71_CAEEL/678-780--------------------------------------------------------------------------------
E0VX25_PEDHC/1662-1767--------------------------------------------------------------------------------
F2USU5_SALS5/118-246--------------------------------------------------------------------------------
B8P3G1_POSPM/122-239--------------------------------------------------------------------------------
E9GC12_DAPPU/1239-1344--------------------------------------------------------------------------------
A3ATB4_ORYSJ/289-371--------------------------------------------------------------------------------
A8JDB0_CHLRE/26-151--------------------------------------------------------------------------------
E3M7Z0_CAERE/718-820--------------------------------------------------------------------------------
A9S0J3_PHYPA/54-177--------------------------------------------------------------------------------
E5S5E0_TRISP/368-478--------------------------------------------------------------------------------
C5YEV3_SORBI/36-162--------------------------------------------------------------------------------
B0E0Z3_LACBS/96-216--------------------------------------------------------------------------------
C5KJB2_PERM5/65-165--------------------------------------------------------------------------------
B0WCV5_CULQU/2345-2450--------------------------------------------------------------------------------
D2A445_TRICA/62-167--------------------------------------------------------------------------------
A7USW6_ANOGA/2823-2926--------------------------------------------------------------------------------
E4WWE2_OIKDI/96-202--------------------------------------------------------------------------------
B3RLC8_TRIAD/434-538--------------------------------------------------------------------------------
D8QC90_SCHCM/85-202--------------------------------------------------------------------------------
D2VJE8_NAEGR/329-435--------------------------------------------------------------------------------
E7F8Y0_DANRE/599-703--------------------------------------------------------------------------------
H2WA87_CAEJA/574-676--------------------------------------------------------------------------------
D5AE81_PICSI/102-222--------------------------------------------------------------------------------
A9RCY5_PHYPA/87-211--------------------------------------------------------------------------------
I1BJQ3_RHIO9/247-352--------------------------------------------------------------------------------
F0ZSB4_DICPU/460-585--------------------------------------------------------------------------------
C1EJG7_MICSR/87-216--------------------------------------------------------------------------------

PF02386

O27332_METTH/161-474--------------------------------------------------------------------------------
Y1485_METJA/160-466--------------------------------------------------------------------------------
TRK1_YEAST/763-1173--------------------------------------------------------------------------------
O87729_VIBAL/151-479--------------------------------------------------------------------------------
TRKH_SHIFL/152-481--------------------------------------------------------------------------------
P73949_SYNY3/106-429--------------------------------------------------------------------------------
O74723_NEUCS/406-766--------------------------------------------------------------------------------
NTPJ_ENTHR/117-435--------------------------------------------------------------------------------
Q9HPA9_HALSA/196-554--------------------------------------------------------------------------------
KTRD_BACSU/117-435--------------------------------------------------------------------------------
Q9P8G2_CANAX/615-975--------------------------------------------------------------------------------
O59477_PYRHO/169-489--------------------------------------------------------------------------------
Q41515_WHEAT/178-533--------------------------------------------------------------------------------
TRKG_ECOLI/155-483--------------------------------------------------------------------------------
TRK2_SCHPO/479-850--------------------------------------------------------------------------------
Y322_MYCGE/143-543--------------------------------------------------------------------------------
O87953_VIBAL/125-442--------------------------------------------------------------------------------
O67474_AQUAE/108-430--------------------------------------------------------------------------------
KTRB_BACSU/117-432--------------------------------------------------------------------------------
O29419_ARCFU/149-474--------------------------------------------------------------------------------
Y460_MYCPN/151-550--------------------------------------------------------------------------------
TRK2_YEAST/450-839--------------------------------------------------------------------------------
TRK1_SCHPO/454-809--------------------------------------------------------------------------------
TRKH_HAEIN/152-485--------------------------------------------------------------------------------
Q9P851_SCHOC/570-932--------------------------------------------------------------------------------
O83176_TREPA/234-561--------------------------------------------------------------------------------

PF03814

ATKA1_STAAM/3-556--------------------------------------------------------------------------------
ATKA_ANASL/8-556--------------------------------------------------------------------------------
ATKA_HALSA/10-579--------------------------------------------------------------------------------
ATKA_RHILO/9-560--------------------------------------------------------------------------------
ATKA_ALIAD/9-560--------------------------------------------------------------------------------
ATKA_MYCTU/9-569--------------------------------------------------------------------------------
ATKA_PSEAE/9-561--------------------------------------------------------------------------------
ATKA_THEAC/27-578--------------------------------------------------------------------------------
ATKA_CAUCR/9-561--------------------------------------------------------------------------------
ATKA_ECOLI/9-557--------------------------------------------------------------------------------
ATKA_STRCO/11-553--------------------------------------------------------------------------------
ATKA_SYNY3/8-556--------------------------------------------------------------------------------
ATKA_DEIRA/8-560--------------------------------------------------------------------------------
ATKA_CLOAB/6-556--------------------------------------------------------------------------------

PF08016

PKD1_MOUSE/3701-4103....CSAAGSLSTSD...YGIGW....QSVVQNGSETWAYSA...........PDLL..............GAWYWGYCA
PKD2_MOUSE/265-685....CYDVYSVSSEDR...........APFGPRNGTAWMYTS...........EKELN.............GSSHWGIIA
Q15142_HUMAN/3046-3448....CSAAGGFSTSD...YDVGW....ES.PHNGSGTWAYSA...........PDLL..............GAWSWGSCA
Q8T8Z2_DROME/169-596....CHIGLGKPEWDKKTYAPEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLLL.............NYDHYGYLL
O42181_TAKRU/3850-4245...........................DGTAENITDYRNISA...........VNSVP.............RAWRSGRLK
PKDRE_MOUSE/1621-2051GEIHCHPQYGIDPEDTQHYSSVWSKAGKQSTDKASHGFTYKP...........PGKRW.............VYHSYGVLN
Q95V80_STRPU/2211-2645....CRALFTPESEDRELYNASWS...QPIVNMSALLNSSQT...........VEEWSLSNYSPWHFYPDKAVGMWGHAT
PKD2_CAEEL/119-538....CFANYEEKLEDK...........TMVGDGSVDAFIYAT...........AKELE.............NLKTVGTIA
Q80ZH4_MOUSE/145-567....CYDVYSPDKEDQ...........LPFGPQNGTAWTYHS...........QNELG.............GSSHWGRLT
Q9VVZ8_DROME/165-591....NRLGLSLPVFTERDFSESWTLPYERVPYTDKYWPIYTPWLPS..VSVARDNLLM.............GINHVGHMF
PKDRE_HUMAN/1748-2178REIHCHPKYGIDPEDTKNYSGFWNEVDKQAIDESTNGFTYKP...........QGTQW.............LYYSYGLLH
Q9VK95_DROME/402-803....CYAAYSSGAEDR...........KPMHKGSP....FRT...........MHDLD.............STPIWTVLA
Q9U1K9_DROME/160-576....PQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYWRIYEPWIPIKMGFEFLDALLM.............NFDHVGSLN

PF00520

KCNS1_MOUSE/243-427--------------------------------------------------------------------------------
KCNAL_DROME/231-405--------------------------------------------------------------------------------
TRPC6_MOUSE/495-726--------------------------------------------------------------------------------
TRPA1_HUMAN/775-960--------------------------------------------------------------------------------
CAC1C_HUMAN/161-404--------------------------------------------------------------------------------
CAC1C_HUMAN/558-752--------------------------------------------------------------------------------
CAC1C_HUMAN/955-1185--------------------------------------------------------------------------------
CAC1C_HUMAN/1273-1523--------------------------------------------------------------------------------
KCNS3_HUMAN/224-405--------------------------------------------------------------------------------
ITPR1_MOUSE/2362-2588--------------------------------------------------------------------------------
TRPC3_HUMAN/427-658--------------------------------------------------------------------------------
KAT2_ARATH/93-295--------------------------------------------------------------------------------
SCN4A_HUMAN/159-446--------------------------------------------------------------------------------
KCNQ4_HUMAN/134-318--------------------------------------------------------------------------------
SCN7A_HUMAN/146-393--------------------------------------------------------------------------------
SCN7A_HUMAN/539-728--------------------------------------------------------------------------------
SCN7A_HUMAN/970-1192--------------------------------------------------------------------------------
SCN7A_HUMAN/1285-1495--------------------------------------------------------------------------------
ITPR2_HUMAN/2317-2540--------------------------------------------------------------------------------
TRPC2_MOUSE/704-920--------------------------------------------------------------------------------
CAC1E_HUMAN/1512-1722--------------------------------------------------------------------------------
TRPA1_CAEEL/873-1068--------------------------------------------------------------------------------
TRPA1_DROME/932-1126--------------------------------------------------------------------------------
CAC1F_HUMAN/129-371--------------------------------------------------------------------------------
TRPM1_HUMAN/862-1075--------------------------------------------------------------------------------
KCNA1_HUMAN/223-407--------------------------------------------------------------------------------
CAC1S_HUMAN/88-333--------------------------------------------------------------------------------
CAC1S_HUMAN/466-660--------------------------------------------------------------------------------
CAC1S_HUMAN/834-1064--------------------------------------------------------------------------------
SCN5A_HUMAN/159-412--------------------------------------------------------------------------------
SCN5A_HUMAN/1241-1469--------------------------------------------------------------------------------
SCN5A_HUMAN/1562-1771--------------------------------------------------------------------------------
KCMA1_RAT/217-388--------------------------------------------------------------------------------
Q9W433_DROME/339-611--------------------------------------------------------------------------------
Q9W433_DROME/1265-1459--------------------------------------------------------------------------------
Q9W433_DROME/2181-2406--------------------------------------------------------------------------------
NALCN_RAT/73-321--------------------------------------------------------------------------------
NALCN_RAT/420-598--------------------------------------------------------------------------------
NALCN_RAT/920-1155--------------------------------------------------------------------------------
NALCN_RAT/1243-1446--------------------------------------------------------------------------------
TPC1_ARATH/154-304--------------------------------------------------------------------------------
TPC1_ARATH/466-671--------------------------------------------------------------------------------
TRPM2_HUMAN/830-1048--------------------------------------------------------------------------------
SCNA_DROME/180-428--------------------------------------------------------------------------------
SCNA_DROME/1337-1559--------------------------------------------------------------------------------
SCNA_DROME/1653-1859--------------------------------------------------------------------------------
SCNBA_HUMAN/611-810--------------------------------------------------------------------------------
SLO_DROME/166-336--------------------------------------------------------------------------------
Q20766_CAEEL/931-1129--------------------------------------------------------------------------------
TPC1_HUMAN/142-319--------------------------------------------------------------------------------
TPC1_HUMAN/477-686--------------------------------------------------------------------------------
Q18351_CAEEL/295-478--------------------------------------------------------------------------------
TRPV2_MOUSE/441-640--------------------------------------------------------------------------------
CAC1A_DROME/1129-1336--------------------------------------------------------------------------------
CAC1A_HUMAN/135-359--------------------------------------------------------------------------------
CAC1A_HUMAN/1279-1510--------------------------------------------------------------------------------
CAC1A_HUMAN/1600-1810--------------------------------------------------------------------------------
O02037_BDECA/160-406--------------------------------------------------------------------------------
O02037_BDECA/1022-1247--------------------------------------------------------------------------------
O02037_BDECA/1341-1543--------------------------------------------------------------------------------
O02038_CYACP/150-380--------------------------------------------------------------------------------
O02038_CYACP/531-726--------------------------------------------------------------------------------
O02038_CYACP/904-1135--------------------------------------------------------------------------------
O02038_CYACP/1223-1425--------------------------------------------------------------------------------
O04242_MAIZE/98-298--------------------------------------------------------------------------------
O04703_SOLTU/123-326--------------------------------------------------------------------------------
SCN9A_RAT/154-401--------------------------------------------------------------------------------
O08661_RAT/376-542--------------------------------------------------------------------------------
O13054_MAKNI/4820-4980--------------------------------------------------------------------------------
CCH1_SCHPO/218-481--------------------------------------------------------------------------------
CCH1_SCHPO/550-743--------------------------------------------------------------------------------
CCH1_SCHPO/982-1212--------------------------------------------------------------------------------
CCH1_SCHPO/1302-1505--------------------------------------------------------------------------------
O17535_CAEEL/261-439--------------------------------------------------------------------------------
O18324_BLAGE/4-195--------------------------------------------------------------------------------
TRPC1_BOVIN/457-645--------------------------------------------------------------------------------
KCNH1_BOVIN/252-498--------------------------------------------------------------------------------
O24382_SOLTU/97-297--------------------------------------------------------------------------------
O24538_VICFA/90-293--------------------------------------------------------------------------------
TRPC4_RAT/436-620--------------------------------------------------------------------------------
KCNS2_MOUSE/229-409--------------------------------------------------------------------------------
CAC1S_CHICK/92-278--------------------------------------------------------------------------------
O42421_CHICK/5-206--------------------------------------------------------------------------------
KCNQ3_HUMAN/158-351--------------------------------------------------------------------------------
KCNQ2_HUMAN/128-312--------------------------------------------------------------------------------
O44164_CAEEL/265-484--------------------------------------------------------------------------------
O44930_AIPPA/138-380--------------------------------------------------------------------------------
O44930_AIPPA/657-846--------------------------------------------------------------------------------
O44930_AIPPA/1083-1306--------------------------------------------------------------------------------
O44930_AIPPA/1402-1607--------------------------------------------------------------------------------
O46129_LOLFO/396-624--------------------------------------------------------------------------------
SCNAA_CANFA/155-405--------------------------------------------------------------------------------
SCNAA_CANFA/708-898--------------------------------------------------------------------------------
SCNAA_CANFA/1195-1424--------------------------------------------------------------------------------
O49846_9LILI/11-193--------------------------------------------------------------------------------
O54812_CAVPO/76-278--------------------------------------------------------------------------------
KCNH6_RAT/302-515--------------------------------------------------------------------------------
CAC1G_RAT/119-394--------------------------------------------------------------------------------
CAC1G_RAT/778-964--------------------------------------------------------------------------------
CAC1G_RAT/1291-1515--------------------------------------------------------------------------------
CAC1G_RAT/1613-1818--------------------------------------------------------------------------------
CAC1S_LITCT/88-331--------------------------------------------------------------------------------
CAC1S_LITCT/465-659--------------------------------------------------------------------------------
O61220_CAEEL/521-763--------------------------------------------------------------------------------
O61567_HOMAM/1241-1406--------------------------------------------------------------------------------
O62604_POLPE/521-713--------------------------------------------------------------------------------
O62604_POLPE/945-1166--------------------------------------------------------------------------------
O62604_POLPE/1260-1469--------------------------------------------------------------------------------
TRPC2_BOVIN/6-182--------------------------------------------------------------------------------
TRPC5_RABIT/405-624--------------------------------------------------------------------------------
O65816_HORVU/144-390--------------------------------------------------------------------------------
O70368_RAT/6-196--------------------------------------------------------------------------------
HCN4_MOUSE/297-513--------------------------------------------------------------------------------
KCNG2_CHICK/260-452--------------------------------------------------------------------------------
O73697_TAKRU/474-668--------------------------------------------------------------------------------
O73697_TAKRU/1162-1386--------------------------------------------------------------------------------
CAC1D_CHICK/158-400--------------------------------------------------------------------------------
CAC1D_CHICK/1260-1492--------------------------------------------------------------------------------
O76266_HIRME/254-434--------------------------------------------------------------------------------
O76457_APLCA/233-409--------------------------------------------------------------------------------
O77089_PANAR/2376-2612--------------------------------------------------------------------------------
CNGC6_ARATH/157-431--------------------------------------------------------------------------------
SCN8A_RAT/1232-1461--------------------------------------------------------------------------------
SCNBA_RAT/158-394--------------------------------------------------------------------------------
SCNBA_RAT/606-797--------------------------------------------------------------------------------
SCNBA_RAT/1070-1287--------------------------------------------------------------------------------
SCNBA_RAT/1380-1583--------------------------------------------------------------------------------
HCN2_MOUSE/219-431--------------------------------------------------------------------------------
HCN1_MOUSE/166-382--------------------------------------------------------------------------------
KCNH3_RAT/273-507--------------------------------------------------------------------------------
CAC1H_HUMAN/138-418--------------------------------------------------------------------------------
O96057_HALRO/84-316--------------------------------------------------------------------------------
O96057_HALRO/463-658--------------------------------------------------------------------------------
O96057_HALRO/839-1070--------------------------------------------------------------------------------
O96057_HALRO/1158-1372--------------------------------------------------------------------------------
O96310_HELVI/265-424--------------------------------------------------------------------------------
O96385_PARTE/190-371--------------------------------------------------------------------------------
O97017_9CNID/118-350--------------------------------------------------------------------------------
O97017_9CNID/503-698--------------------------------------------------------------------------------
O97017_9CNID/885-1115--------------------------------------------------------------------------------
O97017_9CNID/1203-1410--------------------------------------------------------------------------------
SCNA_ELEEL/150-401--------------------------------------------------------------------------------
SCNA_ELEEL/600-789--------------------------------------------------------------------------------
SCNA_ELEEL/1036-1263--------------------------------------------------------------------------------
SCNA_ELEEL/1356-1566--------------------------------------------------------------------------------
SCN1A_RAT/156-422--------------------------------------------------------------------------------
SCN1A_RAT/802-991--------------------------------------------------------------------------------
SCN1A_RAT/1254-1482--------------------------------------------------------------------------------
CAC1S_RABIT/1152-1380--------------------------------------------------------------------------------
KCNAS_DROME/281-477--------------------------------------------------------------------------------
SCN5A_RAT/752-941--------------------------------------------------------------------------------
KCNA6_RAT/266-458--------------------------------------------------------------------------------
KCNAB_DROME/476-658--------------------------------------------------------------------------------
KCNAW_DROME/233-412--------------------------------------------------------------------------------
CAC1S_CYPCA/107-350--------------------------------------------------------------------------------
CAC1S_CYPCA/481-675--------------------------------------------------------------------------------
CAC1S_CYPCA/850-1080--------------------------------------------------------------------------------
CAC1S_CYPCA/1168-1401--------------------------------------------------------------------------------
ITPR_DROME/2410-2680--------------------------------------------------------------------------------
SCN1A_HUMAN/1575-1785--------------------------------------------------------------------------------
TRPL_DROME/432-668--------------------------------------------------------------------------------
CCH1_YEAST/804-998--------------------------------------------------------------------------------
CCH1_YEAST/1244-1472--------------------------------------------------------------------------------
CCH1_YEAST/1563-1767--------------------------------------------------------------------------------
KCNQ1_HUMAN/158-347--------------------------------------------------------------------------------
CAC1A_RAT/523-715--------------------------------------------------------------------------------
CNG_ICTPU/175-364--------------------------------------------------------------------------------
CAC1B_DISOM/1502-1704--------------------------------------------------------------------------------
CAC1E_DISOM/139-362--------------------------------------------------------------------------------
CAC1E_DISOM/1140-1373--------------------------------------------------------------------------------
CAC1E_DISOM/1463-1662--------------------------------------------------------------------------------
P90670_APLCA/165-419--------------------------------------------------------------------------------
P90670_APLCA/788-983--------------------------------------------------------------------------------
P90670_APLCA/1214-1440--------------------------------------------------------------------------------
P90670_APLCA/1534-1731--------------------------------------------------------------------------------
P91256_CAEEL/249-433--------------------------------------------------------------------------------
CAC1A_DROME/75-312--------------------------------------------------------------------------------
CAC1A_DROME/475-666--------------------------------------------------------------------------------
CAC1A_DROME/804-1039--------------------------------------------------------------------------------
P91744_LOLBL/102-336--------------------------------------------------------------------------------
P91744_LOLBL/515-708--------------------------------------------------------------------------------
P91744_LOLBL/930-1162--------------------------------------------------------------------------------
P91744_LOLBL/1252-1456--------------------------------------------------------------------------------
P91783_POLPE/220-401--------------------------------------------------------------------------------
P91784_POLPE/242-415--------------------------------------------------------------------------------
KAT3_ARATH/120-324--------------------------------------------------------------------------------
KCNV1_RAT/247-430--------------------------------------------------------------------------------
P97706_RAT/146-393--------------------------------------------------------------------------------
P97706_RAT/561-749--------------------------------------------------------------------------------
P97706_RAT/991-1213--------------------------------------------------------------------------------
CNGA1_BOVIN/200-394--------------------------------------------------------------------------------
CAC1D_HUMAN/921-1151--------------------------------------------------------------------------------
KCNAE_DROME/272-488--------------------------------------------------------------------------------
CNGA2_BOVIN/177-371--------------------------------------------------------------------------------
CNG_CAEEL/206-410--------------------------------------------------------------------------------
SCN1_LOLBL/80-333--------------------------------------------------------------------------------
SCN1_LOLBL/445-628--------------------------------------------------------------------------------
SCN1_LOLBL/818-1040--------------------------------------------------------------------------------
SCN1_LOLBL/1135-1350--------------------------------------------------------------------------------
Q09658_CAEEL/273-452--------------------------------------------------------------------------------
KCNH2_HUMAN/454-659--------------------------------------------------------------------------------
Q16976_APLCA/270-457--------------------------------------------------------------------------------
Q17314_CYACP/168-407--------------------------------------------------------------------------------
Q17314_CYACP/544-733--------------------------------------------------------------------------------
Q17314_CYACP/1000-1219--------------------------------------------------------------------------------
Q17314_CYACP/1313-1524--------------------------------------------------------------------------------
Q17354_CAEEL/44-236--------------------------------------------------------------------------------
Q17354_CAEEL/376-611--------------------------------------------------------------------------------
Q17354_CAEEL/701-908--------------------------------------------------------------------------------
Q19464_CAEEL/235-414--------------------------------------------------------------------------------
Q23974_DROME/300-504--------------------------------------------------------------------------------
CAC1D_DROME/652-877--------------------------------------------------------------------------------
CAC1D_DROME/1019-1214--------------------------------------------------------------------------------
CAC1D_DROME/1379-1609--------------------------------------------------------------------------------
CAC1D_DROME/1697-1925--------------------------------------------------------------------------------
CNG_DROME/144-346--------------------------------------------------------------------------------
Q25150_HALRO/156-465--------------------------------------------------------------------------------
Q25150_HALRO/833-1021--------------------------------------------------------------------------------
Q25150_HALRO/1297-1535--------------------------------------------------------------------------------
Q25150_HALRO/1628-1838--------------------------------------------------------------------------------
Q25376_LOLOP/220-403--------------------------------------------------------------------------------
Q25377_LOLOP/158-400--------------------------------------------------------------------------------
Q25377_LOLOP/626-812--------------------------------------------------------------------------------
Q25377_LOLOP/1059-1284--------------------------------------------------------------------------------
Q25377_LOLOP/1378-1588--------------------------------------------------------------------------------
CAC1M_MUSDO/1143-1366--------------------------------------------------------------------------------
Q26039_PANIN/184-355--------------------------------------------------------------------------------
Q26094_POLPE/225-397--------------------------------------------------------------------------------
Q26095_POLPE/223-398--------------------------------------------------------------------------------
Q26344_APLSP/357-539--------------------------------------------------------------------------------
Q27170_PARTE/196-376--------------------------------------------------------------------------------
CNGB1_BOVIN/807-993--------------------------------------------------------------------------------
SCN4A_HORSE/606-795--------------------------------------------------------------------------------
SCN4A_HORSE/1064-1291--------------------------------------------------------------------------------
AKT2_ARATH/110-312--------------------------------------------------------------------------------
AKT1_ARATH/91-288--------------------------------------------------------------------------------
Q41461_SOLTU/95-299--------------------------------------------------------------------------------
Q63541_RAT/162-411--------------------------------------------------------------------------------
CNGA4_RAT/71-265--------------------------------------------------------------------------------
Q90518_TAKRU/157-415--------------------------------------------------------------------------------
Q90519_TAKRU/5-205--------------------------------------------------------------------------------
CNG1_CHICK/247-441--------------------------------------------------------------------------------
Q93135_BLAGE/4-216--------------------------------------------------------------------------------
TRPG_CAEEL/1341-1555--------------------------------------------------------------------------------
Q94447_CALVI/422-658--------------------------------------------------------------------------------
SLO1_CAEEL/180-351--------------------------------------------------------------------------------
KCNH5_RAT/249-467--------------------------------------------------------------------------------
KCNF1_HUMAN/224-405--------------------------------------------------------------------------------
SKOR_ARATH/116-328--------------------------------------------------------------------------------
SCN3A_HUMAN/156-423--------------------------------------------------------------------------------
Q9PRI8_XENLA/442-630--------------------------------------------------------------------------------
KCNH8_RAT/269-473--------------------------------------------------------------------------------
TRPV2_RAT/446-645--------------------------------------------------------------------------------
TRPV6_RAT/395-577--------------------------------------------------------------------------------
KCNH4_RAT/276-479--------------------------------------------------------------------------------
Q9RW39_DEIRA/69-240--------------------------------------------------------------------------------
CNGC7_ARATH/145-419--------------------------------------------------------------------------------
AKT5_ARATH/112-312--------------------------------------------------------------------------------
CNG14_ARATH/128-398--------------------------------------------------------------------------------
CNGC3_ARATH/130-394--------------------------------------------------------------------------------
Q9SM12_MAIZE/104-307--------------------------------------------------------------------------------
CNG16_ARATH/98-374--------------------------------------------------------------------------------
Q9U5E2_DROME/162-353--------------------------------------------------------------------------------
SCNBA_HUMAN/161-399--------------------------------------------------------------------------------
SCNBA_HUMAN/1092-1307--------------------------------------------------------------------------------
SCNBA_HUMAN/1400-1603--------------------------------------------------------------------------------
KCNG1_HUMAN/270-459--------------------------------------------------------------------------------
Q9VHY7_DROME/610-800--------------------------------------------------------------------------------
TRPG_DROME/412-652--------------------------------------------------------------------------------
Q9VUD5_DROME/520-718--------------------------------------------------------------------------------
Q9VW35_DROME/377-569--------------------------------------------------------------------------------
PYX_DROME/536-723--------------------------------------------------------------------------------
PAIN_DROME/531-734--------------------------------------------------------------------------------
Q9W2D5_DROME/505-692--------------------------------------------------------------------------------
Q9W3W0_DROME/513-653--------------------------------------------------------------------------------
Q9XH40_SAMSA/112-315--------------------------------------------------------------------------------
TRPV5_RABIT/393-578--------------------------------------------------------------------------------
Q9XSP9_RABIT/139-264--------------------------------------------------------------------------------
Q9XWG9_CAEEL/112-301--------------------------------------------------------------------------------
Q9XXD1_CAEEL/281-465--------------------------------------------------------------------------------
Q9XZC1_BOOMI/498-721--------------------------------------------------------------------------------
Q9XZC1_BOOMI/815-1019--------------------------------------------------------------------------------
TRPV2_HUMAN/444-645--------------------------------------------------------------------------------
CAC1I_RAT/115-395--------------------------------------------------------------------------------
Q9ZPL4_SAMSA/115-318--------------------------------------------------------------------------------

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
Q94253_CAEEL/253-318--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC72_LEIMA/202-273--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O82065_SOLTU/193-268--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRAJA/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8AVI5_XENLA/81-158--------------------------------------------------------------------------------
Q8AVI5_XENLA/191-273--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DAL9_VIBVU/25-105--------------------------------------------------------------------------------
Q8DF13_VIBVU/235-325--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8I6M6_APLCA/77-154--------------------------------------------------------------------------------
Q8J0H6_NEUCS/369-447--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8PI92_XANAC/49-128--------------------------------------------------------------------------------
Q8PT60_METMA/20-95--------------------------------------------------------------------------------
Q8QZZ6_CAVPO/69-146--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8X557_ECO57/148-226--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
Q90ZP4_ONCMY/461-543--------------------------------------------------------------------------------
Q920B6_RAT/120-198--------------------------------------------------------------------------------
Q924I4_RAT/64-145--------------------------------------------------------------------------------
Q924I4_RAT/180-260--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93531_CAEEL/115-196--------------------------------------------------------------------------------
Q93531_CAEEL/236-312--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9AR58_SOLTU/72-154--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9CX88_MOUSE/130-208--------------------------------------------------------------------------------
Q9ERU4_RAT/46-128--------------------------------------------------------------------------------
Q9ERU5_RAT/65-147--------------------------------------------------------------------------------
Q9ESM4_RAT/55-138--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9LLM5_EUCCA/71-153--------------------------------------------------------------------------------
Q9LLM5_EUCCA/192-267--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9V1D2_PYRAB/403-481--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
Q9ZP53_SOLTU/193-268--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/72-154--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/193-268--------------------------------------------------------------------------------

PF01007

IRK5_HUMAN/54-390--------------------------------------------------------------------------------
IRK10_HUMAN/31-369--------------------------------------------------------------------------------
IRK1_CAEEL/77-422--------------------------------------------------------------------------------
IRK1_HUMAN/43-380--------------------------------------------------------------------------------
IRK3_CHICK/39-385--------------------------------------------------------------------------------
IRK4_HUMAN/22-377--------------------------------------------------------------------------------
IRK12_HUMAN/47-381--------------------------------------------------------------------------------
IRK15_HUMAN/30-365--------------------------------------------------------------------------------
IRK8_HUMAN/37-380--------------------------------------------------------------------------------
IRK9_HUMAN/25-362--------------------------------------------------------------------------------
IRK2_CAVPO/48-380--------------------------------------------------------------------------------
IRK16_RAT/37-358--------------------------------------------------------------------------------
IRK11_HUMAN/36-366--------------------------------------------------------------------------------

PF00060

GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR34_ARATH/613-869--------------------------------------------------------------------------------
Q9VIA5_DROME/402-665--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
Q8T0V7_DROME/343-610--------------------------------------------------------------------------------
Q9U0T0_LOLOP/568-841--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
Q9VVU7_DROME/338-596--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
GLK1_DROME/610-907--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
NMDZ1_HUMAN/559-824--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR31_ARATH/587-839--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
GLRK_ANAPL/168-431--------------------------------------------------------------------------------
GLRK_XENLA/162-426--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
GRIA2_HUMAN/543-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
Q9VDH5_DROME/545-823--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GRIK2_HUMAN/560-831--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------

PF15249

B5X552_DROME/1418-1521--------------------------------------------------------------------------------
F8NSX7_SERL9/93-213--------------------------------------------------------------------------------
H3AYR2_LATCH/719-823--------------------------------------------------------------------------------
Q55QM7_CRYNB/131-237--------------------------------------------------------------------------------
H2NZE3_PONAB/668-773--------------------------------------------------------------------------------
Q01LC1_ORYSA/286-403--------------------------------------------------------------------------------
Q4RYD4_TETNG/1-136--------------------------------------------------------------------------------
G3HR60_CRIGR/731-835--------------------------------------------------------------------------------
C3Z068_BRAFL/1333-1438--------------------------------------------------------------------------------
A3CH67_ORYSJ/186-306--------------------------------------------------------------------------------
I1LP29_SOYBN/125-245--------------------------------------------------------------------------------
Q7XVN3_ORYSJ/354-483--------------------------------------------------------------------------------
A8PYV1_BRUMA/646-751--------------------------------------------------------------------------------
D8U255_VOLCA/23-147--------------------------------------------------------------------------------
Q9SRQ0_ARATH/121-240--------------------------------------------------------------------------------
F6Q7W8_XENTR/676-780--------------------------------------------------------------------------------
I1PKQ5_ORYGL/94-212--------------------------------------------------------------------------------
I0Z4J2_9CHLO/35-157--------------------------------------------------------------------------------
H2TKN1_TAKRU/1011-1116--------------------------------------------------------------------------------
D6RLC3_COPC7/97-215--------------------------------------------------------------------------------
H3A9A7_LATCH/1063-1168--------------------------------------------------------------------------------
E7FC48_DANRE/828-933--------------------------------------------------------------------------------
B6U5Z5_MAIZE/33-158--------------------------------------------------------------------------------
E2AU32_CAMFO/2003-2108--------------------------------------------------------------------------------
G0NU71_CAEBE/708-810--------------------------------------------------------------------------------
A8X0V1_CAEBR/811-928--------------------------------------------------------------------------------
B3M7G6_DROAN/504-627--------------------------------------------------------------------------------
A6ZJ71_CAEEL/678-780--------------------------------------------------------------------------------
E0VX25_PEDHC/1662-1767--------------------------------------------------------------------------------
F2USU5_SALS5/118-246--------------------------------------------------------------------------------
B8P3G1_POSPM/122-239--------------------------------------------------------------------------------
E9GC12_DAPPU/1239-1344--------------------------------------------------------------------------------
A3ATB4_ORYSJ/289-371--------------------------------------------------------------------------------
A8JDB0_CHLRE/26-151--------------------------------------------------------------------------------
E3M7Z0_CAERE/718-820--------------------------------------------------------------------------------
A9S0J3_PHYPA/54-177--------------------------------------------------------------------------------
E5S5E0_TRISP/368-478--------------------------------------------------------------------------------
C5YEV3_SORBI/36-162--------------------------------------------------------------------------------
B0E0Z3_LACBS/96-216--------------------------------------------------------------------------------
C5KJB2_PERM5/65-165--------------------------------------------------------------------------------
B0WCV5_CULQU/2345-2450--------------------------------------------------------------------------------
D2A445_TRICA/62-167--------------------------------------------------------------------------------
A7USW6_ANOGA/2823-2926--------------------------------------------------------------------------------
E4WWE2_OIKDI/96-202--------------------------------------------------------------------------------
B3RLC8_TRIAD/434-538--------------------------------------------------------------------------------
D8QC90_SCHCM/85-202--------------------------------------------------------------------------------
D2VJE8_NAEGR/329-435--------------------------------------------------------------------------------
E7F8Y0_DANRE/599-703--------------------------------------------------------------------------------
H2WA87_CAEJA/574-676--------------------------------------------------------------------------------
D5AE81_PICSI/102-222--------------------------------------------------------------------------------
A9RCY5_PHYPA/87-211--------------------------------------------------------------------------------
I1BJQ3_RHIO9/247-352--------------------------------------------------------------------------------
F0ZSB4_DICPU/460-585--------------------------------------------------------------------------------
C1EJG7_MICSR/87-216--------------------------------------------------------------------------------

PF02386

O27332_METTH/161-474--------------------------------------------------------------------------------
Y1485_METJA/160-466--------------------------------------------------------------------------------
TRK1_YEAST/763-1173--------------------------------------------------------------------------------
O87729_VIBAL/151-479--------------------------------------------------------------------------------
TRKH_SHIFL/152-481--------------------------------------------------------------------------------
P73949_SYNY3/106-429--------------------------------------------------------------------------------
O74723_NEUCS/406-766--------------------------------------------------------------------------------
NTPJ_ENTHR/117-435--------------------------------------------------------------------------------
Q9HPA9_HALSA/196-554--------------------------------------------------------------------------------
KTRD_BACSU/117-435--------------------------------------------------------------------------------
Q9P8G2_CANAX/615-975--------------------------------------------------------------------------------
O59477_PYRHO/169-489--------------------------------------------------------------------------------
Q41515_WHEAT/178-533--------------------------------------------------------------------------------
TRKG_ECOLI/155-483--------------------------------------------------------------------------------
TRK2_SCHPO/479-850--------------------------------------------------------------------------------
Y322_MYCGE/143-543--------------------------------------------------------------------------------
O87953_VIBAL/125-442--------------------------------------------------------------------------------
O67474_AQUAE/108-430--------------------------------------------------------------------------------
KTRB_BACSU/117-432--------------------------------------------------------------------------------
O29419_ARCFU/149-474--------------------------------------------------------------------------------
Y460_MYCPN/151-550--------------------------------------------------------------------------------
TRK2_YEAST/450-839--------------------------------------------------------------------------------
TRK1_SCHPO/454-809--------------------------------------------------------------------------------
TRKH_HAEIN/152-485--------------------------------------------------------------------------------
Q9P851_SCHOC/570-932--------------------------------------------------------------------------------
O83176_TREPA/234-561--------------------------------------------------------------------------------

PF03814

ATKA1_STAAM/3-556--------------------------------------------------------------------------------
ATKA_ANASL/8-556--------------------------------------------------------------------------------
ATKA_HALSA/10-579--------------------------------------------------------------------------------
ATKA_RHILO/9-560--------------------------------------------------------------------------------
ATKA_ALIAD/9-560--------------------------------------------------------------------------------
ATKA_MYCTU/9-569--------------------------------------------------------------------------------
ATKA_PSEAE/9-561--------------------------------------------------------------------------------
ATKA_THEAC/27-578--------------------------------------------------------------------------------
ATKA_CAUCR/9-561--------------------------------------------------------------------------------
ATKA_ECOLI/9-557--------------------------------------------------------------------------------
ATKA_STRCO/11-553--------------------------------------------------------------------------------
ATKA_SYNY3/8-556--------------------------------------------------------------------------------
ATKA_DEIRA/8-560--------------------------------------------------------------------------------
ATKA_CLOAB/6-556--------------------------------------------------------------------------------

PF08016

PKD1_MOUSE/3701-4103VYD.SGGYIQ.ELG.LSLEESRARLGFLQLHNWLDSRSRAVFVELTRYSPAVGLHAAVTLRLEFPVAGHALAAFSVRPFA
PKD2_MOUSE/265-685SYS.GAGYYL.DLS.RTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVK
Q15142_HUMAN/3046-3448VYD.SGGYVQ.ELG.LSLEESRDRLRFLQLHNWLDNRSRAVFLELTRYSPAVGLHAAVTLRLEFPAAGRALAALSVRPFA
Q8T8Z2_DROME/169-596NYPEVAGYVV.LMM.STKINCLKQIEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQLPRVHVDSVS
O42181_TAKRU/3850-4245AND.SRDV.......LQLRSLGEAFSSLQQHHWLDQRTRAVVVEFSLYNINTNLLAVFSFLIEFPVSDRALSSMDLHVIT
PKDRE_MOUSE/1621-2051TYG.SGGYVFYFFPGQQMFNSTVRLKELEGKNWLDELTWAVIVELTTLNPDTSLMCSISVVFEVSPLGVVNSSLSVYSFS
Q95V80_STRPU/2211-2645SLP.SSGYIW.VLG.SMYEEAKDSLAEMVDARWLDARTRALFVEWTSYNANTNLFCVVTFLMETPASGGLLKLPEVQAVR
PKD2_CAEEL/119-538SYG.GGGFVQ.RLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTPKLMTYD
Q80ZH4_MOUSE/145-567SYS.GGGYYL.DLP.GSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVK
Q9VVZ8_DROME/165-591NYPESKGYKV.LLS.DTRHKSLKIIDYLMKKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQYPDGHTRIESHT
PKDRE_HUMAN/1748-2178TYG.SGGYALYFFPEQQRFNSTLRLKELQESNWLDEKTWAVVLELTTFNPDINLFCSISVIFEVSQLGVVNTSISLHSFS
Q9VK95_DROME/402-803FYR.TGGYTV.NLD.YDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTVK
Q9U1K9_DROME/160-576SYPELAGYVS.LLA.RSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYN............VDKTPFGGIVPDVQVDSAK

PF00520

KCNS1_MOUSE/243-427--------------------------------------------------------------------------------
KCNAL_DROME/231-405--------------------------------------------------------------------------------
TRPC6_MOUSE/495-726--------------------------------------------------------------------------------
TRPA1_HUMAN/775-960--------------------------------------------------------------------------------
CAC1C_HUMAN/161-404--------------------------------------------------------------------------------
CAC1C_HUMAN/558-752--------------------------------------------------------------------------------
CAC1C_HUMAN/955-1185--------------------------------------------------------------------------------
CAC1C_HUMAN/1273-1523--------------------------------------------------------------------------------
KCNS3_HUMAN/224-405--------------------------------------------------------------------------------
ITPR1_MOUSE/2362-2588--------------------------------------------------------------------------------
TRPC3_HUMAN/427-658--------------------------------------------------------------------------------
KAT2_ARATH/93-295--------------------------------------------------------------------------------
SCN4A_HUMAN/159-446--------------------------------------------------------------------------------
KCNQ4_HUMAN/134-318--------------------------------------------------------------------------------
SCN7A_HUMAN/146-393--------------------------------------------------------------------------------
SCN7A_HUMAN/539-728--------------------------------------------------------------------------------
SCN7A_HUMAN/970-1192--------------------------------------------------------------------------------
SCN7A_HUMAN/1285-1495--------------------------------------------------------------------------------
ITPR2_HUMAN/2317-2540--------------------------------------------------------------------------------
TRPC2_MOUSE/704-920--------------------------------------------------------------------------------
CAC1E_HUMAN/1512-1722--------------------------------------------------------------------------------
TRPA1_CAEEL/873-1068--------------------------------------------------------------------------------
TRPA1_DROME/932-1126--------------------------------------------------------------------------------
CAC1F_HUMAN/129-371--------------------------------------------------------------------------------
TRPM1_HUMAN/862-1075--------------------------------------------------------------------------------
KCNA1_HUMAN/223-407--------------------------------------------------------------------------------
CAC1S_HUMAN/88-333--------------------------------------------------------------------------------
CAC1S_HUMAN/466-660--------------------------------------------------------------------------------
CAC1S_HUMAN/834-1064--------------------------------------------------------------------------------
SCN5A_HUMAN/159-412--------------------------------------------------------------------------------
SCN5A_HUMAN/1241-1469--------------------------------------------------------------------------------
SCN5A_HUMAN/1562-1771--------------------------------------------------------------------------------
KCMA1_RAT/217-388--------------------------------------------------------------------------------
Q9W433_DROME/339-611--------------------------------------------------------------------------------
Q9W433_DROME/1265-1459--------------------------------------------------------------------------------
Q9W433_DROME/2181-2406--------------------------------------------------------------------------------
NALCN_RAT/73-321--------------------------------------------------------------------------------
NALCN_RAT/420-598--------------------------------------------------------------------------------
NALCN_RAT/920-1155--------------------------------------------------------------------------------
NALCN_RAT/1243-1446--------------------------------------------------------------------------------
TPC1_ARATH/154-304--------------------------------------------------------------------------------
TPC1_ARATH/466-671--------------------------------------------------------------------------------
TRPM2_HUMAN/830-1048--------------------------------------------------------------------------------
SCNA_DROME/180-428--------------------------------------------------------------------------------
SCNA_DROME/1337-1559--------------------------------------------------------------------------------
SCNA_DROME/1653-1859--------------------------------------------------------------------------------
SCNBA_HUMAN/611-810--------------------------------------------------------------------------------
SLO_DROME/166-336--------------------------------------------------------------------------------
Q20766_CAEEL/931-1129--------------------------------------------------------------------------------
TPC1_HUMAN/142-319--------------------------------------------------------------------------------
TPC1_HUMAN/477-686--------------------------------------------------------------------------------
Q18351_CAEEL/295-478--------------------------------------------------------------------------------
TRPV2_MOUSE/441-640--------------------------------------------------------------------------------
CAC1A_DROME/1129-1336--------------------------------------------------------------------------------
CAC1A_HUMAN/135-359--------------------------------------------------------------------------------
CAC1A_HUMAN/1279-1510--------------------------------------------------------------------------------
CAC1A_HUMAN/1600-1810--------------------------------------------------------------------------------
O02037_BDECA/160-406--------------------------------------------------------------------------------
O02037_BDECA/1022-1247--------------------------------------------------------------------------------
O02037_BDECA/1341-1543--------------------------------------------------------------------------------
O02038_CYACP/150-380--------------------------------------------------------------------------------
O02038_CYACP/531-726--------------------------------------------------------------------------------
O02038_CYACP/904-1135--------------------------------------------------------------------------------
O02038_CYACP/1223-1425--------------------------------------------------------------------------------
O04242_MAIZE/98-298--------------------------------------------------------------------------------
O04703_SOLTU/123-326--------------------------------------------------------------------------------
SCN9A_RAT/154-401--------------------------------------------------------------------------------
O08661_RAT/376-542--------------------------------------------------------------------------------
O13054_MAKNI/4820-4980--------------------------------------------------------------------------------
CCH1_SCHPO/218-481--------------------------------------------------------------------------------
CCH1_SCHPO/550-743--------------------------------------------------------------------------------
CCH1_SCHPO/982-1212--------------------------------------------------------------------------------
CCH1_SCHPO/1302-1505--------------------------------------------------------------------------------
O17535_CAEEL/261-439--------------------------------------------------------------------------------
O18324_BLAGE/4-195--------------------------------------------------------------------------------
TRPC1_BOVIN/457-645--------------------------------------------------------------------------------
KCNH1_BOVIN/252-498--------------------------------------------------------------------------------
O24382_SOLTU/97-297--------------------------------------------------------------------------------
O24538_VICFA/90-293--------------------------------------------------------------------------------
TRPC4_RAT/436-620--------------------------------------------------------------------------------
KCNS2_MOUSE/229-409--------------------------------------------------------------------------------
CAC1S_CHICK/92-278--------------------------------------------------------------------------------
O42421_CHICK/5-206--------------------------------------------------------------------------------
KCNQ3_HUMAN/158-351--------------------------------------------------------------------------------
KCNQ2_HUMAN/128-312--------------------------------------------------------------------------------
O44164_CAEEL/265-484--------------------------------------------------------------------------------
O44930_AIPPA/138-380--------------------------------------------------------------------------------
O44930_AIPPA/657-846--------------------------------------------------------------------------------
O44930_AIPPA/1083-1306--------------------------------------------------------------------------------
O44930_AIPPA/1402-1607--------------------------------------------------------------------------------
O46129_LOLFO/396-624--------------------------------------------------------------------------------
SCNAA_CANFA/155-405--------------------------------------------------------------------------------
SCNAA_CANFA/708-898--------------------------------------------------------------------------------
SCNAA_CANFA/1195-1424--------------------------------------------------------------------------------
O49846_9LILI/11-193--------------------------------------------------------------------------------
O54812_CAVPO/76-278--------------------------------------------------------------------------------
KCNH6_RAT/302-515--------------------------------------------------------------------------------
CAC1G_RAT/119-394--------------------------------------------------------------------------------
CAC1G_RAT/778-964--------------------------------------------------------------------------------
CAC1G_RAT/1291-1515--------------------------------------------------------------------------------
CAC1G_RAT/1613-1818--------------------------------------------------------------------------------
CAC1S_LITCT/88-331--------------------------------------------------------------------------------
CAC1S_LITCT/465-659--------------------------------------------------------------------------------
O61220_CAEEL/521-763--------------------------------------------------------------------------------
O61567_HOMAM/1241-1406--------------------------------------------------------------------------------
O62604_POLPE/521-713--------------------------------------------------------------------------------
O62604_POLPE/945-1166--------------------------------------------------------------------------------
O62604_POLPE/1260-1469--------------------------------------------------------------------------------
TRPC2_BOVIN/6-182--------------------------------------------------------------------------------
TRPC5_RABIT/405-624--------------------------------------------------------------------------------
O65816_HORVU/144-390--------------------------------------------------------------------------------
O70368_RAT/6-196--------------------------------------------------------------------------------
HCN4_MOUSE/297-513--------------------------------------------------------------------------------
KCNG2_CHICK/260-452--------------------------------------------------------------------------------
O73697_TAKRU/474-668--------------------------------------------------------------------------------
O73697_TAKRU/1162-1386--------------------------------------------------------------------------------
CAC1D_CHICK/158-400--------------------------------------------------------------------------------
CAC1D_CHICK/1260-1492--------------------------------------------------------------------------------
O76266_HIRME/254-434--------------------------------------------------------------------------------
O76457_APLCA/233-409--------------------------------------------------------------------------------
O77089_PANAR/2376-2612--------------------------------------------------------------------------------
CNGC6_ARATH/157-431--------------------------------------------------------------------------------
SCN8A_RAT/1232-1461--------------------------------------------------------------------------------
SCNBA_RAT/158-394--------------------------------------------------------------------------------
SCNBA_RAT/606-797--------------------------------------------------------------------------------
SCNBA_RAT/1070-1287--------------------------------------------------------------------------------
SCNBA_RAT/1380-1583--------------------------------------------------------------------------------
HCN2_MOUSE/219-431--------------------------------------------------------------------------------
HCN1_MOUSE/166-382--------------------------------------------------------------------------------
KCNH3_RAT/273-507--------------------------------------------------------------------------------
CAC1H_HUMAN/138-418--------------------------------------------------------------------------------
O96057_HALRO/84-316--------------------------------------------------------------------------------
O96057_HALRO/463-658--------------------------------------------------------------------------------
O96057_HALRO/839-1070--------------------------------------------------------------------------------
O96057_HALRO/1158-1372--------------------------------------------------------------------------------
O96310_HELVI/265-424--------------------------------------------------------------------------------
O96385_PARTE/190-371--------------------------------------------------------------------------------
O97017_9CNID/118-350--------------------------------------------------------------------------------
O97017_9CNID/503-698--------------------------------------------------------------------------------
O97017_9CNID/885-1115--------------------------------------------------------------------------------
O97017_9CNID/1203-1410--------------------------------------------------------------------------------
SCNA_ELEEL/150-401--------------------------------------------------------------------------------
SCNA_ELEEL/600-789--------------------------------------------------------------------------------
SCNA_ELEEL/1036-1263--------------------------------------------------------------------------------
SCNA_ELEEL/1356-1566--------------------------------------------------------------------------------
SCN1A_RAT/156-422--------------------------------------------------------------------------------
SCN1A_RAT/802-991--------------------------------------------------------------------------------
SCN1A_RAT/1254-1482--------------------------------------------------------------------------------
CAC1S_RABIT/1152-1380--------------------------------------------------------------------------------
KCNAS_DROME/281-477--------------------------------------------------------------------------------
SCN5A_RAT/752-941--------------------------------------------------------------------------------
KCNA6_RAT/266-458--------------------------------------------------------------------------------
KCNAB_DROME/476-658--------------------------------------------------------------------------------
KCNAW_DROME/233-412--------------------------------------------------------------------------------
CAC1S_CYPCA/107-350--------------------------------------------------------------------------------
CAC1S_CYPCA/481-675--------------------------------------------------------------------------------
CAC1S_CYPCA/850-1080--------------------------------------------------------------------------------
CAC1S_CYPCA/1168-1401--------------------------------------------------------------------------------
ITPR_DROME/2410-2680--------------------------------------------------------------------------------
SCN1A_HUMAN/1575-1785--------------------------------------------------------------------------------
TRPL_DROME/432-668--------------------------------------------------------------------------------
CCH1_YEAST/804-998--------------------------------------------------------------------------------
CCH1_YEAST/1244-1472--------------------------------------------------------------------------------
CCH1_YEAST/1563-1767--------------------------------------------------------------------------------
KCNQ1_HUMAN/158-347--------------------------------------------------------------------------------
CAC1A_RAT/523-715--------------------------------------------------------------------------------
CNG_ICTPU/175-364--------------------------------------------------------------------------------
CAC1B_DISOM/1502-1704--------------------------------------------------------------------------------
CAC1E_DISOM/139-362--------------------------------------------------------------------------------
CAC1E_DISOM/1140-1373--------------------------------------------------------------------------------
CAC1E_DISOM/1463-1662--------------------------------------------------------------------------------
P90670_APLCA/165-419--------------------------------------------------------------------------------
P90670_APLCA/788-983--------------------------------------------------------------------------------
P90670_APLCA/1214-1440--------------------------------------------------------------------------------
P90670_APLCA/1534-1731--------------------------------------------------------------------------------
P91256_CAEEL/249-433--------------------------------------------------------------------------------
CAC1A_DROME/75-312--------------------------------------------------------------------------------
CAC1A_DROME/475-666--------------------------------------------------------------------------------
CAC1A_DROME/804-1039--------------------------------------------------------------------------------
P91744_LOLBL/102-336--------------------------------------------------------------------------------
P91744_LOLBL/515-708--------------------------------------------------------------------------------
P91744_LOLBL/930-1162--------------------------------------------------------------------------------
P91744_LOLBL/1252-1456--------------------------------------------------------------------------------
P91783_POLPE/220-401--------------------------------------------------------------------------------
P91784_POLPE/242-415--------------------------------------------------------------------------------
KAT3_ARATH/120-324--------------------------------------------------------------------------------
KCNV1_RAT/247-430--------------------------------------------------------------------------------
P97706_RAT/146-393--------------------------------------------------------------------------------
P97706_RAT/561-749--------------------------------------------------------------------------------
P97706_RAT/991-1213--------------------------------------------------------------------------------
CNGA1_BOVIN/200-394--------------------------------------------------------------------------------
CAC1D_HUMAN/921-1151--------------------------------------------------------------------------------
KCNAE_DROME/272-488--------------------------------------------------------------------------------
CNGA2_BOVIN/177-371--------------------------------------------------------------------------------
CNG_CAEEL/206-410--------------------------------------------------------------------------------
SCN1_LOLBL/80-333--------------------------------------------------------------------------------
SCN1_LOLBL/445-628--------------------------------------------------------------------------------
SCN1_LOLBL/818-1040--------------------------------------------------------------------------------
SCN1_LOLBL/1135-1350--------------------------------------------------------------------------------
Q09658_CAEEL/273-452--------------------------------------------------------------------------------
KCNH2_HUMAN/454-659--------------------------------------------------------------------------------
Q16976_APLCA/270-457--------------------------------------------------------------------------------
Q17314_CYACP/168-407--------------------------------------------------------------------------------
Q17314_CYACP/544-733--------------------------------------------------------------------------------
Q17314_CYACP/1000-1219--------------------------------------------------------------------------------
Q17314_CYACP/1313-1524--------------------------------------------------------------------------------
Q17354_CAEEL/44-236--------------------------------------------------------------------------------
Q17354_CAEEL/376-611--------------------------------------------------------------------------------
Q17354_CAEEL/701-908--------------------------------------------------------------------------------
Q19464_CAEEL/235-414--------------------------------------------------------------------------------
Q23974_DROME/300-504--------------------------------------------------------------------------------
CAC1D_DROME/652-877--------------------------------------------------------------------------------
CAC1D_DROME/1019-1214--------------------------------------------------------------------------------
CAC1D_DROME/1379-1609--------------------------------------------------------------------------------
CAC1D_DROME/1697-1925--------------------------------------------------------------------------------
CNG_DROME/144-346--------------------------------------------------------------------------------
Q25150_HALRO/156-465--------------------------------------------------------------------------------
Q25150_HALRO/833-1021--------------------------------------------------------------------------------
Q25150_HALRO/1297-1535--------------------------------------------------------------------------------
Q25150_HALRO/1628-1838--------------------------------------------------------------------------------
Q25376_LOLOP/220-403--------------------------------------------------------------------------------
Q25377_LOLOP/158-400--------------------------------------------------------------------------------
Q25377_LOLOP/626-812--------------------------------------------------------------------------------
Q25377_LOLOP/1059-1284--------------------------------------------------------------------------------
Q25377_LOLOP/1378-1588--------------------------------------------------------------------------------
CAC1M_MUSDO/1143-1366--------------------------------------------------------------------------------
Q26039_PANIN/184-355--------------------------------------------------------------------------------
Q26094_POLPE/225-397--------------------------------------------------------------------------------
Q26095_POLPE/223-398--------------------------------------------------------------------------------
Q26344_APLSP/357-539--------------------------------------------------------------------------------
Q27170_PARTE/196-376--------------------------------------------------------------------------------
CNGB1_BOVIN/807-993--------------------------------------------------------------------------------
SCN4A_HORSE/606-795--------------------------------------------------------------------------------
SCN4A_HORSE/1064-1291--------------------------------------------------------------------------------
AKT2_ARATH/110-312--------------------------------------------------------------------------------
AKT1_ARATH/91-288--------------------------------------------------------------------------------
Q41461_SOLTU/95-299--------------------------------------------------------------------------------
Q63541_RAT/162-411--------------------------------------------------------------------------------
CNGA4_RAT/71-265--------------------------------------------------------------------------------
Q90518_TAKRU/157-415--------------------------------------------------------------------------------
Q90519_TAKRU/5-205--------------------------------------------------------------------------------
CNG1_CHICK/247-441--------------------------------------------------------------------------------
Q93135_BLAGE/4-216--------------------------------------------------------------------------------
TRPG_CAEEL/1341-1555--------------------------------------------------------------------------------
Q94447_CALVI/422-658--------------------------------------------------------------------------------
SLO1_CAEEL/180-351--------------------------------------------------------------------------------
KCNH5_RAT/249-467--------------------------------------------------------------------------------
KCNF1_HUMAN/224-405--------------------------------------------------------------------------------
SKOR_ARATH/116-328--------------------------------------------------------------------------------
SCN3A_HUMAN/156-423--------------------------------------------------------------------------------
Q9PRI8_XENLA/442-630--------------------------------------------------------------------------------
KCNH8_RAT/269-473--------------------------------------------------------------------------------
TRPV2_RAT/446-645--------------------------------------------------------------------------------
TRPV6_RAT/395-577--------------------------------------------------------------------------------
KCNH4_RAT/276-479--------------------------------------------------------------------------------
Q9RW39_DEIRA/69-240--------------------------------------------------------------------------------
CNGC7_ARATH/145-419--------------------------------------------------------------------------------
AKT5_ARATH/112-312--------------------------------------------------------------------------------
CNG14_ARATH/128-398--------------------------------------------------------------------------------
CNGC3_ARATH/130-394--------------------------------------------------------------------------------
Q9SM12_MAIZE/104-307--------------------------------------------------------------------------------
CNG16_ARATH/98-374--------------------------------------------------------------------------------
Q9U5E2_DROME/162-353--------------------------------------------------------------------------------
SCNBA_HUMAN/161-399--------------------------------------------------------------------------------
SCNBA_HUMAN/1092-1307--------------------------------------------------------------------------------
SCNBA_HUMAN/1400-1603--------------------------------------------------------------------------------
KCNG1_HUMAN/270-459--------------------------------------------------------------------------------
Q9VHY7_DROME/610-800--------------------------------------------------------------------------------
TRPG_DROME/412-652--------------------------------------------------------------------------------
Q9VUD5_DROME/520-718--------------------------------------------------------------------------------
Q9VW35_DROME/377-569--------------------------------------------------------------------------------
PYX_DROME/536-723--------------------------------------------------------------------------------
PAIN_DROME/531-734--------------------------------------------------------------------------------
Q9W2D5_DROME/505-692--------------------------------------------------------------------------------
Q9W3W0_DROME/513-653--------------------------------------------------------------------------------
Q9XH40_SAMSA/112-315--------------------------------------------------------------------------------
TRPV5_RABIT/393-578--------------------------------------------------------------------------------
Q9XSP9_RABIT/139-264--------------------------------------------------------------------------------
Q9XWG9_CAEEL/112-301--------------------------------------------------------------------------------
Q9XXD1_CAEEL/281-465--------------------------------------------------------------------------------
Q9XZC1_BOOMI/498-721--------------------------------------------------------------------------------
Q9XZC1_BOOMI/815-1019--------------------------------------------------------------------------------
TRPV2_HUMAN/444-645--------------------------------------------------------------------------------
CAC1I_RAT/115-395--------------------------------------------------------------------------------
Q9ZPL4_SAMSA/115-318--------------------------------------------------------------------------------

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
Q94253_CAEEL/253-318--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC72_LEIMA/202-273--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O82065_SOLTU/193-268--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRAJA/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8AVI5_XENLA/81-158--------------------------------------------------------------------------------
Q8AVI5_XENLA/191-273--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DAL9_VIBVU/25-105--------------------------------------------------------------------------------
Q8DF13_VIBVU/235-325--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8I6M6_APLCA/77-154--------------------------------------------------------------------------------
Q8J0H6_NEUCS/369-447--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8PI92_XANAC/49-128--------------------------------------------------------------------------------
Q8PT60_METMA/20-95--------------------------------------------------------------------------------
Q8QZZ6_CAVPO/69-146--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8X557_ECO57/148-226--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
Q90ZP4_ONCMY/461-543--------------------------------------------------------------------------------
Q920B6_RAT/120-198--------------------------------------------------------------------------------
Q924I4_RAT/64-145--------------------------------------------------------------------------------
Q924I4_RAT/180-260--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93531_CAEEL/115-196--------------------------------------------------------------------------------
Q93531_CAEEL/236-312--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9AR58_SOLTU/72-154--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9CX88_MOUSE/130-208--------------------------------------------------------------------------------
Q9ERU4_RAT/46-128--------------------------------------------------------------------------------
Q9ERU5_RAT/65-147--------------------------------------------------------------------------------
Q9ESM4_RAT/55-138--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9LLM5_EUCCA/71-153--------------------------------------------------------------------------------
Q9LLM5_EUCCA/192-267--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9V1D2_PYRAB/403-481--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
Q9ZP53_SOLTU/193-268--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/72-154--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/193-268--------------------------------------------------------------------------------

PF01007

IRK5_HUMAN/54-390----------------------------------------------------------------MEKSGKCNVHHGNVQ.
IRK10_HUMAN/31-369----------------------------------------------------------------LTKDGRSNVRMEHIAD
IRK1_CAEEL/77-422----------------------------------------------------------------VGKNGICNVYNTNVPK
IRK1_HUMAN/43-380----------------------------------------------------------------VSKDGRCNIEFGNVEA
IRK3_CHICK/39-385----------------------------------------------------------------VDKNGRCNVQHGNLGG
IRK4_HUMAN/22-377----------------------------------------------------------------VKKNGQCNVYFANLSN
IRK12_HUMAN/47-381----------------------------------------------------------------VKKNGQCNIEFANMDE
IRK15_HUMAN/30-365----------------------------------------------------------------MSKSGHSNVRIDKVDG
IRK8_HUMAN/37-380----------------------------------------------------------------IAKSGACNLAHKNIR.
IRK9_HUMAN/25-362----------------------------------------------------------------VEKDGRCNVQQGNVR.
IRK2_CAVPO/48-380----------------------------------------------------------------VKKDGHCNVQFINVGE
IRK16_RAT/37-358----------------------------------------------------------------LHKDGSCNVYFKHIFG
IRK11_HUMAN/36-366----------------------------------------------------------------VSKKGNCNVAHKNIR.

PF00060

GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR34_ARATH/613-869--------------------------------------------------------------------------------
Q9VIA5_DROME/402-665--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
Q8T0V7_DROME/343-610--------------------------------------------------------------------------------
Q9U0T0_LOLOP/568-841--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
Q9VVU7_DROME/338-596--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
GLK1_DROME/610-907--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
NMDZ1_HUMAN/559-824--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR31_ARATH/587-839--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
GLRK_ANAPL/168-431--------------------------------------------------------------------------------
GLRK_XENLA/162-426--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
GRIA2_HUMAN/543-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
Q9VDH5_DROME/545-823--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GRIK2_HUMAN/560-831--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------

PF15249

B5X552_DROME/1418-1521--------------------------------------------------------------------------------
F8NSX7_SERL9/93-213--------------------------------------------------------------------------------
H3AYR2_LATCH/719-823--------------------------------------------------------------------------------
Q55QM7_CRYNB/131-237--------------------------------------------------------------------------------
H2NZE3_PONAB/668-773--------------------------------------------------------------------------------
Q01LC1_ORYSA/286-403--------------------------------------------------------------------------------
Q4RYD4_TETNG/1-136--------------------------------------------------------------------------------
G3HR60_CRIGR/731-835--------------------------------------------------------------------------------
C3Z068_BRAFL/1333-1438--------------------------------------------------------------------------------
A3CH67_ORYSJ/186-306--------------------------------------------------------------------------------
I1LP29_SOYBN/125-245--------------------------------------------------------------------------------
Q7XVN3_ORYSJ/354-483--------------------------------------------------------------------------------
A8PYV1_BRUMA/646-751--------------------------------------------------------------------------------
D8U255_VOLCA/23-147--------------------------------------------------------------------------------
Q9SRQ0_ARATH/121-240--------------------------------------------------------------------------------
F6Q7W8_XENTR/676-780--------------------------------------------------------------------------------
I1PKQ5_ORYGL/94-212--------------------------------------------------------------------------------
I0Z4J2_9CHLO/35-157--------------------------------------------------------------------------------
H2TKN1_TAKRU/1011-1116--------------------------------------------------------------------------------
D6RLC3_COPC7/97-215--------------------------------------------------------------------------------
H3A9A7_LATCH/1063-1168--------------------------------------------------------------------------------
E7FC48_DANRE/828-933--------------------------------------------------------------------------------
B6U5Z5_MAIZE/33-158--------------------------------------------------------------------------------
E2AU32_CAMFO/2003-2108--------------------------------------------------------------------------------
G0NU71_CAEBE/708-810--------------------------------------------------------------------------------
A8X0V1_CAEBR/811-928--------------------------------------------------------------------------------
B3M7G6_DROAN/504-627--------------------------------------------------------------------------------
A6ZJ71_CAEEL/678-780--------------------------------------------------------------------------------
E0VX25_PEDHC/1662-1767--------------------------------------------------------------------------------
F2USU5_SALS5/118-246--------------------------------------------------------------------------------
B8P3G1_POSPM/122-239--------------------------------------------------------------------------------
E9GC12_DAPPU/1239-1344--------------------------------------------------------------------------------
A3ATB4_ORYSJ/289-371--------------------------------------------------------------------------------
A8JDB0_CHLRE/26-151--------------------------------------------------------------------------------
E3M7Z0_CAERE/718-820--------------------------------------------------------------------------------
A9S0J3_PHYPA/54-177--------------------------------------------------------------------------------
E5S5E0_TRISP/368-478--------------------------------------------------------------------------------
C5YEV3_SORBI/36-162--------------------------------------------------------------------------------
B0E0Z3_LACBS/96-216--------------------------------------------------------------------------------
C5KJB2_PERM5/65-165--------------------------------------------------------------------------------
B0WCV5_CULQU/2345-2450--------------------------------------------------------------------------------
D2A445_TRICA/62-167--------------------------------------------------------------------------------
A7USW6_ANOGA/2823-2926--------------------------------------------------------------------------------
E4WWE2_OIKDI/96-202--------------------------------------------------------------------------------
B3RLC8_TRIAD/434-538--------------------------------------------------------------------------------
D8QC90_SCHCM/85-202--------------------------------------------------------------------------------
D2VJE8_NAEGR/329-435--------------------------------------------------------------------------------
E7F8Y0_DANRE/599-703--------------------------------------------------------------------------------
H2WA87_CAEJA/574-676--------------------------------------------------------------------------------
D5AE81_PICSI/102-222--------------------------------------------------------------------------------
A9RCY5_PHYPA/87-211--------------------------------------------------------------------------------
I1BJQ3_RHIO9/247-352--------------------------------------------------------------------------------
F0ZSB4_DICPU/460-585--------------------------------------------------------------------------------
C1EJG7_MICSR/87-216--------------------------------------------------------------------------------

PF02386

O27332_METTH/161-474--------------------------------------------TAASRLYKSEARDE----------------------
Y1485_METJA/160-466--------------------------------------------TVAYLLYTSEARQE----------------------
TRK1_YEAST/763-1173--------------------------------------------ELGGVEYRAIKLLC----------------------
O87729_VIBAL/151-479--------------------------------------------MLNVGGMKLFQTES----------------------
TRKH_SHIFL/152-481--------------------------------------------ILGVGGMQLYRAEM----------------------
P73949_SYNY3/106-429--------------------------------------------SFDHRFAQGSNNLI----------------------
O74723_NEUCS/406-766--------------------------------------------ELGGIEYRVLKLLQ----------------------
NTPJ_ENTHR/117-435--------------------------------------------ALNLEEMSGVIKLM----------------------
Q9HPA9_HALSA/196-554--------------------------------------------SGSYALYRSEAREK----------------------
KTRD_BACSU/117-435--------------------------------------------DQNQSQFSGIVNLM----------------------
Q9P8G2_CANAX/615-975--------------------------------------------ELGGIEYRAVKLLI----------------------
O59477_PYRHO/169-489--------------------------------------------VAAARLYRAEARTE----------------------
Q41515_WHEAT/178-533--------------------------------------------CTELKRSRSVKCLG----------------------
TRKG_ECOLI/155-483--------------------------------------------LLGIGGAKLYQSEM----------------------
TRK2_SCHPO/479-850--------------------------------------------ELAGIEYESLRILT----------------------
Y322_MYCGE/143-543--------------------------------------------ERGGSKLGNTSEMI----------------------
O87953_VIBAL/125-442--------------------------------------------ALGQERQVNLRRLV----------------------
O67474_AQUAE/108-430--------------------------------------------SLEYPSMHGLIRFL----------------------
KTRB_BACSU/117-432--------------------------------------------ALNQPTIGGVIGLV----------------------
O29419_ARCFU/149-474--------------------------------------------NVAKRSTVLFQAEY----------------------
Y460_MYCPN/151-550--------------------------------------------ERGGSKLGTTSEMI----------------------
TRK2_YEAST/450-839--------------------------------------------ELGGVEYRALRLLC----------------------
TRK1_SCHPO/454-809--------------------------------------------ELGGIEYRALKCVC----------------------
TRKH_HAEIN/152-485--------------------------------------------LLGIGGTQLYRAES----------------------
Q9P851_SCHOC/570-932--------------------------------------------ELGGVEYRAIKLLI----------------------
O83176_TREPA/234-561--------------------------------------------LVSDSDMGSLSHNL----------------------

PF03814

ATKA1_STAAM/3-556-------------------------------IILFLTMMVMITYVFSGYLYRVALVQS.............SRVDLIFTR
ATKA_ANASL/8-556-------------------------------IGLTLCIVIAITPVLGRYIARVFLEER.............TILDPLMNP
ATKA_HALSA/10-579-------------------------------YAVFFTILAVLVFVAGEYLAWVYREQANSDHRPPGYLSWFERLDEIFTP
ATKA_RHILO/9-560-------------------------------ILVFCGIIGLLTKPLGFYMHRVFNGDR.............TPLSPIFGP
ATKA_ALIAD/9-560-------------------------------IFLVVLALVACAWPLGGYIYRTFVGER.............VRPDAVMVP
ATKA_MYCTU/9-569-------------------------------FAALIAVLLLTAPALGGYLAKIYGDEAK............KPGDRVFGP
ATKA_PSEAE/9-561-------------------------------ILAFFALVLVPAPFLGRYCFKVMEGQR.............NLLSAPLAP
ATKA_THEAC/27-578-------------------------------ILIYLIIASVLAYILSFHIAKIYLDEK.............TVFSKITGR
ATKA_CAUCR/9-561-------------------------------IALTLSLAVAIGWPLGVFLSRVWNGEK.............TFLDPVMRP
ATKA_ECOLI/9-557-------------------------------IATFLLVLMVLARPLGSGLARLIN................DIPLPGTTG
ATKA_STRCO/11-553-------------------------------LLALTAALALAHVPLGNYLARVYSSPK...............HLR....
ATKA_SYNY3/8-556-------------------------------IALILAILVATAPLLGRYMARVFLGQS.............TWLDKIARP
ATKA_DEIRA/8-560-------------------------------FVVLLGVMAALVVPVGNWLYGVATGQK...................DTA
ATKA_CLOAB/6-556-------------------------------IAIILIVFVLLCIPIGRYMYKVSEHKK.............TLLDPVLDK

PF08016

PKD1_MOUSE/3701-4103LRRLSTGLSLPLLT.SVCLLLFALYFSMAEVQTWRKDGC-----------------------------------------
PKD2_MOUSE/265-685LIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHR.-----------------------------------------
Q15142_HUMAN/3046-3448LRRLSAGLSLPLLT.SVCLLLFAVHFAVAEARTWHREGR-----------------------------------------
Q8T8Z2_DROME/169-596MLGNVETRSNSELLILFVYTVLVILFARGVFTKIWHH..-----------------------------------------
O42181_TAKRU/3850-4245LWPF.TGLDLQLLL.TIILLALVLYFLVPGVTGFLREG.-----------------------------------------
PKDRE_MOUSE/1621-2051LADFNRKTSSEIYL.YAAILIFFCAYVVDEGYIIRQER.-----------------------------------------
Q95V80_STRPU/2211-2645LHRYAANYKLFVILCEILFVVALFFVMYREYVRYKPIGI-----------------------------------------
PKD2_CAEEL/119-538LLTYQTSGGTRMMIFEGIFCGFILYFIFEELFAIGRHR.-----------------------------------------
Q80ZH4_MOUSE/145-567LIRYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHR.-----------------------------------------
Q9VVZ8_DROME/165-591FVEQLREFTKFGMLMVFVFVVTWLQFTKAFFLKVWYD..-----------------------------------------
PKDRE_HUMAN/1748-2178LADFDRKASAEIYL.YVAILIFFLAYVVDEGCIIMQER.-----------------------------------------
Q9VK95_DROME/402-803MYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGI-----------------------------------------
Q9U1K9_DROME/160-576LLENVDQMPYTGLLALLIYVLVFIQFAQTLAVKLWYE..-----------------------------------------

PF00520

KCNS1_MOUSE/243-427----------------RLEYFCIAWFSFEVSSRLLLAPST..-----------------------------------...
KCNAL_DROME/231-405----------------CLDTACVMIFTAEYLLRLFAAPDR..-----------------------------------...
TRPC6_MOUSE/495-726----------------MLIISWVIGMIWAECKEIWTQGP...-----------------------------------...
TRPA1_HUMAN/775-960----------------ILVFLSSIFGYCKEAGQIFQQK....-----------------------------------...
CAC1C_HUMAN/161-404----------------RVEYLFLIIFTVEAFLKVIAYGLLF.-----------------------------------...
CAC1C_HUMAN/558-752----------------TANKALLALFTAEMLLKMYSLGL...-----------------------------------...
CAC1C_HUMAN/955-1185----------------NADYVFTSIFTLEIILKMTAYGAFL.-----------------------------------...
CAC1C_HUMAN/1273-1523----------------ILNMLFTGLFTVEMILKLIAFKP...-----------------------------------...
KCNS3_HUMAN/224-405----------------GVEIACIAWFTGELAVRLAAAPC...-----------------------------------...
ITPR1_MOUSE/2362-2588----------------CNKIIFLMSFVGNCGTFTRGYR....-----------------------------------...
TRPC3_HUMAN/427-658----------------MLIMVWVLGMMWSECKELWLEGP...-----------------------------------...
KAT2_ARATH/93-295----------------IIDNIVNGFFAIDIILTFFVAYLDSH-----------------------------------SY.
SCN4A_HUMAN/159-446----------------NVEYTFTGIYTFESLIKILARGFCV.-----------------------------------...
KCNQ4_HUMAN/134-318----------------ILEFVMIVVFGLEYIVRVWSAGCCCR-----------------------------------Y..
SCN7A_HUMAN/146-393----------------VLENTLLGIYTFEILVKLFARGVWA.-----------------------------------...
SCN7A_HUMAN/539-728----------------IGNLVFIGIFTAEMIFKIIAMHP...-----------------------------------...
SCN7A_HUMAN/970-1192----------------YADMIFTYIFILEMLLKWMAYGF...-----------------------------------...
SCN7A_HUMAN/1285-1495----------------WINSIFVMLYTMECILKLIAFRCF..-----------------------------------...
ITPR2_HUMAN/2317-2540----------------CNKIVFLVSFVGNRGTFTRGYR....-----------------------------------...
TRPC2_MOUSE/704-920----------------SLHMIWVTGFLWFECKEVWIEGL...-----------------------------------...
CAC1E_HUMAN/1512-1722----------------YLNIAFTMVFSLECVLKVIAFGF...-----------------------------------...
TRPA1_CAEEL/873-1068----------------IIIQTLAVCQILVECFQLFQRK....-----------------------------------...
TRPA1_DROME/932-1126----------------VVIVVYILLNSMRELIQIYQQK....-----------------------------------...
CAC1F_HUMAN/129-371----------------QVEYVFLVIFTVETVLKIVAYGLVL.-----------------------------------...
TRPM1_HUMAN/862-1075----------------WIVISYIVSLALEKIREILMSEPGKL-----------------------------------...
KCNA1_HUMAN/223-407----------------IVETLCIIWFSFELVVRFFACPSK..-----------------------------------...
CAC1S_HUMAN/88-333----------------KLEYFFLIVFSIEAAMKIIAYGFLF.-----------------------------------...
CAC1S_HUMAN/466-660----------------IANRVLLSLFTTEMLMKMYGLGL...-----------------------------------...
CAC1S_HUMAN/834-1064----------------HFDIGFTSVFTVEIVLKMTTYGAFL.-----------------------------------...
SCN5A_HUMAN/159-412----------------YVEYTFTAIYTFESLVKILARGFCL.-----------------------------------...
SCN5A_HUMAN/1241-1469----------------YADKMFTYVFVLEMLLKWVAYGF...-----------------------------------...
SCN5A_HUMAN/1562-1771----------------KINLLFVAIFTGECIVKLAALR....-----------------------------------...
KCMA1_RAT/217-388----------------QIDMAFNVFFLLYFGLRFIAANDK..-----------------------------------...
Q9W433_DROME/339-611----------------IFDDIIFAFFALEMTIKMVAMGICG.-----------------------------------...
Q9W433_DROME/1265-1459----------------TSNVVFSGIFAVEMLLKVVAEGP...-----------------------------------...
Q9W433_DROME/2181-2406----------------TANYVFTVVFTVEMFIKVVATGMFY.-----------------------------------...
NALCN_RAT/73-321----------------TLDTLLMFLYTAEMIAKMHIRGIVK.-----------------------------------...
NALCN_RAT/420-598----------------LAEVAFTVLFDLEALLKIWCLGF...-----------------------------------...
NALCN_RAT/920-1155----------------IAEYVFVIFMSIELNLKIMADGLFF.-----------------------------------...
NALCN_RAT/1243-1446----------------TMSVVFTFIFVLEVTMKIIAMSP...-----------------------------------...
TPC1_ARATH/154-304----------------LVKVACVVILFVDVLVDFLYLSP...-----------------------------------...
TPC1_ARATH/466-671----------------VAEFVFGWIYVLEMALKIYTYGF...-----------------------------------...
TRPM2_HUMAN/830-1048----------------CAIYLWLFSLVCEEMRQLFYDP..DE-----------------------------------...
SCNA_DROME/180-428----------------STEVIFTGIYTFESAVKVMARGFIL.-----------------------------------...
SCNA_DROME/1337-1559----------------YMDRIFTVIFFLEMLIKWLALGF...-----------------------------------...
SCNA_DROME/1653-1859----------------YLNAIFVVIFSSECLLKIFALR....-----------------------------------...
SCNBA_HUMAN/611-810----------------IGNLVFTSIFIAEMCLKIIALDP...-----------------------------------...
SLO_DROME/166-336----------------QIDLAFNIFFMVYFFIRFIAASDK..-----------------------------------...
Q20766_CAEEL/931-1129----------------WITFIYTVTLSVEHIRKLMTSEG.SR-----------------------------------...
TPC1_HUMAN/142-319----------------TLELFALMVVVFELCMKLRWLGL...-----------------------------------...
TPC1_HUMAN/477-686----------------WSYLVFLTIYGVELFLKVAGLGP...-----------------------------------...
Q18351_CAEEL/295-478----------------ILEYICIGWFTFEYLVRFTIYPRK..-----------------------------------...
TRPV2_MOUSE/441-640----------------IYLLLGQLWYFWRRRLFIW.......-----------------------------------...
CAC1A_DROME/1129-1336----------------YINMGFTGMFSVETVLKIIGFGV...-----------------------------------...
CAC1A_HUMAN/135-359----------------DTEPYFIGIFCFEAGIKIIALGFAF.-----------------------------------...
CAC1A_HUMAN/1279-1510----------------YFDYVFTGVFTFEMVIKMIDLGLVL.-----------------------------------...
CAC1A_HUMAN/1600-1810----------------VFNIVFTSLFSLECVLKVMAFGI...-----------------------------------...
O02037_BDECA/160-406----------------ALEQSFTIIYAAEFLVKAFARGLII.-----------------------------------...
O02037_BDECA/1022-1247----------------ILDKVFTIVFLMEMLLKWMAIGL...-----------------------------------...
O02037_BDECA/1341-1543----------------IVGRVFLLIFAGEFIMKLIGFRWF..-----------------------------------...
O02038_CYACP/150-380----------------VAEYFFLAVFAIEGLLKIIAYGFIL.-----------------------------------...
O02038_CYACP/531-726----------------RANYFFLGLFTFEMLLKIYCLGI...-----------------------------------...
O02038_CYACP/904-1135----------------YFDIFFTAMFTFEVTVKMIAFGVIL.-----------------------------------...
O02038_CYACP/1223-1425----------------GFNIGFTAVFLLECVLKLMAFNAK..-----------------------------------...
O04242_MAIZE/98-298----------------AVDNVVNAFFAVDIILTFFVAYLDRM-----------------------------------T..
O04703_SOLTU/123-326----------------IADNIVNLVFAADIILTFSVAYIDST-----------------------------------S..
SCN9A_RAT/154-401----------------NVEYTFTGIYTFESLIKILARGFCV.-----------------------------------...
O08661_RAT/376-542----------------SIDVKYQMWKLGVVFTDNS.......-----------------------------------...
O13054_MAKNI/4820-4980----------------QIWKFGVVFTDGTFLYLCWYLI....-----------------------------------...
CCH1_SCHPO/218-481----------------YLIIVIGILYTLEMLLKIYLFGFLYD-----------------------------------GSS
CCH1_SCHPO/550-743----------------IFYACVDFLLAAEVILRFFAYLPD..-----------------------------------...
CCH1_SCHPO/982-1212----------------WTEVAFATIFTIEAAIKIIADGFCI.-----------------------------------...
CCH1_SCHPO/1302-1505----------------SIFLILSICYTINICVKVYGLSF...-----------------------------------...
O17535_CAEEL/261-439----------------QIEMLCNIWFTLELIIRFVFCPSK..-----------------------------------...
O18324_BLAGE/4-195----------------IECILKIVAFGVRNFFKDPWNTFD..-----------------------------------...
TRPC1_BOVIN/457-645----------------QLSFVMNSLYLATFALKEEAHN....-----------------------------------...
KCNH1_BOVIN/252-498----------------VVDSIVDVIFLVDIVLNFH..TTFVG-----------------------------------PA.
O24382_SOLTU/97-297----------------KTDNVVNGFFAIDIILTFFVAFLDRA-----------------------------------T..
O24538_VICFA/90-293----------------IVDNIIDLFFAIDIVMTFFLAFIDGT-----------------------------------T..
TRPC4_RAT/436-620----------------LMDFVMNSLYLATISLKIVAFV....-----------------------------------...
KCNS2_MOUSE/229-409----------------IVEHFGIAWFTFELVARFAVAPDF..-----------------------------------...
CAC1S_CHICK/92-278----------------ILNVAFTVLFTLEMILKLMAFKAK..-----------------------------------...
O42421_CHICK/5-206----------------MAFVGAFSNLGSVSVLRTF.......-----------------------------------...
KCNQ3_HUMAN/158-351----------------LLETFAIFIFGAEFALRIWAAGCCCR-----------------------------------...
KCNQ2_HUMAN/128-312----------------ILEIVTIVVFGVEYFVRIWAAGCCCR-----------------------------------...
O44164_CAEEL/265-484----------------LMDSIVDVIFFADILLNFH..TTFVG-----------------------------------PG.
O44930_AIPPA/138-380----------------QPEYVFAAIYTFEMLLKIIAKGLVM.-----------------------------------...
O44930_AIPPA/657-846----------------IGNKVFTMVFLLEMILKITAFGFK..-----------------------------------...
O44930_AIPPA/1083-1306----------------YLNIFFAVTFSIEFLLKVLGLGV...-----------------------------------...
O44930_AIPPA/1402-1607----------------IINLVFTGLFTLEAILRIVVLR....-----------------------------------...
O46129_LOLFO/396-624----------------LMILGYVIGLIWSEIKQIWMQGA...-----------------------------------...
SCNAA_CANFA/155-405----------------RIEYVFTVIYTFEALIKILARGFCL.-----------------------------------...
SCNAA_CANFA/708-898----------------IGNIVFTVFFTAEMVFKIIAFDP...-----------------------------------...
SCNAA_CANFA/1195-1424----------------YTDRMFTFIFVLEMLLKWVAYGFK..-----------------------------------...
O49846_9LILI/11-193----------------FVAYLDKVTYLLVDNPKRIALR....-----------------------------------...
O54812_CAVPO/76-278----------------WINLVFVIFFTCECVLKMFALR....-----------------------------------...
KCNH6_RAT/302-515----------------VVDLIVDIMFVVDIVINFRTTY.VNT-----------------------------------ND.
CAC1G_RAT/119-394----------------AFDDFIFAFFAVEMVVKMVALGIFG.-----------------------------------...
CAC1G_RAT/778-964----------------ISNIVFTSLFALEMLLKLLVYGP...-----------------------------------...
CAC1G_RAT/1291-1515----------------LSNYIFTAVFLAEMTVKVVALGWCF.-----------------------------------...
CAC1G_RAT/1613-1818----------------ICNYIFTVIFVFESVFKLVAFGF...-----------------------------------...
CAC1S_LITCT/88-331----------------KVEYIFLFIFTIESFLKIVAYGFIL.-----------------------------------...
CAC1S_LITCT/465-659----------------IANEVLLALFTMEMIVKIYALGF...-----------------------------------...
O61220_CAEEL/521-763----------------VFELFVVIGICVQVFLDFR..DIKRI-----------------------------------GR.
O61567_HOMAM/1241-1406----------------SVDWRYQVWKAGVTVTDNQ.......-----------------------------------...
O62604_POLPE/521-713----------------VFNYIFTATFCIEMGFKILAFTPK..-----------------------------------...
O62604_POLPE/945-1166----------------YCNYFFAVIFTVELLIKLFALGF...-----------------------------------...
O62604_POLPE/1260-1469----------------YLNFLFTGIFTLEAIIRLTAMR....-----------------------------------...
TRPC2_BOVIN/6-182----------------LYLAAFTLRLLLAGLAHKH.CRDAP.-----------------------------------...
TRPC5_RABIT/405-624----------------WMILPWVLGFIWGEIKEMW.DGGF..-----------------------------------...
O65816_HORVU/144-390----------------GFITSSSTNFGRGVLVEDRYAI....-----------------------------------...
O70368_RAT/6-196----------------ILNYFRDAWNIFDFVTVLGSITD...-----------------------------------...
HCN4_MOUSE/297-513----------------VFNVVSDTFFLIDLVLNFR.TGIVVE-----------------------------------DN.
KCNG2_CHICK/260-452----------------VLETVCVAWFSFEFLLRSIQAENK..-----------------------------------...
O73697_TAKRU/474-668----------------VASRVLLVLFIVEMFIKMYALGL...-----------------------------------...
O73697_TAKRU/1162-1386----------------MLNLIFTVLFTVEMILKLMAFKIK..-----------------------------------...
CAC1D_CHICK/158-400----------------KVEYAFLIIFTVETFLKIIAYGLLL.-----------------------------------...
CAC1D_CHICK/1260-1492----------------IMNMVFTGVFTVEMVLKLIAFKPKIF-----------------------------------...
O76266_HIRME/254-434----------------IIETICTAWFTFEAIVRFISCPNK..-----------------------------------...
O76457_APLCA/233-409----------------YIECASNAWFTFEIIIRFVVAPNK..-----------------------------------...
O77089_PANAR/2376-2612----------------VSLMGNKGTFAKRLEQQVTDGELL..-----------------------------------...
CNGC6_ARATH/157-431----------------TIRTVIDSFYLFHMALRFRTAYVAPS-----------------------------------SRV
SCN8A_RAT/1232-1461----------------YADKVFTYIFILEMLLKWTAYGF...-----------------------------------...
SCNBA_RAT/158-394----------------IPEYVFIGIYILEAVIKILARGFIV.-----------------------------------...
SCNBA_RAT/606-797----------------IGNWVFTGIFIAEMCLKIIALDP...-----------------------------------...
SCNBA_RAT/1070-1287----------------CTDNIFTFIFLLEMILKWVAFGF...-----------------------------------...
SCNBA_RAT/1380-1583----------------ILNIAFVVIFTIECLIKVFALR....-----------------------------------...
HCN2_MOUSE/219-431----------------VFNVVSDTFFLMDLVLNFR.TGIVIE-----------------------------------DN.
HCN1_MOUSE/166-382----------------IFNVASDTVFLLDLIMNFRTGTV.NE-----------------------------------DS.
KCNH3_RAT/273-507----------------ILDIVLNFRTTFVSKSGQVVFAPKS.-----------------------------------...
CAC1H_HUMAN/138-418----------------AFDAFIFAFFAVEMVIKMVALGLFG.-----------------------------------...
O96057_HALRO/84-316----------------KVEYIFLGIFTIEAILKIIAYGLFF.-----------------------------------...
O96057_HALRO/463-658----------------LANKILLTLFTIEMLVKMYSLG....-----------------------------------...
O96057_HALRO/839-1070----------------YFDYVFTGVFAVEIVLKMTAFGVFL.-----------------------------------...
O96057_HALRO/1158-1372----------------HMNYVFTALFALEMIVKLVAYKP...-----------------------------------...
O96310_HELVI/265-424----------------QVWKAGVTITDNSFLYSLWYFS....-----------------------------------...
O96385_PARTE/190-371----------------LILTFFKGYYDRGILQRNKAKIF...-----------------------------------...
O97017_9CNID/118-350----------------VAEYVFLAVFTMEAVLKIIAYGFLF.-----------------------------------...
O97017_9CNID/503-698----------------IANKLFLGIFTIEMIVKMYCLGF...-----------------------------------...
O97017_9CNID/885-1115----------------YFDYFFTSVFTFEILVKFISYGLIL.-----------------------------------...
O97017_9CNID/1203-1410----------------GFNIGFTAVFLLECILKLIAFKPK..-----------------------------------...
SCNA_ELEEL/150-401----------------IVEYTFTGIYTFEVIVKVLSRGFCI.-----------------------------------...
SCNA_ELEEL/600-789----------------AGNLVFTTIFAAEMVLKIIALDP...-----------------------------------...
SCNA_ELEEL/1036-1263----------------YADKVFTYVFIVEMLLKWVAYGFK..-----------------------------------...
SCNA_ELEEL/1356-1566----------------QINVIFVIIFTVECLLKLLALR....-----------------------------------...
SCN1A_RAT/156-422----------------NVEYTFTGIYTFESLIKIIARGFCL.-----------------------------------...
SCN1A_RAT/802-991----------------VGNLVFTGIFTAEMFLKIIAMDP...-----------------------------------...
SCN1A_RAT/1254-1482----------------YADKVFTYIFILEMLLKWVAYG....-----------------------------------...
CAC1S_RABIT/1152-1380----------------ILNVAFTIIFTLEMILKLLAFKA...-----------------------------------...
KCNAS_DROME/281-477----------------LIETLCIIWFTFELTVRFLACPNK..-----------------------------------...
SCN5A_RAT/752-941----------------VGNLVFTGIFTAEMTFKIIALDP...-----------------------------------...
KCNA6_RAT/266-458----------------LVETLCIVWFTFELLVRFSACPSK..-----------------------------------...
KCNAB_DROME/476-658----------------MVEAVCITWFTLEYILRFSASPDK..-----------------------------------...
KCNAW_DROME/233-412----------------YIECVCNAWFTFEILVRFISSPNK..-----------------------------------...
CAC1S_CYPCA/107-350----------------SLEYIFLVIFTLECFLKIVAYGLLF.-----------------------------------...
CAC1S_CYPCA/481-675----------------TANVILLACFTIEMVMKMYAFGP...-----------------------------------...
CAC1S_CYPCA/850-1080----------------YADIVFTTVFTIEIVLKMTVYGAFL.-----------------------------------...
CAC1S_CYPCA/1168-1401----------------TLNLIFTVLFTGEMIVKLIAFKAK..-----------------------------------...
ITPR_DROME/2410-2680----------------IFSLVIVLALPRESGIRTFIGSVIL.-----------------------------------...
SCN1A_HUMAN/1575-1785----------------RINLVFIVLFTGECVLKLISLR....-----------------------------------...
TRPL_DROME/432-668----------------LIVVMYVIGFVWEEVQEIFAVG....-----------------------------------...
CCH1_YEAST/804-998----------------KTDRGISIVLFIESLARLVLYLPN..-----------------------------------...
CCH1_YEAST/1244-1472----------------ALDCAFIGAFSIEFIVKTVADGFIY.-----------------------------------...
CCH1_YEAST/1563-1767----------------VYFMFSTSVFLIQEALHMCGEGP...-----------------------------------...
KCNQ1_HUMAN/158-347----------------WMEIVLVVFFGTEYVVRLWSAGCRSK-----------------------------------...
CAC1A_RAT/523-715----------------YAEFIFLGLFMSEMFIKMYGLGT...-----------------------------------...
CNG_ICTPU/175-364----------------GLDYLCDVIYILDTCIRLRTGYL.EQ-----------------------------------G..
CAC1B_DISOM/1502-1704----------------YLNILFTFLFSMECVLKLIGFGV...-----------------------------------...
CAC1E_DISOM/139-362----------------QTEPYFIGIFCFEAGIKIVALGFVF.-----------------------------------...
CAC1E_DISOM/1140-1373----------------YFDYVFTGVFTFEMVIKMIDIGLVF.-----------------------------------...
CAC1E_DISOM/1463-1662----------------LMNIAFTITFTLECILKIIAFGF...-----------------------------------...
P90670_APLCA/165-419----------------FVEHIFLGIYTVEAVVKVLSRGFVL.-----------------------------------...
P90670_APLCA/788-983----------------AANLVFTAIFAVEAFLKILALSP...-----------------------------------...
P90670_APLCA/1214-1440----------------YLDKVFTAIFIIEMLIKWLAFGFK..-----------------------------------...
P90670_APLCA/1534-1731----------------IFNLIFITIFTAECVLKLIGLR....-----------------------------------...
P91256_CAEEL/249-433----------------FTERICIAFFTVEYCLRFFAAPRK..-----------------------------------...
CAC1A_DROME/75-312----------------KTEAYFLCIFCVEASLKILALGLVL.-----------------------------------...
CAC1A_DROME/475-666----------------YAEFIFLGLFMSEMFIKMYALGP...-----------------------------------...
CAC1A_DROME/804-1039----------------YFDYAFTGVFTIEMLLKIVDLGVIL.-----------------------------------...
P91744_LOLBL/102-336----------------ATEFYFLGIFCVEALLKIVALGFAL.-----------------------------------...
P91744_LOLBL/515-708----------------VMEFAFLALFMSEMLIKMYGLGV...-----------------------------------...
P91744_LOLBL/930-1162----------------YFDYVFTGVFTIEMLLKIVDLGIIL.-----------------------------------...
P91744_LOLBL/1252-1456----------------NLNLAFSVLFTIECILKLMGFGI...-----------------------------------...
P91783_POLPE/220-401----------------VLDSACVTFFALEYMFRFYSTDNR..-----------------------------------...
P91784_POLPE/242-415----------------NIEAVCVVVFTIEYLARLYSAPCR..-----------------------------------...
KAT3_ARATH/120-324----------------TIDLVVDFFFAVDIILTFFVSYLDNT-----------------------------------TY.
KCNV1_RAT/247-430----------------ILEYVCISWFTGEFILRFLCVKDR..-----------------------------------...
P97706_RAT/146-393----------------AVENTCLGIYTFEILVKVIARGIWA.-----------------------------------...
P97706_RAT/561-749----------------IGNLVFIGIYTIEMILKIIAMHP...-----------------------------------...
P97706_RAT/991-1213----------------YGDMIFAYIFILEMLLKWVAYGFK..-----------------------------------...
CNGA1_BOVIN/200-394----------------AFDYLSDVVYLLDMFVRTRTGYL.EQ-----------------------------------G..
CAC1D_HUMAN/921-1151----------------YFDYAFTAIFTVEILLKMTTFGAFL.-----------------------------------...
KCNAE_DROME/272-488----------------VVDSIVDVIFFIDIVLNFH..TTFVG-----------------------------------PG.
CNGA2_BOVIN/177-371----------------VLDYVSDVVYIADLFIRLR.TGFLEQ-----------------------------------G..
CNG_CAEEL/206-410----------------FFDLLMDCVYLIDTFLNYRMGYM.DQ-----------------------------------G..
SCN1_LOLBL/80-333----------------FAEYIFLGIYTMEMAIKLVAGGFFI.-----------------------------------...
SCN1_LOLBL/445-628----------------VANYVFTTVFVLEAILKLLAFN....-----------------------------------...
SCN1_LOLBL/818-1040----------------YLDITFCLLFFLEMVLKLVALGF...-----------------------------------...
SCN1_LOLBL/1135-1350----------------TANIAFTILYAVEAIIKIIGLR....-----------------------------------...
Q09658_CAEEL/273-452----------------WIELMCILWFTIELILRFISCPCK..-----------------------------------...
KCNH2_HUMAN/454-659----------------VVDLIVDIMFIVDILINFRTTYVNAN-----------------------------------E..
Q16976_APLCA/270-457----------------TLDIICTVFFTLELILRFIFAPDK..-----------------------------------...
Q17314_CYACP/168-407----------------ESEYVFAAIYTFEVIVKISAKGFIL.-----------------------------------...
Q17314_CYACP/544-733----------------ILNYIFTSIFVIEMTCKLIALTP...-----------------------------------...
Q17314_CYACP/1000-1219----------------YCNYFFAIVFTLEFIIKLIGFGV...-----------------------------------...
Q17314_CYACP/1313-1524----------------YLNYLFTGIFTIEAIIRLVAMR....-----------------------------------...
Q17354_CAEEL/44-236----------------YAEFVFLGIFVVEMLLKLFAMG....-----------------------------------...
Q17354_CAEEL/376-611----------------YMDYCFTGVLACEMLLKLIDQGILL.-----------------------------------...
Q17354_CAEEL/701-908----------------LFNTALTAVFTVESILKILAFGV...-----------------------------------...
Q19464_CAEEL/235-414----------------YVDLICNIWFTIELLIRSLFCPSF..-----------------------------------...
Q23974_DROME/300-504----------------VSDVIVEALFIVDILLNFR.TTFVSR-----------------------------------KG.
CAC1D_DROME/652-877----------------KVEYVFLVIFTAECVMKILAYGFVL.-----------------------------------...
CAC1D_DROME/1019-1214----------------YTNVFFIGLFTCEMLLKMYSLGF...-----------------------------------...
CAC1D_DROME/1379-1609----------------KFDYFFTAVFTIELILKLISYGFVL.-----------------------------------...
CAC1D_DROME/1697-1925----------------ALNMIFTAVFALEFVFKLAAFRFK..-----------------------------------...
CNG_DROME/144-346----------------TLDYLCDFIYLLDTLVHMH.EGFLDQ-----------------------------------GL.
Q25150_HALRO/156-465----------------IVEKTFLAIYTFEAVVKIFSRGFIL.-----------------------------------...
Q25150_HALRO/833-1021----------------VANLVFTVIFTAEMVLKVVGMQP...-----------------------------------...
Q25150_HALRO/1297-1535----------------YADRIFTYVFIFEMLLKWVGYGFK..-----------------------------------...
Q25150_HALRO/1628-1838----------------YINYVFIAIFTGECLLKWCALR....-----------------------------------...
Q25376_LOLOP/220-403----------------IIETGCIIWFTMELLIRFASCPGK..-----------------------------------...
Q25377_LOLOP/158-400----------------VSEWIFTGIYTCEALIKLFARGFIL.-----------------------------------...
Q25377_LOLOP/626-812----------------IGNYVFTAVFAAEAFLKILALAP...-----------------------------------...
Q25377_LOLOP/1059-1284----------------YMDKCFTVIFIGEMFIKWFAFG....-----------------------------------...
Q25377_LOLOP/1378-1588----------------YINMVFIGIFTGECVMKLMGLR....-----------------------------------...
CAC1M_MUSDO/1143-1366----------------ALNMIFTAVFSLEFIFKLAAFRFK..-----------------------------------...
Q26039_PANIN/184-355----------------MVEAVCTTWFTLEYVLRFAASPNK..-----------------------------------...
Q26094_POLPE/225-397----------------TVNTAVICWFTIEFILRLICCPNK..-----------------------------------...
Q26095_POLPE/223-398----------------IINTICNSWFTLEYLLRLIASPNK..-----------------------------------...
Q26344_APLSP/357-539----------------VVEAVCIGWFTLEYLARFWASPNK..-----------------------------------...
Q27170_PARTE/196-376----------------ILLKFNTCYYYKGAVIENRYQIAK..-----------------------------------...
CNGB1_BOVIN/807-993----------------LMDYLCDLIYLLDITVFQMRLQFVRG-----------------------------------G..
SCN4A_HORSE/606-795----------------VGNLVFTGIFTAEMVLKLIALDP...-----------------------------------...
SCN4A_HORSE/1064-1291----------------YADKVFTYIFIMEMLLKWVAYGFK..-----------------------------------...
AKT2_ARATH/110-312----------------IADNIVDLFFAVDIVLTFFVAYIDER-----------------------------------TQ.
AKT1_ARATH/91-288----------------ITDNIVNAFFAIDIIMTFFVGYLDKS-----------------------------------TY.
Q41461_SOLTU/95-299----------------IVDNIVDCFFAIDILLTFFVAYL.HR-----------------------------------ES.
Q63541_RAT/162-411----------------NVEYTFTGIYTFESLVKIIARGFCI.-----------------------------------...
CNGA4_RAT/71-265----------------VLDYTSDLLYLLDIGVRFH.TGFLEQ-----------------------------------G..
Q90518_TAKRU/157-415----------------NVEYTFTGIYTFESLIKILARGFCV.-----------------------------------...
Q90519_TAKRU/5-205----------------FVDLGNVSALRTFRVLRAL.......-----------------------------------...
CNG1_CHICK/247-441----------------FLDYCSDIIYVFDMFVRFR.TGFLEQ-----------------------------------G..
Q93135_BLAGE/4-216----------------WLDFVVIALAYVTMGIDLGNLAA...-----------------------------------...
TRPG_CAEEL/1341-1555----------------YILIAYVAAFGLEQVRKIIMSDAKPF-----------------------------------...
Q94447_CALVI/422-658----------------LGIITYISSLVLGELKSLYSDGL...-----------------------------------...
SLO1_CAEEL/180-351----------------QIDLGFNIFFLVYFFIRFIAASDK..-----------------------------------...
KCNH5_RAT/249-467----------------VLDSVVDVIFLVDIVLNFH.TT..FV-----------------------------------GP.
KCNF1_HUMAN/224-405----------------NVETACIGWFTLEYLLRLFSSPNK..-----------------------------------...
SKOR_ARATH/116-328----------------ILDIAGQIAFLVDIVLTFFVAY..RD-----------------------------------SR.
SCN3A_HUMAN/156-423----------------NVEYTFTGIYTFESLIKILARGFCL.-----------------------------------...
Q9PRI8_XENLA/442-630----------------QLSFVMNSLYLATFALKVVAHN....-----------------------------------...
KCNH8_RAT/269-473----------------IIDIILNFRTTYVSKSGQVIFEARS.-----------------------------------...
TRPV2_RAT/446-645----------------IYLLLGQLWYFWRRRLFIWISFMD..-----------------------------------...
TRPV6_RAT/395-577----------------AVIILLVEIPDIFRLGVTRFFG....-----------------------------------...
KCNH4_RAT/276-479----------------ILDIILNFRTTYVSQSGQVVSAPRS.-----------------------------------...
Q9RW39_DEIRA/69-240----------------QTEWVFTVMFTADYLLRLLGAR..R.-----------------------------------...
CNGC7_ARATH/145-419----------------TLRTIVDVFYLTRMALQFRTAYIAPS-----------------------------------SRV
AKT5_ARATH/112-312----------------ILDNVVNGFFAVDIVLTFFVAFLDKA-----------------------------------T..
CNG14_ARATH/128-398----------------FFRTLADLFYVLHIVIKFRTAYV.SR-----------------------------------TSR
CNGC3_ARATH/130-394----------------FIDAFYVVHMLFQFHTGFI.TP..SS-----------------------------------SGF
Q9SM12_MAIZE/104-307----------------VADIVVDLFFAVDIVLTFFVAYIDGR-----------------------------------TQ.
CNG16_ARATH/98-374----------------CFRNLADLSFLIHILLKFK.TAFVSK-----------------------------------SSR
Q9U5E2_DROME/162-353----------------ICDSMTDVVFILDIIVQLRTGYL.EQ-----------------------------------G..
SCNBA_HUMAN/161-399----------------IAECVFTGIYIFEALIKILARGFIL.-----------------------------------...
SCNBA_HUMAN/1092-1307----------------CTDIIFTHIFILEMVLKWVAFGF...-----------------------------------...
SCNBA_HUMAN/1400-1603----------------HLNWVFVVIFTLECLIKIFALR....-----------------------------------...
KCNG1_HUMAN/270-459----------------IVESVCVGWFSLEFLLRLIQAPSK..-----------------------------------...
Q9VHY7_DROME/610-800----------------MQWWVLVAITIVEIFRKLYGITGYS.-----------------------------------...
TRPG_DROME/412-652----------------WLILAWVSGLIWSEVKQLWDVGL...-----------------------------------...
Q9VUD5_DROME/520-718----------------LLNFVGAILYLLVALREARFLGLK..-----------------------------------...
Q9VW35_DROME/377-569----------------YLLRCTTVNFFRSQFGKELSFDGRL.-----------------------------------...
PYX_DROME/536-723----------------YLVIILNLILLGKEVFQMA.HGL...-----------------------------------...
PAIN_DROME/531-734----------------LLSWLGISYLILRECIQWIMSP....-----------------------------------...
Q9W2D5_DROME/505-692----------------ACDFCADIIYLLDVVFFKH..RVMYL-----------------------------------FE.
Q9W3W0_DROME/513-653----------------CIPFRLIGDTDTEEAILIFAVP....-----------------------------------...
Q9XH40_SAMSA/112-315----------------IVDNIIDIFFGVDIVLTFFLAYIDSS-----------------------------------TQ.
TRPV5_RABIT/393-578----------------VTGAVIILLLEIPDIFRVGASR.YF.-----------------------------------...
Q9XSP9_RABIT/139-264----------------IVETLCIIWFSFELVVRFFACPSK..-----------------------------------...
Q9XWG9_CAEEL/112-301----------------ILEIVLVVFFSVEFIVRLWSAGCRSK-----------------------------------...
Q9XXD1_CAEEL/281-465----------------YIEYVCIVWFTMEYGLKMLVSA..E.-----------------------------------...
Q9XZC1_BOOMI/498-721----------------YMDKTFTVIFFFEMMLKWLAFGFK..-----------------------------------...
Q9XZC1_BOOMI/815-1019----------------RLNIFFIAVFTAECLLKIFALR....-----------------------------------...
TRPV2_HUMAN/444-645----------------IYLLVGQLWYFWRRHVFIWISFID..-----------------------------------...
CAC1I_RAT/115-395----------------VFDDFIFIFFAMEMVLKMVALGIFG.-----------------------------------...
Q9ZPL4_SAMSA/115-318----------------IVDNVVDIFFAVDIVLTFFVAFI.DR-----------------------------------RT.

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
Q94253_CAEEL/253-318--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC72_LEIMA/202-273--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O82065_SOLTU/193-268--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRAJA/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8AVI5_XENLA/81-158--------------------------------------------------------------------------------
Q8AVI5_XENLA/191-273--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DAL9_VIBVU/25-105--------------------------------------------------------------------------------
Q8DF13_VIBVU/235-325--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8I6M6_APLCA/77-154--------------------------------------------------------------------------------
Q8J0H6_NEUCS/369-447--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8PI92_XANAC/49-128--------------------------------------------------------------------------------
Q8PT60_METMA/20-95--------------------------------------------------------------------------------
Q8QZZ6_CAVPO/69-146--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8X557_ECO57/148-226--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
Q90ZP4_ONCMY/461-543--------------------------------------------------------------------------------
Q920B6_RAT/120-198--------------------------------------------------------------------------------
Q924I4_RAT/64-145--------------------------------------------------------------------------------
Q924I4_RAT/180-260--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93531_CAEEL/115-196--------------------------------------------------------------------------------
Q93531_CAEEL/236-312--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9AR58_SOLTU/72-154--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9CX88_MOUSE/130-208--------------------------------------------------------------------------------
Q9ERU4_RAT/46-128--------------------------------------------------------------------------------
Q9ERU5_RAT/65-147--------------------------------------------------------------------------------
Q9ESM4_RAT/55-138--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9LLM5_EUCCA/71-153--------------------------------------------------------------------------------
Q9LLM5_EUCCA/192-267--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9V1D2_PYRAB/403-481--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
Q9ZP53_SOLTU/193-268--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/72-154--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/193-268--------------------------------------------------------------------------------

PF01007

IRK5_HUMAN/54-390E.TYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWW-----------------------------------LIA
IRK10_HUMAN/31-369K.RFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWY-----------------------------------LVA
IRK1_CAEEL/77-422K.DRQYLRDIFTTMIDVKWRWMLMLFASAFVLSWSIFGTTYY-----------------------------------LIA
IRK1_HUMAN/43-380QSRFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWY-----------------------------------AVA
IRK3_CHICK/39-385E.TSRYLSDLFTTLVDLKWRWNLFIFVLTYTVAWLFMASMWW-----------------------------------VIA
IRK4_HUMAN/22-377K.SQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFW-----------------------------------CIA
IRK12_HUMAN/47-381K.SQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFW-----------------------------------VIA
IRK15_HUMAN/30-365I.YLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYY-----------------------------------AIA
IRK8_HUMAN/37-380E.QGRFLQDIFTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWW-----------------------------------LVA
IRK9_HUMAN/25-362E.TYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWW-----------------------------------LIA
IRK2_CAVPO/48-380K.GQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFW-----------------------------------LIA
IRK16_RAT/37-358E.WGSYMVDIFTTLVDTKWRHMFVVFSLSYILSWLIFGSIFW-----------------------------------LIA
IRK11_HUMAN/36-366E.QGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMAWW-----------------------------------LIA

PF00060

GLR27_ARATH/582-833--------------SLDLWVTTACFFVFIGFIVWILEH.RVN.TDFRG................................
GLR34_ARATH/613-869--------------TIEMWAVTGGFFLFVGAMVWILEH.RFN.QEFRG................................
Q9VIA5_DROME/402-665--------------SNQVWWCVLALVTGSTILLLFHVR..LE.RMLSN................................
GLR28_ARATH/577-828--------------GLDLWVTTACFFVLIGFVVWLFEH.RVN.TDFRG................................
Q8T0V7_DROME/343-610--------------TVETWFCLMGIILLTAPTLYAINR.LAPLKEMRI................................
Q9U0T0_LOLOP/568-841--------------SYEIWMCILFAFIGVSVVLFLVSR.FSP.SGWHV..ED............................
GLR1_CAEEL/591-867--------------STEIWMYIIFAYIGVSVVIFLVSR.FSP.YEWRVEETSRG..........................
Q9VVU7_DROME/338-596--------------ENDVWVSILMLLIITTVVLVLELF.FSP.HNHDM................................
Q90278_CARAU/149-409--------------SGETWFGILIAYFVTAVCICIVGR.LSP.CEWSQ................................
Q9TVI0_DROME/547-823--------------SSEVWLYLGIAYLGVSLCFFIIGR.LSP.IEWDN...PYPCI........................
GLK1_DROME/610-907--------------SQEIWISVILSYVGVSFVLYFVTR.FPP.YEWRIVRRPQADSTAQQPPGII...............
GLR2_CAEEL/619-910--------------GMTIWIFTLSSYFGVSLTIFLVSW.FSP.YEKRIE.FKRG..........................
Q9W365_DROME/518-818--------------RLEVWLSIVAALVGTAIMIWFMDK.YSP.YSSRNNRQAYP..........................
Q25412_LYMST/545-818--------------AVEIWLYVIGAYLIVSFTIFTLAR.FSP.YEWYN...PHPCN........................
GRID1_HUMAN/562-842--------------DFAVWACIAAAIPVVGVLIFVLNR.IQA.VRAQSAAQPRP..........................
Q90279_CARAU/144-405--------------STEMWMGVLVAYLLTSVCIFLVSR.ISP.CEWKQ................................
GRID2_RAT/566-842--------------DLSLWACIAGTVLLVGLLVYLLNW.LNP.PRLQM.....G..........................
NMDZ1_HUMAN/559-824--------------QSTLWLLV.GLSVHVVAVMLYLLDRFSP.FGRFK..VN.S..........................
GLRK_LITBE/161-425--------------SKELWIGIIISYVITSLCLFLVGR.LSP.CEWTE................................
NMDE1_RAT/554-828--------------SASVWVMMFVMLLIVSAIAVFVFEYFSP.VGYNRNLAKGK..........................
NMD3B_HUMAN/574-842--------------HWSTWLGV.FAALHLTALFLTVYEWRSP.YGLTPRGRNRS..........................
GLR29_ARATH/566-820--------------SLELWVTTGCFFVFIGFVVWLFEH.RVN.TDFRG................................
GLR31_ARATH/587-839--------------TLPMWAVTASFFVIVGAAIWILEH.RIN.DEFRG................................
GLR21_ARATH/574-835--------------TLALWLISLLSFFIIGLVVWVLEH.RVN.PDFDG................................
O76903_DROME/477-751--------------DTASWMLVGIVAIQAATFMIFLFEWLSP.SGYDMKLYLQN..........................
GLRK_ANAPL/168-431--------------SKETWTGLLFAYILTCFCLFLVAR.LSP.CEWNE................................
GLRK_XENLA/162-426--------------SKETWIGILVAYMVTSLCLFLVGR.LSP.CEWTE................................
GLR22_ARATH/580-842--------------SIELWLTTLVFFFLVGISVWTLEH.RVN.SDFRG................................
Q9V4A0_DROME/553-829--------------AIEIWLYVLAAYILVSFALFVMAR.FSP.YEWKN...PHPCY........................
Q9VSV5_DROME/630-967--------------SQEIWVSVIFSYIGVSIVLFFVSR.FSP.HEWRLVQQQPQQSQSPDPHAHHEQLANQQPPGIIGGA
GLRK_LYMST/556-830--------------SSEIWMCIVFAYIGVSVVLFLVSR.FSP.NEWHLSEAH............................
NMD3A_RAT/674-942--------------HWTMWLGI.FVALHITAIFLTLYEWKSP.FGMTPKGRNRN..........................
GRIA2_HUMAN/543-824--------------AYEIWMCIVFAYIGVSVVLFLVSR.FSP.YEWHT.....EEFED......................
NMDA1_DROME/573-843--------------SNTLWILV.MVSVHVVALVLYLLDRFSP.FGRFKL.SH.S..........................
GLR37_ARATH/578-833--------------TSRLWCVVLVSFLVIAVVIWILEH.RIN.EDFRG................................
GLR11_ARATH/540-781--------------EKSLWLASGAFFVLTGIVVWLVER.SVN.PEFQG..SWGQ..........................
Q9VDH5_DROME/545-823--------------SLDVWIYMATAYLGVSVLLFILAK.FTP.YEWP....AYTD.........................
GLR14_ARATH/568-810--------------TLSLWLTIASFFILTGAIVWLIER.HDN.ADFQG.....SC.........................
GRIK2_HUMAN/560-831--------------SPDIWMYILLAYLGVSCVLFVIAR.FSP.YEWYN...PHPCN........................
O01623_CAEEL/566-855--------------SWQIWTAIATSIITVTLGMYFVAN.VTP.YEWNLNFSCCTAHEPHPAA..................
NMDE3_RAT/552-826--------------SPAVWVMMFVMCLTVVAITVFMFEYFSP.VSYNQNLTKGK..........................
Q9VMP4_DROME/554-829--------------AVEVWIYMIFAQLIMTLAFVFIAR.LSY.REWLP...PNPAI........................
O45028_DROME/553-829--------------NAEVWLFVMIAMMITAFALIFTGR.IDQ.YEWDQ...PVENV........................
Q19693_CAEEL/134-404--------------SWEVWVITAAVILISGVIFLVMTN.IIR.KVYEE................................

PF15249

B5X552_DROME/1418-1521----------------FVRQLEVDQES.......CLKP------------------------------------------
F8NSX7_SERL9/93-213----------------FATCLEADHIS.......VLYP------------------------------------------
H3AYR2_LATCH/719-823----------------ILQQLQKDQSL.......AIGP------------------------------------------
Q55QM7_CRYNB/131-237----------------LQLALAMDQEA.......TLYP------------------------------------------
H2NZE3_PONAB/668-773----------------FLEHLHKHQGS.......VLHP------------------------------------------
Q01LC1_ORYSA/286-403----------------ALGDMAEDARE.......ACNP------------------------------------------
Q4RYD4_TETNG/1-136----------------FLQQLRKDHVG.......VQAP------------------------------------------
G3HR60_CRIGR/731-835----------------ILQQLQRDQAH.......AVTP------------------------------------------
C3Z068_BRAFL/1333-1438----------------IKNKGKLDQQG.......CLKP------------------------------------------
A3CH67_ORYSJ/186-306----------------PEVEMALQDVM......QVCNP------------------------------------------
I1LP29_SOYBN/125-245----------------MELQMAYQDAW......RVCHP------------------------------------------
Q7XVN3_ORYSJ/354-483----------------RRGRHQQFFFA.......AVNS------------------------------------------
A8PYV1_BRUMA/646-751----------------INDYFLSLHNS.......VEHP------------------------------------------
D8U255_VOLCA/23-147----------------SLDLLAEDCKR.......ICTT------------------------------------------
Q9SRQ0_ARATH/121-240----------------LEIQFAYQDAW......RVCHP------------------------------------------
F6Q7W8_XENTR/676-780----------------ILQRLHKDQQH.......AVFL------------------------------------------
I1PKQ5_ORYGL/94-212----------------AAEWMAHEDAW......RACNR------------------------------------------
I0Z4J2_9CHLO/35-157----------------QQDYIHEDIFR.......LLNP------------------------------------------
H2TKN1_TAKRU/1011-1116----------------MLEQLRKQQGS.......VLQP------------------------------------------
D6RLC3_COPC7/97-215----------------VATRIAEDQAA.......VLNP------------------------------------------
H3A9A7_LATCH/1063-1168----------------LLEQFCRDQDT.......ILQS------------------------------------------
E7FC48_DANRE/828-933----------------VKQQMLLDHTA.......VLSP------------------------------------------
B6U5Z5_MAIZE/33-158----------------AAEQMAFEDAW......KALNP------------------------------------------
E2AU32_CAMFO/2003-2108----------------VEQQLKIDQNG.......ATNP------------------------------------------
G0NU71_CAEBE/708-810----------------VKNLMTGQLSQ.......LENG------------------------------------------
A8X0V1_CAEBR/811-928----------------MKNMLDEQMKC.......LNDP------------------------------------------
B3M7G6_DROAN/504-627----------------MVEAVCITWFTLEYILRFSASP------------------------------------------
A6ZJ71_CAEEL/678-780----------------LKDIMIDQLNR.......LEEP------------------------------------------
E0VX25_PEDHC/1662-1767----------------IEQQMRTDQAG.......ATMP------------------------------------------
F2USU5_SALS5/118-246----------------QQQQQQQQQQQRGLKVGVVVDA------------------------------------------
B8P3G1_POSPM/122-239----------------FAQWLAYHQYA.......ALYP------------------------------------------
E9GC12_DAPPU/1239-1344----------------FEHQLKTDQSG.......ALAP------------------------------------------
A3ATB4_ORYSJ/289-371----------------AAEQIAYEDAR......KACNP------------------------------------------
A8JDB0_CHLRE/26-151----------------TLELLAEDCKR.......ICTT------------------------------------------
E3M7Z0_CAERE/718-820----------------VNNFMMEQLDR.......LNAP------------------------------------------
A9S0J3_PHYPA/54-177----------------MEVDMARQDVL......RVCNP------------------------------------------
E5S5E0_TRISP/368-478----------------TAQENSRKLKA..LLRERAMRP------------------------------------------
C5YEV3_SORBI/36-162----------------AAEQMAFEDAW......KALNP------------------------------------------
B0E0Z3_LACBS/96-216----------------VASRLALDQPA.......VLNP------------------------------------------
C5KJB2_PERM5/65-165----------------DLRECVHNARA...........------------------------------------------
B0WCV5_CULQU/2345-2450----------------FERQISVDQDA.......CTRP------------------------------------------
D2A445_TRICA/62-167----------------IEAQLNLDQSG.......AVKP------------------------------------------
A7USW6_ANOGA/2823-2926----------------FEIQIQKDQDA.......CTKP------------------------------------------
E4WWE2_OIKDI/96-202----------------ILLKMQEDQRN.......VTDD------------------------------------------
B3RLC8_TRIAD/434-538----------------ITTALGVDQIF.......VESP------------------------------------------
D8QC90_SCHCM/85-202----------------FAERLAADQQA.......TLKP------------------------------------------
D2VJE8_NAEGR/329-435----------------QNHDMYSQKDK....KKLALDP------------------------------------------
E7F8Y0_DANRE/599-703----------------VLQQLRQDHSR.......VLSS------------------------------------------
H2WA87_CAEJA/574-676----------------VKQLMLNQLNQ.......LAAP------------------------------------------
D5AE81_PICSI/102-222----------------TELEMAQQDAW......KICNP------------------------------------------
A9RCY5_PHYPA/87-211----------------GRVEFSDTKLIACSILFLHLHG------------------------------------------
I1BJQ3_RHIO9/247-352----------------FLETLSKDHVS.......VTTP------------------------------------------
F0ZSB4_DICPU/460-585----------------IIEEALVERKL.......ATQP------------------------------------------
C1EJG7_MICSR/87-216----------------VAEKVSASNKL.......ACRP------------------------------------------

PF02386

O27332_METTH/161-474--------------RIKPSIANTVKTIWWIYITYTVLGIVLYGLT..............................GMPLF
Y1485_METJA/160-466--------------RIMPSAIGTIKTIIWIYILYTILGVLLLYLS..............................GLSFW
TRK1_YEAST/763-1173--------------TILVVYYVGWHIVAFVMLVPWIILKKHYSEVVR.........................DDGVSPTW
O87729_VIBAL/151-479--------------SD..WSDKSSPRAKTVAKNIVAVYLMLTGLCIVG.......................YLVTGMNLF
TRKH_SHIFL/152-481--------------PGPLKDNKMRPRIAETAKTLWLIYVLLTVACALA.......................LWFAGMDAF
P73949_SYNY3/106-429--------------KSVIATTLIFEVTGTIVLFFVFLQDYPPPRA.................................LW
O74723_NEUCS/406-766--------------KIILCYFFGFFLLGLVGLLPWILHEDRWGQVVD.........................QAGQSRVW
NTPJ_ENTHR/117-435--------------IYILKFAVVIQVIGAVALSVVFIPEFGWAKG.................................IW
Q9HPA9_HALSA/196-554--------------KIHPSVVSTVRTVWKLVVGYTVVGVAVLFVAIRASD..................YGAALPVWDAAW
KTRD_BACSU/117-435--------------KQVLFLILWIEFFGGLILGTYFLTYYDSYQEA................................YL
Q9P8G2_CANAX/615-975--------------KIIVVYYVGFNIIPGVMLSIWIYCMPHYKNLMI.........................SSSISPAW
O59477_PYRHO/169-489--------------RILPNFVNTAKIIVQIYTGLTILGAYLYYIN..............................GMSLF
Q41515_WHEAT/178-533--------------YVVFGYFAMIHVLGFLLVFLYITHVPTASAPLN.........................KKGINIVL
TRKG_ECOLI/155-483--------------PGPFKDDKLTPRLADTSRTLWITYSLLGIACIVC.......................YRLAGMPLF
TRK2_SCHPO/479-850--------------VILVVYFLFWHILGLVAFLIFIYTAKTSGRVVT.........................DGGINRGW
Y322_MYCGE/143-543--------------LVSIIFLFIVELIYGFLYGILFYFIPGFEPANLFADHAKVSTQLKALVVDSNQTIAAFNDINKAFQ
O87953_VIBAL/125-442--------------KKIVTFALVAEAIGFVFLSYRWVPEMGWQTG.................................MF
O67474_AQUAE/108-430--------------KRVFSFVFITELTGAILLSIYFS.LKGVEDP.................................VF
KTRB_BACSU/117-432--------------KVLFLFSISIELIAALILSIRLVPQYGWSSG.................................LF
O29419_ARCFU/149-474--------------PG.VSLSKLKPRIRDTALSLYKVYLLLTIAEVAL.......................LYALGLSLF
Y460_MYCPN/151-550--------------VVSVLFLFMVELLYGFLYTILFYFIPAFESASVFQSSGKVSNQLKALIVDSTKRLPVVHNLNLAFQ
TRK2_YEAST/450-839--------------CILMVYYIGFNILAFVTIVPWACTRHHYSEIIR.........................RNGVSPTW
TRK1_SCHPO/454-809--------------SMVTLYFIIFNIAAFVTFIVFAYTAVGSREVID.........................SYDLRRGW
TRKH_HAEIN/152-485--------------SGPLKDQKSLPKISEVAKALWIIYASLTVLCAIA.......................YWLSGMNLF
Q9P851_SCHOC/570-932--------------KILIFYYVGFHILAFIFLLPWILKMPNYSNIVR.........................EQGVSPTW
O83176_TREPA/234-561--------------KLIIFSTFFIEALSALFLFVGFSQTEGYTIQS................................LG

PF03814

ATKA1_STAAM/3-556FENMCFKIIGT.DLEHMSAKTYVKHFLAFNGFMGFITFVLLIVQQWLF--------------------LNPNHILNQSID
ATKA_ANASL/8-556IERSIYVISGVRPKDDMTGWQYIRAILYTNLFMGILVYSLIHYQRLLP--------------------WNPNGFGVPRWD
ATKA_HALSA/10-579IENGLYRLSGINPRREMTWKGYLKAVLVFNVCIWVLLFVVLMFQDALP--------------------MNFVGVGGESWD
ATKA_RHILO/9-560LERGLYRICGTSEREEQHWTAYAVALLLFNLAGFLVLYALQRLQGSLP--------------------YNPAGMGAVDPA
ATKA_ALIAD/9-560VERAIYRLIGVNPEVEMDWKAYLRAMMVSNLVMALFAYAVFRLQGVLP--------------------LNPAHIPAMPPY
ATKA_MYCTU/9-569IERVIYQVCRVDPGSEQRWSTYALSVLAFSVMSFLLLYGIARFQGVLP--------------------FNPTDKPAVTDH
ATKA_PSEAE/9-561LERVCYRLFGVDPASEQDWKTYTLALLAFNLAGLVLLFSILMLQGSLP--------------------LNPQHLPGLEWT
ATKA_THEAC/27-578IISFFERMIGESPDHGMTFKEYFINLLLFNFFAGLISFLVIMFQKYLP--------------------F.SYDTVGMSPS
ATKA_CAUCR/9-561VEGLFYKACGVDPSKSQSWHAYALALLAFNLIGFVFVYAVLRLQGVLP--------------------LNPQGFPGLSGH
ATKA_ECOLI/9-557VERVLFRALGVSDR.EMNWKQYLCAILGLNMLGLAVLFFMLLGQHYLP--------------------LNPQQLPGLSWD
ATKA_STRCO/11-553IEKWIYKSIGADPDTEMRWPAYLRGVLAFSLAGVLFLYLLQRLQGVLP--------------------G.SLGFASIDPD
ATKA_SYNY3/8-556LESLIFAGSGITKHPSMGATQYVSAALISNLVMGVFVFLILMFQGSLP--------------------LNPTGLAAPSWD
ATKA_DEIRA/8-560LERLTYRVIGINPRERMDWKRYGLAIVVSNLVMLLLAYLLIRLQGALP--------------------WNPAGLAAQSPD
ATKA_CLOAB/6-556IDGFIYKLSGIQKEEEMNWKQYIFALLMCNAVPAIIGYIILRIQAVGI--------------------FNPNHVKGMEQG

PF08016

PKD1_MOUSE/3701-4103------------------------------------------ACTARPDTW..ARCLLVILTAA--TGLVRLAQLGIADR
PKD2_MOUSE/265-685------------------------------------------LSYFR.SFWNCLDVVIVVLSVV--AMVINIYRMSNAEG
Q15142_HUMAN/3046-3448------------------------------------------WRVLRLGAW..ARWLLVALTAA--TALVRLAQLGAADR
Q8T8Z2_DROME/169-596------------------------------------------PAAAH.EAWTMVDLAIYILNVF--LTVLAIMRDIETDA
O42181_TAKRU/3850-4245------------------------------------------YTYLL.STWRALGICKLALAAS--VCGLHLSRCTMATQ
PKDRE_MOUSE/1621-2051------------------------------------------ASYIR.SVYNLLNFSLKCMFAL--LIVLFFWKYFLATK
Q95V80_STRPU/2211-2645------------------------------------------RKYLS.DKWNLLEIAIIVNCIV--SAGLYIYRYVITKQ
PKD2_CAEEL/119-538------------------------------------------LHYLT.QFWNLVDVVLLGFSVA--TIILSVNRTKTGVN
Q80ZH4_MOUSE/145-567------------------------------------------LRYLS.SVWNILDLVVILLSIV--AVGFHIFRTLEVNR
Q9VVZ8_DROME/165-591------------------------------------------PRQLK.TLWVQVDAMIVALSLV--VGMIMSVRDNLVQK
PKDRE_HUMAN/1748-2178------------------------------------------ASYVR.SVYNLLNFALKCIFTV--LIVLFLRKHFLATG
Q9VK95_DROME/402-803------------------------------------------KIYFC.SMLNILDCAILLGCYL--ALVYNIWHSFKVMS
Q9U1K9_DROME/160-576------------------------------------------PHLLK.SVWNKLDLFIFMVNVL--VVVLVVLRESLVAS

PF00520

KCNS1_MOUSE/243-427............--------------------------....RNFFC-HPLNLIDIVSVLPFYL--TLLAGAALGDQRGA
KCNAL_DROME/231-405............--------------------------....CKFVR-SVMSIIDVVAIMPYYI--GLGITDNDDVS...
TRPC6_MOUSE/495-726............--------------------------....KEYLF-ELWNMLDFGMLAIFAA--SFIARFMAFWHASK
TRPA1_HUMAN/775-960............--------------------------....RNYFM-DISNVLEWIIYTTGII--FVLPLFVEIPAHL.
CAC1C_HUMAN/161-404.....H......--------------------------...PNAYLR-NGWNLLDFIIVVVGLF--SAILEQATKADGAN
CAC1C_HUMAN/558-752............--------------------------....QAYFV-SLFNRFDCFVVCGGIL--ETILVETKIMSP..
CAC1C_HUMAN/955-1185.....H......--------------------------...KGSFCR-NYFNILDLLVVSVSLI--SFGIQSSAIN....
CAC1C_HUMAN/1273-1523............--------------------------....KGYFS-DPWNVFDFLIVIGSII--DVILSETNHYFCDA
KCNS3_HUMAN/224-405............--------------------------...QKKFWK-NPLNIIDFVSIIPFYA--TLAVDTKEEESED.
ITPR1_MOUSE/2362-2588............--------------------------.....AMVL-DVEFLYHLLYLLICAM--GLFVHE........
TRPC3_HUMAN/427-658............--------------------------....REYIL-QLWNVLDFGMLSIFIA--AFTARFLAFLQATK
KAT2_ARATH/93-295.LLV.DKP....--------------------------KKIAIRYLS-TWFA.FDVCSTAPF.Q--SLSLLFKYNGSE..
SCN4A_HUMAN/159-446...D........--------------------------...DFTFLR-DPWNWLDFSVIMMAYL--TEFVDLGN......
KCNQ4_HUMAN/134-318..RG.WQ.....--------------------------..GRFRFAR-KPFCVIDFIVFVASVA--VIAAGTQG......
SCN7A_HUMAN/146-393...G........--------------------------...SFSFLG-DPWNWLDFSVTVFE.V--IIRYSPLDF.....
SCN7A_HUMAN/539-728............--------------------------....YGYFQ-VGWNIFDSMIVFHGLI--ELCLANVAG.....
SCN7A_HUMAN/970-1192............--------------------------....KAYFS-NGWYRLDFVVVIVFCL--SLIGKTREE.....
SCN7A_HUMAN/1285-1495............--------------------------......YFT-IAWNIFDFMVVIFSIT--GLCLPMTVGSYLV.
ITPR2_HUMAN/2317-2540............--------------------------.....AVIL-DMAFLYHVAYVLVCML--GLFVHE........
TRPC2_MOUSE/704-920............--------------------------....RSYLL-DWWNFLDVVILSLYLA--SFALRLLLAGLAYM
CAC1E_HUMAN/1512-1722............--------------------------....LNYFR-DTWNIFDFITVIGSIT--EIILTDSKLVNT..
TRPA1_CAEEL/873-1068............--------------------------....FAYLV-NWENWIDCFIYSTALI--TVYDFSECSATSGV
TRPA1_DROME/932-1126............--------------------------....LHYIL-ETVNLISWVLYISALV--MVTPAFQPDGGIN.
CAC1F_HUMAN/129-371.....H......--------------------------...PSAYIR-NGWNLLDFIIVVVGLF--SVLLEQGPGRPGDA
TRPM1_HUMAN/862-1075...S.Q......--------------------------..KIKVWLQ-EYWNITDLVAISTFMI--GAILRLQNQPYMG.
KCNA1_HUMAN/223-407............--------------------------....TDFFK-NIMNFIDIVAIIPYFI--TLGTEIAEQEGNQK
CAC1S_HUMAN/88-333.....H......--------------------------...QDAYLR-SGWNVLDFTIVFLGVF--TVILEQVNVIQSHT
CAC1S_HUMAN/466-660............--------------------------....RQYFM-SIFNRFDCFVVCSGIL--EILLVESGAMT...
CAC1S_HUMAN/834-1064.....H......--------------------------...KGSFCR-NYFNMLDLLVVAVSLI--SMGLESSAIS....
SCN5A_HUMAN/159-412.....H......--------------------------...AFTFLR-DPWNWLDFSVIIMAYT--TEFVDLGN......
SCN5A_HUMAN/1241-1469............--------------------------....KKYFT-NAWCWLDFLIVDVSLV--SLVANTLGFAE...
SCN5A_HUMAN/1562-1771............--------------------------....HYYFT-NSWNIFDFVVVILSIV--GTVLSDIIQKYFF.
KCMA1_RAT/217-388............--------------------------....LWFWL-EVNSVVDFFTVPPVFV--SVYL..........
Q9W433_DROME/339-611............--------------------------...KNTYLA-DSWNRLDFFIVLAGLL--EYVMHVENL.....
Q9W433_DROME/1265-1459............--------------------------....FRYIA-NGFNVFDGIIVILSAI--EICQTFMGNGTGG.
Q9W433_DROME/2181-2406.....G......--------------------------...HDAYFT-SGWNIMDGSLVTISII--DLLMSLISESSPR.
NALCN_RAT/73-321.....G......--------------------------...DSSYVK-DRWCVFDGFMVFCLWV--SLVLQVFEIADIVD
NALCN_RAT/420-598............--------------------------....TGYIS-SSLHKFELLLVIGTTL--HVYPDLYH......
NALCN_RAT/920-1155.....T......--------------------------...PTAVIR-DFGGVMDIFIYLVSLI--FLCWMPQNVPA...
NALCN_RAT/1243-1446............--------------------------....AGFWQ-SRRNRYDLLVTSLGVV--WVVLHFALLNA...
TPC1_ARATH/154-304............--------------------------....LAFDF-LPFRIAPYVRVIIF..--..IL..........
TPC1_ARATH/466-671............--------------------------....ENYWR-EGANRFDFLVTWVIVI--GETATFITPDENTF
TRPM2_HUMAN/830-1048..CG.LM.....--------------------------.KKAALYFS-DFWNKLDVGAILLFVA--GLTCRLIPATLY..
SCNA_DROME/180-428.....C......--------------------------...PFTYLR-DAWNWLDFVVIALAYV--TMGIDL...G....
SCNA_DROME/1337-1559............--------------------------....KVYFT-NAWCWLDFVIVMVSLI--NFVASLVGAG....
SCNA_DROME/1653-1859............--------------------------....YHYFI-EPWNLFDVVVVILSIL--GLVLS....DIIEK
SCNBA_HUMAN/611-810............--------------------------....YHYFR-RGWNIFDSIVALLSFA--DVMN.....CVL..
SLO_DROME/166-336............--------------------------....LWFML-EMYSFVDYFTIPPSFV--SIYLDRTWI.....
Q20766_CAEEL/931-1129...I.NE.....--------------------------..KVKVFYA-KWYNIWTSAALLFFLV--GYGFRLVPMYRHS.
TPC1_HUMAN/142-319............--------------------------....HTFIR-HKRTMVKTSVLVVQFV--EAIVVLVRQM....
TPC1_HUMAN/477-686............--------------------------....VEYLS-SGWNLFDFSVTVFAFL--GLLALALNMEP...
Q18351_CAEEL/295-478............--------------------------....RQFVK-KTLNIIDLSTILPFYL--EICLPLFGVESRL.
TRPV2_MOUSE/441-640............--------------------------....ISFMD-SYFEILFLVQALLTVL--SQVLRFVE.TEW..
CAC1A_DROME/1129-1336............--------------------------....KNFFK-DPWNIFDLITVLGSIV--DALWMEFG.HDDS.
CAC1A_HUMAN/135-359.....H......--------------------------...KGSYLR-NGWNVMDFVVVLTGIL--ATVGTEFD......
CAC1A_HUMAN/1279-1510.....H......--------------------------...QGAYFR-DLWNILDFIVVSGALV--AFAFTGNSKG....
CAC1A_HUMAN/1600-1810............--------------------------....LNYFR-DAWNIFDFVTVLGSIT--DILVTEFGNNF...
O02037_BDECA/160-406.....N......--------------------------...DFTYLR-SIWNWLDFLVIGLA..--.YLMFIEPDL....
O02037_BDECA/1022-1247............--------------------------....YKYFK-DPWSCLDFAIVMIALI--SLMPFDMSRY....
O02037_BDECA/1341-1543............--------------------------......YFK-DPWNVFDFSVVVFSTI--AWILQFFESIFPL.
O02038_CYACP/150-380.....H......--------------------------...PGAYLR-NGWNILDFSIVVIGFA--SMIFEEYLK.....
O02038_CYACP/531-726............--------------------------....YGYLN-SLFNRFDCLVVLSSLL--EVAI.....TVPT.
O02038_CYACP/904-1135.....H......--------------------------...KRSFCR-SFFNQLDLVIVAVSWA--AIMLSR...G....
O02038_CYACP/1223-1425............--------------------------.....NYFR-DPWNIFDFVIVVGSIA--DIII.....GEISK
O04242_MAIZE/98-298.YLL.EDD....--------------------------PKRIAWRYT-TSWFVLDVASTIPS..--EFARKILP.PDLR.
O04703_SOLTU/123-326.QLL.VRD....--------------------------RRKIATRYV-STWFLMDVASTIPFDL--LAMLFTGK.HQV..
SCN9A_RAT/154-401.....G......--------------------------...EFTFLR-DPWNWLDFVVIVFAYL--TEFV..........
O08661_RAT/376-542............--------------------------......FLY-LAWY..MTMSVLGHYN--NFFFAA........
O13054_MAKNI/4820-4980............--------------------------....MSLLG-HYNN..FFFACHLLDI--AMGV..........
CCH1_SCHPO/218-481SFYDFINSYTKK--------------------------TPRTMSYLR-HSWNRVDFVAIVALWI--SVIGKKQQ.G....
CCH1_SCHPO/550-743............--------------------------...YRLFFR-RYTNLVDIVLAVLNLV--TLLPSIRK.NP...
CCH1_SCHPO/982-1212.....T......--------------------------...PNAYLR-STWNCIDFFVLVTLWI--NLYAVLTS.HA...
CCH1_SCHPO/1302-1505............--------------------------....YYFFH-SFWNMFDVVVTLGSLT--CNIAILAKFENRS.
O17535_CAEEL/261-439............--------------------------....IRFFK-SPLNMIDLVATLSFYA--DAMMVRVVEDEP..
O18324_BLAGE/4-195............--------------------------......FIT-VIGSIIDALVIKLG..--ENFI..........
TRPC1_BOVIN/457-645............--------------------------......KFH-DFADRKDWDAFHPTLV--AEGLFAFA......
KCNH1_BOVIN/252-498.GEV.ISDP...--------------------------KLIRMNYLK-TWFV.IDLLSCLPYDV--INAFENVDEVSAFM
O24382_SOLTU/97-297.YLL.VDE....--------------------------HKKIAWKYM-STWFLFDVISTIPS..--ELAVKISPKPLR..
O24538_VICFA/90-293.HLL.VRD....--------------------------SKKIVVRYL-STWFIMDVASTIPYEA--.IGFILTG.KHKL.
TRPC4_RAT/436-620............--------------------------....KYSAL-NPRE..SWDMWHPTLV--AEAL..........
KCNS2_MOUSE/229-409............--------------------------....LKFFK-NALNLIDLMSIVPFYI--TLVVNLVVESSPT.
CAC1S_CHICK/92-278............--------------------------.....GYFG-DPWNVFDFLIVIGSII--DVILSEIDDPDDN.
O42421_CHICK/5-206............--------------------------......RVL-RALK..TISVVPGL..--..............
KCNQ3_HUMAN/158-351..YK.GW.....--------------------------.RGRLKFAR-KPLCMLDIFVLIASVP--VVAVGNQGN.....
KCNQ2_HUMAN/128-312..YR.GW.....--------------------------.RGRLKFAR-KPFCVIDIMVLIASIA--VLAAGSQGN.....
O44164_CAEEL/265-484.GEV.VIEP...--------------------------SVIRQNYFK-SWFL.IDLLSCLPYDI--FYMFKRDDER....
O44930_AIPPA/138-380.....H......--------------------------...EYAYLR-DPWNWLDFVVVILGYV--TLVP..........
O44930_AIPPA/657-846............--------------------------.....GYIK-SRWNIFDGFIVVISMV--DLMVELLVDDH...
O44930_AIPPA/1083-1306............--------------------------....VSYFR-NCWNCLDVLIVFVPVS--SVIADSSNQD....
O44930_AIPPA/1402-1607............--------------------------....LHYFR-EPWNVFDFVIVVLSIL--GIILEHLEYELF..
O46129_LOLFO/396-624............--------------------------....LEYIH-DMWNIMDLVTNSLYMA--TFTLRLLAWLQVRR
SCNAA_CANFA/155-405.....N......--------------------------...EFAYLR-DPWDWLDFSVITLAYI--GEATA.........
SCNAA_CANFA/708-898............--------------------------....YYYFQ-KRWNIFDCIIVTVSLI--ELGAARKGS.....
SCNAA_CANFA/1195-1424............--------------------------.....KYFT-NAWCWLDFLIVNISLI--SLIA.....KIL..
O49846_9LILI/11-193............--------------------------......YTR-TWLI.LDVASTIPS..--DLARKMLPQKLQ..
O54812_CAVPO/76-278............--------------------------....HYYFT-IGWNIFDFVVVILSIV--GMFLA....DIIEK
KCNH6_RAT/302-515.EVV.SHP....--------------------------RRIAVHYFK-GWFL.IDMVAAIPF..--DLLIFRTGSDET..
CAC1G_RAT/119-394............--------------------------...KKCYLG-DTWNRLDFFIVIAGML--EYSLDLQNV.....
CAC1G_RAT/778-964............--------------------------....FGYIK-NPYNIFDGVIVVIS.V--WEIVGQQGG.....
CAC1G_RAT/1291-1515.....G......--------------------------...EQAYLR-SSWNVLDGLLVLISVI--DILVSMVS.DSG..
CAC1G_RAT/1613-1818............--------------------------....RRFFQ-DRWNQLDLAIVLLSIM--GITLEEIEVNLSL.
CAC1S_LITCT/88-331.....H......--------------------------...TDAYLR-NGWNILDFTIVSVGVF--SVLLEQ...ISKLQ
CAC1S_LITCT/465-659............--------------------------....QSYFM-SLFNRFDSFVVCTGLL--EVMLVASDIMS...
O61220_CAEEL/521-763.KKW.WNVL...--------------------------TAFPAKITF-KLTY.FLVLAMIPT..--RLACDLSPVLLVV.
O61567_HOMAM/1241-1406............--------------------------......FLY-NLWY..LTFSVLGN.I--NYFFFAAH......
O62604_POLPE/521-713............--------------------------.....GYIR-NRWNVFDGLLVIVSII--DIVLSNADVVK...
O62604_POLPE/945-1166............--------------------------....MKYFT-NFWNLLDVFIVCISLS--SLFGK.........
O62604_POLPE/1260-1469............--------------------------....LEYFK-YGMNVFDFVIVVFSIA--VIIMIEYDEEFFV.
TRPC2_BOVIN/6-182...D.G......--------------------------..AACHYFT-SAER.SEWRTEDPQFL--AEVL..........
TRPC5_RABIT/405-624............--------------------------....TEYIH-DWWNLMDFAMNSLYLA--TISLKIVA.YVKYN
O65816_HORVU/144-390............--------------------------....AKRYL-STYFLIDVCAVLPLPQ--VVIWIVLPTLQVSQ
O70368_RAT/6-196............--------------------------.....ILVT-EFGN.PNNFINLSF..--..............
HCN4_MOUSE/297-513.TEI.ILDP...--------------------------QRIKMKYLK-SWFV.VDFISSIPVEY--IFLIVETRIDSEVY
KCNG2_CHICK/260-452............--------------------------....CAFLK-TPLNIIDILAILPFYI--SLIVDMASTKNSSK
O73697_TAKRU/474-668............--------------------------....RAYFM-SLFNRFDFFVVLCGIL--EMIMFSAG.AVT..
O73697_TAKRU/1162-1386............--------------------------.....GYFG-DPWNVFDFIIVIGSVV--DVILSEVDTALASS
CAC1D_CHICK/158-400.....H......--------------------------...PNAYVR-NGWNLLDFVIVVVGLF--SVILEQLTKETEGG
CAC1D_CHICK/1260-1492..VR.KK.....--------------------------.ERWLGYFS-DAWNTFDSLIVIGSIV--DVVLSEADPKPTET
O76266_HIRME/254-434............--------------------------....IMFWF-GFQNLIDVTAVVPYYV--TLFNVV...STMSC
O76457_APLCA/233-409............--------------------------....LDFLK-APVNIIDIVATLSFYL--DFMLTELKQES...
O77089_PANAR/2376-2612............--------------------------....YHVIY-LVFC.VLGLSVHPF..--.CYSVL........
CNGC6_ARATH/157-431FGRG.ELVI..D--------------------------PAQIAKRYL-QQYFIIDLLSVLPVPQ--IIVWRFLYTSRGAN
SCN8A_RAT/1232-1461............--------------------------....VKFFT-NAWCWLDFLIVAVSLV--SLIANALG.Y....
SCNBA_RAT/158-394.....D......--------------------------...EFSFLR-DPWNWLDFIVIGTAIA--TCFPGSQVN.....
SCNBA_RAT/606-797............--------------------------....YHYFR-HGWNVFDSIVALLSLA--DVLYNTLSDN....
SCNBA_RAT/1070-1287............--------------------------....RRYFT-SAWCWLDFLIVVVSVL--SLMN..........
SCNBA_RAT/1380-1583............--------------------------....QHYFT-NGWNLFDCVVVVLSII--STLVSRLEDSDIS.
HCN2_MOUSE/219-431.TEI.ILDP...--------------------------EKIKKKYLR-TWFV.VDFVSSIPVDY--IFLIVEKGIDSEVY
HCN1_MOUSE/166-382.SEI.ILDP...--------------------------KVIKMNYLK-SWFV.VDFISSIPVDY--IFLIVEKGMDSEVY
KCNH3_RAT/273-507............--------------------------...ICLHYV-TTWFLLDVIAALPFDL--LHAFKV...N....
CAC1H_HUMAN/138-418............--------------------------...QKCYLG-DTWNRLDFFIVVAGMM--EYSLDGHNV.....
O96057_HALRO/84-316.....H......--------------------------...PNAYLR-NGWNVIDFVIVVIGLV--SIVLETANVGS...
O96057_HALRO/463-658............--------------------------...MQQYFV-SLFNRFDCFVVCGGIV--ELVLTSSKIME...
O96057_HALRO/839-1070.....H......--------------------------...KGSFCR-SYFNLLDLLVVAVSLV--SMLSNSDK......
O96057_HALRO/1158-1372............--------------------------....RGYLS-DPWNVFDSLIVIGSIV--DIVFSELD.HGNE.
O96310_HELVI/265-424............--------------------------....FSVMG-NFNN..FFFAAHLLDV--AVGF..........
O96385_PARTE/190-371............--------------------------....WHYIK-GDFA.LDLAIVLPFIL--SWMG..........
O97017_9CNID/118-350.....H......--------------------------...PGAYLR-NGWNILDFVIVVVGLA--TILVKATL.S....
O97017_9CNID/503-698............--------------------------....HGYFA-SLFNRFDCLVVISSLL--ELAITE...ALKQ.
O97017_9CNID/885-1115.....H......--------------------------...KGSFCR-SAFNLLDLLVVSVSVI--SISLRTSQ......
O97017_9CNID/1203-1410............--------------------------.....NYFT-DRWNLFDFIIVVGSII--DITMNEVSSEQ...
SCNA_ELEEL/150-401.....G......--------------------------...HFTFLR-DPWNWLDFSVVTMTYI--TEFID.........
SCNA_ELEEL/600-789............--------------------------....YYYFQ-QTWNIFDSIIVSLSLL--ELGLSNMQG.....
SCNA_ELEEL/1036-1263............--------------------------.....RYFT-DAWCWLDFVIVGASIM--GITSSLLG.Y....
SCNA_ELEEL/1356-1566............--------------------------....QYFFT-VGWNVFDFAVVVISII--GLLLS....DIIEK
SCN1A_RAT/156-422.....E......--------------------------...DFTFLR-DPWNWLDFTVITFAYV--TEFVDL...G....
SCN1A_RAT/802-991............--------------------------....YYYFQ-EGWNIFDGFIVTLSLV--ELGLANVEG.....
SCN1A_RAT/1254-1482............--------------------------...YQTYFT-NAWCWLDFLIVDVSLV--SLTANALG.Y....
CAC1S_RABIT/1152-1380............--------------------------....RGYFG-DPWNVFDFLIVIGSII--DVILSEID.TFLAS
KCNAS_DROME/281-477............--------------------------....LNFCR-DVMNVIDIIAIIPYFI--TLATVVAEEEDTLN
SCN5A_RAT/752-941............--------------------------....YYYFQ-QGWNIFDSIIVILSLM--ELGLSRMGN.....
KCNA6_RAT/266-458............--------------------------....AAFFR-NIMNIIDLVAIFPYFI--TLGTELVQ.RHEQQ
KCNAB_DROME/476-658............--------------------------....WKFFK-GGLNIIDLLAILPYFV--SLFLLETNKNATD.
KCNAW_DROME/233-412............--------------------------....WEFIK-SSVNIIDYIATLSFYI--DLVLQRFA.SHLE.
CAC1S_CYPCA/107-350.....H......--------------------------...EGAYLR-NCWNILDFVIVFMGLF--TLVVDT...INTIA
CAC1S_CYPCA/481-675............--------------------------....RAYFM-SIFNRFDCFVVTIGIL--EIILVVSNIMT...
CAC1S_CYPCA/850-1080.....H......--------------------------...TGSFCR-NSFNILDLIVVGVSLL--SMGMES...S....
CAC1S_CYPCA/1168-1401............--------------------------.....GYFG-DPWNVFDFIIVVGSIV--DVVLSEVDAALEAR
ITPR_DROME/2410-2680............--------------------------...RFIFLL-GPES....TLCLLGVV--TVTLKSVHIVSIMG
SCN1A_HUMAN/1575-1785............--------------------------....HYYFT-IGWNIFDFVVVILSIV--GMFLAELIEKYFV.
TRPL_DROME/432-668............--------------------------...MKSYLR-NMWNFIDFLRNSLYVS--VMCLRAFAYIQQAT
CCH1_YEAST/804-998............--------------------------...MWKFLT-KPSYVYDFIISIITLV--ISCLAV...EGV..
CCH1_YEAST/1244-1472.....S......--------------------------...PNAYLR-NPWNFIDFCVLISMWI--NLIAYLKNNG....
CCH1_YEAST/1563-1767............--------------------------....RLYFR-QKWNSIRLSIIIIAFI--MNAVAF...HVPAS
KCNQ1_HUMAN/158-347..YV.GL.....--------------------------.WGRLRFAR-KPISIIDLIVVVASMV--VLCVGSKGQ.....
CAC1A_RAT/523-715............--------------------------....RPYFH-SSFNCFDCGVIIGSIF--EVIWAVIKPGT...
CNG_ICTPU/175-364.LLV.KDL....--------------------------AKLRDNYIR-TLQFKLDFLSILPT..--ELLFFVTGYV....
CAC1B_DISOM/1502-1704............--------------------------....LNYFR-DAWNVFDFVTVLGSIT--DILVTELA.DS...
CAC1E_DISOM/139-362.....H......--------------------------...KGSYLR-NGWNVMDFIVVLSGLL--ATAATHFN......
CAC1E_DISOM/1140-1373.....H......--------------------------...EGSYFR-DVWNILDFIVVSGALV--AFAFTNLIGGSS..
CAC1E_DISOM/1463-1662............--------------------------....LNYFR-DSWNVFDFVTVVGSIS--EIIVTE...CNL..
P90670_APLCA/165-419.....K......--------------------------...PFTYLR-DPWNWLDFFVISIAYM--TMTVKS........
P90670_APLCA/788-983............--------------------------....VIYFK-DGWNIFDSIIVALSLM--ELSMTKLPG.....
P90670_APLCA/1214-1440............--------------------------.....TYFT-DAWCWLDFTIVMLSIV--MLVADLTASEEG..
P90670_APLCA/1534-1731............--------------------------....WYYFK-IPWNVFDFVVVVLSIL--ASSLSEFEDSFFI.
P91256_CAEEL/249-433............--------------------------....LRFAL-KPLNLVDLLAIVPFYL--ELLLTLCGVDDRKL
CAC1A_DROME/75-312.....H......--------------------------...KHSYLR-NIWNIMDFFVVVTGFM--TQYPQIGPEV....
CAC1A_DROME/475-666............--------------------------....RIYFE-SSFNRFDCVVISGSIF--EVIWSEVKGGS...
CAC1A_DROME/804-1039.....H......--------------------------...PGSYLR-EFWNIMDAVVVICAAV--SFGFDMSG.SSA..
P91744_LOLBL/102-336.....H......--------------------------...KGSYLR-NVWNIMDFVVVVTGFI--SIFPASNSF.....
P91744_LOLBL/515-708............--------------------------....RLYFQ-SSFNIFDCVVILVSII--EVIWSAIKDGS...
P91744_LOLBL/930-1162.....H......--------------------------...PGSYCR-DAWNILDATVVICALV--AFAFGDAAGG....
P91744_LOLBL/1252-1456............--------------------------....GNYFR-DRWNMFDFIIVIGSII--DVVTTNVL.PSAS.
P91783_POLPE/220-401............--------------------------....YNYLK-NVMSIIDILAILPFFV--DLILFHLNVGTNVV
P91784_POLPE/242-415............--------------------------....FRHAR-ISLSIIDVIAILPFYI--GLAM.....TK...
KAT3_ARATH/120-324.LNV.TDH....--------------------------KLIAKRYLK-SVAFVMDVASTLPIQF--IYKTITGDVGRGQ.
KCNV1_RAT/247-430............--------------------------....CHFLR-KVPNIIDLLAILPFYI--TLLVESLSGSHTT.
P97706_RAT/146-393.....G......--------------------------...SFSFLG-DLWNWLDFSVTLFE..--.LITRSSP......
P97706_RAT/561-749............--------------------------....YGYFQ-ISWHIFDSILVVLGLT--EMLLADIEE.....
P97706_RAT/991-1213............--------------------------.....AYFS-NNWYKLDFMVVIVLCL--SLKGKTRED.....
CNGA1_BOVIN/200-394.LLV.KEE....--------------------------RKLIDKYKS-TFQFKLDVLSVIPT..--DLLYIKFG.WN...
CAC1D_HUMAN/921-1151.....H......--------------------------...KGAFCR-NYFNLLDMLVVGVSLV--SFGIQSSA......
KCNAE_DROME/272-488.GEV.VSDP...--------------------------KVIRMNYLK-SWFI.IDLLSCLPYDV--FNAFDRDEDG....
CNGA2_BOVIN/177-371.LLV.KDT....--------------------------KKLRDNYIH-TMQFKLDVASIIPT..--DLIYFAVG.IH...
CNG_CAEEL/206-410.LVV.REA....--------------------------EKVTKAYWQ-SKQYRIDGISLIPL..--DYILGWPIPY....
SCN1_LOLBL/80-333.....D......--------------------------...KYTYLR-DAWNCLDFTVIMISYI--TLLLQTIN.D....
SCN1_LOLBL/445-628............--------------------------....KQYFK-SGWNICDLVVVVASLI--DLGVEGLKG.....
SCN1_LOLBL/818-1040............--------------------------....VHYYT-HFWTILDFTIVIITVI--SLAASGLGME....
SCN1_LOLBL/1135-1350............--------------------------....IHYLR-NLWNVFDFLVVTLSVM--DAFL.....NDIFG
Q09658_CAEEL/273-452............--------------------------....VTFAT-SVLNIIDFVAIAPFFV--NFFFADTSKSNS..
KCNH2_HUMAN/454-659.EVV.SHP....--------------------------GRIAVHYFK-GWFL.IDMVAAIPFDL--LIFGSGSEE.....
Q16976_APLCA/270-457............--------------------------....RKFIF-SLMNVIDLLALVPLYV--QVIFTKSD.NMQAC
Q17314_CYACP/168-407.....H......--------------------------...KYSYLR-NSWNWLDFFVVIVGYV--TMIPEMNK......
Q17314_CYACP/544-733............--------------------------....RGYAK-NRWNLFDGFLVLASLF--DLILSQ...LKLV.
Q17314_CYACP/1000-1219............--------------------------....IKYFT-NLWNLLDVFIVAISLA--SLFG...NP.....
Q17314_CYACP/1313-1524............--------------------------....LEYFK-SFMNIFDFTIVLISIA--VIVYESSK.SSTDN
Q17354_CAEEL/44-236............--------------------------...SRTYFA-SKFNRFDCVVIVGSAA--EVIWAEVYGGS...
Q17354_CAEEL/376-611.....H......--------------------------...PGSYCR-DFWNILDGIVVTCA..--LFAFGFAGTEGS..
Q17354_CAEEL/701-908............--------------------------....RNYFR-DGWNRFDFVTVVGSIT--DALVTEFGGHF...
Q19464_CAEEL/235-414............--------------------------....HKFVR-SPLTIIDVISTGAFFF--ESLL.....HAILI
Q23974_DROME/300-504.EVV.SNS....--------------------------KQIAINYLR-GWFA.LDLLAALPFDH--LYASDLYDGE....
CAC1D_DROME/652-877.....H......--------------------------...NGAYLR-NGWNLLDFTIVVIGAI--STALSQLMK.....
CAC1D_DROME/1019-1214............--------------------------....QGYFV-SLFNRFDCFVVIGSIT--ETLLTNTGMMP...
CAC1D_DROME/1379-1609.....H......--------------------------...DGAFCR-SAFNLLDLLVVCVSLI--SLVSSSNA......
CAC1D_DROME/1697-1925............--------------------------.....NYFG-DAWNVFDFIIVLGSFI--DIVYSEIKSKDTSQ
CNG_DROME/144-346.LVR.DAF....--------------------------RLRRHYFHT-KGWY.LDVLSMLPT..--DLAYIWWP.PETCS
Q25150_HALRO/156-465.....S......--------------------------...SFTYLR-DPWNILDISVIFTAYL--DIVMALAQKASDGG
Q25150_HALRO/833-1021............--------------------------....FQYFQ-DPWNCFDSVIVSFSLL--EYALQSVGG.....
Q25150_HALRO/1297-1535............--------------------------.....KYFT-NAWCWLDFLIVGVSLI--SLIAEALGMD....
Q25150_HALRO/1628-1838............--------------------------....FYYFK-NPWNVFDFIVVILSVV--GSTMNEVIKQYFL.
Q25376_LOLOP/220-403............--------------------------....LDFFK-DSMNAIDVVSIMPYFI--TLGTVIQN.DTNTQ
Q25377_LOLOP/158-400.....E......--------------------------...PFTYLR-DAWNWLDFVVIGLAYL--TEVVD.........
Q25377_LOLOP/626-812............--------------------------....QTYFK-DPWNVFDSFIVFLSLM--ELGLGGIQG.....
Q25377_LOLOP/1059-1284............--------------------------...WKKYFT-DAWCWLDFLIVAVSII--MLAA.....ESI..
Q25377_LOLOP/1378-1588............--------------------------....FYYFK-EPWNIFDFVVVVLSIL--GIALS....DIIKQ
CAC1M_MUSDO/1143-1366............--------------------------.....NYFG-DAWNTFDFIIVLGSFI--DIVY.....SEIKT
Q26039_PANIN/184-355............--------------------------....WKFFK-GAMNVIDLLAILPYFV--SLFLIESNKHTDQ.
Q26094_POLPE/225-397............--------------------------....IKFFL-NTGNIIDFLSILPYYL--SLVLVSSSK.....
Q26095_POLPE/223-398............--------------------------....LQFVK-STLNIVDLVSIIPYYV--TATVGENDSG....
Q26344_APLSP/357-539............--------------------------....WKFFK-GPLNVIDLLAIMPYFI--SLGLTETN.KSTT.
Q27170_PARTE/196-376............--------------------------.....NYLR-SSFF.FDIFVVIPYFI--SLRFD.........
CNGB1_BOVIN/807-993.DII.TDK....--------------------------KEMRNNYVK-SQRFKMDMLCLLPLDL--LYLK..........
SCN4A_HORSE/606-795............--------------------------....YEYFQ-QGWNVFDSIIVTLSWV--ELGLVNVKG.....
SCN4A_HORSE/1064-1291............--------------------------.....VYFT-NAWCWLDFLIVDVSII--SLVANWLG.Y....
AKT2_ARATH/110-312.LLV.REP....--------------------------KQIAVRYLS-TWFL.MDVASTIPFDA--....IGYLITGTST
AKT1_ARATH/91-288.LIV.DDR....--------------------------KQIAFKYLR-SWFL.LDLVSTIPSEA--AMRI.....SSQ..
Q41461_SOLTU/95-299.YLL.VDE....--------------------------PKKIAIRYL-STWFIFDVCSTVPF.Q--SLILVFTG.HKESG
Q63541_RAT/162-411.....D......--------------------------...GFTFLR-DPWNWLDFSVIMMAYV--TEFVDL...G....
CNGA4_RAT/71-265.ILV.VDK....--------------------------GMIASRYVR-TWSFLLDLASLVPT..--DAAYVQLGPHI...
Q90518_TAKRU/157-415.....G......--------------------------...KFSFLW-DPWNWLDFSVILMAYI--TEFVNLGNV.....
Q90519_TAKRU/5-205............--------------------------....KTISV-IPGL..KTIVGALI..--..............
CNG1_CHICK/247-441.LLV.KDE....--------------------------KKLRDHYTQ-TVQFKLDVLSLLPTDL--AYLK.....LGL..
Q93135_BLAGE/4-216............--------------------------....LRTFR-VLRA.LKTVAIVPG..--..............
TRPG_CAEEL/1341-1555...Y.E......--------------------------..KIRTYVC-SFWNCVTILAIIFYIV--GFFMRCFGS.....
Q94447_CALVI/422-658............--------------------------....FDYIM-DLWNIVDFISNMFYVT--WILCRATAWIIVHR
SLO1_CAEEL/180-351............--------------------------....VWFLL-EMYSWIDFFTIPPSFV--AIYLQRNWL.....
KCNH5_RAT/249-467GGEV.ISDP...--------------------------KLIRMNYLK-TWFV.IDLLSCLPYDI--INAFENVDEG....
KCNF1_HUMAN/224-405............--------------------------....LHFAL-SFMNIVDVLAILPFYV--SLTLTHLG.ARMME
SKOR_ARATH/116-328TYRM.IYKR...--------------------------SSIALRYLK-STFI.IDLLACMPW..--DIIYKAAGEK....
SCN3A_HUMAN/156-423.....E......--------------------------...DFTFLR-DPWNWLDFSVIVMAYV--TEFVSL...G....
Q9PRI8_XENLA/442-630............--------------------------......KFH-SIAERKDWDAFHPTLV--VEGLFAFG......
KCNH8_RAT/269-473............--------------------------...ICIHYV-TTWFIIDLIAALPFDL--LYAF..........
TRPV2_RAT/446-645............--------------------------.....SYFE-ILFL.LQALLTVLSQV--LRFM.....ETEW.
TRPV6_RAT/395-577............--------------------------....QTILG-GPFHVIIVTYAFMVLV--TMVMRLTNSDGEV.
KCNH4_RAT/276-479............--------------------------...IGLHYL-ATWFFVDLIAALPFDL--LYVF..........
Q9RW39_DEIRA/69-240............--------------------------...PLRYAL-SFYGLVDLLTILPSYL--SLLFPGTQY.....
CNGC7_ARATH/145-419FGRG.ELVID.P--------------------------AKIAERYLT-RYFV.VDFLAVLPLPQ--IAVWKFLHGSKGSD
AKT5_ARATH/112-312.YLL.VDD....--------------------------PKRIAWRYT-STWLIFDVVSTVPY..--ELFGSLLHNTIQ..
CNG14_ARATH/128-398VFGRGELVKD.P--------------------------KLIARRYLR-SDFI.VDLIACLPLPQ--IVSWFILPSIRSSH
CNGC3_ARATH/130-394GRGE.LNEK..H--------------------------KDIALRYLG-SYFL.IDLLSILPIPQ--VVVLAIVPRMRRPA
Q9SM12_MAIZE/104-307.LLV.RDR....--------------------------KKITLRYLS-TFFI.MDVASTIPF.Q--GLAYLITGEV....
CNG16_ARATH/98-374VFGRGELVMD.R--------------------------REIAIRYLK-SEFV.IDLAATLPLPQ--IMIWFVIP.N....
Q9U5E2_DROME/162-353.LMV.YDD....--------------------------RKLACHYVH-SRDFIFDMIALIPLDL--LQLKMGTHP.....
SCNBA_HUMAN/161-399.....D......--------------------------...EFSFLR-DPWNWLDSIVIGIAIV--SYIPGITIK.....
SCNBA_HUMAN/1092-1307............--------------------------....GKYFT-SAWCCLDFIIVIVSVT--TLIN..........
SCNBA_HUMAN/1400-1603............--------------------------....QYYFT-NGWNLFDCVVVLLS.I--VSTMISTLENQEHI
KCNG1_HUMAN/270-459............--------------------------....FAFLR-SPLTLIDLVAILPYYI--TLLVDGAAAGRRKP
Q9VHY7_DROME/610-800.....S......--------------------------...FRHYVT-QVENIMEWFVITSVFV--ISYIYTNKTYTF..
TRPG_DROME/412-652............--------------------------....QEYLN-DMWNVIDFVTNSLYVA--TVALRVVSFFQVQK
Q9VUD5_DROME/520-718............--------------------------........M-FIENLMTAPSRVMFLF--SCALMMTIPWLRVS
Q9VW35_DROME/377-569...E.F......--------------------------..VNFWYIM-IIFN..DVLLIIGS..--..ALKEQIEGRYLV
PYX_DROME/536-723............--------------------------....RGYAK-YWENWLQWTIGTGVLL--CVTPETVRTDDLTA
PAIN_DROME/531-734............--------------------------....VRYFW-SITNIMEVALITLSIF--TCMESSFDKE....
Q9W2D5_DROME/505-692.GFW.VKNK...--------------------------NLTRKNYMR-KLQFKLDLLALLPL..--ELLYFKLGTQA...
Q9W3W0_DROME/513-653............--------------------------....GSWFL-LMFF..AGAIRLTG..--..............
Q9XH40_SAMSA/112-315.LLV.QDS....--------------------------KQIALRYLS-TWFV.MDVASSIPY..--EALGYLFTGKH...
TRPV5_RABIT/393-578............--------------------------...GQTILG-GPFHVIIITYASLVLL--TMVMRLTNMNGE..
Q9XSP9_RABIT/139-264............--------------------------....TDFFK-NIMNIIDIISIIPY..--..............
Q9XWG9_CAEEL/112-301..YI.GV.....--------------------------.YGRLKFVR-KPITLIDLVVVICSLF--VICFGTEGQ.....
Q9XXD1_CAEEL/281-465............--------------------------...RSKTFR-QLLNIIDLLAILPFII--EMLLLIFGISTEQL
Q9XZC1_BOOMI/498-721............--------------------------.....KYFT-NAWCWLDFVIVLVSFF--NMAVAMMG.Y....
Q9XZC1_BOOMI/815-1019............--------------------------....WHYFR-EPWNMFDFVVVILSIL--GTVLK....DLIAA
TRPV2_HUMAN/444-645............--------------------------.....SYFE-ILFL.FQALLTVVSQV--LCFLA....IEW..
CAC1I_RAT/115-395............--------------------------...KKCYLG-DTWNRLDFFIVMAGMV--EYSLDLQN.I....
Q9ZPL4_SAMSA/115-318.QLL.VRDA...--------------------------KKIAVRYLS-SWFV.LDVASTIPYEA--LSYVITGK.H....

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
Q94253_CAEEL/253-318--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC72_LEIMA/202-273--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O82065_SOLTU/193-268--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRAJA/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8AVI5_XENLA/81-158--------------------------------------------------------------------------------
Q8AVI5_XENLA/191-273--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DAL9_VIBVU/25-105--------------------------------------------------------------------------------
Q8DF13_VIBVU/235-325--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8I6M6_APLCA/77-154--------------------------------------------------------------------------------
Q8J0H6_NEUCS/369-447--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8PI92_XANAC/49-128--------------------------------------------------------------------------------
Q8PT60_METMA/20-95--------------------------------------------------------------------------------
Q8QZZ6_CAVPO/69-146--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8X557_ECO57/148-226--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
Q90ZP4_ONCMY/461-543--------------------------------------------------------------------------------
Q920B6_RAT/120-198--------------------------------------------------------------------------------
Q924I4_RAT/64-145--------------------------------------------------------------------------------
Q924I4_RAT/180-260--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93531_CAEEL/115-196--------------------------------------------------------------------------------
Q93531_CAEEL/236-312--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9AR58_SOLTU/72-154--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9CX88_MOUSE/130-208--------------------------------------------------------------------------------
Q9ERU4_RAT/46-128--------------------------------------------------------------------------------
Q9ERU5_RAT/65-147--------------------------------------------------------------------------------
Q9ESM4_RAT/55-138--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9LLM5_EUCCA/71-153--------------------------------------------------------------------------------
Q9LLM5_EUCCA/192-267--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9V1D2_PYRAB/403-481--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
Q9ZP53_SOLTU/193-268--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/72-154--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/193-268--------------------------------------------------------------------------------

PF01007

IRK5_HUMAN/54-390YIRGDLDH.V...............GDQEWIP......CVENLSGFVSAFLFSIETETTIGYGF--RVITEKCPEG----
IRK10_HUMAN/31-369VAHGDLLELD...............PPANHTP......CVVQVHTLTGAFLFSLESQTTIGYGF--RYISEECPLA----
IRK1_CAEEL/77-422LVHGDLSLP................TPVNHTA......CVMNLDSVYSSFLFAVETHHTIGYGH--RYITTECYLA----
IRK1_HUMAN/43-380YIHKDLPEFH...............PSANHTP......CVENINGLTSAFLFSLETQVTIGYGF--RCVTEQCATA----
IRK3_CHICK/39-385YMRGDLNK................AHDDSYTP......CVANVYNFPSAFLFFIETEATIGYGY--RYITDKCPEG----
IRK4_HUMAN/22-377FFHGDLEASPGVPAAGGPAAGGGGAAPVAPKP......CIMHVNGFLGAFLFSVETQTTIGYGF--RCVTEECPLA----
IRK12_HUMAN/47-381VAHGDLEP................AEGRGRTP......CVMQVHGFMAAFLFSIETQTTIGYGL--RCVTEECPVA----
IRK15_HUMAN/30-365FIHGDLEPGE...............PISNHTP......CIMKVDSLTGAFLFSLESQTTIGYGV--RSITEECPHA----
IRK8_HUMAN/37-380FAHGDIYAYM..............EKSGMEKSGLESTVCVTNVRSFTSAFLFSIEVQVTIGFGG--RMMTEECPLA----
IRK9_HUMAN/25-362YGRGDLEH................LEDTAWTP......CVNNLNGFVAAFLFSIETETTIGYGH--RVITDQCPEG----
IRK2_CAVPO/48-380LLHGDLDAS..................KESKA......CVSEVNSFTAAFLFSIETQTTIGYGF--RCVTDECPIA----
IRK16_RAT/37-358LHHGDLLS..................DPDITP......CVDNVHSFTAAFLFSLETQTTIGYGY--RCVTEECSVA----
IRK11_HUMAN/36-366FAHGDLAPSE.................GTAEP......CVTSIHSFSSAFLFSIEVQVTIGFGG--RMVTEECPLA----

PF00060

GLR27_ARATH/582-833........................................PPHHQIGTSFWFAFSTMN..FAHR..EKVVSNLARFVVL-
GLR34_ARATH/613-869........................................PPRRQLITIFWFSFSTMF..FSHR..ENTVSSLGRFVLI-
Q9VIA5_DROME/402-665..........................................MENRFSFVWFTMLETYLQQGPA.NEIFRLFSTRLLIS-
GLR28_ARATH/577-828........................................PPHHQIGTSFWFSFSTMV..FAHR..EKVVSNLARFVVV-
Q8T0V7_DROME/343-610........................................VGLSTVKSCFWYIFGALLQ.QGGM..YLPTADSGRLVVG-
Q9U0T0_LOLOP/568-841....................................ESNITNDFTISNSLWFSLGAFMQ.QGCD..FSPRSISGRIVGS-
GLR1_CAEEL/591-867....................................GFTISNDFSVYNCLWFTLAAFMQ.QGTD..ILPRSISGRIASS-
Q9VVU7_DROME/338-596............................................SYMDTLNFVWGAMCQ.QGFY..VEVRNRSARIIVF-
Q90278_CARAU/149-409....................................PETEPNHFTLLYSLWYAAGALSL.QGAG..PHPKAVSGRVISC-
Q9TVI0_DROME/547-823..................................EEPEELENQFTINNSLWFTTGALLQ.QGSE..IAPKALSTRTISA-
GLK1_DROME/610-907........................GGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQ.QGCD..ITPPSIAGRIAAA-
GLR2_CAEEL/619-910....................................EFTVTNEFTLYNSLWFTLAAFMQ.QGTD..ILPRAVSGRIASS-
Q9W365_DROME/518-818......................................YACREFTLRESFWFALTSFTP.QGGG..EAPKAISGRMLVA-
Q25412_LYMST/545-818..................................PDTDLVENTFNLSNSFWFTVGTLMQ.QGSD..INPRAVSTRIVGG-
GRID1_HUMAN/562-842........................................SASATLHSAIWIVYGAFVQ.QGGE..SSVNSMAMRIVMG-
Q90279_CARAU/144-405....................................PEKEENSFTLSHSFWYTMGAMTL.QGAG..PHPKALSGRVITS-
GRID2_RAT/566-842....................................SMTST...TLYNSMWFVYGSFVQ.QGGE..VPYTTLATRMMMG-
NMDZ1_HUMAN/559-824....................................EEEEEDALTLSSAMWFSWGVLLNSGIGE..GAPRSFSARILGM-
GLRK_LITBE/161-425....................................PASEQNQFTLLNSLWYGVGALTL.QGAE..PQPKALSARIIAV-
NMDE1_RAT/554-828....................................APHGP.SFTIGKAIWLLWGLVFNNSVPV..QNPKGTTSKIMVS-
NMD3B_HUMAN/574-842....................................T.....VFSYSSALNLCYAILFRRTVSS..KTPKCPTGRLLMN-
GLR29_ARATH/566-820........................................PPQYQIGTSLWFSFSTMV..FAHR..ENVVSNLARFVVV-
GLR31_ARATH/587-839........................................PPRRQIITILWFTFSTMF..FSHR..ETTVSTLGRMVLL-
GLR21_ARATH/574-835........................................PGQYQLSTIFWFSFSIMV..FAPR..ERVLSFWARVVVI-
O76903_DROME/477-751....................................TNVTPYRFSLFRTYWLVWAVLFQAAVHV..DSPRGFTSRFMTN-
GLRK_ANAPL/168-431....................................PKNEENHFTFLNSLWFGAGALAL.QGVT..PRPKALSVRVIAA-
GLRK_XENLA/162-426....................................LSTEQNNFTFLNSLWFGAGAFTL.QGAE..PHPKSVSARIIAV-
GLR22_ARATH/580-842........................................PANYQASTIFWFAFSTMV..FAPR..ERVLSFGARSLVV-
Q9V4A0_DROME/553-829..................................KETDIVENQFSISNSFWFITGTFLR.QGSG..LNPKATSTRIVGG-
Q9VSV5_DROME/630-967PLPAPPGPPTPGAQTAAGAAALQAALSAGSPGSGGSSSAVVNEFSVWNSFWFSLAAFMQ.QGCD..LSPRSVSGRIAAA-
GLRK_LYMST/556-830....................................HSYIANDFSISNSLWFSLGAFMQ.QGCD..ISPRSMSGRIVGS-
NMD3A_RAT/674-942....................................K.....VFSFSSALNVCYALLFGRTAAI..KPPKCWTGRFLMN-
GRIA2_HUMAN/543-824...............................GRETQSSESTNEFGIFNSLWFSLGAFMQ.QGCD..ISPRSLSGRIVGG-
NMDA1_DROME/573-843....................................DSNEEKALNLSSAVWFAWGVLLNSGIGE..GTPRSFSARVLGM-
GLR37_ARATH/578-833........................................PPRRQLSTMLLFSFSTLF....KRNQEDTISNLARLVMI-
GLR11_ARATH/540-781............................................QLSMMLWFGFSTIV..FAHR..EKLQKMSSRFLVI-
Q9VDH5_DROME/545-823..................................AHGEKVESQFTLLNCMWFAIGSLMQ.QGCD..FLPKALSTRMVAG-
GLR14_ARATH/568-810..................................FQQ........IGTLLCFGFSTLV..FAHR..ERLQHNMSRFVVI-
GRIK2_HUMAN/560-831..................................PDSDVVENNFTLLNSFWFGVGALMQ.QGSE..LMPKALSTRIVGG-
O01623_CAEEL/566-855............................AFATNQEAPIVMSNNYSFWNTVWYVLSTMLK.GGCD..FGPRAVSTRLLGG-
NMDE3_RAT/552-826....................................KPGGP.SFTIGKSVWLLWALVFNNSVPI..ENPRGTTSKIMVL-
Q9VMP4_DROME/554-829..................................QDPDELENIWNVNNSTWLMVGSIMQ.QGCD..ILPRGPHMRILTG-
O45028_DROME/553-829..................................NREMERQNIWHLSNALWLVLGSMLN.QGCD..LLPRGLPMRLLTA-
Q19693_CAEEL/134-404.........................................MTVTPFESIWVFFSIFVQ.QGLP..EQPRSWSCRVLVA-

PF15249

B5X552_DROME/1418-1521--------------------------------------------------------------------------------
F8NSX7_SERL9/93-213--------------------------------------------------------------------------------
H3AYR2_LATCH/719-823--------------------------------------------------------------------------------
Q55QM7_CRYNB/131-237--------------------------------------------------------------------------------
H2NZE3_PONAB/668-773--------------------------------------------------------------------------------
Q01LC1_ORYSA/286-403--------------------------------------------------------------------------------
Q4RYD4_TETNG/1-136--------------------------------------------------------------------------------
G3HR60_CRIGR/731-835--------------------------------------------------------------------------------
C3Z068_BRAFL/1333-1438--------------------------------------------------------------------------------
A3CH67_ORYSJ/186-306--------------------------------------------------------------------------------
I1LP29_SOYBN/125-245--------------------------------------------------------------------------------
Q7XVN3_ORYSJ/354-483--------------------------------------------------------------------------------
A8PYV1_BRUMA/646-751--------------------------------------------------------------------------------
D8U255_VOLCA/23-147--------------------------------------------------------------------------------
Q9SRQ0_ARATH/121-240--------------------------------------------------------------------------------
F6Q7W8_XENTR/676-780--------------------------------------------------------------------------------
I1PKQ5_ORYGL/94-212--------------------------------------------------------------------------------
I0Z4J2_9CHLO/35-157--------------------------------------------------------------------------------
H2TKN1_TAKRU/1011-1116--------------------------------------------------------------------------------
D6RLC3_COPC7/97-215--------------------------------------------------------------------------------
H3A9A7_LATCH/1063-1168--------------------------------------------------------------------------------
E7FC48_DANRE/828-933--------------------------------------------------------------------------------
B6U5Z5_MAIZE/33-158--------------------------------------------------------------------------------
E2AU32_CAMFO/2003-2108--------------------------------------------------------------------------------
G0NU71_CAEBE/708-810--------------------------------------------------------------------------------
A8X0V1_CAEBR/811-928--------------------------------------------------------------------------------
B3M7G6_DROAN/504-627--------------------------------------------------------------------------------
A6ZJ71_CAEEL/678-780--------------------------------------------------------------------------------
E0VX25_PEDHC/1662-1767--------------------------------------------------------------------------------
F2USU5_SALS5/118-246--------------------------------------------------------------------------------
B8P3G1_POSPM/122-239--------------------------------------------------------------------------------
E9GC12_DAPPU/1239-1344--------------------------------------------------------------------------------
A3ATB4_ORYSJ/289-371--------------------------------------------------------------------------------
A8JDB0_CHLRE/26-151--------------------------------------------------------------------------------
E3M7Z0_CAERE/718-820--------------------------------------------------------------------------------
A9S0J3_PHYPA/54-177--------------------------------------------------------------------------------
E5S5E0_TRISP/368-478--------------------------------------------------------------------------------
C5YEV3_SORBI/36-162--------------------------------------------------------------------------------
B0E0Z3_LACBS/96-216--------------------------------------------------------------------------------
C5KJB2_PERM5/65-165--------------------------------------------------------------------------------
B0WCV5_CULQU/2345-2450--------------------------------------------------------------------------------
D2A445_TRICA/62-167--------------------------------------------------------------------------------
A7USW6_ANOGA/2823-2926--------------------------------------------------------------------------------
E4WWE2_OIKDI/96-202--------------------------------------------------------------------------------
B3RLC8_TRIAD/434-538--------------------------------------------------------------------------------
D8QC90_SCHCM/85-202--------------------------------------------------------------------------------
D2VJE8_NAEGR/329-435--------------------------------------------------------------------------------
E7F8Y0_DANRE/599-703--------------------------------------------------------------------------------
H2WA87_CAEJA/574-676--------------------------------------------------------------------------------
D5AE81_PICSI/102-222--------------------------------------------------------------------------------
A9RCY5_PHYPA/87-211--------------------------------------------------------------------------------
I1BJQ3_RHIO9/247-352--------------------------------------------------------------------------------
F0ZSB4_DICPU/460-585--------------------------------------------------------------------------------
C1EJG7_MICSR/87-216--------------------------------------------------------------------------------

PF02386

O27332_METTH/161-474DAINNT------------------------------------LTNLSTGGMSIKNMN.IGYYHS...AAVYLVTMLLMIL
Y1485_METJA/160-466DALNLT------------------------------------MTGISTGGMSISNYS..FPYND....FAKIVMIGIMMV
TRK1_YEAST/763-1173WGFWTA------------------------------------MSAFNDLGLTLTPNS.MMSFNK..AVYPLIVMIWFIII
O87729_VIBAL/151-479EAINHA------------------------------------FTTLSTGGYSTSDGS.MNHFSN....GAHWVATTFMFL
TRKH_SHIFL/152-481DAIGHS------------------------------------FATIAIGGFSTHDAS.IGYFDS...PTINTIIAIFLLI
P73949_SYNY3/106-429YAVFHS------------------------------------VSAFNNAGFSLFADN.LIGYQT..SVPLNLTVSALIIF
O74723_NEUCS/406-766WAFFTA------------------------------------NSAFMDLGLTLTPDS.MNSFNT..AVWPLLLMIFLIII
NTPJ_ENTHR/117-435FSIFHA------------------------------------VSSFCNAGFDLLGDSLLADQTN...VYLIMVVSALIIA
Q9HPA9_HALSA/196-554QALNHT------------------------------------MTGLTTGGFSVTDNS.IATYDA...PVIEAALLPIMVA
KTRD_BACSU/117-435HGFFAS------------------------------------ISATTNGGFDITGNS.MIPFRH..DYFVQFITMLLIIF
Q9P8G2_CANAX/615-975WAFFTS------------------------------------QSSFNDLGLTLTSNS.MMSFNQ..NAFVQILCSFLIVI
O59477_PYRHO/169-489DAFIHS------------------------------------MTGLGTGGMSSHDLS.IGYFNS...LAIETITVFLMIM
Q41515_WHEAT/178-533FSLSVT------------------------------------VASCANAGLVPTNEN.MVIFSK..NSGLLLLLSGQMLA
TRKG_ECOLI/155-483DAICHG------------------------------------ISTVSLGGFSTHSES.IGYFNN...YLVELVAGSFSLL
TRK2_SCHPO/479-850WAAFTS------------------------------------SSLFDNLGYSLNSDS.LNSFQK..AIFPQVLGTILIFL
Y322_MYCGE/143-543AGFFHS------------------------------------LSAVNNAGIDLIGGSSFVPYRNGLGIIIQWLTISQIIF
O87953_VIBAL/125-442YALFHS------------------------------------ISAFNNAGFALFSDS.MMSFVN..DPLVSFTLAGLFIF
O67474_AQUAE/108-430NGIFHS------------------------------------VSAFNNAGFSTFKNG.LLDFRG..DLFVNLVISFLIIL
KTRB_BACSU/117-432ASLFHA------------------------------------ISAFNNAGFSLWPDN.LMSYVG..DPTVNLVITFLFIT
O29419_ARCFU/149-474DAINHT------------------------------------FTTLSTGGYSTHSES.IAFFKD...VRVEAVVAFFAFL
Y460_MYCPN/151-550YGFFHS------------------------------------LSAVNNAGIDLLGANSFAPYRTNWGIVIQWLAISQIIF
TRK2_YEAST/450-839WGFFTA------------------------------------MSAFSNLGLSLTADS.MVSFDT..APYPLIFMMFFIII
TRK1_SCHPO/454-809WALFSS------------------------------------ASSFNDLGFSLIPSS.FVPMNR..NIFLLLISSLFIIA
TRKH_HAEIN/152-485DAIGHS------------------------------------FSTISNGGFSTHDAS.IGYFNQ...ASIYWVTTIFMLI
Q9P851_SCHOC/570-932WAFFTA------------------------------------QSSFNDLGLTLTADS.MQSFNR..SIYVMVVMSFFIVI
O83176_TREPA/234-561NAYFHA------------------------------------ISAFCNAGFSLYPNS.LESFVS..NPWITFPIAFTIIL

PF03814

ATKA1_STAAM/3-556LAFNTA------------------------------------ISFLTNSNLQHYNGESDVTYLT-----QMIVMTYLMFT
ATKA_ANASL/8-556IILHTV------------------------------------VSFVTNTDQQHYAGETTLSYFS-----QVAALGFLMFT
ATKA_HALSA/10-579LAFHTA------------------------------------SSFTSNTNQQHYSGET.LSVFT-----HTFGIGIAMFL
ATKA_RHILO/9-560LAFNTA------------------------------------ASFVTNTNWQNYGGESTMSYLL-----QMAGLTVQNFV
ATKA_ALIAD/9-560LAFNTA------------------------------------ASFITNTNWQNYAGEQSLSYLS-----QMIGITFLQFT
ATKA_MYCTU/9-569VAFNAA------------------------------------VSFMTNTNWQSYSGEATMSHFT-----QMTGLAVQNFV
ATKA_PSEAE/9-561LAFNTA------------------------------------VSFVTNTNWQAYSGEASLSYFS-----QMVGLTVQNFV
ATKA_THEAC/27-578LDFNTV------------------------------------VSFLTNTNLQHYSNPMRLSYFS-----QTFVITGLMFL
ATKA_CAUCR/9-561LAFNTA------------------------------------ISFITNTNWQSYAGETTMSTLS-----QMLVLTVQNFV
ATKA_ECOLI/9-557LALNTA------------------------------------VSFVTNTNWQSYSGETTLSYFS-----QMAGLTVQNFL
ATKA_STRCO/11-553QAFNTA------------------------------------ASFVANTNWQSYYGEQAMGHVV-----QTAGLAVQNFV
ATKA_SYNY3/8-556LALHTA------------------------------------ISFVTNTNQQHYSGETTYTYFS-----QAGALGFLMFT
ATKA_DEIRA/8-560LAWNTV------------------------------------VSFMTNTNWQAYSGEQSLSYFS-----QMAVITTFMFT
ATKA_CLOAB/6-556LTFNTI------------------------------------ISFLTNTNLQDYAGETGASYLS-----QMIVITFFMFF

PF08016

PKD1_MOUSE/3701-4103QWTHFVQDH----------------------PRHFTSFDQVAQLGSVARGLAASLLFLLLV---K---AAQQLRF-----
PKD2_MOUSE/265-685LLQFL..ED----------------------QNSFPNFEHVAYWQIQFNNISAVMVFLVWI---K---LFKFINF-----
Q15142_HUMAN/3046-3448QWTRFVRGR----------------------PRRFTSFDQVAQLSSAARGLAASLLFLLLV---K---AAQQLRF-----
Q8T8Z2_DROME/169-596LLQIIETAT----------------------KGQYLDFQRPLRLHQMLFIVKGFLVCITTL---R---LWKVLQF-----
O42181_TAKRU/3850-4245LWTQYVKHP----------------------HDDFTDFYPLARQTQLYTVASALLLFVFVL---K---VSHQLRF-----
PKDRE_MOUSE/1621-2051MVQLYL.AD----------------------PEAFIPFHAVSRVDHFMRIILAFLLFLTIL---K---TLRYSRF-----
Q95V80_STRPU/2211-2645LFKQMR.DE----------------------SVRFVGFRTAATSDNALGYSLAVIIILSCV---K---FLYLLRL-----
PKD2_CAEEL/119-538RVNSVI.EN----------------------GLTNAPFDDVTSSENSYLNIKACVVFVAWV---K---VFKFISV-----
Q80ZH4_MOUSE/145-567LMGKLL.QQ----------------------PDTYADFEFLAFWQTQDNNMNAVNLFFAWI---K---IFKYISF-----
Q9VVZ8_DROME/165-591MIKSVEIAV----------------------VVDFLDFREPAQLAYLEDVVTGLAVALVTM---R---LWKVLQF-----
PKDRE_HUMAN/1748-2178IIRFYL.SN----------------------PEDFIPFHAVSQVDHIMRIILGFLLFLTIL---K---TLRYSRF-----
Q9VK95_DROME/402-803LTARA..HS----------------------DVTYQSLDVLCFWNIIYVDMMAILAFLVWI---K---IFKFISF-----
Q9U1K9_DROME/160-576MMKKVEGAS----------------------KMEFIDFRRPSRMHQLTTITIGFLICITTL---R---LWRVLQF-----

PF00520

KCNS1_MOUSE/243-427S......................................GEELGD.....LGKVVQVFRLM...R...IFRVLKL-----
KCNAL_DROME/231-405............................................G.....AFVTLRVFRVF...R...IFKFSRH-----
TRPC6_MOUSE/495-726AQSIIDANDTLKDLTKVTLG.DNVKYYNLARIKWDPTDPQIISEG.....LYAIAVVLSFS...R...IAYILPA-----
TRPA1_HUMAN/775-960.........................................QWQ......CGAIAVYFYWM...N...FLLYLQR-----
CAC1C_HUMAN/161-404ALG...................................GKGAGF......DVKALRAFRVL...R...PLRLVSG-----
CAC1C_HUMAN/558-752...........................................L......GISVLRCVRLL...R...IFKITRY-----
CAC1C_HUMAN/955-1185..................................................VVKILRVLRVL...R...PLRAINR-----
CAC1C_HUMAN/1273-1523WNTFDALIVVGSIVDIAIT...EVNPAEHTQCSPSMNAEENSRI......SITFFRLFRVM...R...LVKLLSR-----
KCNS3_HUMAN/224-405.........................................IEN......MGKVVQILRLM...R...IFRILKL-----
ITPR1_MOUSE/2362-2588........................................................FFYSL...L...LFDLVYR-----
TRPC3_HUMAN/427-658AQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEG......LYAIAVVLSFS...R...IAYILPA-----
KAT2_ARATH/93-295...........................................I......GFRVLSMLRLW...R...LRRVSSL-----
SCN4A_HUMAN/159-446...................................................ISALRTFRVL...R...ALKTITV-----
KCNQ4_HUMAN/134-318..................................................NIFATSALRSM...R...FLQILRM-----
SCN7A_HUMAN/146-393...................................................IPTLQTARTL...R...ILKIIPL-----
SCN7A_HUMAN/539-728...................................................MALLRLFRML...R...IFKLGKY-----
SCN7A_HUMAN/970-1192...................................................LKPLISMKFL...R...PLRVLSQ-----
SCN7A_HUMAN/1285-1495..........................................PP.....SLVQLILLSRII...H...MLRLGKG-----
ITPR2_HUMAN/2317-2540.....................................................FFYSFL.........LFDLVYR-----
TRPC2_MOUSE/704-920HCRDASDSTTCRYF............TTAERSEWRTEDPQFLAE.....VLFAVTSMLSFT...R...LAYILPA-----
CAC1E_HUMAN/1512-1722..........................................SG.....FNMSFLKLFRAA...R...LIKLLRQ-----
TRPA1_CAEEL/873-1068R.......................................QNWQ.W...ILAALCIFFGWI...N...LLFMIRK-----
TRPA1_DROME/932-1126.........................................TIH.Y...SAASIAVFLSWF...R...LLLFLQR-----
CAC1F_HUMAN/129-371PH....................................TGGKPG.G...FDVKALRAFRVL...R...PLRLVSG-----
TRPM1_HUMAN/862-1075..........................................YG.....RVIYCVDIIFWY..IR...VLDIFGV-----
KCNA1_HUMAN/223-407.........................................GEQ.A...TSLAILRVIRLV...R...VFRIFKL-----
CAC1S_HUMAN/88-333AP....................................MSSKGA.G...LDVKALRAFRVL...R...PLRLVSG-----
CAC1S_HUMAN/466-660...........................................P.....LGISVLRCIRLL...R...IFKITKY-----
CAC1S_HUMAN/834-1064..................................................VVKILRVLRVL...R...PLRAINR-----
SCN5A_HUMAN/159-412...................................................VSALRTFRVL...R...ALKTISV-----
SCN5A_HUMAN/1241-1469...........................................M.....GPIKSLRTLRAL...R...PLRALSR-----
SCN5A_HUMAN/1562-1771..........................................SP.....TLFRVIRLARIG...R...ILRLIRG-----
KCMA1_RAT/217-388...................................................NRSWLGLRFL...R...ALRLIQF-----
Q9W433_DROME/339-611..................................................NLTAIRTIRVL...R...PLRAINR-----
Q9W433_DROME/1265-1459..........................................GG.....SGLSVLRTFRLL...R...ILKLVRF-----
Q9W433_DROME/2181-2406..........................................IF.....GILRVFRLLRSL...R...PLRVINR-----
NALCN_RAT/73-321........................................QMSP.W...GMLRIPRPLIMI...R...AFRIYFR-----
NALCN_RAT/420-598....................................................SQFTYFQVL...R...VVRLIKI-----
NALCN_RAT/920-1155...........................................E.....SGAQLLMVLRCL...R...PLRIFKL-----
NALCN_RAT/1243-1446.................................................YTYMMGACVIVF...R...FFSICGK-----
TPC1_ARATH/154-304..........................................................................S-----
TPC1_ARATH/466-671.........................................FSN.G...EWIRYLLLARML...R...LIRLLMN-----
TRPM2_HUMAN/830-1048..........................................PG.....RVILSLDFILFC..LR...LMHIFTI-----
SCNA_DROME/180-428..................................................NLAALRTFRVL...R...ALKTVAI-----
SCNA_DROME/1337-1559..................................................GIQAFKTMRTL...RALRPLRAMSR-----
SCNA_DROME/1653-1859........................................YFVS.P...TLLRVVRVAKVG...R...VLRLVKG-----
SCNBA_HUMAN/611-810..........................................QK.....RSWPFLRSFRVL...R...VFKLAKS-----
SLO_DROME/166-336..................................................GLRFLRALRLM...T..........-----
Q20766_CAEEL/931-1129..........................................WG.R...VLLSFSNVLFYM...K...IFEYLSV-----
TPC1_HUMAN/142-319.................................................SHVRVTRALRCI.......FLVDCRY-----
TPC1_HUMAN/477-686...........................................F.....YFIVVLRPLQ.........LLRLFKL-----
Q18351_CAEEL/295-478.........................................KEF.T...GAMLVVRVLRVL...R...MARVFKL-----
TRPV2_MOUSE/441-640..........................................YL.....PLLVSSLVLGWL...N...LLYYTRG-----
CAC1A_DROME/1129-1336..........................................NS.....INVGFLRLFRAA...R...LIKLLRQ-----
CAC1A_HUMAN/135-359...................................................LRTLRAVRVL...R...PLKLVSG-----
CAC1A_HUMAN/1279-1510.................................................KDINTIKSLRVL...RVLRPLKTIKR-----
CAC1A_HUMAN/1600-1810.................................................INLSFLRLFRAA...R...LIKLLRQ-----
O02037_BDECA/160-406.................................................GNYSSLRTLRVF...R...ALKTVTI-----
O02037_BDECA/1022-1247.................................................DALKAMRTLRAL...R...PLRAISR-----
O02037_BDECA/1341-1543..........................................DP.T...LI.RIVRLFRIT...R...VLRLVKS-----
O02038_CYACP/150-380..................................................SGFDVKALRAF...RVLRPLRLVSG-----
O02038_CYACP/531-726.........................................GWP.P...IGISVLRCVRLL...R...IFKVTRY-----
O02038_CYACP/904-1135.................................................SATSVVRILRVL...RVLRPLRAINR-----
O02038_CYACP/1223-1425.........................................DGG.I...KV.NFFRLFRAL...R...LVKLLSQ-----
O04242_MAIZE/98-298..........................................SY.....GFFNMLRLWRLR...R...VSSLFAR-----
O04703_SOLTU/123-326...........................................G.....ISYSVLGILRFW...R...LRKVKQF-----
SCN9A_RAT/154-401..................................................NLGNVSALRTF...RVLRALKTISV-----
O08661_RAT/376-542................................................................H...LLDIAMG-----
O13054_MAKNI/4820-4980...........................................................................-----
CCH1_SCHPO/218-481..................................................IFRLFSMIACL...R...LTRLLNI-----
CCH1_SCHPO/550-743.................................................VAFGWLSIFAIA...R...IYRCILL-----
CCH1_SCHPO/982-1212.................................................LLSRAFRAFKAL...R...VLRLINL-----
CCH1_SCHPO/1302-1505..........................................LT.....LLQTTLLVLVTV...H......LIPK-----
O17535_CAEEL/261-439...........................................K.....DVVEFLSMIR.........IFRLFKL-----
O18324_BLAGE/4-195..................................................NVGFLRLFRAA...R...LIKLLRQ-----
TRPC1_BOVIN/457-645....................................................NVLSYLR.........LFFYVYT-----
KCNH1_BOVIN/252-498GDPGKIGF.........................ADQIPPPLEGR.ES.QGISSLFSSLKVV...R...LLRLGRV-----
O24382_SOLTU/97-297..........................................QY.....GLFNMLRLWRLR...R...VSSLFAR-----
O24538_VICFA/90-293.........................................GLP.Y...FLLGMLRFWRIR...R...VKQFFTR-----
TRPC4_RAT/436-620...................................................FAIANIFSSL...R...LISLFTA-----
KCNS2_MOUSE/229-409..........................................LA.....NLGRVAQVLRLM...R...IFRILKL-----
CAC1S_CHICK/92-278..........................................SR.....VSITFFRLFRVM...R...LVKLLSR-----
O42421_CHICK/5-206...........................................................................-----
KCNQ3_HUMAN/158-351..................................................V..LATSLRSL...R...FLQILRM-----
KCNQ2_HUMAN/128-312...................................................VFATSALRSL...R...FLQILRM-----
O44164_CAEEL/265-484..................................................IGSLFSALKVV...R...LLRLGRV-----
O44930_AIPPA/138-380..................................................NVANLSGIRIF...RVLRALRTISA-----
O44930_AIPPA/657-846...........................................D.....SGLSVLRTFRLL...R...VFKLAQS-----
O44930_AIPPA/1083-1306.................................................SSLSSLRSLRTL...RALRPLRAISR-----
O44930_AIPPA/1402-1607..........................................IT.....PSPFVARVFRIG...R...LLRFYKG-----
O46129_LOLFO/396-624ERAELNPYA......................FEERKHWDAYDPN.LIAEALFAGANIFSSL...K...LIYIFTV-----
SCNAA_CANFA/155-405...................................................LRGISGLRTF...RVLRALKTVSV-----
SCNAA_CANFA/708-898...................................................LSVLRTFRLL...R...VFKLAKS-----
SCNAA_CANFA/1195-1424..........................................QY.....SDVASIKALRTL...RALRPLRALSR-----
O49846_9LILI/11-193..........................................SY.....GFFNMLRLWRLR...R...VGALFSR-----
O54812_CAVPO/76-278........................................YFVS.P...TLFRVIRLARIG...R...ILRLIKG-----
KCNH6_RAT/302-515...........................................T.....TLIGLLKTARLL...R...LVRVARK-----
CAC1G_RAT/119-394.....................................................SFSAVRTV...RVLRPLRAINR-----
CAC1G_RAT/778-964..................................................GLSVLRTFRLM...R...VLKLVRF-----
CAC1G_RAT/1291-1515...........................................T.....KILGMLRVLRLL...RTLRPLRVISR-----
CAC1G_RAT/1613-1818.........................................PIN.P...TIIRIMRVLRIA...R...VLKLLKM-----
CAC1S_LITCT/88-331G......................................LPAPG.K...SSGFNVKALRAF...RVLRPLRLVSG-----
CAC1S_LITCT/465-659...........................................P.....LGISVLRCIRLL...R...IFKITRY-----
O61220_CAEEL/521-763..........................................DN.....VLITVTMIFTTV...H...YLYYCRV-----
O61567_HOMAM/1241-1406....................................................................LLDVAVS-----
O62604_POLPE/521-713...........................................G.....NQLAVLKVFRLM...R...VLKLAQS-----
O62604_POLPE/945-1166...................................................GANLKALRSL...RGLRPLRAISR-----
O62604_POLPE/1260-1469..........................................SP.....GLFRVVRVFRLG...R...LLRFFEG-----
TRPC2_BOVIN/6-182...................................................FAVTSMLSFT...R...LASILPA-----
TRPC5_RABIT/405-624GSRPREE..........................WEMWHPTLIAE.AL.FAISNILSSLR.........LISLFTA-----
O65816_HORVU/144-390.........................................FMK.A...KN.....ILMLI...V...ICQYVPR-----
O70368_RAT/6-196......................................................LRLFRAA...R...LIKLLRQ-----
HCN4_MOUSE/297-513K.......................................TARA.V...RIVRFTKILSLL...RLLRLSRLIRY-----
KCNG2_CHICK/260-452PGG...................................GAGNKY.L..ERVGLVLRFLRAL...R...ILYVMRL-----
O73697_TAKRU/474-668...........................................P.....LGFSVLRCIRLL...R...ILKVTKY-----
O73697_TAKRU/1162-1386GGLYC..............................LHGCADSEN.A..SVSITFFRLFRVM...R...LVKLLNR-----
CAC1D_CHICK/158-400S.......................................HSGG.K...PGGFDVKALRAF...RVLRPLRLVSG-----
CAC1D_CHICK/1260-1492VTTD................................ESGNSEDS.A..RISITFFRLFRVM...R...LVKLLSR-----
O76266_HIRME/254-434S.......................................TAKS.S...ASLAFLRVIRLV...R...VFKLTKH-----
O76457_APLCA/233-409.................................................DMLEFFSIIR.........IMRLCKL-----
O77089_PANAR/2376-2612....................................................................LFDVVYR-----
CNGC6_ARATH/157-431V.......................................LATK.Q...AL.RYIVLVQYI..PR...FLRMYPL-----
SCN8A_RAT/1232-1461.................................................SELGAIKSLRTL...RALRPLRALSR-----
SCNBA_RAT/158-394...................................................LSALRTFRVF...R...ALKAISV-----
SCNBA_RAT/606-797..................................................NRSFLASLRVL...R...VFKLAKS-----
SCNBA_RAT/1070-1287...................................................LPSLKSFRTL...RALRPLRALSQ-----
SCNBA_RAT/1380-1583..........................................FP.P...TLFRVVRLARIG...R...ILRLVRA-----
HCN2_MOUSE/219-431K.......................................TARA.L...RIVRFTKILSLL...RLLRLSRLIRY-----
HCN1_MOUSE/166-382K.......................................TARA.L...RIVRFTKILSLL...RLLRLSRLIRY-----
KCNH3_RAT/273-507..................................................VYVGAHLLKTV...R...LLRLLRL-----
CAC1H_HUMAN/138-418.....................................................SLSAIRTV...RVLRPLRAINR-----
O96057_HALRO/84-316...........................................T.....DKVRSLRAFRVL...R...PLRLVSG-----
O96057_HALRO/463-658...........................................P.....LGISVLRCVRLL...R...IFKMTSS-----
O96057_HALRO/839-1070...................................................FSVVKILRVL..PSVLRPLRAINR-----
O96057_HALRO/1158-1372..........................................KS.....FSINFFRLFRVL...R...LVKLLSR-----
O96310_HELVI/265-424...........................................................................-----
O96385_PARTE/190-371...................................................YSAANYLMLI...R...MTRVRRT-----
O97017_9CNID/118-350.................................................SGSFDVKALRAF...RVLRPLRLVSG-----
O97017_9CNID/503-698..........................................PP.....IGISVLRCIRLL...R...IFKVTRY-----
O97017_9CNID/885-1115...................................................FSVVRILRVL...RVLRPLRAINR-----
O97017_9CNID/1203-1410...........................................M.....FAFGFFRLFRAL...R...LVKLLNQ-----
SCNA_ELEEL/150-401...................................................LRNVSALRTF...RVLRALKTITI-----
SCNA_ELEEL/600-789...................................................MSVLRSLRLL...R...IFKLAKS-----
SCNA_ELEEL/1036-1263.................................................EELGAIKNLRTI...RALRPLRALSR-----
SCNA_ELEEL/1356-1566........................................YFVS.P...TLFRVIRLARIA...R...VLRLIRA-----
SCN1A_RAT/156-422..................................................NVSALRTFRVL...R...ALKTISV-----
SCN1A_RAT/802-991...................................................LSVLRSFRLL...R...VFKLAKS-----
SCN1A_RAT/1254-1482.................................................SELGAIKSLRTL...RALRPLRALSR-----
CAC1S_RABIT/1152-1380SGGLYCLG........................GGCGNVDPDESA.RI.SSA..FFRLFRVM...R...LIKLLSR-----
KCNAS_DROME/281-477LPKAP..............................VSPQDKSSN.Q..AMSLAILRVIRLV...R...VFRIFKL-----
SCN5A_RAT/752-941...................................................LSVLRSFRLL...R...VFKLAKS-----
KCNA6_RAT/266-458PV....................................SGGSGQ.N..RQQAMSLAILRVI...RLVRVFRIFKL-----
KCNAB_DROME/476-658..........................................QF.Q...DVRRVVQVFRIM...R...ILRVLKL-----
KCNAW_DROME/233-412..........................................NA.....DILEFFSIIR.........IMRLFKL-----
CAC1S_CYPCA/107-350G.......................................VPTE.K...GGGFDMKALRAF...RVLRPLRLVSG-----
CAC1S_CYPCA/481-675...........................................P.....LGISVMRCIRLL...R...LFKLTRY-----
CAC1S_CYPCA/850-1080..................................................TISVVKILRVL...RVLRPLRAINR-----
CAC1S_CYPCA/1168-1401GGLWCLHGC......................AEVNPMQAIAEAE.NV.RVSITFFRLFRVL...R...LIKLLNR-----
ITPR_DROME/2410-2680NKGTLEKQLIK..................IITDFQLLYHCIYIA.FCFCGLIFHPFFYSLL.......LFDVVYR-----
SCN1A_HUMAN/1575-1785..........................................SP.....TLFRVIRLARIG...R...ILRLIKG-----
TRPL_DROME/432-668EIARDPQMA......................YIPREKWHDFDPQ.LIAEGLFAAANVFSAL...K...LVHLFSI-----
CCH1_YEAST/804-998..........................................LG.....HMYAWLSIFHIS...R...FYRVIIS-----
CCH1_YEAST/1244-1472.................................................NLSRIFKGLTAL...R...ALRCLTI-----
CCH1_YEAST/1563-1767........................................HYWF.H...NIKGFFLLVI.........FLFIIPQ-----
KCNQ1_HUMAN/158-347...................................................VFATSAIRGI...R...FLQILRM-----
CAC1A_RAT/523-715...........................................S.....FGISVLRALRLL...R...IFKVTKY-----
CNG_ICTPU/175-364.................................................PQLRFNRLLRFS...R...MFEFFDR-----
CAC1B_DISOM/1502-1704...........................................F.....INLSFLRLFRAA...R...LIKLLRQ-----
CAC1E_DISOM/139-362...................................................LRTLRAVRVL...R...PLKLVSG-----
CAC1E_DISOM/1140-1373...........................................G.....KDINTIKSLRVL...RVLRPLKTIKR-----
CAC1E_DISOM/1463-1662..........................................KF.....VNLSFLKLFRAA...R...LIKLLRQ-----
P90670_APLCA/165-419...................................................FGNLQALRTF...RVLRALKTISV-----
P90670_APLCA/788-983...................................................LSVLRAFRLL...R...VFKLAKS-----
P90670_APLCA/1214-1440...........................................G.....GSMSWMKSMRTL...RALRPLRAVSR-----
P90670_APLCA/1534-1731..........................................SP.....TLLRVIRVFRVG...R...VLRLVKS-----
P91256_CAEEL/249-433.........................................RDL.R...WAFLVVRILRVL...RVIRIIKLGRF-----
CAC1A_DROME/75-312..................................................DLRTLRAIRVL...R...PLKLVSG-----
CAC1A_DROME/475-666.................................................FGLSVLRALRLL...R...IFKVTKY-----
CAC1A_DROME/804-1039...........................................G.....QNLSTIKSLRVL...RVLRPLKTIKR-----
P91744_LOLBL/102-336..................................................DLRTLRAVRVL...R...PLKLVSG-----
P91744_LOLBL/515-708...........................................S.....FGISTLRALRLL...R...MFKVTRY-----
P91744_LOLBL/930-1162..................................................NLNTIKSLRVL...RVLRPLKTINR-----
P91744_LOLBL/1252-1456..........................................SF.....RT.GSFRLFRAA...R...LVKLLRQ-----
P91783_POLPE/220-401.........................................ISN.I...LV..AFRSVRII...R...VFKLARH-----
P91784_POLPE/242-415...........................................T.....SISGAFVSLRVF...R...VFRIFKF-----
KAT3_ARATH/120-324..........................................AF.....GFLNLLRLWRLR...R...VAELFKR-----
KCNV1_RAT/247-430.........................................QEL.E...NVGRLVQVLRLL...R...ALRMLKL-----
P97706_RAT/146-393...................................................LSSLPMFKTI...RTLRILKIIPL-----
P97706_RAT/561-749...................................................ITVFILVPLI.......FIKLGKY-----
P97706_RAT/991-1213...................................................LNPLPSIKFL...R...ALRVLSQ-----
CNGA1_BOVIN/200-394...........................................Y.....PEIRLNRLLRIS...R...MFEFFQR-----
CAC1D_HUMAN/921-1151...................................................ISVVKILRVL...RVLRPLRAINR-----
KCNAE_DROME/272-488..................................................IGSLFSALKVV...R...LLRLGRV-----
CNGA2_BOVIN/177-371...........................................N.....PEVRFNRLLHFA...R...MFEFFDR-----
CNG_CAEEL/206-410.................................................INWRGLPILR.........LNRLIRY-----
SCN1_LOLBL/80-333.................................................KVISDITGLRTF...RVLRALRTLSI-----
SCN1_LOLBL/445-628...................................................VSVFRSFRLL...R...VFHLAQS-----
SCN1_LOLBL/818-1040..................................................QITAFRSLRTL...RALRPLRAVSR-----
SCN1_LOLBL/1135-1350D......................................GIFMN.P...SLLRVARMFRIG...R...IIRLIKW-----
Q09658_CAEEL/273-452...........................................S.....MSFAVLRVLRLV...R...VFRVFKL-----
KCNH2_HUMAN/454-659..................................................LIGLLKTARLL...R...LVRVARK-----
Q16976_APLCA/270-457........................................YLNE.R...FVIEIMFILRII...R...MFRIFHL-----
Q17314_CYACP/168-407...................................................YSGVKTFRVL...R...ALKTIST-----
Q17314_CYACP/544-733..........................................SG.....SSLSVMRVFRLL...R...VLKLAQS-----
Q17314_CYACP/1000-1219..................................................DLNALRSLRAL...R...PLRAVSR-----
Q17314_CYACP/1313-1524........................................LDFS.P...GLLRVIRVFRLG...R...LLRFFDG-----
Q17354_CAEEL/44-236.................................................FGISVMRALRLL...R...IFKLTSY-----
Q17354_CAEEL/376-611..........................................AG.....KNLNTIKSLRVL...RVLRPLKTIKR-----
Q17354_CAEEL/701-908.................................................VSLGFLRLFRAA...R...LIRLLQQ-----
Q19464_CAEEL/235-414........................................QTGS.L...VTLDFLSMIC.........VLRLFKL-----
Q23974_DROME/300-504..................................................D.SHIHLVKLT...R...LLRLARL-----
CAC1D_DROME/652-877..................................................DAFDVKALRAF...RVLRPLRLVSG-----
CAC1D_DROME/1019-1214...........................................P.....LGVSVLRCVRLL...R...VFKVTKY-----
CAC1D_DROME/1379-1609...................................................ISVVKILRVL...RVLRPLRAINR-----
CAC1D_DROME/1697-1925IAECDIV..........................EGCKSTKKSAG.SN.LISINFFRLFRVM...R...LVKLLSK-----
CNG_DROME/144-346S......................................LYLPC.P...VIVRLNRLLRIN...R...LWEWFDR-----
Q25150_HALRO/156-465K.......................................AQKI.P...GM.AALRAFRVL...R...ALKAISA-----
Q25150_HALRO/833-1021...................................................LSVLRTFRLM...R...VFKLAKS-----
Q25150_HALRO/1297-1535..................................................QIGSIRSLRTL...RALRPLRAMSR-----
Q25150_HALRO/1628-1838..........................................QP.....TLFRIIRLARIG...R...ILRLIRG-----
Q25376_LOLOP/220-403.........................................DKQ.N...MSLAILRVIRLV...R...VFRIFKL-----
Q25377_LOLOP/158-400...................................................LGNLSALRTF...RVLRALKTVAV-----
Q25377_LOLOP/626-812...................................................LSVLRSFRLL...R...VFKLAKS-----
Q25377_LOLOP/1059-1284..........................................GM.....GNLTAFRSMRTL...RALRPLRAVSR-----
Q25377_LOLOP/1378-1588........................................YFVS.P...TLLRVVRVFRVG...R...VLRLVKS-----
CAC1M_MUSDO/1143-1366KEQALATCD.......................GQSCNKAKGGST.LI.SIN..FFRLFRVM...R...LVKLLSK-----
Q26039_PANIN/184-355..........................................FQ.....DVRRIVQIFRIM...R...ILRILKL-----
Q26094_POLPE/225-397..................................................G..SFSMLRVI...R...VLRVFKL-----
Q26095_POLPE/223-398..................................................SIAVLRVVRVI...R...VIRIFKL-----
Q26344_APLSP/357-539.........................................EQF.Q...NVRRVVQIFRIM...R...ILRILKL-----
Q27170_PARTE/196-376...................................................LQYLDLVIIL...K...VFQITKF-----
CNGB1_BOVIN/807-993...................................................FGVNPLLRLP...R...CLKYMAF-----
SCN4A_HORSE/606-795...................................................LSVLRSFRLV...R...SLKLAKS-----
SCN4A_HORSE/1064-1291.................................................SELGPIKSLRTL...RALRPLRALSR-----
AKT2_ARATH/110-312.........................................LNI.T...CN.....LLGLL...R...FWRLRRV-----
AKT1_ARATH/91-288..........................................SY.....GLFNMLRLWRLR...R...VGALFAR-----
Q41461_SOLTU/95-299.........................................GVG.F...RLLSMLRLWRLR...R...VSALFAR-----
Q63541_RAT/162-411..................................................NVSALRTFRVL...R...ALKTISV-----
CNGA4_RAT/71-265.................................................PTLRLNRFLRVP...R...LFEAFDR-----
Q90518_TAKRU/157-415..................................................S........AL...R..........-----
Q90519_TAKRU/5-205...........................................................................-----
CNG1_CHICK/247-441..........................................NY.....PELRFNRLLRIA...R...LFEFFDR-----
Q93135_BLAGE/4-216...........................................................................-----
TRPG_CAEEL/1341-1555...................................................VAYGRVILAC..DSVLWTMKLLDY-----
Q94447_CALVI/422-658DLWFRDINPYF...................PREHWHPFDPMLLS.EGAFAAGMVFSYLKLV...H......IFSI-----
SLO1_CAEEL/180-351..................................................GFRFLRALRLM...T..........-----
KCNH5_RAT/249-467..................................................ISSLFSSLKVV...R...LLRLGRV-----
KCNF1_HUMAN/224-405........................................LTNV.Q...QAVQALRIMRIA...R...IFKLARH-----
SKOR_ARATH/116-328.................................................EEVRYLLLIRLY...R...VHRVILF-----
SCN3A_HUMAN/156-423..................................................NVSALRTFRVL...R...ALKTISV-----
Q9PRI8_XENLA/442-630....................................................NVLSYLRLF.......FMYTTSS-----
KCNH8_RAT/269-473.....................................................NVTVVSLV...H...LLKTVRL-----
TRPV2_RAT/446-645..........................................YL.....PLLVLSLVLGWL...N...LLYYTRG-----
TRPV6_RAT/395-577..........................................VP.....MS..FALVLGWC...N...VMYFARG-----
KCNH4_RAT/276-479..................................................NITVTSLVH.........LLKTVRL-----
Q9RW39_DEIRA/69-240...................................................LLVVRALRLL...R...VFRVFKL-----
CNGC7_ARATH/145-419.........................................VLP.T...KT.ALLNIVIVQYIPR...FVRFIPL-----
AKT5_ARATH/112-312..........................................GY.....GIFSMLRLWRLH...R...VSKCFAR-----
CNG14_ARATH/128-398........................................SDHT.T...NALVLIVLVQYI..PR...LYLIFPL-----
CNGC3_ARATH/130-394S.......................................LVAK.E...LL.KWVIFCQYV..PR...IARIYPL-----
Q9SM12_MAIZE/104-307.................................................RENAVYSMLGVL...R...LWRLRRV-----
CNG16_ARATH/98-374..................................................AGEFRYAAHQN...HTLSLIVLIQY-----
Q9U5E2_DROME/162-353........................................................LLRFT...R...FFKVYRS-----
SCNBA_HUMAN/161-399...................................................LLPLRTFRVF...R...ALKAISV-----
SCNBA_HUMAN/1092-1307...................................................LMELKSFRTL...RALRPLRALSQ-----
SCNBA_HUMAN/1400-1603.........................................PFP.P...TLFRIVRLARIG...R...ILRLVRA-----
KCNG1_HUMAN/270-459GA.....................................GNSYL.D...KVGLVLRVLRAL...R...ILYVMRL-----
Q9VHY7_DROME/610-800..........................................QN.....HIGAFAVLLGWT...N...LMLMIGQ-----
TRPG_DROME/412-652EMIYNSHAT......................DLPRERWDAWDPM.LISEGLFSAANIFSSL...K...LVYIFSV-----
Q9VUD5_DROME/520-718C.......................................LTEI.D...DHVTVVIMLTTA..PY...FLFFCRG-----
Q9VW35_DROME/377-569VD.....................................QWDTC.S...LFLGIGNLLVWF...G...VLRYLGF-----
PYX_DROME/536-723V.......................................PVWQ.H...HVAAIVILLVWL...E...LMMLVGR-----
PAIN_DROME/531-734..................................................TQRVLAVFTIL..LV...SMEFCLL-----
Q9W2D5_DROME/505-692.................................................VW......LRFP...R...FFKIQSF-----
Q9W3W0_DROME/513-653...........................................................................-----
Q9XH40_SAMSA/112-315.................................................KVGLTFFLLGML...R...LWRLRRV-----
TRPV5_RABIT/393-578...........................................V.....VPLSFALVLGWC...S...VMYFARG-----
Q9XSP9_RABIT/139-264...........................................................................-----
Q9XWG9_CAEEL/112-301...................................................VFAASAMRGI...R...FLQILRM-----
Q9XXD1_CAEEL/281-465.........................................RDL.K...GAFLVIRILRVL...RVIRVLKLGRY-----
Q9XZC1_BOOMI/498-721.................................................GRIPAFKTMRTL...RALRPLRAMSR-----
Q9XZC1_BOOMI/815-1019........................................YFVS.P...TLLRVVRVVKVG...R...VLRLVKG-----
TRPV2_HUMAN/444-645..........................................YL.....PLLVSALVLGWL...N...LLYYTRG-----
CAC1I_RAT/115-395..................................................NLSAIRTVRVL...R...PLKAINR-----
Q9ZPL4_SAMSA/115-318.................................................KVGLVCYLLGML...R...FWRLRRM-----

PF07885

Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q22426_CAEEL/285-360--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
Q94253_CAEEL/147-219--------------------------------------------------------------------------------
Q94253_CAEEL/253-318--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O44773_CAEEL/33-118--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC72_LEIMA/202-273--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O82065_SOLTU/193-268--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
Q19671_CAEEL/76-156--------------------------------------------------------------------------------
Q19671_CAEEL/157-246--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q22043_CAEEL/365-448--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
Q81K77_BACAN/22-99--------------------------------------------------------------------------------
Q81V28_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRAJA/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8AVI5_XENLA/81-158--------------------------------------------------------------------------------
Q8AVI5_XENLA/191-273--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DAL9_VIBVU/25-105--------------------------------------------------------------------------------
Q8DF13_VIBVU/235-325--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8I6M6_APLCA/77-154--------------------------------------------------------------------------------
Q8J0H6_NEUCS/369-447--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8PI92_XANAC/49-128--------------------------------------------------------------------------------
Q8PT60_METMA/20-95--------------------------------------------------------------------------------
Q8QZZ6_CAVPO/69-146--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8X557_ECO57/148-226--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
Q90ZP4_ONCMY/461-543--------------------------------------------------------------------------------
Q920B6_RAT/120-198--------------------------------------------------------------------------------
Q924I4_RAT/64-145--------------------------------------------------------------------------------
Q924I4_RAT/180-260--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93531_CAEEL/115-196--------------------------------------------------------------------------------
Q93531_CAEEL/236-312--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q988Q8_RHILO/59-133--------------------------------------------------------------------------------
Q9A7V3_CAUCR/24-99--------------------------------------------------------------------------------
Q9AR58_SOLTU/72-154--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9CX88_MOUSE/130-208--------------------------------------------------------------------------------
Q9ERU4_RAT/46-128--------------------------------------------------------------------------------
Q9ERU5_RAT/65-147--------------------------------------------------------------------------------
Q9ESM4_RAT/55-138--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9LLM5_EUCCA/71-153--------------------------------------------------------------------------------
Q9LLM5_EUCCA/192-267--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9V1D2_PYRAB/403-481--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
Q9ZP53_SOLTU/193-268--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/72-154--------------------------------------------------------------------------------
Q9ZPL3_SAMSA/193-268--------------------------------------------------------------------------------

PF01007

IRK5_HUMAN/54-390-------------------------------------------------IILLLVQAILGSIVNAFMVGCMFVKI-----
IRK10_HUMAN/31-369-------------------------------------------------IVLLIAQLVLTTILEIFITGTFLAKI-----
IRK1_CAEEL/77-422-------------------------------------------------GAIVCLQAICALLLQSFMVGIVFAKM-----
IRK1_HUMAN/43-380-------------------------------------------------IFLLIFQSILGVIINSFMCGAILAKI-----
IRK3_CHICK/39-385-------------------------------------------------IILFLFQSILGSIVDAFLIGCMFIKM-----
IRK4_HUMAN/22-377-------------------------------------------------VIAVVVQSIVGCVIDSFMIGTIMAKM-----
IRK12_HUMAN/47-381-------------------------------------------------VFMVVAQSIVGCIIDSFMIGAIMAKM-----
IRK15_HUMAN/30-365-------------------------------------------------IFLLVAQLVITTLIEIFITGTFLAKI-----
IRK8_HUMAN/37-380-------------------------------------------------ITVLILQNIVGLIINAVMLGCIFMKT-----
IRK9_HUMAN/25-362-------------------------------------------------IVLLLLQAILGSMVNAFMVGCMFVKI-----
IRK2_CAVPO/48-380-------------------------------------------------VFMVVFQSIVGCIIDAFIIGAVMAKM-----
IRK16_RAT/37-358-------------------------------------------------VLTVILQSILSCIINTFIIGAALAKM-----
IRK11_HUMAN/36-366-------------------------------------------------ILILIVQNIVGLMINAIMLGCIFMKT-----

PF00060

GLR27_ARATH/582-833-------------------------------------------------VWCFVVLVLIQSYTANLTSFFTVKLL-----
GLR34_ARATH/613-869-------------------------------------------------IWLFVVLIINSSYTASLTSILTIRQL-----
Q9VIA5_DROME/402-665-------------------------------------------------LSCIFSFMLMQFYGAFIVGSLLSESA-----
GLR28_ARATH/577-828-------------------------------------------------VWCFVVLVLTQSYTANLTSFLTVQRF-----
Q8T0V7_DROME/343-610-------------------------------------------------FWWIVVIVLVTTYCGNLVAFLTFPKF-----
Q9U0T0_LOLOP/568-841-------------------------------------------------VWWFFTLIIISSYTANLAAFLTVERM-----
GLR1_CAEEL/591-867-------------------------------------------------AWWFFTMIIVSSYTANLAAFLTLEKM-----
Q9VVU7_DROME/338-596-------------------------------------------------TTFVAALFLFTSFSANIVALLQSPSD-----
Q90278_CARAU/149-409-------------------------------------------------TWWLFAVVLLACYFSSLSSSQGLTPA-----
Q9TVI0_DROME/547-823-------------------------------------------------IWWFFTLIMVSSYTANLAAFLTIENP-----
GLK1_DROME/610-907-------------------------------------------------VWWFFTIILISSYTANLAAFLTVERM-----
GLR2_CAEEL/619-910-------------------------------------------------CWWFFTLIIVSSYTANLAAFLTLERM-----
Q9W365_DROME/518-818-------------------------------------------------AYWLFVVLMLATFTANLAAFLTVERM-----
Q25412_LYMST/545-818-------------------------------------------------IWWFFTLIIISSYTANLAAFLTVERM-----
GRID1_HUMAN/562-842-------------------------------------------------SWWLFTLIVCSSYTANLAAFLTVSRM-----
Q90279_CARAU/144-405-------------------------------------------------IWWLFSLVLLACYFANLSLWLHSDNQ-----
GRID2_RAT/566-842-------------------------------------------------AWWLFALIVISSYTANLAAFLTITRI-----
NMDZ1_HUMAN/559-824-------------------------------------------------VWAGFAMIIVASYTANLAAFLVLDRP-----
GLRK_LITBE/161-425-------------------------------------------------IWWVFSITLLAAYIGSFASYINSNTN-----
NMDE1_RAT/554-828-------------------------------------------------VWAFFAVIFLASYTANLAAFMIQEEF-----
NMD3B_HUMAN/574-842-------------------------------------------------LWAIFCLLVLSSYTANLAAVMVGDKT-----
GLR29_ARATH/566-820-------------------------------------------------VWCFVVLVLTQSYTASLTSFLTVQSL-----
GLR31_ARATH/587-839-------------------------------------------------IWLFVVLIITSSYTASLTSILTVQQL-----
GLR21_ARATH/574-835-------------------------------------------------IWYFLVLVLTQSYTASLASLLTTQHL-----
O76903_DROME/477-751-------------------------------------------------VWALFAVVFLAIYTANLAAFMITREE-----
GLRK_ANAPL/168-431-------------------------------------------------IWWLFTIALLAAYIANFTALLSSGSE-----
GLRK_XENLA/162-426-------------------------------------------------IWWIFSIVLVAAYIASFAAFLNSDSV-----
GLR22_ARATH/580-842-------------------------------------------------TWYFVLLVLTQSYTASLASLLTSQQL-----
Q9V4A0_DROME/553-829-------------------------------------------------CWFFFCLIIISSYTANLAAFLTVERM-----
Q9VSV5_DROME/630-967-------------------------------------------------SWFFFTLILISSYTANLAAFLTVERM-----
GLRK_LYMST/556-830-------------------------------------------------VWWFFTLIIISSYTANLAAFLTVERM-----
NMD3A_RAT/674-942-------------------------------------------------LWAIFCMFCLSTYTANLAAVMVGEKI-----
GRIA2_HUMAN/543-824-------------------------------------------------VWWFFTLIIISSYTANLAAFLTVERM-----
NMDA1_DROME/573-843-------------------------------------------------VWAGFAMIIVASYTANLAAFLVLERP-----
GLR37_ARATH/578-833-------------------------------------------------VWLFLLMVLTASYTANLTSILTVQQL-----
GLR11_ARATH/540-781-------------------------------------------------VWVFVVLILTSSYSANLTSTKTISRM-----
Q9VDH5_DROME/545-823-------------------------------------------------IWWFFTLIMISSYTANLAAFLTVERM-----
GLR14_ARATH/568-810-------------------------------------------------VWIFAVLILTSNYTATLTSVMTVQQI-----
GRIK2_HUMAN/560-831-------------------------------------------------IWWFFTLIIISSYTANLAAFLTVERM-----
O01623_CAEEL/566-855-------------------------------------------------TWWVFYLVIISAYTANLAAVLTVSRP-----
NMDE3_RAT/552-826-------------------------------------------------VWAFFAVIFLASYTANLAAFMIQEQY-----
Q9VMP4_DROME/554-829-------------------------------------------------MWWFFALMMLSTYTANLAAFLTSNKW-----
O45028_DROME/553-829-------------------------------------------------FWWIFALLISQTYIAKLAAFITSSKI-----
Q19693_CAEEL/134-404-------------------------------------------------LWWLASITLSATFTGSLVALFAVDKT-----

PF15249

B5X552_DROME/1418-1521--------------------------------------------------------------------------------
F8NSX7_SERL9/93-213--------------------------------------------------------------------------------
H3AYR2_LATCH/719-823--------------------------------------------------------------------------------
Q55QM7_CRYNB/131-237--------------------------------------------------------------------------------
H2NZE3_PONAB/668-773--------------------------------------------------------------------------------
Q01LC1_ORYSA/286-403--------------------------------------------------------------------------------
Q4RYD4_TETNG/1-136--------------------------------------------------------------------------------
G3HR60_CRIGR/731-835--------------------------------------------------------------------------------
C3Z068_BRAFL/1333-1438--------------------------------------------------------------------------------
A3CH67_ORYSJ/186-306--------------------------------------------------------------------------------
I1LP29_SOYBN/125-245--------------------------------------------------------------------------------
Q7XVN3_ORYSJ/354-483--------------------------------------------------------------------------------
A8PYV1_BRUMA/646-751--------------------------------------------------------------------------------
D8U255_VOLCA/23-147--------------------------------------------------------------------------------
Q9SRQ0_ARATH/121-240--------------------------------------------------------------------------------
F6Q7W8_XENTR/676-780--------------------------------------------------------------------------------
I1PKQ5_ORYGL/94-212--------------------------------------------------------------------------------
I0Z4J2_9CHLO/35-157--------------------------------------------------------------------------------
H2TKN1_TAKRU/1011-1116--------------------------------------------------------------------------------
D6RLC3_COPC7/97-215--------------------------------------------------------------------------------
H3A9A7_LATCH/1063-1168--------------------------------------------------------------------------------
E7FC48_DANRE/828-933--------------------------------------------------------------------------------
B6U5Z5_MAIZE/33-158--------------------------------------------------------------------------------
E2AU32_CAMFO/2003-2108--------------------------------------------------------------------------------
G0NU71_CAEBE/708-810--------------------------------------------------------------------------------
A8X0V1_CAEBR/811-928--------------------------------------------------------------------------------
B3M7G6_DROAN/504-627--------------------------------------------------------------------------------
A6ZJ71_CAEEL/678-780--------------------------------------------------------------------------------
E0VX25_PEDHC/1662-1767--------------------------------------------------------------------------------
F2USU5_SALS5/118-246--------------------------------------------------------------------------------
B8P3G1_POSPM/122-239--------------------------------------------------------------------------------
E9GC12_DAPPU/1239-1344--------------------------------------------------------------------------------
A3ATB4_ORYSJ/289-371--------------------------------------------------------------------------------
A8JDB0_CHLRE/26-151--------------------------------------------------------------------------------
E3M7Z0_CAERE/718-820--------------------------------------------------------------------------------
A9S0J3_PHYPA/54-177--------------------------------------------------------------------------------
E5S5E0_TRISP/368-478--------------------------------------------------------------------------------
C5YEV3_SORBI/36-162--------------------------------------------------------------------------------
B0E0Z3_LACBS/96-216--------------------------------------------------------------------------------
C5KJB2_PERM5/65-165--------------------------------------------------------------------------------
B0WCV5_CULQU/2345-2450--------------------------------------------------------------------------------
D2A445_TRICA/62-167--------------------------------------------------------------------------------
A7USW6_ANOGA/2823-2926--------------------------------------------------------------------------------
E4WWE2_OIKDI/96-202--------------------------------------------------------------------------------
B3RLC8_TRIAD/434-538--------------------------------------------------------------------------------
D8QC90_SCHCM/85-202--------------------------------------------------------------------------------
D2VJE8_NAEGR/329-435--------------------------------------------------------------------------------
E7F8Y0_DANRE/599-703--------------------------------------------------------------------------------
H2WA87_CAEJA/574-676--------------------------------------------------------------------------------
D5AE81_PICSI/102-222--------------------------------------------------------------------------------
A9RCY5_PHYPA/87-211--------------------------------------------------------------------------------
I1BJQ3_RHIO9/247-352--------------------------------------------------------------------------------
F0ZSB4_DICPU/460-585--------------------------------------------------------------------------------
C1EJG7_MICSR/87-216--------------------------------------------------------------------------------

PF02386

O27332_METTH/161-474GG.TSFLVHYQLIKGRF.................FSVLHDIQLQATV..VFISIFTILAVYVGGVA..............
Y1485_METJA/160-466GGVMSFSIHHKLLTGKY....................FNDIQTKYAL..IVTAFISIIISIKDKVP..............
TRK1_YEAST/763-1173GN.TGFPILLRCIIWIMFKIS....PDLSQMRESLGFLLDHPRRCFT.LLFPKAATWWLLLTLAGLNITDWILFIILDFG
O87729_VIBAL/151-479GG.LPFLLFIAALRKRR................IDVLVNDAQVRGFAYLFVFSSLVISAWLVIRDG..............
TRKH_SHIFL/152-481SG.CNYGLHFS..LLSGRS..............LKVYWRDPEFRMFI.GVQFTLVVICTLVLWFHN..............
P73949_SYNY3/106-429GG.IGYQVIIESYFWLVRKVK....KS.QRPFAFSLNLRVVVRVTIF.LLLLGFFGILILEAQGNR..............
O74723_NEUCS/406-766GN.TGFPVMLRFIIWVMSIVV....PRDSGLYEEVRFLLDHPRRCFI.LLFPSGATWWLFFILIGLNCADVVFFVVLDLG
NTPJ_ENTHR/117-435GG.LGFIVWRDILSYHR.............VKKITLHSKVALSVTAL.LLIGGFILFLITERNGLT..............
Q9HPA9_HALSA/196-554GA.IAFPIHYRLLADRD................HGVLRGDLQTRWLFVLLGGGVVVLAAQNVAAVPVTPDAVTQWTPAIG
KTRD_BACSU/117-435GA.IGFPVLVEVKDFLFSKHR.........RYPFTLFTKITTITFGS.LVLFGAIGIFALEANHAF..............
Q9P8G2_CANAX/615-975GN.TGFPILLRFIIWVMFKTA....RPLSLYKESLGFLLDHPRRCFT.LLFPSVPTWWLFFILVVLNGFDLVIFCILDLH
O59477_PYRHO/169-489GA.TNFTVHYKLFKNRS................IRSFFMDIQVKTML.YLLGITIPLIALSLVSFG..............
Q41515_WHEAT/178-533GN.TLFPLFLRLLVWFLGRIT.........KVKELRLMINNPEEVRFANLLARLPTVFLSSTVVGLVAAGVTMFCAVDWN
TRKG_ECOLI/155-483SA.FNFTLWYIVISRKT................IKPLIRDIELRFFL.LIALGVIIVTSFQVWHIG..............
TRK2_SCHPO/479-850GN.TFFPIMLRFIIWIMIRTT....RFSPNFQQALYFLFEHPRRSFT.LLFPSKTTWVLFLNLTLLNFASFFFFMVLDLG
Y322_MYCGE/143-543GG.IGYPCLFDGFEAIKKKIK....YGRHTKHQFSLFTKLTVITNIV.VILLFFTLLLMVEFIASDSLTNTIVNFSDEKK
O87953_VIBAL/125-442GG.LGFTVIGDVWRHWRKG...........FHFLHIHTKIMLIATPL.LLLVGTVLFWLLERHNPN..............
O67474_AQUAE/108-430GG.IGFFVVNDIYLWYTKK...........VPRLSVHTKLVMITSVL.LILLGTVGLIFTEFGNYKG.............
KTRB_BACSU/117-432GG.IGFTVLFDVMKNRR.............FKTFSLHTKLMLTGTLM.LNAIAMLTVFILEYSNPG..............
O29419_ARCFU/149-474GG.ANFALIYFLLSGKP.................VIFRN.TEFRAYVCFLALASVVIAAVNLDRYS..............
Y460_MYCPN/151-550GG.IGYPVLFDAYEAIKKRRL....YGKYYKHQFSLFTKLAVLTNLI.VTAWCFLMLLMVEFIVITSLTNTIAHLNVEKA
TRK2_YEAST/450-839GN.TGFPIMLRFIIWIMFKTS....RDLSQFKESLGFLLDHPRRCFT.LLFPSGPTWWLFTTLVVLNATDWILFIILDFN
TRK1_SCHPO/454-809GN.TGFPCFFRTFIWTTYKLY....PFSFEKKEAMAFLLDHPRRCFT.LLFPSGATWVLFFVLLLLNVIDLVLFMVLDTG
TRKH_HAEIN/152-485GG.VNFSLHISAFLALGKRN............IWRNYWKDPEFRFFL.TMQIIFIGIVSLSLYGYG..............
Q9P851_SCHOC/570-932GN.TGFPVFLRFIIWILFKFA....RPSSLFKESLGFLLDHPRRCFT.LLFPSIPTWWLFSILVVMNVVDLVLFIILDLN
O83176_TREPA/234-561GG.ISFVVIDEVLCRVHGSIKNIFFKGKNILGSLSLNTFVVLKATVL.LLAVSFVGIYLLEHTHSM..............

PF03814

ATKA1_STAAM/3-556SSASGYAVCIAMLRRLTGLT.----------NIIGNFYQDIVRFIVRVLLPLSCLISILLMTQGVPQTLHA.NLMIRTLS
ATKA_ANASL/8-556SAATGLAVGIAFIRGLTGK..----------K.LGNFYIDLTRGITRILLPISVIGAIALVLLGVPQTLGG.SLTITTLE
ATKA_HALSA/10-579TPATGLALMPAFARAFTNKED----------PRLGNFYENVVRGLVRFLLPISLLIAIILMAEGSVQTILGGQLTANTFT
ATKA_RHILO/9-560SAATGIAIAIALIRGFARASG----------KSIGNFWVDMTRCTLYVLLPLCIVLTLVYVWLGIPQTLGP.YVDATTLE
ATKA_ALIAD/9-560SAATGLAAAMAFLRGLSRQKT----------DALGNFWVDLVKAHTRLLLPIAAILAVLLLALGVPETLSG.PAVVHTLA
ATKA_MYCTU/9-569SASAGMCVLAALIRGLARKRA----------STLGNFWVDLARTVLRIMFPLSFVVAILLVSQGVIQNLHG.FIVANTLE
ATKA_PSEAE/9-561SAAVGLCVLVALARGISRRST----------RQLGNFWVDLTRGTLYVLLPLCLLLALLLVWQGVPQTFFD.YVHATTLQ
ATKA_THEAC/27-578SAGTGFAASMAFVRGIRTDTG----------N.IGNFYHDFLVSIFDLILPLTVILTVILILAGIPETMQRYITVNAFLT
ATKA_CAUCR/9-561SAATGATVAAALARAFVANRG----------EGVGNFWADLVRTTLYLLLPLAFVVAVVLAALGLPQTLAA.GVTAHTLE
ATKA_ECOLI/9-557SAASGIAVIFALIRAFTRQSM----------STLGNAWVDLLRITLWVLVPVALLIALFFIQQGALQNFLP.YQAVNTVE
ATKA_STRCO/11-553SAAVGIAVAVALVRGFARSRT----------GELGNFWADLVRGVVRVLVPIAAVGAVILVACGVIQNFSG.IHEVGQFM
ATKA_SYNY3/8-556SAATGIAVAIAFIRGLTGQ..----------A.IGNFYQDLVLSITRILLPISLVGAILLLVAGVPETLAG.PAQVTTLE
ATKA_DEIRA/8-560SAATGFAAALAFMRGLAGRDG----------TNLGNFWVDVTRLIYRVLLPVCFGLALVFVWQGMPQTLGA.YANATTLE
ATKA_CLOAB/6-556AAATGIAVALAFIRALSGK..----------KKLGNFYVDLVRITTRILLPLSIIVAIFYIGQGVPQTLSA.NKTVTTIE

PF08016

PKD1_MOUSE/3701-4103--------------------------------------------------------------------------------
PKD2_MOUSE/265-685--------------------------------------------------------------------------------
Q15142_HUMAN/3046-3448--------------------------------------------------------------------------------
Q8T8Z2_DROME/169-596--------------------------------------------------------------------------------
O42181_TAKRU/3850-4245--------------------------------------------------------------------------------
PKDRE_MOUSE/1621-2051--------------------------------------------------------------------------------
Q95V80_STRPU/2211-2645--------------------------------------------------------------------------------
PKD2_CAEEL/119-538--------------------------------------------------------------------------------
Q80ZH4_MOUSE/145-567--------------------------------------------------------------------------------
Q9VVZ8_DROME/165-591--------------------------------------------------------------------------------
PKDRE_HUMAN/1748-2178--------------------------------------------------------------------------------
Q9VK95_DROME/402-803--------------------------------------------------------------------------------
Q9U1K9_DROME/160-576--------------------------------------------------------------------------------

PF00520

KCNS1_MOUSE/243-427--------------------------------------------------------------------------------
KCNAL_DROME/231-405--------------------------------------------------------------------------------
TRPC6_MOUSE/495-726--------------------------------------------------------------------------------
TRPA1_HUMAN/775-960--------------------------------------------------------------------------------
CAC1C_HUMAN/161-404--------------------------------------------------------------------------------
CAC1C_HUMAN/558-752--------------------------------------------------------------------------------
CAC1C_HUMAN/955-1185--------------------------------------------------------------------------------
CAC1C_HUMAN/1273-1523--------------------------------------------------------------------------------
KCNS3_HUMAN/224-405--------------------------------------------------------------------------------
ITPR1_MOUSE/2362-2588--------------------------------------------------------------------------------
TRPC3_HUMAN/427-658--------------------------------------------------------------------------------
KAT2_ARATH/93-295--------------------------------------------------------------------------------
SCN4A_HUMAN/159-446--------------------------------------------------------------------------------
KCNQ4_HUMAN/134-318--------------------------------------------------------------------------------
SCN7A_HUMAN/146-393--------------------------------------------------------------------------------
SCN7A_HUMAN/539-728--------------------------------------------------------------------------------
SCN7A_HUMAN/970-1192--------------------------------------------------------------------------------
SCN7A_HUMAN/1285-1495--------------------------------------------------------------------------------
ITPR2_HUMAN/2317-2540--------------------------------------------------------------------------------
TRPC2_MOUSE/704-920--------------------------------------------------------------------------------
CAC1E_HUMAN/1512-1722--------------------------------------------------------------------------------
TRPA1_CAEEL/873-1068--------------------------------------------------------------------------------
TRPA1_DROME/932-1126--------------------------------------------------------------------------------
CAC1F_HUMAN/129-371--------------------------------------------------------------------------------
TRPM1_HUMAN/862-1075--------------------------------------------------------------------------------
KCNA1_HUMAN/223-407--------------------------------------------------------------------------------
CAC1S_HUMAN/88-333--------------------------------------------------------------------------------
CAC1S_HUMAN/466-660--------------------------------------------------------------------------------
CAC1S_HUMAN/834-1064--------------------------------------------------------------------------------
SCN5A_HUMAN/159-412--------------------------------------------------------------------------------
SCN5A_HUMAN/1241-1469--------------------------------------------------------------------------------
SCN5A_HUMAN/1562-1771--------------------------------------------------------------------------------
KCMA1_RAT/217-388--------------------------------------------------------------------------------
Q9W433_DROME/339-611--------------------------------------------------------------------------------
Q9W433_DROME/1265-1459--------------------------------------------------------------------------------
Q9W433_DROME/2181-2406--------------------------------------------------------------------------------
NALCN_RAT/73-321--------------------------------------------------------------------------------
NALCN_RAT/420-598--------------------------------------------------------------------------------
NALCN_RAT/920-1155--------------------------------------------------------------------------------
NALCN_RAT/1243-1446--------------------------------------------------------------------------------
TPC1_ARATH/154-304--------------------------------------------------------------------------------
TPC1_ARATH/466-671--------------------------------------------------------------------------------
TRPM2_HUMAN/830-1048--------------------------------------------------------------------------------
SCNA_DROME/180-428--------------------------------------------------------------------------------
SCNA_DROME/1337-1559--------------------------------------------------------------------------------
SCNA_DROME/1653-1859--------------------------------------------------------------------------------
SCNBA_HUMAN/611-810--------------------------------------------------------------------------------
SLO_DROME/166-336--------------------------------------------------------------------------------
Q20766_CAEEL/931-1129--------------------------------------------------------------------------------
TPC1_HUMAN/142-319--------------------------------------------------------------------------------
TPC1_HUMAN/477-686--------------------------------------------------------------------------------
Q18351_CAEEL/295-478--------------------------------------------------------------------------------
TRPV2_MOUSE/441-640--------------------------------------------------------------------------------
CAC1A_DROME/1129-1336--------------------------------------------------------------------------------
CAC1A_HUMAN/135-359--------------------------------------------------------------------------------
CAC1A_HUMAN/1279-1510--------------------------------------------------------------------------------
CAC1A_HUMAN/1600-1810--------------------------------------------------------------------------------
O02037_BDECA/160-406--------------------------------------------------------------------------------
O02037_BDECA/1022-1247--------------------------------------------------------------------------------
O02037_BDECA/1341-1543--------------------------------------------------------------------------------
O02038_CYACP/150-380--------------------------------------------------------------------------------
O02038_CYACP/531-726--------------------------------------------------------------------------------
O02038_CYACP/904-1135--------------------------------------------------------------------------------
O02038_CYACP/1223-1425--------------------------------------------------------------------------------
O04242_MAIZE/98-298--------------------------------------------------------------------------------
O04703_SOLTU/123-326--------------------------------------------------------------------------------
SCN9A_RAT/154-401--------------------------------------------------------------------------------
O08661_RAT/376-542--------------------------------------------------------------------------------
O13054_MAKNI/4820-4980--------------------------------------------------------------------------------
CCH1_SCHPO/218-481--------------------------------------------------------------------------------
CCH1_SCHPO/550-743--------------------------------------------------------------------------------
CCH1_SCHPO/982-1212--------------------------------------------------------------------------------
CCH1_SCHPO/1302-1505--------------------------------------------------------------------------------
O17535_CAEEL/261-439--------------------------------------------------------------------------------
O18324_BLAGE/4-195--------------------------------------------------------------------------------
TRPC1_BOVIN/457-645--------------------------------------------------------------------------------
KCNH1_BOVIN/252-498--------------------------------------------------------------------------------
O24382_SOLTU/97-297--------------------------------------------------------------------------------
O24538_VICFA/90-293--------------------------------------------------------------------------------
TRPC4_RAT/436-620--------------------------------------------------------------------------------
KCNS2_MOUSE/229-409--------------------------------------------------------------------------------
CAC1S_CHICK/92-278--------------------------------------------------------------------------------
O42421_CHICK/5-206--------------------------------------------------------------------------------
KCNQ3_HUMAN/158-351--------------------------------------------------------------------------------
KCNQ2_HUMAN/128-312--------------------------------------------------------------------------------
O44164_CAEEL/265-484--------------------------------------------------------------------------------
O44930_AIPPA/138-380--------------------------------------------------------------------------------
O44930_AIPPA/657-846--------------------------------------------------------------------------------
O44930_AIPPA/1083-1306--------------------------------------------------------------------------------
O44930_AIPPA/1402-1607--------------------------------------------------------------------------------
O46129_LOLFO/396-624--------------------------------------------------------------------------------
SCNAA_CANFA/155-405--------------------------------------------------------------------------------
SCNAA_CANFA/708-898--------------------------------------------------------------------------------
SCNAA_CANFA/1195-1424--------------------------------------------------------------------------------
O49846_9LILI/11-193--------------------------------------------------------------------------------
O54812_CAVPO/76-278--------------------------------------------------------------------------------
KCNH6_RAT/302-515--------------------------------------------------------------------------------
CAC1G_RAT/119-394--------------------------------------------------------------------------------
CAC1G_RAT/778-964--------------------------------------------------------------------------------
CAC1G_RAT/1291-1515--------------------------------------------------------------------------------
CAC1G_RAT/1613-1818--------------------------------------------------------------------------------
CAC1S_LITCT/88-331--------------------------------------------------------------------------------
CAC1S_LITCT/465-659--------------------------------------------------------------------------------
O61220_CAEEL/521-763--------------------------------------------------------------------------------
O61567_HOMAM/1241-1406--------------------------------------------------------------------------------
O62604_POLPE/521-713--------------------------------------------------------------------------------
O62604_POLPE/945-1166--------------------------------------------------------------------------------
O62604_POLPE/1260-1469--------------------------------------------------------------------------------
TRPC2_BOVIN/6-182--------------------------------------------------------------------------------
TRPC5_RABIT/405-624--------------------------------------------------------------------------------
O65816_HORVU/144-390--------------------------------------------------------------------------------