Sequence alignment for CL0031

PF03162

YNF3_SCHPO/80-256------------------------------PLVPDNFGV---------VY-------------P..GIIYR------SAC
OCA6_YEAST/3-180------------------------------LVTPLQFST---------VQ-------------P...NLYR------GSY
Q9U0Z9_LEIMA/398-559------------------------------LVPPFRFAR---------VE-------------S...GVYR------GAY
OCA1_YEAST/67-236------------------------------IVPPLNFCP---------VE-------------R...YLYR------SGQ
OCA4_YEAST/62-220------------------------------VLRMSDFSA---------AA-------------V...PVKS------SSV
Y1500_ARATH/53-215------------------------------LIPPLNFSM---------VD-------------N...GIFR------SGF
SIW14_YEAST/116-280------------------------------VIPPENFSH---------VV-------------G...EIYR------SSF
OCA2_YEAST/3-169------------------------------YIPPLNFSP---------VV-------------STDVSLYR------SGY

PF13350

E9T5X0_RHOHA/81-325---------------------PRLAT....VDNFRDVAG.......PGYE..T...PFGH...MRTGVFYR......ANA
A6T6R5_KLEP7/12-260---------------------LSLQG....GINFRDLGG.........QL..A...ADGRR..VRSGKLLR......SGA
D4K940_9FIRM/333-585---------------------LPFAG....GNNFRELGG.........YR..A...DEGKT..VKWGQIYR......GFP
Q82ML8_STRAW/10-265---------------------PELAG....VRNFRDVGG.........LP..T...VDGRR..VRHGLLYR......SGH
A0QNM9_MYCS2/9-268---------------------LELGG....AWNFRDVAQ.................ETG....IRPGVLYR......SSE
A1CBV7_ASPCL/27-276---------------------PQVLG....LFNFRDVGG.........NR......VSATQ.HVRKNFLFR......SAT
D1ARM6_SEBTE/10-235---------------------IVLEG....AHNVRDIGG.........YK..A...ENGKI..TRWKKFIR......SDG
Q47PY0_THEFY/64-302---------------------PVFTA....LMNFRDVGG.........VR..T...TDGGR..IRMGRLYR......SAT
D9TDL5_MICAI/5-241---------------------PDFAT....LCNFRDLGG.........WR..T...GDGRT..VARGRLYR......SDS
A5FUX1_ACICJ/2-255---------------------TTLAN....APNFRDVGP.........LP..L...TGGGT..LRPGRLFR......SGQ
Q1G872_LACDA/6-252---------------------VKLEA....GYNCRDLGG.........YV..S...QDGRT..VKWGRLYR......SGS
R7EFW7_9BACE/108-352---------------------INIPG....IQNFRDLGG.........YS..S...YPTQK.KVHWGMLYR......SAE
G0FRX0_AMYMS/1-250---------------------MDWEG....FYNTRDLGG.........LP..T...RSGET..TRRGAFFR......AAD
A4FAM6_SACEN/7-242---------------------EALDG....LVNLRDLGG.........IP..V...EEGVE..TAAGVVLRSDAPHAGDR
Q185E4_PEPD6/1-246---------------------.........MKNFRDLGG.........NK..T...EDGRT..VKKGLFYR......SAK
Q8EMV0_OCEIH/13-243---------------------INIEG....AANIRDLGG.........YP..T...KEGYM..TKWGKYFR......GDS
Q8XJ09_CLOPE/79-332---------------------VPLKR....FCNFRDLGG.........YE..T...KDGRK..VKWGLFYR......SEA
G0FYB0_AMYMS/111-325---------------------VDLDG....VKNARDLGG.........YP..A...ADGLR..IRWGTIFR......TAR
Y669_CUPNH/32-272---------------------LAFDT....ISNARDLGG.........LA..G...AGGRR..VRQGRLYR......SGN
Q6BSM6_DEBHA/334-619---------------------KQIDG....ISNFRDIGAWKIQNPTYRLPNY....DNESHYYVKPHIAFR......CAN
Q2H3W5_CHAGB/12-268---------------------IHVPG....LANLRDAGG.........YAIEG...QPGKA..IRRGVLYR......SAD
B4E7J5_BURCJ/46-292---------------------PRLAS....ASNFRDTAG....PDGTGYV..T...TSGAK..MKKGAIYR......SSA
Q03NX9_LACBA/62-314---------------------IKLQG....ASNARDLGG.........YV..N...RHGQK..IKAHRLIR......ANS
D3VBS7_XENNA/12-260---------------------LPLNG....GINFRDLGN.........KT..L...NNGAK..IKSGLLFR......SGS
E2PZ53_STRC2/19-274---------------------PELTG....VRNFRDVGG.........LP..T...TDGRR..VRHGRLFR......SGH
C4Y7T2_CLAL4/371-653---------------------KTVDG....VSNFRDVGGWRIDQPTFKVT..N...SDKAKYYVRPSFIFR......CAN
R7D4X4_9FIRM/95-350---------------------ISMQS....LPNTRDLGA.........LE..T...EDGRH..ILPKRLLC......SGS
Q04DP2_OENOB/7-260---------------------LKIKG....GSNFRDLGG.........YQ..T...HDGKK..ILWGRLFR......GSA
Q1WS71_LACS1/6-259---------------------LELEE....GINFRELGG.........YL..T...EDGRK..IKWHKLLR......CGS
D0IYE3_COMT2/16-254---------------------VSLSG....ASNFRDLGG.........YR..G...LDGRR..LQWGKLYR......SAH
Q2J7B2_FRASC/1-245---------------------..MSG....CDNARDLGG.........LP..T...LDGAT..TRWGVFLR......TDS
A2FYW1_TRIVA/7-254---------------------ISFSK....MRNFRDIGG.........FL..A...SNGKK..VKKNIFFR......GPA
B5H4K5_STRPR/34-289---------------------PELTG....VRNFRDVGG.........LP..T...TDGRT..VRPGRLFR......SGH
A1SQF4_NOCSJ/19-265---------------------LRLAS....ADNFRDVAG.....TGLGLP..T...RDGGR..VRRGVFYR......SNE
A4SW99_POLSQ/41-300---------------------LDIPS....LPNLRDIGG.........YQ..N...NEGLY..VVRGKTYR......SNA
F2RJF7_STRVP/4-263---------------------IPATS....VANLRDLGG.........LP..L...GAGHS..VRPGLVLR......AAQ
E8N8B3_MICTS/54-273---------------------TDVPG....LVNGRELGS.........FT..G...AAGQT..VNASRLLR......TES
D9TEE3_MICAI/9-246---------------------SPFPA....LFNFRDVGG.........YA..A...RDGRT..VRRGRLYR......SDS
D4YX60_SPHJU/14-261---------------------LPLES....AFNLRDFGG.........YA..T...ADGRC..VKRGMLYR......SGT
Q5AQS5_EMENI/18-272---------------------IDIDG....VFNVRSFGG.........YP..S...SLRPNCFTRDSFIYR......SGH
W8VBL2_YEREN/12-265---------------------LPLDG....GINFRDLGG.........NV..V...ADGRL..IKRGLLFR......SGS
R6K7N0_9BACE/108-352---------------------VNIPG....IQNFRDMGG.........YP..S...YPTKK.RVRWGMLYR......SAQ
Q2NBB0_ERYLH/7-258---------------------LPLQQ....VHNFRDYGG.........YA..T...AGGGR..VRTGLLFR......SGH
D7GCQ3_PROFC/25-281---------------------IELES....LPNLRDIGG.........YP..I...TGGGR..VRTGVLYR......SAA
D5UQX9_TSUPD/1-244---------------------.........MYNFRDVAG......REGYA......ANGGR..MRSGILYR......SNA
C0ZYT8_RHOE4/49-269---------------------LHLEG....ASNARDIGG.........YV..T...EEGRT..VRWGKVLR......SNA
F2I8X4_AERUA/3-235---------------------YPFNE....ICNFRDIGG.........CY......KESGE.IIPRGKFFR......SSM
G2SRY4_LACRR/1-254---------------------.MLTN....CDNFRDMGG.........IK..T...HDGHV..LKEKKIIR......SGK
E3IX14_FRASU/5-257---------------------YELDG....CDNVRDLGG.........LP..T...VDGGQ..TQYGVLLR......SDT
A5V7W0_SPHWW/16-277---------------------VVLPG....TSNLRDLGG.........YA..G...AGGRK..VRWGRLYR......SGA
Q5FHZ9_LACAC/7-257---------------------LALDG....PLNFRDIGG.........YK..N...DKGQH..VKWNKIYR......SDS
Q0D202_ASPTN/36-281---------------------ISVPG....AFNVRDLGR.........FD..A.......P.YIRPGRVYR......SGT
D8QAJ5_SCHCM/11-261---------------------VNVPG....IVNFRSVGG.........FA..T...SHGSS.RVKPAAFYR......SGD
C5DRB4_ZYGRC/374-639---------------------HSFSH....VSNFRDLGG.........YE..T...VFQKR.RVKSGCFYR......CAN
V4IBR2_9ACTN/4-259---------------------PELTG....VRNFRDVGG.........LP..T...ADGRR..VRAGQLFR......SGH
C0ZR41_RHOE4/10-265---------------------VLLKT....APNFRDLGG.........IP..V...ADGT...VRAGALYR......SAT
Q1WR92_LACS1/8-263---------------------LDIKH....GFNFRDLGS.........YK..T...LDGRK..IKKHKILR......SAN
A4X4B1_SALTO/17-252---------------------TQFDS....LFNFRDVGG.........PA..G...QDGRI..VRSGRLFR......SDA
R5R190_9FIRM/11-244---------------------LDVKS....MTNVRDLGG.........YE..T...QTGFY..TKSHKFIR......STN
E9FC74_METRA/34-295---------------------VILPG....SLNIRDVGA.........YA..P.......G.YIKPSLIYR......SGT
D1BJX8_SANKS/41-309---------------------LDVPG....TWNVRDVGA.........SG......ADGGA.RLRPGVLLRPGVLLRSAS
E9ESJ0_METRA/41-283---------------------IPSRS....LFNLRDLGA.........VP..G.SA.......LTTTRFYR......SGF
E4UT41_ARTGP/16-268---------------------YAVEG....VNNLRDVGG.........YT..V....SPTT.SVRRNFIYR......SAH
C0ZYF0_RHOE4/68-302---------------------IRLDE....ARNFRDIGG.........YR..T...TDGRT..VRTGLVFR......SNK
E4NFP1_KITSK/132-367---------------------LHLAS....APNFRDLGG.........YR..T...ADGRW..VRLGRVYR......SDD
E3GQR7_EUBLK/9-245---------------------IELDG....CHNFRDLGG.........FP..G...RDGT...TGYKVAYR......ADA
D9R4N1_CLOSW/7-227---------------------YPMKG....IANFRDLGG.........YF......CKGGV..TKWGVFFR......STS
Q8Y5X0_LISMO/78-326---------------------LPLES....VFNFRDMGG.........YA..S...KNGKH..VKWGKLYR......SSN
Q0C2M9_HYPNA/7-259---------------------LNLET....VRNFRDFGG.........YE..S...RHGGR..VKMGRLYR......SGH
Q5FMM6_LACAC/10-266---------------------IDVTS....GRNFRELGG.........YE..T...NSGKK..IKMHKLLR......TGN
D6CZI7_9BACE/108-353---------------------INIPG....IQNFRDLGG.........YE..S...ANTGK.SLRWGMIYR......SAQ
C9A549_ENTCA/5-259---------------------IQLER....AANVRELGG.........YQ..T...TNGTT..IKRKKLIR......SAA
Q036B0_LACC3/6-262---------------------LDIKN....GLNFRDLGG.........YK..T...KSGQL..VKPQKVIR......SAK
Q033X0_LACC3/1-250---------------------MTLKK....ITNFRSLGG.........YQ..N...AHGQM..VKDGLIFR......SGQ
C0NGW7_AJECG/39-284---------------------ISVPG....LFNFRDLSY.........PH..T.T....LT.SLKQNYIFR......SGM
F5WQX8_ERYRF/1-242---------------------..MSE....LINFRDFGG.........YP..T...KDGRK..IKTGIFYR......SGS
A8G8B5_SERP5/12-260---------------------APLDG....GINFRDLGG.........NS..V...ADGRR..IKRGLLFR......SGS
D0L2R1_GORB4/12-270---------------------IDLTA....VANFRDVGG.........MT..T...HDGRT..VATGRLFR......SAA
B4RDR9_PHEZH/6-257---------------------.PFEG....IENFRDFGD.........Y...A...AGGRR..LRRGMLYR......SAH
C7YRI4_NECH7/35-278---------------------IPTRS....LVNVRDLGA.........VP..G.SA.......IRPGRIFR......SGM
C7MQT5_SACVD/3-253---------------------LELEG....AVNARDVGG.........IP..T...NDGAK..IAPGRLLR......SDN
D2PLN7_KRIFD/10-240---------------------LDWPG....CRNARDLGG.........LP..T...ADGGA..IRTGALIR......ADS
E9T363_RHOHA/13-270---------------------IPIES....VPNLRDVGG.........YR..T...RDGAT..IRFGRYYR......STD
E6SDK7_INTC7/7-271---------------------IDLPG....VVNMRDLGG.........LP..T...VSGEV..VRFRRLLR......SDN
C6W152_DYAFD/64-316---------------------IGLEE....TVNFRDLGG.........LQ..T...KDGKT..VRQGMIYR......SDN
Q03Q03_LACBA/76-297---------------------IKLSG....TKNTRDLGG.........YQ..T...ADGKW.KVRSQRLLR......SDN
A5VF96_SPHWW/104-349---------------------IPLER....GSNFRDVGG.........YP..A...AGGKH..VRWGMIYR......SAA
C6XQ14_HIRBI/6-256---------------------KPLLG....VKNFRDFGG.........YE..T...VCGRR..VKTGKLYR......TAA
Q74LQ6_LACJO/10-266---------------------IGIQN....GRNFRELGG.........YK..T...VSGQT..IKYNKLLR......TGN
Q03TS5_LACBA/7-264---------------------LNVTG....GLNFRELGG.........YP..T...LDNQT..VKWHKLLR......TAG
C7QBN3_CATAD/19-253---------------------IPLAG....TFNLRDVGG.........YP......AAGGT..VRAGLLLR......GDA
E9T5X1_RHOHA/57-304---------------------PRLAS....VNNFRDIAG....T.GAGYE..G...LGGLH..VNRGVFYR......SNT
E1R7L9_SPISS/7-227---------------------WNLQG....VANFRDLGG.........YP..C...KNGGA..TRYGIFFR......STH
R6FZZ0_9FIRM/12-240---------------------LPMEN....AYNVRELGG.........YA..T...KKGSI..TIHHQFLR......SEN
A5VM96_LACRD/8-263---------------------LAFEN....GFNFRDLGG.........YR..T...IDGES..LKWNNLVR......SAH
F2N8T3_CORGP/30-270---------------------IDFSK....LPNTRDLGG.........LI..G...ADGRR..VKSRLLLR......SGA
R6VR32_9FIRM/7-245---------------------MRLQG....AGNVRDLGG.........YP......CGETI..TAWQCCYR......SDM
A6LFZ6_PARD8/108-351---------------------AVMDS....VQNFRDLGG.........YT..S...TNGKT..VKWGKVFR......SGE
Q1GC11_LACDA/9-264---------------------LDVKG....GRNFRELGG.........YQ..T...VSGKK..IKMHKLIR......SGH
B1VMV2_STRGG/7-263---------------------VPAAT....VVNLRDLGG.........IA..L...GRDRR..VRQGVLFR......SGQ
Q5LB73_BACFN/30-260---------------------LPIEG....AYNIRDLGG.........YP..T...SDHKH..VKWKTFIR......SGD
D3Q281_STANL/17-248---------------------IPFET....IFNFRDLGG.........LA..A...LGGSK..VRTGLVFR......SDQ
C0ZZF5_RHOE4/21-266---------------------PRLAS....IHNFRDVAG.......PGYV..T...TSGQA..MSRGVFYR......ANV
Q6AJA2_DESPS/33-282---------------------PYLTS....ASNFRDIAGISKNYGGTGFVNDT...SHEGI..MRTGVFYR......SPK
D6Y3T5_THEBD/6-263---------------------IPLEG....AVNVRDLGG.........LP..T...EDGGT..TRFGRILR......ADN
D1CIH8_THET1/11-246---------------------LGWEG....CLNVRDLGG.........YA..S...RYGGE..TRWGAVIR......ADN
D9T566_MICAI/6-265---------------------WELVG....APNARDLGG.........LP..T...TDGRR..VRAGQLIR......TPA
F9US87_LACPL/1-247---------------------..MEG....ITNLRSLGG.........YR..N...KNQQV..IKDGLIYR......SGQ
C7RGV1_ANAPD/9-240---------------------YPLKD....VQNARDLGG.........VP..T...LDGKV..TNWGKFIR......TAT
D2ARP8_STRRD/5-223---------------------LPWPG....CRNARDLGD.........LP..G..........IRDRALIR......SEG
C6D6T4_PAESJ/11-261---------------------LPLEG....VFNFRDMGG.........YR..T...EGGRK..VKKGLLFR......AAE
Q04GW5_OENOB/7-259---------------------LPVIG....GYNFRDIGG.........YT..S...ADGQK..IKWGKLFR......TAN
C7PF99_CHIPD/28-269---------------------VKMQG....TVNFRDAGG.........YT..T...KDGKT..VTWGKVYR......SAD
G8PQS7_PSEUV/50-308---------------------KPIEK....LENFRALTT.............P...QNGPA..LKPQMVFR......SDQ
C0ZWU0_RHOE4/37-298---------------------PKLSSVVPSLANLRDIGG.........PE..S...SFGGT..VRTGSVFR......STD
A5VME4_LACRD/7-260---------------------LPIKN....GYNFRDLGG.........YP..T...ADGHQ..IKWHRLIR......TGS
Q6CBD6_YARLI/399-649---------------------KDVDG....IDNFRDYGG.........FQ......LDSKT.SIIQGVLYR......CAD
Q0S1R9_RHOJR/87-304---------------------LGLEG....ARNARDIGG.........YP..T...ADGAV..VRSGLVFR......TDA
C4JST8_UNCRE/37-283---------------------IFVPG....TFNLRDIGQ.........PT..C.T....PP..VRSNFLYR......SGM
Q752H2_ASHGO/397-662---------------------HDFSR....ISNFRDLGG.........YM..T...ASGRR..VRHGILYR......CAN
F5WUH9_ERYRF/1-251---------------------MHHK.....IRNFRDLGG.........IP......VKGGH..VKYHKLLR......GGP
Q2G5U2_NOVAD/7-261---------------------LPLEG....IHNFRDYGG.........YA..A...R.GGR..LRKGVLWR......SGQ
A5DGM7_PICGU/335-615---------------------KQVDG....VSNFRDIGGWRITNPARQLSHVP...PNSFY.YVQPGFAYR......AAN
F2RG23_STRVP/16-271---------------------PELAE....VRNFRDVGG.........LP..T...TDGRA..VHPGRLFR......SGH
F3Z7Q4_9ACTN/23-278---------------------PALSA....VRNFRDVGG.........LP..T...RDGRR..TRRGVLFR......SGH
C6WQQ9_ACTMD/112-345---------------------LGFAS....AKNFRDVGG.........YR..T...SDGRW..VRNGVLYR......STK
Q2UG77_ASPOR/38-277---------------------VTIPG....LFNIRDLS.....................SG.NLRPGYAYR......SGV
D7BYZ2_STRBB/13-268---------------------PELTG....VRNFRDVGG.........LP..T...VDGRH..VGRGVLFR......SGH
Q7MZ78_PHOLL/12-260---------------------LPLNG....GINFRDLGG.........KK..V...ASGGK..IKSGLLFR......SGS
Q6CPF1_KLULA/356-621---------------------YDFSQ....ISNFRDVGG.........YV..T...TSGKQ..VKPGIMYR......CAN
F2R3Z6_STRVP/5-244---------------------IPFER....LHNFRDLGG.........YP..T...ADGGT..VRWETLYR......SDS
F0XI08_GROCL/211-472---------------------IVIEG....TFNARDIGR.........VP..R...SEQASQRLRPGFAFR......SGG
Q5YQK3_NOCFA/10-248---------------------FHLSG....TFNFRDTGG.........LR..T...VDGAK..VRPGVLLR......SAQ
D6S3F4_9LACO/10-266---------------------INITN....GRNFRELGG.........YE..T...ISGKK..IKFHKILR......SGH
Q6DAR7_PECAS/12-260---------------------LPLDG....GINFRDLGG.........NR..A...ADGRL..IRHGKLFR......SGS
A4X9J4_SALTO/6-265---------------------LALVG....APNARDLGG.........LV..G...AEGRR..VRRGLLLR......TPA
C5GJJ3_AJEDR/10-263---------------------HSADG....IANLRDLGG.........YA..I....SPTT.SVRRNFIFR......CAT
C5DFC4_LACTC/350-613---------------------YSFSN....VSNFRDIGG.........YK..T...RDGYR..VKPKVLYR......CAN
A5UVJ7_ROSS1/8-243---------------------IPLEG....AHNVRDVGG.........YM..T...VDGRI..TRWRRLLR......ADS
E0S1S1_BUTPB/212-437---------------------SLLET....TLNTRDLGG.........YR......IDGTENYTKYGRLIR......SDV
D6X883_STRPR/4-264---------------------IPSTT....VANLRDLGG.........TP..L...PGGRS..VRSGLLFR......SGQ
C7Q4Y5_CATAD/4-228---------------------LDFEG....CHNVRDLGG.........VP..L...VDGGT..TAFGAVLR......SDT
C6CXY5_PAESJ/14-250---------------------VKLEG....AYNMRDLGG.........YE..T...NDGQI..TIWGRLYR......ADG
F9URK9_LACPL/11-267---------------------LTVPG....GINFRELGG.........YS..T...KDGRK..IKWHKVIR......TGG
A8NYE3_COPC7/24-276---------------------VTVPG....VINFRDLGS.........YPSTT...HPGKV..TKPKLLFR......SAE
A7TQ59_VANPO/366-638---------------------YNYSK....VSNFRDIGG.........YL..T...IFQNR.RVKSGLLFR......SAN
Q89MM7_BRADU/9-246---------------------LALQG....ASNFRDLGG.........YP..T...IDGRT..TRWRHIFR......SNH
R5CAC0_9FIRM/93-348---------------------IAFQS....LANTRDLGA.........LK..A...TDGRV..ILPHRLLR......SGD
E9D9N7_COCPS/41-287---------------------LTIPG....VFNVRDIGQ.........PT..A.T....PP..VRTNFLFR......SGL
D4MTX1_ANAHA/4-256---------------------IYLEG....ADNTRDLGG.........LK..T...TEGAV..IKDKQLIR......SNR
B8DWE7_BIFA0/8-251---------------------LPLPT....VENCRDLGG.........IH..T...EQGRM..VRPGLLVR......SAN
Q6MPS3_BDEBA/1-249---------------------MKLQG....GINFRDMGG.........YL..T...TDGRR..VKKNRLYR......SGS
Q0BU45_GRABC/14-254---------------------VSVEA....AHNFRDLGG.........WS..T...RLGGK..VRFGRVFR......SAA
A8L360_FRASN/22-269---------------------VRLEG....AVNVRDLGG.........YP..T...TGGGR..VRWGRVYR......SAA
E9T131_RHOHA/41-275---------------------IRLEG....AKNFRDIGG.........YE..T...SDGRT..VRSGLVYR......ANK
C7N3J9_SLAHD/11-269---------------------GGLRD....ELNFRELGG.........YR..T...ADGRT..VKHGVFYR......SGA
E3IY94_FRASU/26-299---------------------LRLAG....SLNLRDVGD.........YR..A...ADGRR..VRRRTLLR......SAA
Q2J949_FRASC/31-266---------------------LSLPG....TINLRDVGG.........YP..T...VHGRS..LRWRTLLR......SGT
D3Q8Q6_STANL/7-262---------------------PKLSG....SPNLRDLGG.........YR..T...GDGRR..TRHGLLYR......SGS
E8NB10_MICTS/3-236---------------------SLVSG....AANFRDVGG.........LP..A...GEGR...TREGVFFR......SGN
D7B332_NOCDD/12-265---------------------FLLSS....APNFRDLGG.........HR..T...ASGRT..VRSGLVYR......SDA
R6WSD4_9PORP/110-354---------------------VQMDS....VQNLRDIGG.........YF..S...EHGNR.MTGWGKIFR......SGE
Q5Z372_NOCFA/73-330---------------------LDLAH....APNARDIGG.........YP..V...RGGGK..VRFGVVYR......ADA
Q837I3_ENTFA/1-249---------------------..MNS....VVNFRDIGG.........FP..T...QQGTV..VKTGYFFR......SGE
E2SBJ5_9ACTN/1-228---------------------.....MPDVVPNLRDLGG.........VP..A...ADGLT..IRPARLLRSAAPWADDV
B1ML15_MYCA9/15-276---------------------NPVEG....IWNFRDVGG.................ADSPV.TIRPGVLFR......SSE
Q4QBX1_LEIMA/8-252---------------------IEAEG....LQNCRDLGG.........YR..T...RDGKH.VVKYRHIYR......SDN
A5V449_SPHWW/42-306---------------------LPLEG....GRNFRDLGG.........YR..A...QDGRH..VKWGLLFR......SGA
B0RGK3_CLAMS/55-275---------------------TDVPG....LVNGRELGA.........YA..G...VDGRT..VAASRLIR......TES
D4LM77_9FIRM/95-346---------------------LPLQN....LPNTRDLGA.........LM..T...VDGSH..ILPRKLLR......SGE
Q38Z00_LACSS/8-265---------------------LNLTR....SYNLRELGG.........YP..T...VDGKT..VKWHKLLR......SGS
D0LBL7_GORB4/46-264---------------------VALAG....TENTRTFEA.........YR..T...GDGRL..VR.DLVLR......SDN
D4K261_9FIRM/333-586---------------------LPFEG....GHNFRELGG.........YE..A...DEGKH..IKWGQIYR......GIP
D5G972_TUBMM/23-279---------------------KLVQG....IANFRDIGG.........YP..L...RDGSG.SVRRAYIYR......SAE
Q82PC9_STRAW/5-245---------------------ISFER....LHNFRDLGG.........YT..T...ADGRV..VRWGRLFR......SDS
D9QLA9_BRESC/6-259---------------------HAFEA....LDNFRDYGG.........YD..T...AAGRA..LKAGRLFR......SAH
B1VTU1_STRGG/9-264---------------------TVLTG....VRNFRDVGG.........LP..T...TDGRR..TAFGRLYR......SGH
Q6AJA3_DESPS/33-292---------------------PLLPT....ANNFRDIAGISETHGGNGFVNDT...RYKGL..MRTGVFYR......SSK
Q1G875_LACDA/17-265---------------------IELDM....PVNFRDLGG.........YQ..G...LDGRQ..VKWRKIYR......SAA
Q74HI5_LACJO/7-258---------------------VTFDG....TVNFRDIGG.........YE..N...NEGKH..VKWNKIYR......SDS
A8FDZ3_BACP2/6-257---------------------NPFAK....LANFREVGG.........LQ..T...TDEMV..IREGMIYR......SAD
D6ZCQ9_SEGRD/35-285---------------------LDIPS....VVNFRDAAG.........HP..RPLLGHGGT.PLRARQFFR......SGT
C7MM04_CRYCD/2-255---------------------IQFSH....IRNLRDVGG.........MP..A...EGGAL..LRKRRIYR......SAE
Q2G3Q6_NOVAD/42-292---------------------LHLAS....APNFRDIGG.........YR..T...QDGRL..VRQGIAYR......SDQ
D8PJU6_SCHCM/23-275---------------------VQVSG....VINIRDLGN.........LPSAA...YPPQR..TKPHYMYR......SAE
D1CHG9_THET1/7-244---------------------LAWEG....CLNIRDLGG.........YP..T...AYGVQ..TRWGAVVR......ADT
Q099H2_STIAD/12-265---------------------HPFQR....LSNFRDVGG.........RK..T...VDGRT..FRTGVLFR......SDE
C4R0W7_KOMPG/332-602---------------------KKVEG....IHNFRSLGG.........WR......IDSNH.YVREGLIFR......SAN
E3QF10_COLGM/18-282---------------------HTIPG....LPNFRDAGG.........YP..ID..AQPGR.ILRPGVVFR......SAE
Q9CEK1_LACLA/1-245---------------------M........LVNFRDIQA.................QNSKESGLKKNILFR......GGQ
Q03H83_PEDPA/7-263---------------------LPISS....GLNFRELGG.........YT..N...LDGKT..IKWNKLIR......SGK
B8MD83_TALSN/42-300---------------------IHVDG....VPNFRDIGG.........YP......ITSST.SIRRNFIYR......SAL
Q0ASN4_MARMM/5-255---------------------TSLEG....VHNFRHFHG.........YD..G...LDGAR..VKDG.LYR......SGH
Q1LQX9_CUPMC/38-278---------------------LGLET....IPNARDLGG.........LA..G...LSGRR..VRSGKLYR......SAN
A2SP34_METPP/1-237---------------------..........MNFRDLGG.........YP..V...GDGRR..TRWGRLFR......SDS
A7F170_SCLS1/15-271---------------------ITVEG....IPNFRDLGG.........YP..L...ASGSH.SVRQGVVYR......CGE
B2HLU1_MYCMM/6-276---------------------PELPG....AWNFRDVAD....................STAALRPGRLFR......SSE
E6SMS6_BACT6/108-352---------------------VNILG....IQNFRDLGG.........YP..S...YTTKK.EMRWGMLYR......SAE
C0ZL96_RHOE4/58-311---------------------PNLAS....VANFRDIAG....NDGRGYA..T...VDGSH..LKRGVIYR......SNA
C0ZRI9_RHOE4/63-310---------------------PRLTG....IDNFRDVAG.....TGAGYS..G...TLGLP..VNKGVFYR......ANA
D5ULT5_CELFN/46-302---------------------LATDA....LANLRDVGG.........RT..T...ADGRS..VRRRVAFR......SAE
Q38ZB6_LACSS/6-262---------------------LPIEN....GHNFRELGG.........YQ..T...LDGKT..LKTKRLLR......TAN
D2QHX9_SPILD/32-275---------------------VPLEG....ASNFRDLGG.........YP..T...KNGRR..VKWGHLYR......SAD
B4EWC6_PROMH/12-260---------------------LPLTG....GINFRDLGG.........KK..L...SNGGI..IKPGLLFR......SGS
C8WJC8_EGGLE/31-290---------------------IVLEG....LPNTRDVGG.........LP..T...DDGRY..VKHARLLR......SGA
A1TVR0_ACIAC/8-246---------------------LPLAG....ATNFRDLGG.........YA..G...QDGRT..VRWRRLFR......SDH
C2X0Y4_BACCE/98-348---------------------LPLQG....AFNFRDMGG.........YE..T...TEGRK..VKWGKLYR......SEE
C8XE08_NAKMY/7-249---------------------DVVSG....TWNFRDIGG.........TP..T...PDGP...VRHGLVYR......CAV
E4NDQ8_KITSK/19-243---------------------LDWDG....CLNVRDLGL.........LP..T...VDGRT..TRTGAVVR......ADN
D4LU94_9FIRM/95-350---------------------IPLQS....LPNTRDLGA.........LM..T...SDGRH..ILPHRLLR......SGT
A9BQC1_DELAS/36-274---------------------IRLDG....ASNFRDLGG.........YA..G...LDGRR..VRWRTLFR......ADH
Q5LIW3_BACFN/108-351---------------------VNMPG....IQNFRDLGG.........YK..S...ATGKH..VRWGKLYR......SAQ
Q1GTR8_SPHAL/9-261---------------------LPLSG....VHNFRDYGG.........YA..V...EGGGR..LRDGMLWR......SAH
K0HYW0_9BURK/11-249---------------------LPLAG....ATNFRDLGG.........YV..G...HGGQA..VKWRRIFR......SDH
G2SRM1_LACRR/8-261---------------------LNLES....GVNFRELGG.........YQ..T...LDGHT..TKWHKALR......CGS
E9DC06_COCPS/15-267---------------------YIADG....ISNLRDVGG.........YA..I....SSTA.SVRRNFIYR......SAH
Q6BTL3_DEBHA/324-606---------------------RSIQG....ISNFRDIGGWRINSPRSH........DIEEYLYVKPNTIFR......CAT
E3QK75_COLGM/39-281---------------------HCVPG....TFNTRDIGQ.........VP..G.SA.......VRPGLAFR......SGS
Q74HM0_LACJO/7-261---------------------LPLQH....VPNARDLGG.........YV..G...FDGRK..IKMHRLLR......TGK
Q0S331_RHOJR/4-261---------------------IPLTS....VPNLRDVGG.........YR..T...RDGAK..VRTGVYFR......STD
D1A3M0_THECD/94-341---------------------LRMEG....LSNFRDLGG.........YR..T...ADGGR..VRWGLVYR......SDA
D3EZY0_CONWI/13-271---------------------APLLAA...MPNLRDAGG.........LP..A...AGGAH..VRTGVLYR......SGQ
C9A985_ENTCA/5-233---------------------LPLKG....TYNTRDLGG.........YA..A...KDGA...TAWKRFLR......SDS
C7YNH4_NECH7/9-263---------------------HHIPG....LPNFRDLGG.........HP..IPIASRPGY.TIRPGVVFR......SAD
D5ELA1_CORAD/7-258---------------------ISLET....QPNFRDLGG.........YP..T...TEDQS..VRYGQLYR......SGN
D6S2F7_9LACO/6-260---------------------LPLKT....IRNPRDLGG.........YL..T...QDGHK..VKMQRLLR......TGR
Q215M3_RHOPB/9-249---------------------LALTG....ACNFRDLGG.........YP..G...KDGRG..VRWRQLFR......SNH
Q03P16_LACBA/45-256---------------------IHLEG....GENMRDLGG.........YR..T...KSGQR..VKMGKVLR......SAS
B0CXN9_LACBS/22-274---------------------VSIPG....VINVRDLGS.........YPSAT...YSGRI..TKPEYLYR......SAE
Q0SFJ4_RHOJR/74-321---------------------PRLAS....VDNFRDVGG.....SRRGYA..T...ARGGH..VTRGLFYR......SNA
Q1G8A2_LACDA/6-259---------------------LPLKT....VRNPRDLGG.........YT..G...FSGRK..IKAGLLLR......TGT
Q38ZP0_LACSS/6-262---------------------LPLEK....GHNFRELGG.........YQ..T...TDGRT..LKWHKLLR......SAN
A8L7R7_FRASN/5-251---------------------FDLAG....TDNTRDLGG.........MP..T...PDGRL..TRSGVFLR......SDT
A4X2U1_SALTO/27-253---------------------LSWDG....CVNARDLGG.........LG..R..........VRPGAVVR......MEE
Q03Q47_LACBA/6-261---------------------LQLDG....GFNFRDLGG.........YP..S...AQQTT..VKWHRLMR......AAH
B9THB6_RICCO/25-274---------------------IVLEG....TANFRDFGG.........YA..T...RDGRH..VAWQKLYR......SGS
B2JI11_PARP8/75-321---------------------PRLAS....LENFRDVGG....T.AAGYP..T...VDGRV..VRRNAFFR......SNA
C6CR88_PAESJ/127-376---------------------VNLQG....AYNFRDLGG.........YK..T...TDGKT..VKWGKLFR......GEE
B0SYG0_CAUSK/6-257---------------------.PLQG....VENFRDFGD.........Y...A...AGQGR..LKKGVLFR......AAH
D2PUS2_KRIFD/4-236---------------------LDWNG....CLNARDVAG.........LP..T...RYGGT..TRAG.IIR......TDS
E0SLI9_DICD3/12-260---------------------LPLEG....GVNFRDLGG.........IR..V...ADGRQ..VRRGRLFR......SGA
Q03H84_PEDPA/7-259---------------------LNVPG....AVNFRELGG.........YQ..T...KFNQT..IKWQKLLR......SGE
C7QFP3_CATAD/5-243---------------------VEFQR....LHNFRDLGG.........YP..A...GAGRA..TKWGVLYR......SDN
Q0RP91_FRAAA/25-264---------------------ADIAG....LVNLRDVGG.........MT..T...ADGRR..TRPGVLYRSEMPKAGDR
R7CLZ0_9FIRM/95-350---------------------ISLHS....LPNTRDLGA.........IV..T...ADDRH..ILPRRLLR......SGE
E3GPJ0_EUBLK/71-318---------------------IQLEN....SINIRDIGG.........YT..G...LDGRR..TKWRKVIR......SEE
E3J517_FRASU/11-255---------------------IELAG....AYNVRDLGG.........LP......AAGGT..VRPRVLLR......GDN
A8L1T3_FRASN/11-255---------------------IELTG....AHNVRDLGG.........LP......AAGGT..VRPGVLLR......GDN
B6GYK5_PENRW/34-284---------------------IPIQG....VSNFRDLSH.........DG..N.Q........VRPGFIYR......SGT
C0ZQ41_RHOE4/12-244---------------------MDLST....LPNLRDLGG.........LA..R...EAGGL..TATGVLYRSALPAPGDV
D2S5X4_GEOOG/17-283---------------------LRLDG....TTNTRDLGG.........LP..T...SDGGS..TVPGRVLR......SDN
C8V371_EMENI/34-281---------------------ASVPG....IFNLRDISG.........AD..S.PLYPFSV.NLRTGLVYR......AGA
F2RHW5_STRVP/42-300---------------------IPLQG....AVNVRDLGG.........YL..T...YDGSR..VRHGLAYR......GDH
Q0RE18_FRAAA/5-251---------------------FNLAG....CDNVRDLGG.........LP..T...VDGAA..TRHGVFLR......SDS
V4J3P9_9ACTN/10-268---------------------VQAAT....VANLRDLGG.........IP..LPGAGQGRS..VRPGALLR......SAD
Q4Q3Q1_LEIMA/11-258---------------------IEVEG....LENLRNLGG.........YH..T...NNSTK.TTRWGVVYR......SDQ
C9ABV6_ENTCA/6-260---------------------VTLEG....AYNFRDFGG.........YR..T...KEGKY..VVTGKLYR......SDE
C7QCX6_CATAD/4-219---------------------VPLTG....VKNARDIGG.........IS..T...DSGAV..VQPLRLLR......TAR

PF04273

Q9A9Q0_CAUCR/3-111--------------------------------DFRFVTE--------SLS--V------------------------SPQ
BLH_XYLFA/2-111--------------------------------RIVDINE--------RLA--I------------------------SGQ
Q98J12_RHILO/2-111--------------------------------TMIRVND--------VLS--V------------------------GPQ
Q983I8_RHILO/2-111--------------------------------EYREISA--------DYS--V------------------------SGQ
D5AUD0_RHOCB/2-109--------------------------------DLRTLTP--------DFA--V------------------------APQ

PF00581

Q3UQ26_MOUSE/92-215----------------------------------------------------T------------------------AKE
UBP7_YEAST/319-444----------------------------------------------------L------------------------FSI
A6DRQ7_9BACT/39-134----------------------------------------------------P------------------------HAV
Q7RS06_PLAYO/48-151----------------------------------------------------L------------------------YNY
A6Q9B1_SULNB/104-220----------------------------------------------------V------------------------MKF
Q0S745_RHOJR/147-268----------------------------------------------------F------------------------RDE
A6Q7I9_SULNB/15-111----------------------------------------------------.------------------------LET
A2W0V1_9BURK/34-136----------------------------------------------------A------------------------PET
UBP4_ASHGO/163-290----------------------------------------------------.------------------------...
A6ZRA1_YEAS7/148-277----------------------------------------------------E------------------------PGK
PYP1_SCHPO/41-159----------------------------------------------------L------------------------QEY
Q2GUP8_CHAGB/320-441----------------------------------------------------S------------------------PTE
PTP3_YEAST/99-226----------------------------------------------------T------------------------AVE
PYP2_SCHPO/13-124----------------------------------------------------T------------------------LKS
A8BJL6_GIAIC/25-144----------------------------------------------------S------------------------TEW
Q5V0H7_HALMA/7-124----------------------------------------------------S------------------------AEW
A0LFK9_SYNFM/381-492----------------------------------------------------E------------------------TAW
Q6Q1E2_9FIRM/37-149----------------------------------------------------T------------------------ADE
A4YDN1_METS5/6-113----------------------------------------------------S------------------------APK
Q6APH8_DESPS/54-166----------------------------------------------------T------------------------TDE
A5GEA5_GEOUR/46-159----------------------------------------------------D------------------------AAA
A0A0E8MSC5_MYCTX/46-156----------------------------------------------------T------------------------ADW
Q1ZSD2_PHOAS/164-271----------------------------------------------------H------------------------QQP
Q2S417_SALRD/398-522----------------------------------------------------T------------------------LDE
A6UVI6_META3/92-215----------------------------------------------------T------------------------LSD
Q79HS1_WOLSU/43-148----------------------------------------------------D------------------------YDY
B8FP35_DESHD/222-317----------------------------------------------------T------------------------AEE
A4ARX6_MARSH/58-153----------------------------------------------------S------------------------DVL
A0LFK9_SYNFM/238-331----------------------------------------------------E------------------------PEA
Q5ZT59_LEGPH/41-131----------------------------------------------------S------------------------PQS
Q7CPH6_SALTY/41-135----------------------------------------------------T------------------------RGE
Q1JVT3_DESAC/182-288----------------------------------------------------S------------------------AAE
Q14PT6_SPICI/14-105----------------------------------------------------S------------------------IKK
Q4RJE9_TETNG/806-939----------------------------------------------------S------------------------AGL
A2SM11_METPP/221-317----------------------------------------------------T------------------------QAE
Q9HKF8_THEAC/96-184----------------------------------------------------N------------------------AEE
A0DUQ2_PARTE/119-217----------------------------------------------------Y------------------------ATE
CE41A_XENLA/168-268----------------------------------------------------S------------------------SSA
A6H0K8_FLAPJ/365-456----------------------------------------------------T------------------------AAE
Q5ZV71_LEGPH/281-372----------------------------------------------------T------------------------LDE
A8G773_PROM2/285-378----------------------------------------------------F------------------------NKL
A5CVJ0_VESOH/26-121----------------------------------------------------E------------------------IQR
Q5HKB3_STAEQ/351-442----------------------------------------------------T------------------------RSI
Q2ST45_MYCCT/8-101----------------------------------------------------S------------------------NDK
A4ADQ3_9GAMM/250-346----------------------------------------------------D------------------------PLE
A5GWB7_SYNR3/27-124----------------------------------------------------S------------------------APE
Q8FSR3_COREF/397-486----------------------------------------------------L------------------------PQD
Q5KY63_GEOKA/370-461----------------------------------------------------D------------------------VQQ
Q21SC0_RHOFT/40-138----------------------------------------------------M------------------------VSY
Q6W140_SINFN/664-759----------------------------------------------------D------------------------VTE
D4FJ51_STAEP/34-123----------------------------------------------------D------------------------QNE
A3YZ19_9SYNE/28-121----------------------------------------------------.------------------------LQK
DIN1_RAPSA/74-177----------------------------------------------------V------------------------PVR
UBA4_KLULA/334-436----------------------------------------------------F------------------------ERD
Q9A4H1_CAUCR/10-101----------------------------------------------------T------------------------PDD
C1DFE4_AZOVD/270-360----------------------------------------------------V------------------------AAW
A6ERQ8_9BACT/41-135----------------------------------------------------S------------------------PKE
Q14BE0_MOUSE/63-178----------------------------------------------------S------------------------VTD
MOEB_PYRYE/276-370----------------------------------------------------S------------------------VIQ
A7SQG4_NEMVE/62-168----------------------------------------------------T------------------------LTC
A0A0D1CKZ8_USTMA/79-181----------------------------------------------------L------------------------KPE
A4ARX3_MARSH/58-152----------------------------------------------------M------------------------ADE
Q97TR5_CLOAB/14-103----------------------------------------------------S------------------------VHD
Q99IY6_9BACT/162-268----------------------------------------------------E------------------------PAG
A3JNH0_9RHOB/144-234----------------------------------------------------D------------------------GAS
A4P043_HAEIF/7-97----------------------------------------------------T------------------------PQQ
Q65H01_BACLD/7-107----------------------------------------------------S------------------------PKE
Q1V0S6_PELUQ/18-119----------------------------------------------------S------------------------VDE
A6F9M6_9GAMM/22-116----------------------------------------------------S------------------------CDD
A3W0C4_9RHOB/45-145----------------------------------------------------P------------------------AAE
A4YZA0_BRASO/20-119----------------------------------------------------T------------------------PAE
A4SWZ6_POLSQ/197-315----------------------------------------------------.------------------------.DE
YPSL_SYNEL/8-105----------------------------------------------------T------------------------VQE
Q3UB30_MOUSE/23-142----------------------------------------------------L------------------------NEQ
A8MLP3_ALKOO/6-124----------------------------------------------------S------------------------QQW
A3I8D3_9BACI/4-124----------------------------------------------------V------------------------FKS
Q4DV84_TRYCC/37-153----------------------------------------------------I------------------------AHS
A0LIE9_SYNFM/201-298----------------------------------------------------T------------------------VST
A0ZKG4_NODSP/153-275----------------------------------------------------T------------------------TEE
Q4H3P4_CIOIN/10-132----------------------------------------------------Q------------------------FAS
DUS2_HUMAN/14-138----------------------------------------------------L------------------------GTL
Q13649_HUMAN/50-170----------------------------------------------------S------------------------HGT
A0RUH8_CENSY/140-246----------------------------------------------------T------------------------LEQ
A5G4J8_GEOUR/39-135----------------------------------------------------S------------------------SER
A0C532_PARTE/163-271----------------------------------------------------V------------------------ISY
Q3UMM5_MOUSE/11-131----------------------------------------------------V------------------------TES
Q1N257_9GAMM/148-263----------------------------------------------------T------------------------KNE
A0L4Y3_MAGMM/160-274----------------------------------------------------M------------------------QRV
Q8YQB5_NOSS1/164-277----------------------------------------------------D------------------------IED
Q2SDR5_HAHCH/155-271----------------------------------------------------T------------------------AEE
B9LNB2_HALLT/200-323----------------------------------------------------T------------------------REW
Q8YQ45_NOSS1/19-112----------------------------------------------------S------------------------WDL
U5LJ54_9BACI/173-289----------------------------------------------------T------------------------KED
B3EJ38_CHLPB/8-115----------------------------------------------------D------------------------TGV
Q0IM09_ORYSJ/261-378----------------------------------------------------N------------------------LDQ
A0B705_METTP/164-279----------------------------------------------------G------------------------MYE
A5EER6_BRASB/151-263----------------------------------------------------D------------------------RHA
A7H0S5_CAMC5/36-127----------------------------------------------------S------------------------LNE
Q315B7_DESAG/88-191----------------------------------------------------D------------------------LDA
A6Q5F5_NITSB/6-109----------------------------------------------------S------------------------PEY
A2FS10_TRIVA/10-117----------------------------------------------------T------------------------PAQ
Q1A5X4_PTEVI/11-119----------------------------------------------------S------------------------ATD
A5DGW6_PICGU/15-119----------------------------------------------------L------------------------REW
A2G462_TRIVA/58-168----------------------------------------------------T------------------------PKQ
MPIP_SCHPO/422-527----------------------------------------------------L------------------------DGK
A8WPE1_CAEBR/64-173----------------------------------------------------L------------------------ASI
Q2H1E1_CHAGB/18-128----------------------------------------------------T------------------------LLE
A6Q615_NITSB/27-142----------------------------------------------------S------------------------AKE
A0A090M8W4_OSTTA/62-164----------------------------------------------------N------------------------VDD
A5D3B0_PELTS/64-178----------------------------------------------------S------------------------VYE
Q1NX08_9DELT/38-134----------------------------------------------------S------------------------VEW
Q3M5Q3_ANAVT/51-164----------------------------------------------------A------------------------PNW
Q30TU2_SULDN/21-134----------------------------------------------------K------------------------PAQ
Q31H13_THICR/25-133----------------------------------------------------S------------------------ADW
D5B939_ZUNPS/260-354----------------------------------------------------S------------------------PDA
Q2T7N9_BURTA/15-135----------------------------------------------------L------------------------AER
Q18C56_PEPD6/6-129----------------------------------------------------S------------------------AKE
Q2SQQ3_HAHCH/41-139----------------------------------------------------E------------------------LQE
THT2_CAEEL/12-156----------------------------------------------------V------------------------NTL
A8XWD8_CAEBR/8-147----------------------------------------------------E------------------------PKW
Q92UU7_RHIME/29-150----------------------------------------------------D------------------------AEW
A4WTF3_RHOS5/29-148----------------------------------------------------T------------------------PEQ
Q87VI1_PSESM/12-123----------------------------------------------------E------------------------PND
B3EN19_CHLPB/61-161----------------------------------------------------S------------------------ARE
A3KIP2_STRAM/342-438----------------------------------------------------G------------------------VEA
Q18FK5_HALWD/10-106----------------------------------------------------V------------------------KHQ
A7BRE1_9GAMM/28-117----------------------------------------------------D------------------------INV
A4YEV3_METS5/22-109----------------------------------------------------M------------------------VRK
A5DMM8_PICGU/110-238----------------------------------------------------E------------------------QKD
A4RQH3_OSTLU/25-155----------------------------------------------------S------------------------AKE
Q7NLN3_GLOVI/208-308----------------------------------------------------T------------------------TTE
R7G243_9FIRM/6-94----------------------------------------------------.------------------------IEE
A1K7U1_AZOSB/23-116----------------------------------------------------A------------------------ADM
Q10W62_TRIEI/22-136----------------------------------------------------N------------------------PAE
Q64AN8_9ARCH/226-334----------------------------------------------------D------------------------TEW
A7HA14_ANADF/61-157----------------------------------------------------A------------------------VDE
B9LNB2_HALLT/62-175----------------------------------------------------G------------------------PSW
Q6ANQ7_DESPS/26-124----------------------------------------------------A------------------------AGD
A9WET4_CHLAA/163-266----------------------------------------------------A------------------------ADL
Q1K257_DESAC/30-123----------------------------------------------------A------------------------PKS
Q926L9_LISIN/458-550----------------------------------------------------T------------------------PTE
D2ADU7_SHIF2/20-111----------------------------------------------------L------------------------ALV

PF00102

O01555_CAEEL/93-327----------------NTDKNR-------YQDVP---------------------------CQDK--G---------RIV
PTPR_CAEEL/1160-1401----------------NLLKNR-------YEAAV---------------------------PFDK--Y---------RVI
PTN14_MOUSE/935-1181----------------NAERSR-------IREVV---------------------------PYEE--N---------RVE
Q9U1Q9_CAEEL/1009-1238----------------PKNKHR-------YPTLP---------------------------CKPS--T---------AVK
PTPRC_MOUSE/664-898----------------NQNKNR-------YVDIL---------------------------PYDY--N---------RVE
O01913_CAEEL/714-963----------------HLYRCS-------SPRYT---------------------------.HDW--A---------RVR
PTPRO_HUMAN/962-1194----------------NRCKNR-------YTNIL---------------------------PYDF--S---------RVR
PTN12_MOUSE/58-292----------------NVKKNR-------YKDIL---------------------------PFDH--S---------RVK
PTN2_HUMAN/42-274----------------NRNRNR-------YRDVS---------------------------PYDH--S---------RVK
Q9W324_DROME/532-778----------------NLTKNR-------YTDVL---------------------------CYDH--S---------RVV
PTN13_HUMAN/2237-2466----------------NRRKNR-------YKNIL---------------------------PYDA--T---------RVP
O17889_CAEEL/879-1129----------------NISQRR-------HTLFL---------------------------CEPK--T---------MAK
PTN22_HUMAN/54-288----------------NIKKNR-------YKDIL---------------------------PYDY--S---------RVE
Q18652_CAEEL/243-468----------------NMDKNR-------FVDVI---------------------------CMDH--S---------RVK
P91568_CAEEL/223-451----------------NPTRNR-------YRNIP---------------------------CCDI--T---------RVK
PTN7_HUMAN/119-349----------------HASKDR-------YKTIL---------------------------PNPQ--S---------RVC
PYP1_SCHPO/295-538----------------SYKKNR-------YTDIV---------------------------PYNC--T---------RVH
PTPRF_RAT/1655-1888----------------NKFKNR-------LVNIM---------------------------PYEL--T---------RVC
PTPRE_MOUSE/450-687----------------NMKKAR-------VIQII---------------------------PYDF--N---------RVI
PYP2_SCHPO/458-697----------------ISRKNR-------YTDIV---------------------------PYDK--T---------RVR
O01736_CAEEL/142-375----------------HSEKCR-------YYDIL---------------------------CPDA--T---------RVV
PTPRT_HUMAN/1202-1436----------------NHDKNR-------SMDVL---------------------------PLDR--C---------LPF
P91498_CAEEL/98-327----------------HPEKNR-------YKDVY---------------------------CIDD--T---------RVV
PTN9_HUMAN/327-573----------------NLEKNR-------YGDVP---------------------------CLDQ--T---------RVK
PTPRV_RAT/1174-1408----------------NIIKNR-------YPHVL---------------------------PYDH--S---------RVR
PTN3_HUMAN/670-900----------------NLDKNR-------YKDVL---------------------------PYDT--T---------RVL
PTPRZ_RAT/1751-1992----------------NKHKNR-------YVNIV---------------------------AYDH--S---------RVK
LAR_DROME/1497-1728----------------NKSKNR-------YANVT---------------------------AYDH--S---------RVQ
PTPRK_HUMAN/1200-1434----------------NHDKNR-------FMDML---------------------------PPDR--C---------LPF
PTP99_DROME/789-1015----------------NSIKNR-------.GAIF---------------------------PIEG--S---------RVH
Q20108_CAEEL/150-375----------------EFKKNR-------YKDVP---------------------------CNDK--T---------RVI
PTPRG_CHICK/1152-1386----------------NKEKNR-------NSSVV---------------------------PSER--A---------RVG
LAR_CAEEL/1670-1901----------------NKHKNR-------YANVA---------------------------AYDH--S---------RVV
PTN5_HUMAN/322-554----------------LVRKNR-------YKTIL---------------------------PNPH--S---------RVC
PTP3_DICDI/470-714----------------NYGKNR-------YHDVL---------------------------PNES--T---------RVR
O01435_CAEEL/295-520----------------NPTRNR-------YTNIP---------------------------CCDA--T---------RVK
Q21297_CAEEL/18-256----------------EHGKNR-------YKDVG---------------------------CLDN--N---------RVK
O44901_CAEEL/79-316----------------EHGKNR-------YKDVG---------------------------CLDH--N---------RVK
Q20252_CAEEL/164-398----------------NIDFSQ-------SENVE---------------------------LYDT--N---------RVK
Q22668_CAEEL/151-376----------------NPTKNR-------YKDVV---------------------------CNDI--T---------RVI
PYP3_SCHPO/49-291----------------ALARNR-------YSNIV---------------------------PYEN--T---------RVR
Q20402_CAEEL/237-513----------------YLTKAR-------SKMVP---------------------------CAEF--S---------RVK
O01556_CAEEL/90-324----------------NPEKNR-------YTDIK---------------------------CIEK--T---------RVI
PTPRA_HUMAN/558-790----------------NMKKNR-------VLQII---------------------------PYEF--N---------RVI
PTPRK_HUMAN/910-1140----------------NRAKNR-------YGNII---------------------------AYDH--S---------RVI
Q9W4F5_DROME/1353-1583----------------NRPKNR-------FTNIL---------------------------PYDH--S---------RFK
Q22158_CAEEL/87-334----------------HPELNK-------FGEIQ---------------------------VYEQ--T---------RVR
PTP61_DROME/60-295----------------NRGLNR-------YRDVN---------------------------PYDH--S---------RIV
P91147_CAEEL/72-332----------------NLPVNV-------RLPIP---------------------------IRDN--R---------RVL
PTP1_CAEEL/777-1010----------------NLAKNR-------YRDVC---------------------------PYDD--T---------RVT
PTP69_DROME/917-1155----------------NACKNR-------YPDIK---------------------------AYDQ--T---------RVK
PTN6_MOUSE/270-514----------------NKSKNR-------YKNIL---------------------------PFDH--S---------RVI
PTN20_MOUSE/189-417----------------NRDKNR-------YRDIL---------------------------PYDS--T---------RVP
PTPRN_RAT/738-972----------------NIKKNR-------HPDFL---------------------------PYDH--A---------RIK
PTP2_YEAST/408-736----------------SFTKNR-------YSNIL---------------------------PYEH--S---------RVK
PTPRM_HUMAN/1213-1447----------------NHEKNR-------CMDIL---------------------------PPDR--C---------LPF
PTN18_HUMAN/56-290----------------NVRKNR-------YKDVL---------------------------PYDQ--T---------RVI
Q22852_CAEEL/84-312----------------MMDKNR-------YRHIF---------------------------CGDD--N---------RVV
Q18385_CAEEL/174-407----------------NTFKNQ-------RKDVP---------------------------CIDD--T---------RVK
PTPRZ_RAT/2049-2282----------------NREKNR-------TSSII---------------------------PVER--S---------RVG
PTP1_ARATH/87-325----------------NVEKNR-------YSDVV---------------------------PFDK--N---------RIV
PTN1_RAT/40-276----------------NKNRNR-------YRDVS---------------------------PFDH--S---------RIK
O01923_CAEEL/808-1045----------------EQMKQR-------LPIPL---------------------------VMD.--T---------RVV
Q9XWA6_CAEEL/1194-1423----------------HKDKHR-------YDGVP---------------------------CKPL--T---------AVE
Q9VUH6_DROME/1557-1788----------------FPEKNR-------SLDCL---------------------------PYDH--A---------RVK
PTP99_DROME/502-740----------------NKRKNR-------YLNIT---------------------------AYDH--S---------RVH
PTPRG_CHICK/851-1095----------------NKHKNR-------YINIL---------------------------AYDH--S---------RVK
PTN23_RAT/1080-1306----------------YSLKNR-------HQDVM---------------------------PYDS--N---------RVV
PTP69_DROME/1213-1449----------------NNMKNR-------SQEII---------------------------PYDR--N---------RVI
Q9VJ95_DROME/428-672----------------NREKNR-------DVLCV---------------------------PPDN--F---------RPY
O45095_CAEEL/243-500----------------NKVRNR-------EGCPK---------------------------IYDE--N---------RVQ
Q9VJ95_DROME/125-368----------------NLEKNQ-------NPKCI---------------------------PYDY--N---------RVV
Q20179_CAEEL/225-455----------------NMHKNR-------FADVI---------------------------CLDH--S---------KVH
PTPRU_MOUSE/913-1143----------------KLKGGR-------QEPVS---------------------------AYDR--H---------HVK
O44180_CAEEL/290-520----------------NNKKNR-------YSNIP---------------------------CLDI--S---------RVQ
Q18301_CAEEL/158-391----------------HSSRNR-------HNDSK---------------------------CYDH--N---------RII
O61789_CAEEL/432-660----------------NQEKCR-------NPRVH---------------------------CRDS--T---------RIA
PTPRM_HUMAN/923-1153----------------NRMKNR-------YGNII---------------------------AYDH--S---------RVR
PTPRJ_CHICK/1134-1366----------------NRGKNR-------YNNVL---------------------------PYDI--S---------RVK
O45079_CAEEL/180-408----------------NLQMNQ-------ADNYP---------------------------ILDS--T---------IVK
O17840_CAEEL/203-436----------------NPDLNR-------YADVR---------------------------CIEE--T---------RVV
LAR_CAEEL/1958-2191----------------NRPKNR-------MLSAV---------------------------PYDS--N---------RVI
PTN21_RAT/922-1167----------------NAERNR-------FQDVL---------------------------PYDD--A---------RVE
B4JBQ7_DROGR/1040-1276----------------NESKNH-------DPNFL---------------------------PYDD--N---------RVR
F1NVB1_CHICK/901-1159----------------NKNKNR-------SANTI---------------------------PYDF--N---------RVP
F1P3M5_CHICK/271-506----------------NKEKNR-------YVNIL---------------------------PYDH--S---------RVH
F6ZV27_ORNAN/52-283----------------NKPKNR-------YANVI---------------------------AYDH--S---------RVI
F7BMX4_XENTR/425-671----------------NQAKNR-------YSDVL---------------------------CLDL--S---------RVK
G1QLI5_NOMLE/189-423----------------NVPKNR-------SLAVL---------------------------TYDH--S---------RVL
I1LD92_SOYBN/86-325----------------NLRKNR-------YTDVL---------------------------PFDK--N---------RVV
M3WBW9_FELCA/273-519----------------NKNKNR-------YKNIL---------------------------PFDH--T---------RVV
PTN20_HUMAN/183-411----------------NREKNR-------YRDIL---------------------------PYDS--T---------RVP
PTN4_MOUSE/679-909----------------NISKNR-------YRDIS---------------------------PYDA--T---------RVL
S4R1M0_MOUSE/794-1051----------------NKKKNR-------NSNVV---------------------------PYDF--N---------RVP

PF00782

Q22707_CAEEL/65-203--------------------------------------------------------------------------------
Q19388_CAEEL/18-146--------------------------------------------------------------------------------
DUS5_HUMAN/186-316--------------------------------------------------------------------------------
VHP1_CAEEL/183-315--------------------------------------------------------------------------------
STYX_MOUSE/36-168--------------------------------------------------------------------------------
CDC14_YEAST/198-335--------------------------------------------------------------------------------
DUS1_HUMAN/181-311--------------------------------------------------------------------------------
DUS2_HUMAN/180-310--------------------------------------------------------------------------------
DUS3_HUMAN/37-176--------------------------------------------------------------------------------
DUS6_HUMAN/214-346--------------------------------------------------------------------------------
MSG5_YEAST/242-372--------------------------------------------------------------------------------
DUS8_MOUSE/168-299--------------------------------------------------------------------------------
PMP1_SCHPO/69-211--------------------------------------------------------------------------------
PVH1_SCHPO/54-184--------------------------------------------------------------------------------
Q84621_PBCV1/32-162--------------------------------------------------------------------------------
DUSP_MYXVL/34-169--------------------------------------------------------------------------------
Q93592_CAEEL/21-151--------------------------------------------------------------------------------
Q93622_CAEEL/10-138--------------------------------------------------------------------------------
SDP1_YEAST/68-193--------------------------------------------------------------------------------
YNBD_ECOLI/306-430--------------------------------------------------------------------------------
DUSP_VACCW/34-166--------------------------------------------------------------------------------
CPP1_CANAL/437-575--------------------------------------------------------------------------------

PF14566

Q5KH69_CRYNJ/229-383----------------.STREETLV....YCNGR---------------------------PYVL--R---------DAS
E1BUS7_CHICK/161-329----------------FCVREEPVLFLRVESDFV---------------------------PYTP--R---------GKE
E1BUS7_CHICK/545-692----------------VSLREEVVL....EGNEQ---------------------------IYTL--R---------EPG
E1BH07_BOVIN/161-330----------------FCVREEPVLFLRAAEDFI---------------------------PYTP--R---------DKQ
E3JPZ2_PUCGT/669-828----------------INLREEPLI....YINGV---------------------------PYVL--R---------LEA
A4HD18_LEIBR/578-733----------------VNLREEPLV....YINDN---------------------------SYIV--R---------ERA
A4HD18_LEIBR/955-1112----------------ISLRAEPMV....LINDV---------------------------TYTL--S---------DYD
A4HD18_LEIBR/1405-1567----------------VNLREEPIL....YVGDR---------------------------PFVF--R---------DLA
A7S980_NEMVE/79-248----------------FNLREEPVIFLSLNHDYI---------------------------PYSP--R---------DPN
A8NUG9_COPC7/152-312----------------FSTREEPLV....YISGR---------------------------PFVL--R---------DAS
A8NUG9_COPC7/652-809----------------LTLREEPIV....YINGA---------------------------PYCL--R---------RER
A8NUG9_COPC7/1085-1245----------------TSLREEPVI....YVAGR---------------------------PHVL--R---------LVN
A8PWR7_MALGO/105-261----------------ICTREEPVV....YVGDI---------------------------PYVL--R---------EAY
A8PWR7_MALGO/1010-1170----------------TNLREEPVL....YVNGR---------------------------PHVL--R---------LAD
A9SKI5_PHYPA/87-242----------------HNLREEPVI....YVNGR---------------------------PFVL--R---------EVE
A9SKI5_PHYPA/507-663----------------HNMREEPVV....YINGK---------------------------PFVL--R---------EVE
A9SKI5_PHYPA/942-1102----------------TDLREEVVV....YVHDN---------------------------PFVL--R---------EVD
B3S659_TRIAD/150-328----------------LNTKQEPVLFVYDDMDFR---------------------------PYSI--R---------KPE
B3S659_TRIAD/514-665----------------FNLREDLVI....QADQS---------------------------TYSV--R---------EVG
D0NS27_PHYIT/226-388----------------VNLREEAVI....YVNGR---------------------------PFTA--R---------RSA
D0NS27_PHYIT/608-784----------------INLREEAVI....YVSGR---------------------------PFCV--R---------HQD
D7LSR9_ARALL/949-1107----------------TDLREEAVV....YINGT---------------------------PFVL--R---------ELS
D8Q3Q5_SCHCM/576-728----------------ITLREEPIV....YINGM---------------------------PYCL--R---------REG
D8Q3Q5_SCHCM/1008-1168----------------TSLREEPVI....YVAGR---------------------------PHVL--R---------LVD
D8QMN2_SELML/93-248----------------HNLREEPVI....YINGR---------------------------PFVL--R---------EIE
D8QMN2_SELML/507-663----------------HNMREEPVV....YINGQ---------------------------PFVL--R---------EVE
D8TQ16_VOLCA/99-254----------------QNLREEPLI....FINGN---------------------------PFVV--R---------EAD
D8TQ16_VOLCA/549-710----------------INMREEPVV....YIKGR---------------------------PFVL--R---------EER
E1ZN66_CHLVA/161-316----------------HNQREEPVI....YINGK---------------------------PFVV--R---------ESE
E1ZN66_CHLVA/570-738----------------HLQREEPVV....YINGR---------------------------PYVL--R---------ESA
E6ZVY8_SPORE/227-382----------------VCTREEPVI....YVGGR---------------------------PFVL--R---------EAE
E6ZVY8_SPORE/725-885----------------INLREEPIV....YVNGK---------------------------PYCL--R---------QKG
E6ZVY8_SPORE/1211-1371----------------TSLREEPVL....YVNGR---------------------------PHVL--R---------LAD
PALD_XENTR/164-333----------------FCVREEPVLFLKLEDDFV---------------------------PYTP--R---------RKE
PALD_XENTR/549-696----------------VNLREDVIL....EANEQ---------------------------IFTP--R---------EPD
PALD_DANRE/152-321----------------FCLREEPVVFLHLQEDFL---------------------------PYTP--R---------RKE
PALD_DANRE/539-686----------------VNLQDELLL....EANNQ---------------------------IFSP--R---------EPT
B7ZD37_DANRE/177-345----------------ICVREEPVVFFRSSGDFI---------------------------PYTP--R---------RKE
D3HQA5_LEGLN/106-249----------------LDLRQESHG....YLNGR---------------------------AITL--V---------SEY
F8L2G7_PARAV/112-247----------------VDLREESHG....FINGD---------------------------AVSW--Y---------GTR
G0VLV4_MEGEL/130-269----------------VDLRQESHG....FFNGT---------------------------AVSW--Y---------GRH
G3NCI0_GASAC/546-691----------------VNLQEELVL....EGNGQ---------------------------ILTP--R---------EPS
G4Q6F9_ACIIR/130-269----------------VDLRQESHG....FVNGM---------------------------PVSW--Y---------GKR
K7MZP3_SOYBN/503-659----------------HNMREEPVI....YINGK---------------------------PFVL--R---------EVE
Q57YX2_TRYB2/395-546----------------VNLREEPLV....YINNE---------------------------AHIV--R---------QRS
Q5ZRR1_LEGPH/106-249----------------LDLRQESHG....YLNGR---------------------------AITL--V---------SAY
Q97TT3_CLOAB/105-246----------------IDLRQESHI....FVNGI---------------------------GISW--Y---------GKN
R5T921_9FIRM/138-277----------------VDLRQETHG....IFNGN---------------------------AVSW--F---------GAR

PF04179

C1GPQ9_PARBA/356-466-----------------------------KVLNL---------------------------GCPP--G.--------KLG
S8AI90_DACHA/404-517-----------------------------PLYQA---------------------------VIPS--N.--------KSG
E9DAT9_COCPS/337-447-----------------------------PVLNL---------------------------GCVA--G.--------KLG
G9MHA9_HYPVG/367-492-----------------------------TLLRV---------------------------GLGK--H.--------KTA
R9PDR6_PSEHS/404-524-----------------------------KVLEL---------------------------QMSA--N.--------KKG
U5GYA0_USTV1/383-496-----------------------------PDLVL---------------------------VAKT--G.--------KAG
D8RSU0_SELML/381-489-----------------------------YFLSL---------------------------DIQD--S.--------KFD
C7YUH6_NECH7/338-448-----------------------------SYMKA---------------------------GLGK--S.--------KAA
F0XM43_GROCL/358-471-----------------------------VRLEV---------------------------GLGK--QD--------KTA
H6C7Z6_EXODN/346-456-----------------------------RQLDL---------------------------KCRS--G.--------KLG
M2SJZ2_COCSN/342-454-----------------------------HYLNL---------------------------KCQT--G.--------KLG
B9ILU0_POPTR/385-495-----------------------------AHLHL---------------------------PMVS--S.--------KLD
H1V029_COLHI/347-462-----------------------------SRMEV---------------------------GLGK--H.--------KVA
E1Z633_CHLVA/380-483-----------------------------RYCWL---------------------------PVRS--S.--------KLE
M9MG34_PSEA3/410-530-----------------------------NVYSI---------------------------HMSP--N.--------KKG
C5DDT7_LACTC/364-473-----------------------------AIKIF---------------------------KLQS--EC--------KKS
A3GEW1_PICST/430-536-----------------------------QLFQH---------------------------KIES--S.--------KKG
YAW6_SCHPO/327-444-----------------------------NELCF---------------------------PIPS--G.--------KKG
B8P5G6_POSPM/342-456-----------------------------MILQL---------------------------HLAE--G.--------KID
U5D482_AMBTC/451-561-----------------------------AYLCL---------------------------PIVN--S.--------KMD
Q5Z9S3_ORYSJ/423-533-----------------------------SYLEL---------------------------PMVG--S.--------KDD
M2YX40_PSEFD/338-447-----------------------------FYITL---------------------------ATPT--G.--------KNG
G1XCX2_ARTOA/414-526-----------------------------PEYRT---------------------------YIPP--N.--------KVG
X6N575_RETFI/407-503-----------------------------QLICL---------------------------FVSE--N.--------KKY
G8JSC9_ERECY/371-479-----------------------------RIKVY---------------------------PINN--NS--------KKS
R7YVR8_CONA1/342-453-----------------------------NYLHL---------------------------QCTA--G.--------KLG
I1RME2_GIBZE/335-448-----------------------------TYMQA---------------------------GLGK--S.--------KLA
I1K5Y8_SOYBN/394-504-----------------------------SYLHL---------------------------PMVT--S.--------KFD
G8ZND5_TORDC/376-488-----------------------------FISIH---------------------------KLQS--GS--------KVS
K1WJY4_MARBU/341-452-----------------------------VRVDV---------------------------GLGP--H.--------KLG
G8BB49_CANPC/346-447-----------------------------KVHQF---------------------------SIPN--N.--------KKG
G8BXA9_TETPH/379-492-----------------------------IIKLF---------------------------RLQS--GS--------KKS
S3C242_OPHP1/408-502-----------------------------NHLEV---------------------------GLGK--QD--------KIA
E5AAV6_LEPMJ/344-453-----------------------------HHLHL---------------------------ACQT--G.--------KLG
H2AQP4_KAZAF/367-482-----------------------------IIKLF---------------------------KLQS--GS--------KKS
S2J0U1_MUCC1/357-464-----------------------------HYLHL---------------------------PIPD--G.--------KKG
M7U0Y5_BOTF1/340-461-----------------------------TRLDI---------------------------GLGA--K.--------KVG
B2B700_PODAN/339-458-----------------------------SHIEV---------------------------GLGK--S.--------KAA
M1W3J9_CLAP2/425-535-----------------------------NYMEI---------------------------GLGK--H.--------KTA
G2XEA9_VERDV/363-481-----------------------------TEMEV---------------------------GVGK--H.--------KVA
Q5K8J8_CRYNJ/362-504-----------------------------SERVL---------------------------AVPS--A.--------KTD
R0IX52_SETT2/342-453-----------------------------HYLHL---------------------------KCQS--G.--------KLG
A6RFJ3_AJECN/420-530-----------------------------KTLNL---------------------------GCPS--G.--------KLG
K5X0D2_AGABU/371-488-----------------------------NILHI---------------------------HASP--KS--------KSK
E3KA19_PUCGT/393-503-----------------------------NTVAV---------------------------SKSR--AM--------KNF
C5E0N9_ZYGRC/359-471-----------------------------FIKTY---------------------------NLQS--GS--------KRS
G9P8X7_HYPAI/362-484-----------------------------THIRV---------------------------DLGK--H.--------KTA
V5GDC2_BYSSN/340-449-----------------------------KRLNL---------------------------GCGS--A.--------KLG
V2XTW4_MONRO/357-466-----------------------------TTLRI---------------------------FCPA--G.--------KKG
E7KT28_YEASL/399-512-----------------------------FISIY---------------------------KLQS--GD--------KKS
U7Q4K7_SPOS1/379-495-----------------------------TSLEV---------------------------GLGK--QD--------KIA
C8VDH2_EMENI/343-469-----------------------------KRLNL---------------------------GCIS--S.--------KQG
S8EAV7_FOMPI/344-458-----------------------------HILRL---------------------------RMAE--G.--------KKE
N1JAB6_BLUG1/339-458-----------------------------SHLEV---------------------------GIGQ--H.--------KIG
Q752X2_ASHGO/363-471-----------------------------RIRIY---------------------------PLNS--GC--------KKS
B6HQQ9_PENRW/338-448-----------------------------KRLNL---------------------------GCDS--G.--------KLG
M7XLM4_RHOT1/359-476-----------------------------QPCHL---------------------------CAKP--G.--------KAG
F4SBX2_MELLP/374-492-----------------------------.....---------------------------....--..--------KQG
C4Y409_CLAL4/373-474-----------------------------AVSHY---------------------------RVES--T.--------KKG
C5GAQ9_AJEDR/362-472-----------------------------RTLNL---------------------------GCPS--G.--------KLG
D5GAF8_TUBMM/380-486-----------------------------MPSHH---------------------------PIPN--N.--------SPG
A5DDJ2_PICGU/366-468-----------------------------KVHHY---------------------------KLQS--S.--------KKG
B8M9U3_TALSN/348-458-----------------------------KRLNL---------------------------GCGS--H.--------KLG
K5VFS6_PHACS/357-468-----------------------------DLLRL---------------------------QLPQ--G.--------KRG
S8A0J5_PENO1/340-450-----------------------------RRLNL---------------------------GCAS--A.--------KLG
G3AWZ7_CANTC/338-437-----------------------------KVFHY---------------------------ELEP--N.--------KKG
K2R165_MACPH/343-477-----------------------------NYLYL---------------------------KCGT--G.--------KLG
F4Q8M0_DICFS/386-509-----------------------------KFLSI---------------------------QLKE--G.--------KKS
L2G6S0_COLGN/344-454-----------------------------MYMQV---------------------------GLGK--H.--------KVA
G4MYV2_MAGO7/371-492-----------------------------TLIDV---------------------------GIGK--G.--------KLA
Q7S7X7_NEUCR/344-470-----------------------------RHMEV---------------------------GLGK--S.--------KTA
B6K0F6_SCHJY/330-447-----------------------------GEYHY---------------------------PVSS--G.--------KMG
M4DKF4_BRARP/403-513-----------------------------EHLHL---------------------------PMMG--S.--------KFD
F4NTS2_BATDJ/373-483-----------------------------LYVYL---------------------------DIPE--G.--------KKG
G3AS11_SPAPN/393-494-----------------------------MILKY---------------------------PIPS--G.--------KKG
F9XI17_ZYMTI/344-452-----------------------------QRLQL---------------------------TCVE--G.--------KVG
K0KV37_WICCF/348-447-----------------------------KTYRY---------------------------ELSS--D.--------KKG
J7RB50_KAZNA/385-498-----------------------------MVKIF---------------------------RLTS--GS--------KKS
G2Q8H3_MYCTT/361-480-----------------------------RCLEV---------------------------GIGK--S.--------RAA
N4V8M2_COLOR/342-452-----------------------------TRMEV---------------------------GLGK--H.--------KVA
Q7Y230_ARATH/402-512-----------------------------EHLHL---------------------------PMKG--S.--------KFD
G2QSG8_THITE/366-478-----------------------------AHLEV---------------------------GLGK--H.--------KAA
G8YD06_PICSO/413-517-----------------------------TVIHL---------------------------NVPS--N.--------KKG
A1CAM8_ASPCL/342-452-----------------------------KRLCL---------------------------GCRS--S.--------KLG
L8GDB1_PSED2/342-457-----------------------------HRLEI---------------------------GIGS--G.--------KIG
I2G2Q6_USTH4/409-522-----------------------------GIYAL---------------------------HLSS--S.--------KKD
A9S2G5_PHYPA/392-501-----------------------------SDLHL---------------------------PIVG--S.--------KFD
K7VV88_MAIZE/422-532-----------------------------SYLEL---------------------------SIVG--S.--------KDD
W1QIL3_OGAPD/335-432-----------------------------VLLHV---------------------------LLTS--GS--------KKS
M2MJZ2_BAUCO/346-453-----------------------------KYIQL---------------------------VCRA--G.--------KLG
A7TSQ7_VANPO/375-488-----------------------------RIVIN---------------------------QLQS--GS--------KKS
G0RHH7_HYPJQ/349-476-----------------------------TLLRV---------------------------GLGK--H.--------KTA
B0DXY4_LACBS/355-474-----------------------------NCLYI---------------------------PLHH--ER--------KKK
G0VC18_NAUCC/373-485-----------------------------STHIF---------------------------KLQS--GS--------KKS
G7XWH4_ASPKW/344-454-----------------------------NRLNL---------------------------GCGS--S.--------KLG
E4UTV7_ARTGP/337-447-----------------------------KRLNL---------------------------GCPA--G.--------KLG
M2YPJ4_DOTSN/341-449-----------------------------RYIPL---------------------------ICSS--G.--------KVG
K4DBT3_SOLLC/405-515-----------------------------AHLNL---------------------------SIVS--S.--------KFD
E9EIX2_METAQ/356-466-----------------------------TSMDV---------------------------GLGK--H.--------KTA
B9RKG8_RICCO/398-508-----------------------------SYLHL---------------------------PMVS--S.--------KLD
M0RLY9_MUSAM/414-524-----------------------------SQLHL---------------------------PIVT--S.--------KVD
I1HUK5_BRADI/428-538-----------------------------SYLEI---------------------------AIVG--S.--------KND
J3NGW3_GAGT3/398-531-----------------------------TTLEV---------------------------GLGK--G.--------KIA
F2UJ91_SALR5/411-524-----------------------------SILPV---------------------------RMPA--G.--------KRH
E3RT85_PYRTT/341-451-----------------------------NYLHL---------------------------PCQT--G.--------KLG
U4LI63_PYROM/344-451-----------------------------GATNI---------------------------PIPG--G.--------KRG
G0WHG3_NAUDC/380-503-----------------------------SVKIY---------------------------KLTS--GS--------KKS
Q6CSF9_KLULA/375-488-----------------------------SIHIF---------------------------PLPS--GS--------KKS
Q6BMH5_DEBHA/431-537-----------------------------TILQY---------------------------KVES--S.--------KKG
M2Q805_CERS8/351-462-----------------------------HVLKL---------------------------SMPE--G.--------KKG
D7TBG8_VITVI/401-511-----------------------------AYLHL---------------------------PIVN--S.--------KLD
F0ZEU9_DICPU/383-509-----------------------------NYLHL---------------------------PIRE--G.--------KIG
E6ZXK3_SPORE/413-527-----------------------------KVLTL---------------------------HMSP--N.--------KKG
D3B088_POLPA/398-512-----------------------------NYIHI---------------------------PMKE--G.--------KLA

PF06602

MTMR9_CAEEL/119-461DYAFFYN..........SPFTI......LDDGWS...........................AFDL--EQ........EFA
C9JEX3_HUMAN/120-457LFAFEYK..........EVFP........ENGWK...........................LYDP--LL........EYR
D6W9S3_TRICA/203-540LFAFEYS..........ETFP........ENGWA...........................IYEP--IA........ELK
C3XWL9_BRAFL/127-466LYAFQYNP.......QATLLD.......HEEGWN...........................YFSL--EA........EFS
S3C8M7_OPHP1/129-641LYAFSYTPP.....RQEKEV..........RGWA...........................IYDT--RA........EFR
D3ZTB0_RAT/68-407LYCFSFNP.......KLDKEE.......REQGWL...........................LVDL--SE........EYK
M7X0W0_RHOT1/149-559RYAFFCNDAG...KADRKGKG........KASWD...........................IYSA--EE........EFA
D6WMP8_TRICA/113-453LYPFFYR...........PMYN.....ILEDGHT...........................LFKL--ES........EYA
L8G7Q2_PSED2/120-600LYAYRYKGN.....PKEDPI..........KGWE...........................IYDA--RA........EWK
F6YKJ2_CIOIN/154-495FFAYIYK...........EEYP.....EEANGWM...........................MYSA--KA........EYH
R0KQU7_SETT2/121-609LLAFSYQPK.....PPEDKQ..........DGWS...........................IYDA--RR........EWK
G1PXE9_MYOLU/11-349MYPFFYR...........PMFE.....VIEDGWH...........................SFLP--EQ........EFE
A0A0J9Y087_BRUMA/150-497VFAFENKERN....DDIRLNA.......EKRGWD...........................RFDW--AV........EFA
C5MAZ5_CANTT/147-657LYAYEYRPN.....MLEQKLE........PKGWD...........................IYDP--IE........EYT
K4D528_SOLLC/172-591LYAFAGGP........S............................................RFSN--TNPKV.RLLNEYC
B7PN04_IXOSC/107-444LYCFHYTA.......SNEDLT.......RSSGWT...........................KFDF--QS........EFL
N1Q257_DOTSN/240-741MHAFHFKA........PQQEA........MVGAA...........................PFDA--RR........EFS
W5LHV8_ASTMX/109-447MYPFFHR...........PREL.....SLKDPRG...........................LSSP--EQ........DYT
I1I9E0_BRADI/148-576LYAFSCDP........S............................................TVDK--KSDPKLRLLKEYH
E0VHL9_PEDHC/552-891IFAFSYT...........ETF.......NENGWN...........................IYEP--IG........ELK
K1PF27_CRAGI/141-481LYAFVYAS........ADGME.......KSYGWD...........................LYDT--RS........EYL
Q55E04_DICDI/741-1092SPSFSTQPN.....VLNSSTS.......SIDGWQ...........................VYNQ--RR........EYA
F0ZYE9_DICPU/163-502SFAFYNSE........RFSHN........TKGWY...........................IYDA--EK........EYN
YMR1_YEAST/136-572LYAFIYISNN....LERKLPS........PDSWD...........................IYDP--IK........EFR
A7S8S7_NEMVE/126-517LFAFAHY........................AWSMASPNSF............TSQDASATPYSF--LE........EVH
Q17AB3_AEDAE/129-469LFAFNYK...........ERF.......PEDGWS...........................VYEP--VA........ELR
E3QC99_COLGM/127-595LFAFSHKGS.....KAERQV..........NGWK...........................IYDP--KA........EFR
A7SNP0_NEMVE/110-450LYAFSYSP.......QTEKLT.......QSAGWA...........................LFDI--KS........DYT
G8YJX9_PICSO/151-634LYAFSYRPN.....VLESQLG........KKGWD...........................LYKP--LD........EYR
M0TWG6_MUSAM/151-572LYVFVCGP........S............................................TFKN--DDPKL.RLLKEYH
H3GBH0_PHYRM/684-1027CFAYSPTVAP...SEEV............................................QFDI--RQ........EYA
U1GMS5_ENDPU/916-1439LYAFTYQPQ.....PPEKDI..........NSWD...........................FYDP--MK........EWR
T1L1W1_TETUR/108-448LYPFYYP...........CNFE.....IVEDGWF...........................AFQI--EK........EFS
S7ZC40_PENO1/121-601LYAFSYQPP.....PPEREF..........NGWD...........................LYKP--RK........EWE
F2SBK2_TRIRC/123-609LYAFTFQPP.....AAELAL..........NGWD...........................LYNP--RK........EWA
H9JUN7_BOMMO/136-493TFAAAYA........................AWAKEQPKSSVHR.......ALIDDSMATQRHWF--TI........EME
K3WGY1_PYTUL/996-1356SFAFSYAV........ECPSA.......EYDGWN...........................LFAD--ER........EFK
G4VLK6_SCHMA/68-454LYPFAYKSNQ....SSLLPVI.......KTTDWP...............................--.............
G8BAA5_CANPC/161-694LYAYAYVPN.....NLEKKLD........TRGWD...........................IYDP--VA........EYT
G7DS70_MIXOS/120-515LYAFS.NGN.....LTEAGKD........AQGWN...........................LYSP--SA........EYA
G3UQ85_MELGA/102-441LYAFSYNP.......KMSKDN.......REIGWK...........................LIDL--KV........DYQ
I3MZ61_ICTTR/109-450SFPFFYR...........PKGL.....RLGDAWH...........................FHPP--EC........YYK
Q7KK51_DROME/57-394LYCFNYQP.......NKDDFP.......KNAGWD...........................YFKL--EA........EFK
G2YGM0_BOTF4/130-610LYAFSYKAH.....GAEKQI..........NGWD...........................VYDP--KA........EWK
X6M9G5_RETFI/187-542LFAFHYCKKHP.IVTYQSDNE.......LLLGWH...........................TFDI--EK........EYK
W4Z9C7_STRPU/168-567IFAFSFH........................AWCFDHIQEHREPDGFEPGVCFLEGSSKVTHCKF--GT........EID
A0A0E1RWX6_COCIM/121-608LYAFTYQPP.....LPERSF..........NGWD...........................LYNP--RE........EWA
E3NKD1_CAERE/151-493MFAFVHAA........ESPRL.......LKDGWK...........................VYSA--ER........EYE
U1M373_ASCSU/150-497VFAFENRERR....IEHRVGE.......VRRGWD...........................RFDW--DI........EFA
A7THB1_VANPO/138-578LYAFIYKPNK....IETQF...........NSWN...........................IYDP--MK........EFQ
J9KAQ2_ACYPI/156-493VYCFLYKS.......NSDKIS.......KSAGWD...........................SFNL--EK........EYQ
B3RSS9_TRIAD/196-531.................................................................--..........EFY
Q5KP89_CRYNJ/121-513LYAFFYVP........P...S.......PGTGWT...........................VFNH--RT........EFA
I2H614_TETBL/171-633LYAFIYNPGK....AESKF...........NSWK...........................IYNV--ID........EFK
F6I5V0_VITVI/167-590LYAFASGP........F............................................KFTN--TNPMV.RLLDEYF
K1Y4Z5_MARBU/125-608LHAFSYDPV.....PPEKKI..........NGWE...........................LYDA--KA........EWK
H9J1I9_BOMMO/114-451FYPFFYR...........HMNP.....IVENGYT...........................LYSI--EE........EFT
A7SR96_NEMVE/108-448KYPFFYRHVG...ALSG............EDGWD...........................MFSN--DL........DFA
U4LJB1_PYROM/115-607LYAFFYQPV.....GNEKKC..........NGWK...........................IYNP--LK........ELQ
C5DH60_LACTC/126-560LYAFIYTPNK....AEKPF...........NSWN...........................IYDP--VR........EFH
B3RX90_TRIAD/107-446LHAFTYEP.......PGSKWP.......RSDGWN...........................IFEF--EA........EMT
M5BN64_THACB/239-656LYAFFYT.........PPTDT.......PRNGWS...........................MFTP--RE........EFG
K0KB78_WICCF/101-495LYAFIYQPNL....IESKF...........NSWN...........................LYDP--IK........EFK
A0EGI5_PARTE/166-524LFAFTFYKE.....MQNLENE........FQGWK...........................IYNI--EK........DFE
U7Q4J5_SPOS1/160-660LYAFSYAPA.....RQEKDL..........CGWD...........................VYDA--RA........EFR
Q4RR78_TETNG/108-446MYPFFYR...........PMFE.....VLEDGWN...........................LFLP--GD........AFK
I7M0W4_TETTS/279-641YPAFVYKKY.....NDE.EQQ........FNGWN...........................IYNI--KK........EFE
N1QIY4_SPHMS/120-622LHAFYFKA........PQEET........SISGT...........................AYDA--RR........EFA
Q5CWV5_CRYPI/401-807LFSYTFRENF...ESLPLFSS........INGIF...........................EFDI--LK........EYN
V5EUK4_KALBG/132-595LYAFYYQPS.....SSAGPSQ........QDLSR...........................VYDP--KT........EFA
M3YJJ4_MUSPF/154-491LFAFSYK...........EKF.......PMNGWK...........................VYDP--VS........EYK
D0NRZ1_PHYIT/258-667FAKFSIER.......FDGVNG.......AVDGWR...........................IYDA--VA........EFR
M4ACQ9_XIPMA/114-453LYCLSFNP.......NANKEE.......REESWS...........................FIDL--KA........DYR
M2RH09_CERS8/106-508LYAFHYVP........NPPFT.......SQNGWT...........................LYSP--RE........EFG
G3SD46_GORGO/127-525LFSFAYH........................AWCMEVYASEKEQ......HGDLCRPGEHVTSRF--KN........EVE
B3SBP9_TRIAD/113-452FFAYKFKG........NYPDF.......ESTGWK...........................IFDP--QV........EYK
W5KWS3_ASTMX/220-557LFAFQYK...........EEY.......PVDGWK...........................VYDP--VA........EYK
Q6CPC9_KLULA/127-533LYAFIYSPNK....AETPF...........NSWN...........................IYDP--VK........EFE
M3XJ57_LATCH/108-446MYPFFHR...........PLDM.....ALKEGWD...........................LYSP--EQ........EFT
K7IWE5_NASVI/115-459QYPFFYR...........PQSLSNSKVQIEDGWT...........................AFQP--LS........EWS
U9W3E6_NEUCR/121-581LLAFSYRPPP...NSPESKI..........NGWD...........................LYDV--RA........EFR
E0W3N5_PEDHC/130-511VFAFAFH........................AWATEEGGEEVL.........SRLSSKDGEYYYF--KS........EVD
K7J4U1_NASVI/112-448LYCFHYKG.......INEGLT.......QEVGWN...........................FFSI--QD........EFQ
B3MMR2_DROAN/166-509LFAFAHA...........AANAVN.GNGGWDGWA...........................VYEP--LA........ELR
Q7KSP6_DROME/1137-1547MRERSYV.........Q................................................--..........DWK
H3AE55_LATCH/1065-1482MSHVVERAC......CR................................................--..........DYQ
G1X052_ARTOA/190-629LYAFIYKPT.....KFEMPF..........NGWR...........................IYDP--QR........EFD
I1GF95_AMPQE/360-681.............................................................FFLK--SE........PYA
D3B3I4_POLPA/600-998LFAFYNK...........ETY.......SINGWD...........................LFDL--EK........EYQ
K1R474_CRAGI/111-449KYPFFYR...........AMFE.....PLEDGWQ...........................AFQP--EN........DYP
L0PBM5_PNEJ8/153-547FYAFFYRPE.....LSEAMF..........NGWT...........................LYQP--AK........EFE
J7R4V3_KAZNA/137-557LYAFIYVPNE....RETQF...........NSWT...........................LYDV--SK........EAE
B8M5V2_TALSN/121-609LYAFTYQPP.....PPEQGL..........NGWQ...........................LYDA--RK........EWN
D1ZZL4_TRICA/106-443LYCFTYTS.......PVEDIP.......KATGWD...........................FFNL--QK........EYE
Q75D71_ASHGO/126-524LYAFIYLPNR....VEAPF...........DSWK...........................LYKP--LE........EYA
A0A068XB07_HYMMI/118-483LFAYTFAEV.....CLAKGLY.......LESGWD...........................IYIP--ED........EYH
F6VED7_XENTR/133-471SYPFFFR...........PPGY.....SLGHGWP...........................RDTM--EN........FYH
K7LKG8_SOYBN/170-592LYAFASGP........S............................................RFKN--TTPLV.RLLDEYF
D3BMG4_POLPA/223-606FFAHVYNPFK...STLS............FNGWT...........................MYDA--IE........EYN
K5X3K1_AGABU/106-510LYAFIYRP........NPPFP.......NNDGWS...........................IYSP--RE........EFG
M3HQM6_CANMX/147-671LYAYEYRPN.....MIEQELE........VKGWD...........................IYDP--IE........EYT
F1QFI4_DANRE/108-447LYAFSYNP.......KQNDQQ.......REEGWQ...........................LIDL--AA........EFE
MYTM2_ARATH/168-589LYAFTCGP........S............................................QFGN--TNPKE.RLLNEYF
G9NQC0_HYPAI/120-588LFAFSHKPP.....KMEREV..........DGWN...........................IYDP--RA........EFR
D0MQT4_PHYIT/847-1207SFAFSYSI........SNVPP.......EQNGWH...........................LFVD--ER........EFK
W1PTA0_AMBTC/149-572LYTFTCGP........S............................................KFKG--ANPKL.RLLNEYL
C5E149_ZYGRC/135-556LYAFIYLSTN....AESSY...........NSWD...........................IYNV--EA........EFK
F9WY32_ZYMTI/108-611LHAFHFKP........PPEEL........ATSTL...........................VYDA--RR........EFA
G3APU7_SPAPN/134-605LYAYEYRPN.....MLEQALE........VRGWD...........................LYDP--VQ........EYT
E0VBZ2_PEDHC/111-451LYPFFYR...........PNFM.....VIENGWD...........................AFDT--ES........EYK
B8NRV4_ASPFN/121-606LYAFTYQPP.....PPEREL..........NGWE...........................LYDP--LK........EWA
F0Z8X8_DICPU/405-761LFCYLMRQE......YTKLET.......VGLGWT...........................IYSA--RD........EYA
X1WTU1_ACYPI/150-503VFAFAFH........................AWAIEDQCNEDI.........SSNLGHDGDDDYF--MK........EIE
G2RA16_THITE/121-606LLAFNYTPPP...GSPELKI..........DGWD...........................LYDV--RA........EFK
D8MA50_BLAHO/20-365VFAFRPEAS......KLIPQG.......ELNGWT...........................LYDA--AL........DYD
T1KVR9_TETUR/130-468LFAFLYKS........AGATF.......PFNGWS...........................VYEP--IA........EYK
C4R4B0_KOMPG/124-506LYAFLYSPVK....IEAPL...........NGWK...........................IYEP--VR........EFA
W5JLC3_ANODA/114-451LYPFFYI...........RMYD.....ILEDGYG...........................AYRP--EQ........EYA
C4XXZ6_CLAL4/140-622FYAYDYKPN.....MLESRLE........SSGWS...........................LYSA--ED........EYR
G2X7C1_VERDV/122-582LYAFSHKPS.....KHEQSV..........NGWE...........................MYDA--KA........EFR
E9H2A7_DAPPU/111-452YYPFFYQ...........PVYT.....AIEDGWT...........................AFRP--ET........EFS
B7PU64_IXOSC/108-448FYPFFHR...........ALFD.....IMEDGWS...........................AFTI--EH........DFA
W4XXX3_STRPU/73-410FFAFEYK...........EYY.......NENGWA...........................VFDP--VA........EYK
K9FL89_PEND2/117-597LYAFSYQPP.....PPEKEF..........DGWQ...........................LYDP--RK........EWA
I7MHG2_TETTS/341-702LFSYSYSIYDR.QLEDQ............FQGWQ...........................LLDI--KA........EFE
I1FRW6_AMPQE/108-447LYAFQFTP.......SSDGFV.......KSSGWN...........................LYDS--VV........EYG
G8ZRV1_TORDC/132-558SYAFIYSPSS....AESQF...........NSWQ...........................IYDT--MV........EFK
D3AZN8_POLPA/434-774VFAFKFSPPPL.ADPIN............DDGWR...........................TYDL--FS........EFI
G3PJV3_GASAC/127-519LFSFAFH........................AWCMGVYAGEKEQ......HSELCRPGEHVTSWF--KN........EVE
MTMR_DICDI/332-721LFSMSYSPFKG..VISP............IDGWL...........................FYDP--IE........EYT
Q0C7A8_AEDAE/114-449LYPFFYI...........PMYN.....VMQDGHT...........................EYTI--ET........EYA
YMR1_SCHPO/103-493LYAFYYMPS.....GDEEKL.........PSSWK...........................SFLL--EN........EYR
T1JCY3_STRMM/107-462YYPLFFR...........PTFE.....IMEDGWT...........................AFLP--ET........EFS
I3KM64_ORENI/109-448LYCFAYKP.......NVDEKE.......RRQEWD...........................FLDL--KA........DYS
E3KNU9_PUCGT/155-581..AFVQGATSKSNPSSTDPSS.......TLPGWD...........................SYDP--HA........EFT
MTMR3_CAEEL/220-576LNAFAWKFSEA.VDELDRDGK........LPSW............................LLRA--DSVAQEITHIDFN
K3X024_PYTUL/242-585LFAFTAGISPA.HAHRE............LQGHQ...........................IYNL--VA........DFA
S3D1P6_GLAL2/140-615LYAF..ECVQ....PNGEGI..........NGWE...........................IYDA--KA........EWK
C3ZSP5_BRAFL/108-434TYPFFFR...........PMFD.....VIEDGWQ...........................AFPP--ET........EFG
W1QEY9_OGAPD/121-491VYAFIYTPIK....IEVAF...........DGWN...........................DYQV--RS........EFQ
U3JCZ0_FICAL/108-444MYPFFYR...........PASL.....RLQQGWH...........................RFTL--ES........FFQ
K5UY85_PHACS/106-506LYAFHYTP........NPPFT.......TTNGWT...........................LYNP--RE........EFG
G6DQM0_DANPL/94-431LYCFHYKS.......TPDDLP.......KSAGWN...........................FFDI--QT........EFQ
F2UN43_SALR5/141-483....YYQGRMH..LKKADDNE.......PTKGWT...........................IYSV--HK........EAE
Q54PL3_DICDI/527-866LFAFKYSP........N.KSQ.......LQDGWR...........................ILND--FG........EWL
U5G1I7_POPTR/62-484LYAFSCGP........F............................................KFTN--ANPKV.RLLNEYF
H3CF16_TETNG/109-447LYCFSYNS.......NTDEQE.......RQQEWA...........................ALDV--TA........DYN
B7Q0U6_IXOSC/131-468LFAFEYG...........GRF.......TANGWA...........................VYDP--VV........EYR
H2YV90_CIOSA/105-444LYAFSFNP.......RSTQLQ.......QQEGWD...........................LFTL--NN........HFL
G3WI64_SARHA/131-469LFAFEYK.........E..VF.......SENGWK...........................LYDP--LL........EYR
F4P5V0_BATDJ/5-397VFAFTYKKEL...SEPL...P........SRGWS...........................VFDP--NI........EYA
F1A1E7_DICPU/40-385MFTYSYTPYK...GLQT............VNGWQ...........................LYDP--VE........EYT
W5L8J5_ASTMX/122-513LFAFAFH........................SCSATLPAERDLH.......EEICHAGEHVRGRF--KG........EVQ
Q6FWK8_CANGA/123-582LYAYIYKPNE....LETKL.T........RKGWD...........................IYDL--KS........EFL
E9GCX0_DAPPU/107-444LYCFHYTS.......SLEEIP.......RTAGWT...........................FFDL--ET........EFH
E9EEP8_METAQ/46-510LYAFSHRPL.....KNEKEM..........NGWE...........................FYDP--KA........EFR
A0E8R1_PARTE/249-601LFAFTFYKE.....FSNLEND........FQGWK...........................IFNI--EK........DFE
A5DEK5_PICGU/124-584FYAFDYTRN.....ALEEKLD........ENGWS...........................LYDE--NS........EYA
A3LPR3_PICST/165-655LYAYEYRPN.....MFEQKLE........LKGWD...........................IYDP--IN........EFT
B2AWC6_PODAN/121-613LLAFNYSPPS...NSLESKI..........NGWD...........................LYDA--RA........EFR
F6ZST8_XENTR/107-446LYAFSYNP.......KQKESE.......GVLGWQ...........................HIDL--KE........EYQ
D8PSV3_SCHCM/106-510LYAFFYTP........NPPFP.......TSDGWS...........................IYSP--RV........EFG
F7FF42_MONDO/108-447SYPFFFR...........PQSL.....RLGDAED...........................LYPP--DH........FYQ
F6Z7M4_ORNAN/48-386SYPFFYR...........PQTM.....KLEDGWR...........................LYPY--DL........YYQ
G6D5H7_DANPL/140-498TFAAAYA........................AWAKEQPNNSVHR.......ALMRASQPPQRHWF--KP........ELD
G1NGC4_MELGA/109-447LYCFSFNP.......KLNKEE.......REKGWK...........................LVDL--NE........EYN
F6ZL94_CIOIN/125-462QYPYFYR...........PTFK.....FEEDGFD...........................LFHV--EN........EFA
D3BLJ5_POLPA/497-918VFAFASQE.......NT............................................IDAS--ENFCQRLIPGEFD
T0JZF0_COLGC/134-596LFAFHHKPS.....KVEKHV..........NGWH...........................IYDP--RA........EFR
Q5APM2_CANAL/145-654LYAYSYKPN.....MLEQNLD........VKGWQ...........................LYNP--IE........EYK
G0QMH5_ICHMG/105-461CFAFIYGQF.....DNQLELD........YQGHK...........................IYDS--YQ........EFS
Q54TD5_DICDI/133-525SYAFSNNE........KFSYD........TKGWY...........................IYDA--EK........EYN
E0VBG7_PEDHC/106-443LYCFHYAS.......STEDIP.......KSAGWN...........................FFDL--VS........EYQ
E9IZM6_SOLIN/85-430QYPFFYR...........PQTTNNIMIQIEDGWT...........................AFAP--VS........EWS
A0A0D2US15_CAPO3/152-487LAAFTFK.........PAFSA.......AGNGWD...........................FYSP--VE........EFS
T1FQ89_HELRO/187-525LFAYEYK...........GNF.......KENGWN...........................VYDA--VS........ELR
E5SCK8_TRISP/125-471LPAFCFVP.......EMKDLM.......QSEGWN...........................EINM--YD........DYA
A0A0C4E2G4_MAGP6/114-593LYAFAYEPA.....RPERSV..........NGWT...........................LYDA--RE........EFR
H9G937_ANOCA/109-448MYPFFYR...........PQSMR....LAGGGRQ...........................PHAL--EK........YYQ
C0NUC9_AJECG/125-612LYAFTYQPP.....PPERGF..........NGWN...........................IYNP--RE........EWL
Q6C4T9_YARLI/175-567LYAFYYKPG.....KSERRF..........NGWA...........................AFNP--QQ........EFG
B0WIZ7_CULQU/133-522LFAFPFH........................AWASESPTLNQDNE.....WYGRLQRVGNYDDDF--RK........EVE
D3BK85_POLPA/1613-1970LFCFVHRSE......FTSPEV.......QNLGWN...........................VYSP--RD........EYA
MTMR8_DANRE/109-448LYAFLYNP.......HQNEEE.......RRRGWE...........................LISV--VN........DFN
H6BK64_EXODN/119-622LYAFTYQPQ.....GPEKDVT........PNGWS...........................LYDP--MR........EFR
D3BT00_POLPA/890-1235LFCFASNN........ISNLD.......QSKGWN...........................IYNP--SE........EYQ
C3ZL63_BRAFL/350-687FFAFEYK...........EKF.......STNGWK...........................VYSP--VE........EFK
A0A087ZQW5_APIME/106-441LYCFHYQA.......NKDTLP.......QHAGWN...........................FFNV--QS........EFQ
N1JPV3_BLUG1/121-602LYAFHYEAP.....PPEKQV..........NGWS...........................LYNA--KE........EWR
F1QHK9_DANRE/109-448LYCFSFNP.......AVDKAE.......RQHSWD...........................FIDL--KA........EYS
F2TYL0_SALR5/61-399LDAFHVHP........KINNV.......TVDGWA...........................LYDA--EQ........EYK
D8LMG1_ECTSI/530-890LFAFSRNT........VKPRA.......PDPGWH...........................IYDA--GK........ELD
MTMR8_HUMAN/109-448LYAFSYNP.......KSSKEM.......RESGWK...........................LIDP--IS........DFG
S2IWP4_MUCC1/104-488LYAYAYQP........RTPFT.......AKNGWN...........................IYDP--LK........EYE
U9TMA9_RHIID/106-487LYAFYYKP........EKEFR.......CKDGWE...........................VYDT--RK........EFT
T1IU07_STRMM/107-444LYCFHYTS.......CNEEMS.......RKVGWN...........................FFDL--QA........EFQ
H3GSF1_PHYRM/503-868LFAFDYHT........EKAKQRGGPLSEKHNGWF...........................VYSP--FA........EYQ
H9G424_ANOCA/127-521LFAFAYH........................AWCLGVCADEEDQ......HAHLCRPGDHVKYRF--EM........ELA
G0S6I8_CHATD/121-606LLAFHYTPPP...GSPEHKI..........NGWD...........................IYDA--RA........EFR
M2LKW6_BAUCO/231-739MLAFHFQP........PVEEA........AVEIP...........................EYDA--RK........EFA
R7YNQ0_CONA1/121-615LYAFSYKPQ.....GPEREI..........NGWD...........................IYDA--KR........ELK
U3I3P9_ANAPL/154-491FFAFSNE...........EKF.......SENGWM...........................VYNP--MS........EYR
Q8SZY7_DROME/117-513LYPFFYR...........PMYS.....ILEDGYT...........................MFRP--EL........EFA
F4W7J4_ACREC/132-505IFAFAYY........................AWSIEEGKDYP..........RLGKDNSSYITTF--NS........EVE
J9F2D0_WUCBA/113-457DYPFYYR..........CPFTV......LDNGWT...........................AFDA--EQ........EYA
S8A4K0_DACHA/201-638LYAFIYKPT.....KVEAPF..........NGWK...........................LYDA--QK........EFD
M4BZT0_HYAAE/106-466FFAFSSITR......PT..EQ.......DKQGHA...........................LYDL--YA........DFA
I3JN82_ORENI/109-447MYPFFYR...........PVEL.....SLPEQWG...........................LSSP--EM........HYS
N1Q744_PSEFD/131-638LHAFHFKA........PQEEI........AVGEF...........................AYEA--RR........EFS
G7X8Z5_ASPKW/122-607LYAFSYRPP.....PPEQKF..........NGWE...........................LYNP--SK........EWA
C7YZ12_NECH7/125-589LYAFSHKPL.....RGERDI..........NGWS...........................FYDP--KA........EFR
G8BY17_TETPH/154-600LYAFIYKPNK....TELQY...........NSWD...........................IYDE--VS........EFS
B3S431_TRIAD/109-445HHAFYYN...........PNFA.....ITEDGWK...........................SFNL--ET........EYA
E1C6W8_CHICK/133-471MYPFFHR...........PQSL.....RLEEGWP...........................LLPV--EQ........YFQ
E9GCQ5_DAPPU/55-392LFAFEFK...........EEY.......PENGWT...........................MYEP--VA........ELK
B4NIH7_DROWI/1151-1559MRERSYV.........Q................................................--..........DWK
R8BFR7_TOGMI/133-610LYAFAYQRL.....KQEQEI..........GGWH...........................LYDP--RA........EFR
F0XCQ4_GROCL/128-618LYAFSYGPP.....RLEKDV..........HGWD...........................IYDA--RA........EFR
Q0U936_PHANO/60-557LLAFSYQPK.....PPEDQQ..........NGWD...........................IYDA--RR........EWK
T1FWY3_HELRO/128-515SFALTFA........................AWCSSEKSCSE..........SLSDEWFQG.SVF--DR........EVT
I3K4K8_ORENI/127-519LFALAYH........................AWCLGGSADDEDQ......HLHLCRPGDHVRQRM--EM........EVK
G3JPP9_CORMM/121-586LFAFAHKPL.....RNEREV..........DGWH...........................IYDP--RA........EFR
G3B9W7_CANTC/149-641FYAFYYKAN.....SMELNLT........PKGWD...........................IYDP--VS........EYR
V2X5H5_MONRO/106-511LYAFFYQP........NPSYP.......TNNGWS...........................VYNP--RE........EFG
W4Z0A3_STRPU/8-344TYPFFYR...........STFD.....ELEDGWH...........................AFLP--EN........EFA
E7F7A8_DANRE/108-448LFCFSFNP.......NLDKEL.......REKAWG...........................FMDL--KA........EFN
G0W991_NAUDC/135-608LYAFLYTPNR....AELQF...........NGWN...........................LYSP--ER........EFK
Q6BWJ6_DEBHA/171-652FYAFDYNPN.....TLEQNLE........TRGWD...........................IYDP--IA........EYK
G0VIM8_NAUCC/129-542LYAFIYSPTI....SEREH...........DNWG...........................IYSI--SR........EFK
W5M3F3_LEPOC/109-447MYPFFYR...........PTTL.....SLQNKWG...........................LSTP--EE........DFQ
R4XBG5_TAPDE/92-499LYAFTYKPG.....KFESQL..........NSWK...........................HYNP--EA........EFA
N4V3P3_COLOR/126-589LFAFHHKPS.....KTEKQV..........NGWK...........................IYDP--RT........EFR
G7YT25_CLOSI/395-762LFAYTFGER.....CIAENVF.......PFNGWE...........................VYTP--EE........EYH

PF05706

CDKN3_MOUSE/1-167-----------------------------MKPPI---------------------------SIQA--S---------EFD
CDKN3_HUMAN/1-168-----------------------------MKPPS---------------------------SIQT--S---------EFD

PF14671

F8W600_DANRE/16-155-------------------------------------------------------------EFIK..D---------QLY
D7EK71_TRICA/13-154-------------------------------------------------------------EFIP..G---------RLY
K0KJP3_WICCF/11-150-------------------------------------------------------------EFLR..G---------RIY
I7MMU0_TETTS/24-160-------------------------------------------------------------EIIK..G---------KLY
I1FMG0_AMPQE/9-149-------------------------------------------------------------EFIE..D---------RLY
G3ATW9_SPAPN/12-151-------------------------------------------------------------EFLK..N---------RIY
B8LD57_THAPS/3-141-------------------------------------------------------------EIIP..N---------RLY
G3PNM2_GASAC/13-155-------------------------------------------------------------EFIKGTD---------RLY
I3LR09_PIG/13-152-------------------------------------------------------------EVIK..D---------RLC
W1QLT9_OGAPD/11-150-------------------------------------------------------------EFLK..G---------RVY
R9AL04_WALI9/16-166-------------------------------------------------------------......D---------RLF
G4VP89_SCHMA/22-162-------------------------------------------------------------CIIR..D---------RLY
C5K4Q5_PERM5/141-284-------------------------------------------------------------ELIP..Q---------RLY
G6DSP0_DANPL/12-151-------------------------------------------------------------EIIK..D---------RLY
E0VM64_PEDHC/25-167-------------------------------------------------------------EFIA..E---------KLY
E1Z501_CHLVA/14-153-------------------------------------------------------------EVIP..G---------RLF
G0PKI5_CAEBE/23-174-------------------------------------------------------------ELLP..N---------QLY
G3W790_SARHA/1-138-------------------------------------------------------------..IS..D---------RLC
J9K1D6_ACYPI/24-176-------------------------------------------------------------EFIE..N---------RLY
B3S2H1_TRIAD/24-161-------------------------------------------------------------..IS..G---------RLY
Q231C6_TETTS/26-165-------------------------------------------------------------EIIK..D---------RLY
D8RE91_SELML/15-157-------------------------------------------------------------EVIK..G---------KVY
H3G9E5_PHYRM/15-152-------------------------------------------------------------EFLP..G---------RLF
H2Z9U8_CIOSA/79-219-------------------------------------------------------------EIIR..D---------QFY
D2V4G7_NAEGR/6-143-------------------------------------------------------------CLIE..D---------RLY
J9LPV5_ACYPI/24-165-------------------------------------------------------------TIIP..D---------RLY
K7ILY6_NASVI/81-224-------------------------------------------------------------ELIK..N---------KFY
W5JWJ6_ANODA/39-180-------------------------------------------------------------.IIT..Y---------RLY
W5LJ29_ASTMX/11-152-------------------------------------------------------------EFIK..D---------RLY
B7P3Q9_IXOSC/14-156-------------------------------------------------------------EIVK..D---------RLF
D8MAX5_BLAHO/11-148-------------------------------------------------------------EVIP..N---------KLF
A7SE41_NEMVE/11-159-------------------------------------------------------------ELVE..D---------RLF
A0A068XI37_HYMMI/20-160-------------------------------------------------------------CIIK..D---------RFY
A2E6A0_TRIVA/11-149-------------------------------------------------------------PIIE..D---------RLE
C3YLS9_BRAFL/12-152-------------------------------------------------------------EFIK..D---------RLY
M3IHD8_CANMX/15-150-------------------------------------------------------------......K---------RIY
H3DGY5_TETNG/16-155-------------------------------------------------------------EFIK..D---------RLY
I7M1U6_TETTS/21-159-------------------------------------------------------------PIIE..D---------RLY
U1M7Q1_ASCSU/35-174-------------------------------------------------------------EIIP..E---------QLY
U3JL01_FICAL/14-153-------------------------------------------------------------.CIS..D---------RLY
F7DZD0_XENTR/4-141-------------------------------------------------------------..LS..D---------RLY
F0Y4C3_AURAN/14-158-------------------------------------------------------------.IIP..G---------RFA
T1JBF3_STRMM/13-155-------------------------------------------------------------EIIK..D---------RLN
T1FPZ6_HELRO/9-158-------------------------------------------------------------EIIP..G---------RLY
D6WTN6_TRICA/12-153-------------------------------------------------------------EILK..N---------RFY
A0E9G0_PARTE/15-154-------------------------------------------------------------EIIK..D---------KLY
E4XMY0_OIKDI/19-159-------------------------------------------------------------ELIK..D---------RLY
B6AF18_CRYMR/16-159-------------------------------------------------------------TLIE..G---------KLY
H9J4Q3_BOMMO/12-152-------------------------------------------------------------EYVK..N---------VLY
A2E639_TRIVA/12-150-------------------------------------------------------------QIIK..D---------RLI
T1G889_HELRO/11-149-------------------------------------------------------------.....TD---------KFY
G7YJ36_CLOSI/755-894-------------------------------------------------------------.LLL..D---------RLY
K3WJ76_PYTUL/19-174-------------------------------------------------------------.VVP..E---------KLE
U6GC88_EIMAC/15-154-------------------------------------------------------------EVLQ..G---------RLY
Q6C5Q7_YARLI/8-145-------------------------------------------------------------EFLK..D---------RVY
H2VRY9_CAEJA/25-178-------------------------------------------------------------ELLP..N---------QLY
M7NMG0_PNEMU/11-152-------------------------------------------------------------EFLE..D---------RIY
Q245B2_TETTS/17-158-------------------------------------------------------------EIIQ..D---------RLY
H3ANX2_LATCH/13-152-------------------------------------------------------------EFVE..G---------RLY
A2FHE7_TRIVA/8-146-------------------------------------------------------------PIIP..D---------RLY
I7MAY6_TETTS/46-184-------------------------------------------------------------EIIQ..N---------RFF
K7IWZ3_NASVI/56-198-------------------------------------------------------------EIIK..D---------RLY
A8BAI9_GIAIC/9-149-------------------------------------------------------------EFIP..D---------RLY
Q24BA7_TETTS/21-158-------------------------------------------------------------EVIP..N---------KLY
A7SDJ9_NEMVE/1-137-------------------------------------------------------------......D---------RLY
G1KVB1_ANOCA/12-152-------------------------------------------------------------EVLQ..D---------RLY
H2TD44_TAKRU/17-156-------------------------------------------------------------.LLT..E---------RLY
E2BNA0_HARSA/13-155-------------------------------------------------------------EFIK..D---------RLY
E1FZN0_LOALO/18-157-------------------------------------------------------------EIIP..K---------KLF
B4JEI3_DROGR/16-157-------------------------------------------------------------EVQE..D---------RLY
F4NXK9_BATDJ/27-166-------------------------------------------------------------ELIK..D---------RLY
F7GR37_CALJA/13-152-------------------------------------------------------------EFMK..D---------RLY
Q5CXY2_CRYPI/16-159-------------------------------------------------------------TLIE..N---------KFY
W5MS44_LEPOC/34-171-------------------------------------------------------------..IT..D---------QLY
S9X9G0_SCHCR/13-156-------------------------------------------------------------EFLE..D---------KLY
Q22LZ6_TETTS/7-143-------------------------------------------------------------EIVP..Q---------RLY
H3B231_LATCH/13-153-------------------------------------------------------------EFIK..D---------RLY
C4QXD7_KOMPG/34-173-------------------------------------------------------------EFLK..G---------RVY
I2H3N6_TETBL/12-151-------------------------------------------------------------EFLK..G---------RVY
T1KJ59_TETUR/37-178-------------------------------------------------------------SIIP..D---------RLY
R4XCT9_TAPDE/7-148-------------------------------------------------------------EFLQ..D---------RLY
K3WHJ0_PYTUL/14-154-------------------------------------------------------------EFVP..D---------LLY
T1G2U9_HELRO/2-137-------------------------------------------------------------.......---------VLY
B0WM71_CULQU/13-156-------------------------------------------------------------EIIE..N---------RLY

PF04722

M3CM17_SPHMS/6-267-----------------LR--FCTVCASNN--NR--------------------------.SMEA------------HLR
U9TR51_RHIID/6-196-----------------.N--FAVVCASNQ--NR--------------------------.SMEA------------HHV
K1VN79_TRIAC/179-363-----------------..--FCVVCASN.--NH--------------------------.VART------------NN.
G3VJW4_SARHA/6-194-----------------LK--VAVVCSSNQ--NR--------------------------.SMEA------------HHI
C4V7E6_NOSCE/1-185-----------------MK--IAVCCAMNQ--NR--------------------------.SMEA------------HKI
A5DSB2_LODEL/6-221-----------------LK--ICTVCASNN--NR--------------------------.SMES------------HKQ
J9D665_EDHAE/2-208-----------------KR--IAICCAMNQ--NR--------------------------.SMEV------------HRL
W5P9P6_SHEEP/6-194-----------------LR--VAVVCMSNV--NR--------------------------.SMEA------------HRV
I2H6G9_TETBL/4-202-----------------LK--FCTVCASNN--NR--------------------------.SMEA------------HKV
C9SH87_VERA1/28-258-----------------LK--FCTVCASNQ--NR--------------------------.SMVS------------HLR
Q7Q339_ANOGA/9-197-----------------LS--IAVICSSNM--NR--------------------------.SMEA------------HGF
R0MEC6_NOSB1/1-179-----------------MK--IAVVCAMNQ--NR--------------------------.SMEA------------HKV
A4S8K5_OSTLU/6-199-----------------KR--YAVVCAANF--NR--------------------------.SMEA------------HKV
C5DD47_LACTC/9-206-----------------LK--FCTVCASNN--NR--------------------------.SMES------------HRV
E6ZMC2_SPORE/52-240-----------------IM--FCVVCASNQ--NR--------------------------.SMAA------------HSL
G5C5J8_HETGA/6-194-----------------LK--VAVVCSNNQ--NR--------------------------.SMEA------------HHI
Q9VWE4_DROME/7-195-----------------LA--VAVVCSSNM--NR--------------------------.SMEA------------HNF
A9T8M1_PHYPA/3-193-----------------LR--HAMVCASNQ--NR--------------------------.SMEA------------HAL
G3RMY0_GORGO/6-194-----------------LR--VAVVCVSNI--NR--------------------------.SMEA------------HSI
G1QGE4_MYOLU/6-194-----------------LR--VAVVCSSNQ--NR--------------------------.SMEA------------HHL
D6WNM1_TRICA/7-194-----------------LR--IAVICSSNM--NR--------------------------.SMEA------------HAF
E7KHF5_YEASA/9-206-----------------LK--FCTVCASNN--NR--------------------------.SMES------------HKV
M3W044_FELCA/6-198-----------------LR--IRTVCCRIA--DG--------------------------LCMRC------------QRL
F7AUY7_CIOIN/4-192-----------------LS--FAVVCSSNM--NR--------------------------.SMEA------------HRC
M3J959_CANMX/9-226-----------------LK--ICTVCASNN--NR--------------------------.SMES------------HKQ
A8NX74_COPC7/95-281-----------------..--FCVVCASNQ--NR--------------------------.SMEG------------HNV
I3NBA4_ICTTR/6-194-----------------LR--VAVVCSNNQ--NR--------------------------.SMEA------------HRL
B9RPG0_RICCO/3-193-----------------LR--YAMVCSSNQ--NR--------------------------.SMEA------------HSL
M3WPM1_FELCA/6-196-----------------LG--VAVGCMINM--NR--------------------------.SMEA------------HSI
B7PE44_IXOSC/5-193-----------------LR--IAVVCSSNQ--NR--------------------------.SMEA------------HAF
E4XFN7_OIKDI/13-201-----------------LR--IAVICSSNM--NR--------------------------.SMEA------------HRL
G2R3A5_THITE/27-257-----------------LK--FCTVCASNQ--NR--------------------------.SMEG------------HLR
G1QFZ8_MYOLU/6-195-----------------LR--LAIVCSSNQ--NR--------------------------.SMEA------------HRL
T1G229_HELRO/3-191-----------------LR--FAIICSSNQ--NR--------------------------.SMEA------------HNF
M2NKA1_BAUCO/33-271-----------------LK--FCTVCASNN--NR--------------------------.SMEA------------HLR
A3LQU1_PICST/6-217-----------------LK--ICTVCASNN--NR--------------------------.SMEA------------HKQ
E1G566_LOALO/7-197-----------------LR--FAVSCSSNM--NR--------------------------.SMEA------------HSF
A5DEF6_PICGU/6-223-----------------LK--ICTVCASNN--NR--------------------------.SMES------------HKQ
E9FS49_DAPPU/5-192-----------------LK--LAVICSSNM--NR--------------------------.SMEA------------HNF
A8J0V7_CHLRE/6-199-----------------MH--FAMVCAANN--NR--------------------------.SMES------------HAM
L5M545_MYODS/28-217-----------------LR--LAVVCSSNQ--NR--------------------------.SMEA------------HCM
A9URK0_MONBE/6-196-----------------RR--YAVVCSSNQ--NR--------------------------.SMET------------HLV
S3BQX5_OPHP1/29-259-----------------LK--FCTVCASNQ--NR--------------------------.SMEA------------HLR
Q22453_CAEEL/7-197-----------------LR--FAVSCSSNM--NR--------------------------.SMEA------------HGI
D8TZN0_VOLCA/4-192-----------------LR--FAMVCASNQ--NR--------------------------.SMEA------------HAL
E2C7C7_HARSA/7-195-----------------IS--VAVICSSNM--NR--------------------------.SMEA------------HAF
T1J4B9_STRMM/5-193-----------------LK--IAVVCSSNQ--NR--------------------------.SMEA------------HAF
F1RF63_PIG/7-195-----------------LR--VAVVCMSNM--NR--------------------------.SMEA------------HSI
A0A0E1S3B5_COCIM/65-299-----------------LK--FCTVCAANQ--NR--------------------------.SMEA------------HNR
Q8SRQ6_ENCCU/1-188-----------------MK--LAVTCAMNQ--NR--------------------------.SMQT------------HDL
K3WTR6_PYTUL/19-217-----------------..--FAMICVNNV--NR--------------------------.STAA------------HDH
M7WK09_RHOT1/118-306-----------------VT--FCVVCASNQ--NR--------------------------.SMEA------------HNV
M0RRI2_MUSAM/5-212-----------------LR--YAMVCSSNQ--NR--------------------------.SMEA------------HAL
A2FVC5_TRIVA/7-200-----------------LA--FACVCASNV--NR--------------------------.SMEG------------HRV
S2JY24_MUCC1/3-191-----------------.K--YAVICASNQ--NR--------------------------.SMEA------------HHV
D8SHD7_SELML/3-194-----------------LR--HAMVCASNQ--NR--------------------------.SMEA------------HAL
G3JK05_CORMM/45-273-----------------..--VCVLSHLTN--PR--------------------------.SMEA------------HLR
W1QG60_OGAPD/3-223-----------------LK--FCTVCASNN--NR--------------------------.SMEA------------HKV
SSU72_DICDI/22-214-----------------KR--IAMVCASNQ--NR--------------------------.SLEA------------HHL
G5E5U5_BOVIN/6-194-----------------LS--VAVVCTSNM--NR--------------------------.SMEA------------HRI
L5KNK4_PTEAL/5-193-----------------LR--VAVVCWSNQ--NR--------------------------.SMEA------------HNF
C3YRI6_BRAFL/4-196-----------------LN--IAVVCSSNQ--NR--------------------------.SMEA------------HAF
H0WPH8_OTOGA/6-194-----------------LR--VAVVCMSNI--NR--------------------------.SMEA------------HSM
J9JXC9_ACYPI/6-194-----------------FK--IAVVCSSNM--NR--------------------------.SMEA------------HAF
Q00U02_OSTTA/10-205-----------------YR--YACVCAANF--NR--------------------------.SMEA------------HRV
F7BTU0_HORSE/6-194-----------------LM--VAVVCKSNM--NR--------------------------.SMEA------------HSI
E3L5J3_PUCGT/78-267-----------------FT--FCVVCASNQ--NR--------------------------.SMEG------------HNV
E0W1I3_PEDHC/7-195-----------------LK--IAVSCSSNM--NR--------------------------.SMEA------------HAF
C4M1T3_ENTHI/14-201-----------------.S--IAVICRSNQ--NR--------------------------.SISA------------HCR
I4YAY0_WALMC/36-224-----------------RM--FCVVCSSNQ--NR--------------------------.SMEA------------HKV
G4TIH3_SERID/79-265-----------------..--FCVVCASNQ--NR--------------------------.SMEG------------HNV
D0N2F3_PHYIT/2-199-----------------..--FAMLCANNV--NR--------------------------.STEA------------HDH
F4NZ84_BATDJ/4-201-----------------IK--FAVVCASNQ--NR--------------------------.SMEA------------HHV
G3SBQ4_GORGO/6-194-----------------LR--VAVVCWNNQ--NQ--------------------------.SMEA------------HRV
G8C1Y0_TETPH/6-202-----------------LK--LCTVCASNN--NR--------------------------.SMES------------HKV
G3B7X8_CANTC/13-230-----------------LR--VCTVCAANN--NR--------------------------.SMEA------------HKQ
F2TVW4_SALR5/85-275-----------------FR--YAVVCSSNQ--NR--------------------------.SMEA------------HLF
L9LDJ3_TUPCH/6-194-----------------LR--LAVVCMSNI--NR--------------------------.SMEA------------HSM
F7GUF1_CALJA/6-194-----------------LR--VAVVCSSNQ--NR--------------------------.SMEA------------HNI
E4ZJL7_LEPMJ/56-286-----------------LK--FCTVCASNQ--NR--------------------------.SMEA------------HLQ
M7NPB3_PNEMU/8-196-----------------FA--ISVICASNQ--NR--------------------------.SMEA------------HCV
D8PRF9_SCHCM/6-190-----------------..--..VIHCSLQ--NR--------------------------.SMEG------------HFV
R4XAN6_TAPDE/3-195-----------------LQ--IATVCASNN--NR--------------------------.SMQA------------HKV
SSU72_ASHGO/84-281-----------------LR--LCTVCASNN--NR--------------------------.SMES------------HRV
A7S9J1_NEMVE/5-193-----------------LK--IAVVCSSNQ--NR--------------------------.SMEA------------HNF
B6K4R2_SCHJY/7-197-----------------LK--ISVICASNQ--NR--------------------------.SMEA------------HNV
SSU72_KLULA/10-207-----------------LK--FCTVCASNN--NR--------------------------.SMES------------HRV
H6BZX6_EXODN/113-347-----------------LR--FCTVCASNN--NR--------------------------.SMEA------------HLR
U1HX26_ENDPU/75-307-----------------LR--YCTVCASNN--NR--------------------------.SMEA------------HSR
SSU72_YARLI/4-193-----------------LK--MCTVCASNQ--NR--------------------------.SMEA------------HKV
C1N6C2_MICPC/1-181-----------------..--..MVCAANM--NR--------------------------.SMEA------------HRV
D5GG44_TUBMM/44-259-----------------LK--FCTVCASNQ--NR--------------------------.SMEA------------HLV
C5M3Z1_CANTT/9-226-----------------LK--ICTVCASNN--NR--------------------------.SMES------------HKQ
T1KEB8_TETUR/6-193-----------------LR--LAVVCSSNQ--NR--------------------------.SMEA------------HQV
G8BC17_CANPC/6-220-----------------LK--ICTVCASNN--NR--------------------------.SMES------------HKQ
I3KRS9_ORENI/6-194-----------------LR--VAVVCSSNQ--NR--------------------------.SMEA------------HNI
D3B2Q4_POLPA/40-232-----------------KR--LAMVCASNQ--NR--------------------------.SVEA------------HNL
H3GZW6_PHYRM/33-222-----------------.M--FAMVCANNV--NR--------------------------.SAAA------------HER
G1XE66_ARTOA/50-284-----------------LK--FCTVCANNQ--NR--------------------------.SMEA------------HLV
L8Y7B4_TUPCH/6-194-----------------LR--VAVVCSNNQ--NR--------------------------.SMEA------------HNL
F7BYE3_MONDO/6-195-----------------LR--MAVVCSSNQ--NR--------------------------.SMEA------------HSL
C4XWG9_CLAL4/6-225-----------------LK--VCTVCASNN--NR--------------------------.SMES------------HKQ
I1R4D5_ORYGL/9-200-----------------MR--FAMVCSSNM--NR--------------------------.SMEA------------HSL
SSU72_DEBHA/6-223-----------------LK--ICTVCAANN--NR--------------------------.SMES------------HKQ
G4N6I8_MAGO7/29-259-----------------LK--FCTVCASNQ--NR--------------------------.SMEA------------HLQ
C4QYQ1_KOMPG/5-230-----------------LS--FCTVCASNQ--NR--------------------------.SMEA------------HKL
W4ZD81_STRPU/3-191-----------------LR--IAVVCSSNQ--NR--------------------------.SMEA------------HAI
B3S0A9_TRIAD/4-192-----------------LD--FAIVCSSNQ--NR--------------------------.SMAA------------HKL
B8M8F3_TALSN/57-290-----------------LK--FCTVCASNN--NR--------------------------.SMEA------------HYQ
S9XIA9_SCHCR/7-197-----------------LE--ISVICASNQ--NR--------------------------.SMEA------------HNL
G3HMJ7_CRIGR/6-194-----------------IR--VAVVCSSNH--NR--------------------------.SMEA------------HRV
A7EL18_SCLS1/31-260-----------------LK--FCTVCASNN--NR--------------------------.SMES------------HLR
A2QP66_ASPNC/32-250-----------------LR--FCTVCASNQ--NR--------------------------.SMEA------------HLR
R4FPS1_RHOPR/6-194-----------------LS--VAVVCSSNM--NR--------------------------.SMEA------------HAF
Q9C9T0_ARATH/3-193-----------------FR--YAMVCSSNQ--NR--------------------------.SMEA------------HAL
E1BBD9_BOVIN/6-192-----------------LR--LAVVCSSNQ--NR--------------------------.SMEA------------HNI
R7Z2W6_CONA1/31-261-----------------LK--FCTVCASNQ--NR--------------------------.SMEA------------HDR

PF01451

Y328_SYNY3/3-148---------------------LLFVCLGNI--CR---------------------------SPAA------------ENI
WZB_ECOLI/5-139---------------------ILVVCVGNI--CR---------------------------SPTA------------ERL
PPAL_YEAST/10-157---------------------VAFICLGNF--CR---------------------------SPMA------------EAI
PPAL_SCHPO/7-152---------------------VLFVCLGNI--CR---------------------------SPMA------------EAV
PAP_BACSU/3-142---------------------IIFVCTGNT--CR---------------------------SPMA------------EAL
O66881_AQUAE/3-130---------------------IGFISKKGA--VR---------------------------ALLA------------EAI
ARSC_HALSA/9-135---------------------FGFVCVQNA--GR---------------------------SQMS------------TAF
ETP_ECOLI/9-143---------------------ILVVCTGNI--CR---------------------------SPIG------------ERL
PPAC_HUMAN/9-154---------------------VLFVCLGNI--CR---------------------------SPIA------------EAV
YFKJ_BACSU/4-147---------------------VLFVCLGNI--CR---------------------------SPMA------------EAI
PTPA_STRCO/5-152---------------------VCFVCTGNI--CR---------------------------SPMA------------EAV
O66910_AQUAE/3-135---------------------IAFICTGNS--AR---------------------------SQMA------------EGF
G3XD22_PSEAE/3-134---------------------VLFMCTANS--CR---------------------------SILS------------EAM
EPSP_RALSO/5-138---------------------ILVVCIGNI--CR---------------------------SPMA------------QAL
PTPA_MYCTU/7-148---------------------VTFVCTGNI--CR---------------------------SPMA------------EKM

PF02302

Q8Y9U3_LISMO/6-98------------------I--AVTACATGV--AH---------------------------TYMA------------AQA
A0A0B8R667_LISMN/405-496------------------K--VLIVCASGL--GT---------------------------SQLL------------ESK
A0A0E0USS5_LISMM/3-94------------------N--ILLVCNAGM--ST---------------------------SFLV------------.EK
A0A0E0ZVT8_LISMN/4-96------------------V--GVTSCIAGL--AH---------------------------TPMA------------AKA
A8LVB0_SALAI/11-93------------------K--VVIACDAGM--GS---------------------------SAML------------AGQ
Q8YA08_LISMO/4-94------------------V--GVTACPTGI--AH---------------------------TYMS------------AEK
Q8Y3Q2_LISMO/3-94------------------N--IMLMCNAGM--ST---------------------------SVLV------------.RK
B1ZC18_METPB/5-96------------------L--AVVGGGDLS--TH---------------------------AVLA------------AEA
B0K249_THEPX/6-89------------------R--IVTACGVGM--GS---------------------------SLIL------------KMM
B0K277_THEPX/391-475------------------L--IVFACDAGM--GS---------------------------SAMG------------ETI
B0K278_THEPX/415-493------------------R--VFVICPNGM--GT---------------------------ARIL------------SAK
A9B4K5_HERA2/12-92------------------T--IVFACEAGI--GS---------------------------SFMG------------VTA
A9VR06_BACWK/171-262------------------L--AVTACPTGI--AH---------------------------TYMA------------ADS
A0A075SKV8_STRSU/407-489------------------R--VLVVCATGI--GS---------------------------ALML------------KNR
A0A126ULG0_STRSU/171-262------------------V--AVTACTTGI--AH---------------------------TYMA------------EEA
B0KBP1_THEP3/4-96------------------R--GVILCSWGA--TS---------------------------SALA------------.KK
B0K7D7_THEP3/11-95------------------R--VLVVCADGV--AT---------------------------STIA------------LVS
A8L503_FRASN/11-93------------------K--LVVACDAGM--GS---------------------------SVML------------ASQ
A0AL58_LISW6/3-94------------------N--IVLVCAAGM--ST---------------------------SLLV------------.TK
A0AMB6_LISW6/405-496------------------K--VLIVCASGL--GT---------------------------SQLL------------ESK
A0KFQ8_AERHH/380-464------------------N--IVVACDAGM--GS---------------------------SAMG------------AGL
A0NIU2_OENOE/10-101------------------K--VMLVCAAGM--ST---------------------------SLLV------------.SK
A0NKC3_OENOE/2-89------------------R--LAAVCQSGL--GT---------------------------SFMV------------QMN
A0PYT1_CLONN/2-86------------------K--IVTCCGSGL--VT---------------------------SFMI------------QTN
A0RA56_BACAH/2-94------------------Y--ILLCCAAGM--ST---------------------------SMVV------------.RK
Q81X06_BACAN/2-94------------------N--ILLCCSAGM--ST---------------------------SLLV------------.TK
PTFB1_ECOLI/6-98------------------I--ALCACPMGL--AH---------------------------TFMA------------AQA
A1T0H1_PSYIN/4-95------------------A--IVTACPSGI--AN---------------------------SIIA------------AGL
A1TV02_ACIAC/5-99------------------I--AIAASQAGP--AH---------------------------SFMV------------AEA
Q9KR21_VIBCH/165-256------------------I--GVTGCPAGI--AH---------------------------TYLA------------AEA
A3CN00_STRSV/2-91------------------K--ILLICAAGM--ST---------------------------SILM------------.KK
Q8Y5T3_LISMO/2-82------------------E--ILTVCGMGF--GT---------------------------SLML------------LME
Q8Y3Q0_LISMO/405-496------------------K--VLIVCASGL--GT---------------------------SQLL------------ESK
Q92EF3_LISMO/5-90------------------R--IYVCCGTGI--AT---------------------------STVI------------SKK
A0A0B1Y986_9BACI/2-82------------------K--ILVVCGSGL--GS---------------------------SFIL------------ELN
Q9HY57_PSEAE/4-95------------------A--IVTACPGGQ--VT---------------------------SVLA------------ARL
A3N2Z8_ACTP2/501-584------------------R--ILAVCGSGQ--GS---------------------------SMMM------------KMK
A3N313_ACTP2/2-85------------------K--IMAVCGHGI--GS---------------------------SFMM------------EMN
A3UUG8_VIBS1/382-474------------------V--AVTCCPSGV--AH---------------------------TFMA------------AKA
A4ALK2_9ACTN/177-268------------------V--AVTACPTGI--AH---------------------------TYMA------------ADS
A4BB46_9GAMM/4-93------------------L--IVTHCPAGI--AT---------------------------SYLA------------AGA
Q8Y8I8_LISMO/3-95------------------N--ILLICGSGA--SS---------------------------GFMA------------.AA
A4E6N6_9ACTN/7-100------------------I--AATGCPTGI--AH---------------------------TFMA------------KEA
A4EB76_9ACTN/4-100------------------V--GVAACTVGI--AH---------------------------TYMA------------QKA
A4SM92_AERS4/4-95------------------I--LVTACPAGI--AT---------------------------SFLV------------AKR
A4VI86_PSEU5/4-95------------------L--IITACPNGM--VT---------------------------SVLT------------SRL
A4VY52_STRSY/3-96------------------H--IMLVCNAGM--ST---------------------------SMLV------------.TK
A4VY53_STRSY/407-489------------------R--VLVVCATGI--GS---------------------------ALML------------KNR
A4W4U8_ENT38/3-95------------------K--IMLCCSAGM--ST---------------------------SLLV------------.RK
A4WQ54_RHOS5/5-99------------------V--AVISTGSFG--PH---------------------------AALA------------REA
A5CU90_CLAM3/4-88------------------R--ILVVCGSGA--SS---------------------------TFLA------------.QR
A5EVD5_DICNV/160-251------------------V--GVTACPTGV--AH---------------------------TYMA------------QEA
A5FUY5_ACICJ/5-96------------------V--AIIAGGEGT--VT---------------------------RALA------------AEA
A5IZ78_MYCAP/2-87------------------K--VLCLCGSGM--GT---------------------------SMII------------KLK
R5QWP1_9FIRM/174-265------------------L--AVTSCPTGI--AH---------------------------TYMA------------AEG
A5KWZ6_VIBBS/3-87------------------K--ILVVCGNGL--GT---------------------------SLMM------------EMA
A0A0B7LQ27_STREE/1-66------------------M--IANSGAYGA--HY---------------------------DIM.------------...
G6LWB5_STREE/5-99------------------T--IMLACAAGM--ST---------------------------SLLV------------.TK
G6JAR1_STREE/463-547------------------N--VLVLCAGG.--GT---------------------------SGLL------------ANA
A5LK37_STREE/457-551------------------K--VLVLC.AGS--GT---------------------------SAQL------------ANA
A0A0U0GRH3_STREE/457-551------------------K--VLVLC.AGS--GT---------------------------SAQL------------ANA
J0UTL7_STREE/3-93------------------Q--ILLVCNAGM--ST---------------------------SMLV------------.KK
A0A0B7L304_STREE/457-551------------------K--VLVLC.AGS--GT---------------------------SAQL------------ANA
A5Z556_9FIRM/8-91------------------K--IMCCCGSGL--GS---------------------------SLMI------------RLN
A5ZAC0_9FIRM/2-92------------------K--ILLVCNAGM--ST---------------------------GIMK------------.MK
A6CWH3_9VIBR/2-94------------------K--ILLLCSAGM--ST---------------------------SILV------------.RK
A6D1Q5_9VIBR/4-96------------------V--GVTACISGV--AH---------------------------TYMA------------AEL
A6D1R0_9VIBR/5-97------------------V--AVTACPSGV--AH---------------------------TYMA------------AEA
A6F1Q1_9ALTE/4-95------------------I--IVTACPQGV--AT---------------------------SFLA------------ARA
A6LQT5_CLOB8/389-473------------------F--VAFACDAGL--GS---------------------------SAMG------------ASA
A6LS05_CLOB8/2-95------------------K--ILLMCAAGM--ST---------------------------SLLV------------.TK
A6LWT9_CLOB8/2-80------------------K--VLMVCSGGM--SS---------------------------AIVV------------.QA
A6LX11_CLOB8/2-87------------------E--ILTVCGNGI--GS---------------------------SLML------------AMK
A6LZZ9_CLOB8/3-94------------------K--ILLVCNAGM--ST---------------------------SMLV------------.QK
A6M2G2_CLOB8/3-95------------------K--IRLFCAAGM--ST---------------------------SLLV------------.SK
A6NRV7_9FIRM/3-95------------------H--IVLACAFGM--ST---------------------------SMLV------------.QR
A6T5D3_KLEP7/3-85------------------V--IRTVCGNGI--GS---------------------------SLMA------------ANN
A6T9A2_KLEP7/4-96------------------V--GVTACTVGI--AH---------------------------TYIA------------QKK
A6T9A6_KLEP7/3-86------------------K--VLIVCGNGL--GS---------------------------SFIV------------EMN
A6TVQ8_ALKMQ/3-95------------------R--VMLVCSAGM--ST---------------------------SLLV------------.TK
A6V1N4_PSEA7/123-214------------------V--AVTACPTGV--AH---------------------------TFMA------------AEA
A6VLW3_ACTSZ/4-100------------------V--AITACPTGV--AH---------------------------TYMA------------QEA
D7HCF5_VIBCL/127-218------------------V--AITACPTGV--AH---------------------------TFMA------------AEA
Q0WJQ9_YERPE/6-98------------------V--AVTACVSGV--AH---------------------------TYMV------------AER
A7GIU6_CLOBL/3-95------------------N--ILLVCCAGM--ST---------------------------SLLV------------.TK
M9WXN5_MANHA/366-450------------------K--IYVACDAGM--GS---------------------------SAMG------------ASM
A7MI94_CROS8/168-260------------------I--VITSCSTGI--AH---------------------------TYMA------------AEA
A0A017I5Q2_ECOLX/5-97------------------V--AVTACVSGV--AH---------------------------TYMA------------AER
A8AKT6_CITK8/3-95------------------N--IVLCCAAGM--ST---------------------------SMLV------------.QR
A0A0F2D688_STRMT/3-86------------------K--IVTVCGAGV--GS---------------------------SMME------------RLF
A0A0F2CZG4_STRMT/3-97------------------K--IYLFCSAGM--ST---------------------------SMLA------------.SN
A8F9K0_BACP2/4-96------------------V--GVTSCPAGL--AH---------------------------TPMA------------AKA
A8FC85_BACP2/4-86------------------K--ILVSCGTAV--AT---------------------------STVV------------AKK
A8FIW5_BACP2/3-99------------------R--IILACAAGM--ST---------------------------SIVV------------.SK
A8GJM8_SERP5/3-95------------------K--IFLCCAAGM--ST---------------------------SMVV------------.NK
D5AMJ5_RHOCB/5-96------------------V--AVTAGAKGV--AH---------------------------THLA------------AEA
D5AMJ5_RHOCB/120-211------------------V--AITSCPTGI--AH---------------------------TFMA------------ADA
PTF3A_MYCGE/169-261------------------V--AVTACPTGI--AH---------------------------TFMA------------KEA
MNGA_ECOLI/187-279------------------V--CVTACPAGI--AH---------------------------TYMA------------AEY
Q034F1_LACC3/4-88------------------K--LLVICGTGV--AT---------------------------STVV------------MGK
Q03GK6_PEDPA/4-95------------------N--VLLVCGSGA--SS---------------------------GFMA------------.AN
Q03HS3_PEDPA/7-98------------------I--AATGCPTGI--AH---------------------------TYMA------------QEA
Q03UQ7_LEUMM/2-88------------------N--ILVSCANGS--GT---------------------------SLMM------------MKS
Q03XM7_LEUMM/5-97------------------N--ILLICNTGA--SS---------------------------SFMA------------.QK
Q03XN8_LEUMM/3-102------------------K--ALIICAAGM--SS---------------------------SMMA------------.KK
A0A087QC51_LACGS/22-116------------------K--LLAACGAGV--NS---------------------------SHQI------------KDA
Q04H52_OENOB/3-90------------------T--LMIVCGTGI--AT---------------------------STIA------------TGK
Q8DQZ0_STRR6/457-551------------------K--VLVLC.AGS--GT---------------------------SAQL------------ANA
Q08XD4_STIAD/4-95------------------L--IITACPSGV--AT---------------------------TFLA------------ARA
Q0SL49_BORAP/2-94------------------N--ILLVCGAGM--ST---------------------------SMLV------------.QR
Q0SN99_BORAP/167-258------------------V--AVTACPVGV--AH---------------------------TYIA------------AKK
Q0SPV8_CLOPS/3-94------------------K--ILLVCSAGM--ST---------------------------SLLV------------.NK
Q0SVN2_CLOPS/2-83------------------K--IMTVCGFGV--GT---------------------------SLLL------------KMT
A0A026RYV5_ECOLX/4-96------------------V--CVAACTAGI--AH---------------------------TYIA------------REK
Q181N4_PEPD6/3-88------------------K--ILIACRAGV--GS---------------------------SLML------------KIK
Q182P2_PEPD6/2-86------------------K--ILAVCGFGV--GS---------------------------SMVL------------KMT
Q183X2_PEPD6/3-95------------------K--IMLACSAGM--ST---------------------------SLLV------------.TK
Q184N6_PEPD6/2-87------------------R--VLFVCSSGM--SS---------------------------AIAV------------.NA
Q184R8_PEPD6/5-97------------------R--VLLACGSGA--ST---------------------------GFMA------------.TS
Q184S3_PEPD6/173-265------------------L--AITACPAGI--AH---------------------------TYMS------------AEA
Q184X2_PEPD6/163-256------------------V--GITGCPTGI--AH---------------------------TFMA------------KKA
Q185K1_PEPD6/3-85------------------K--ILVACGAGI--AT---------------------------STVV------------CDK
Q186F7_PEPD6/3-94------------------R--ILLVCVGGM--SS---------------------------TLLV------------.NK
Q18A08_PEPD6/4-94------------------K--IVAVCESER--SL---------------------------....------------.NS
Q18A56_PEPD6/2-100------------------N--ILLVCANGA--ST---------------------------GVLV------------.EK
Q18CC5_PEPD6/9-93------------------K--ILVACGTGV--CT---------------------------STIA------------INK
Q18CM8_PEPD6/4-98------------------K--VYLFCSFGM--ST---------------------------SLLA------------.DK
Q18CU9_PEPD6/4-96------------------V--AVTSCPSGV--AH---------------------------TYMS------------AES
A0A0E1NLR5_YERPA/2-87------------------K--ITVVCGNGL--GT---------------------------SLMM------------EIS
E7PXV2_STRDY/3-95------------------K--IGLFCAAGF--ST---------------------------GMLV------------.NN
Q1J657_STRPF/408-490------------------R--VLVVCATGY--GS---------------------------AMML------------KNR
Q1J4M9_STRPF/10-92------------------K--IVTVCGNGI--GS---------------------------SLLL------------RMK
Q1JLA6_STRPC/408-490------------------R--VLVVCATGY--GS---------------------------AMML------------KNR
Q1JGE0_STRPD/408-490------------------R--VLVVCATGY--GS---------------------------AMML------------KNR
Q1QU65_CHRSD/4-95------------------I--LITACPSGV--AT---------------------------TFLA------------ARR
Q1Z3L6_9GAMM/4-96------------------V--CVAACPTGI--AH---------------------------TYMA------------AEA
Q1ZN20_PHOAS/3-95------------------K--IFLCCAAGM--ST---------------------------SMVV------------.NK
Q1ZRJ2_PHOAS/4-96------------------V--AVTACPTGI--AH---------------------------TYMA------------ADA
Q2C2Z8_9GAMM/4-97------------------S--IVTACPSGI--AT---------------------------SLIA------------AGL
Q2C9E2_9GAMM/3-95------------------K--ILLICDMGM--ST---------------------------SLVV------------.KR
Q2RSX5_RHORT/5-96------------------I--AVVGGGERS--TQ---------------------------ALLV------------AEA
Q2SR18_MYCCT/166-258------------------V--GITACPTGI--AH---------------------------TYLA------------SDK
Q2SRQ5_MYCCT/516-599------------------K--IVAVCGQGL--GS---------------------------SLLI------------EMS
Q2SS31_MYCCT/434-518------------------T--IVVACDAGV--GS---------------------------SAMA------------AGI
Q2ST87_MYCCT/422-506------------------K--IVVACEAGV--GS---------------------------SAMA------------AGL
Q2T6U4_BURTA/5-98------------------I--GLVAAPART--AA---------------------------PTFA------------AHA
A0A0D1JUX8_STAAU/2-86------------------K--ILVVCGHGL--GS---------------------------SFMV------------EMN
A0A023KEK7_ECOLX/4-90------------------R--ILAVCGNGQ--GS---------------------------SMIM------------KMK
Q31WJ6_SHIBS/372-455------------------R--IAFVCDTGM--GS---------------------------SAMG------------ATT
Q8DXN6_STRA5/3-90------------------K--VLTACGNGM--GS---------------------------SMVI------------KMK
A0A0H1I1B6_STRAG/3-90------------------K--LLIMCGSGI--AT---------------------------STVV------------VGK
Q8E204_STRA5/3-86------------------R--IGTACGSGL--GS---------------------------SFMV------------QMN
A0A0H1I1B1_STRAG/3-85------------------K--LIVACGSGV--AT---------------------------SQTV------------ASK
Q3XYI0_ENTFC/2-91------------------R--ILVSCANGS--GT---------------------------SLMM------------MRS
Q3XZI4_ENTFC/4-74------------------R--LIVACGSGV--AT---------------------------SQTI------------ASK
A0A0M1XZK5_ENTFC/5-92------------------N--ILFVCGAGL--GS---------------------------SFAA------------QMS
Q3Y3D9_ENTFC/2-86------------------K--IFAVCQSGL--GT---------------------------SFMV------------EMN
Q3YV77_SHISS/10-104------------------V--AITNCPAGI--AH---------------------------TYMV------------AEA
PTEB_GEOSE/2-94------------------N--ILLICAAGM--ST---------------------------SLLV------------.TK
Q48SY3_STRPM/408-490------------------R--VLVVCATGY--GS---------------------------AMML------------KNR
Q4A0L5_STAS1/5-99------------------T--IMLVCAAGM--ST---------------------------SMLV------------.QK
Q4A582_MYCS5/2-84------------------K--ILCICGSGM--GT---------------------------SMII------------KMK
Q8Y6G7_LISMO/3-95------------------N--IMLVCSAGM--ST---------------------------SLLV------------.KK
Q4ZY91_PSEU2/4-95------------------A--IVTACPSGK--VS---------------------------SVLS------------ARL
A0A066NKU7_LELAM/2-85------------------K--IMAICGSGL--GS---------------------------SFMV------------EMN
Q5E797_VIBF1/3-95------------------K--ILLLCAAGM--ST---------------------------SMVV------------.KK
Q5FKN9_LACAC/5-104------------------T--IMLNCSAGM--ST---------------------------SLLV------------.TK
Q5HKT2_STAEQ/4-95------------------L--AITSCPNGI--AH---------------------------TYMA------------QEK
A0A0T7RXL2_SALET/4-87------------------K--VIVACGGAV--AT---------------------------STMA------------AEE
Q5V5X1_HALMA/4-95------------------V--AVTSCPTGI--AH---------------------------SQMA------------AEN
Q5WC74_BACSK/6-91------------------S--ILMVCGAGL--GS---------------------------SFAC------------EMA
Q5WDU7_BACSK/481-566------------------K--IVFACDAGM--GS---------------------------SAMG------------ASL
Q5WJ13_BACSK/2-85------------------K--ILTVCGSGL--GT---------------------------SFMV------------EMN
Q5WJQ7_BACSK/165-256------------------I--GITACMTGI--AH---------------------------TYMA------------AES
Q5WKC6_BACSK/2-94------------------N--ILLVCSAGM--ST---------------------------SMLV------------.DR
Q5WKT3_BACSK/2-94------------------N--VLLACSAGM--ST---------------------------SLLV------------.AK
Q600G5_MYCH2/169-260------------------I--GITSCTVGI--AH---------------------------TYLA------------AEK
Q600R7_MYCH2/4-90------------------K--IVAACGNGM--GT---------------------------SMII------------KLK
Q65HT3_BACLD/3-93------------------K--ILLVCAAGM--ST---------------------------SLLV------------.SR
Q660P2_BORBP/166-257------------------L--AVTACPVGI--AH---------------------------TYMA------------AES
Q67M02_SYMTH/2-83------------------K--ILAVCGMGL--GS---------------------------SLML------------RMQ
Q67QV7_SYMTH/2-94------------------F--ILLACGMGA--SS---------------------------GFLA------------.QS
Q6AAU6_PROAC/5-90------------------K--VLVCCGTGI--AT---------------------------SVQV------------ANK
Q6AAV5_PROAC/5-89------------------K--ILVCCGTGI--AT---------------------------SVQV------------ANK
Q6ABG6_PROAC/181-272------------------V--AITACPTGI--AH---------------------------TYMA------------ADY
Q6AGN8_LEIXX/2-87------------------K--IVAICGAGV--GT---------------------------SGIL------------KVN
Q6D103_PECAS/3-99------------------R--IVLACSAGM--ST---------------------------SLVV------------.TK
Q2G2B6_STAA8/3-88------------------Q--VLVACGAGI--AT---------------------------STVV------------NNA
Q6KH39_MYCMO/175-267------------------L--AITSCPTGI--AH---------------------------TYLA------------AQK
Q6LQH2_PHOPR/7-99------------------R--IILCCGGGF--ST---------------------------SILA------------.KR
Q6MSD1_MYCMS/23-114------------------V--AITACAAGV--AH---------------------------TYMA------------ADS
Q7CPF8_SALTY/4-86------------------M--ILFVCATGV--AT---------------------------STAV------------AEK
Q7CQH8_SALTY/4-86------------------K--ILVACGTGM--ST---------------------------STMI------------AQK
Q7MCJ1_VIBVY/7-99------------------V--AVTACPTGI--AH---------------------------TFMA------------AKK
Q7MFX7_VIBVY/527-619------------------L--AVTSCPSGV--AH---------------------------TFLA------------AKS
Q7MHH0_VIBVY/4-96------------------K--ILLCCSAGM--ST---------------------------SMLV------------.KK
Q7N3G3_PHOLL/3-95------------------K--ILLCCAAGM--ST---------------------------SMLV------------.QR
Q7N5G9_PHOLL/8-93------------------K--ITVVCGHGL--GT---------------------------SLMM------------EMS
Q7NVN2_CHRVO/4-96------------------V--AITACPTGI--AH---------------------------TYMA------------AEK
A0A0E1ETC3_STRPY/408-490------------------R--VLVVCATGY--GS---------------------------AMML------------KNR
Q87IV5_VIBPA/380-463------------------F--VAFACDAGM--GS---------------------------SAMG------------AST
Q7MCQ4_VIBVY/3-79------------------K--IMVVCGHGL--GT---------------------------SLMM------------EMS
Q8DT01_STRMU/4-103------------------Q--ALIICAGGM--SS---------------------------SMIA------------KKT
Q8EUZ2_MYCPE/175-267------------------V--AITACPTGI--AH---------------------------TFMA------------AQR
Q8EV00_MYCPE/168-259------------------I--ALTACPVGV--AH---------------------------TYLA------------ADK
C0R297_BRAHW/4-96------------------V--AITSCPTGV--AH---------------------------TYMA------------ANA
Q8R739_CALS4/5-96------------------V--AVTACPTGI--AH---------------------------TYMA------------AEN
Q8RCS7_CALS4/2-95------------------R--ILLICGAGM--ST---------------------------SLLV------------.EK
Q8RD65_CALS4/8-90------------------T--ILVACGTGI--AT---------------------------STVV------------TEK
Q8RDR5_FUSNN/160-251------------------L--AVTACPTGI--AH---------------------------TYMA------------EAA
A0A085P480_ECOLX/6-91------------------N--ILFVCGYGV--GS---------------------------SVML------------QTV
Q8XI92_CLOPE/3-94------------------K--VVLLCTLGM--ST---------------------------SLLV------------.SK
Q8XVG8_RALSO/114-205------------------V--AITSCPTGI--AH---------------------------TFMA------------AEA
Q8Z3J7_SALTI/5-96------------------I--AVTGCPTGI--AH---------------------------TFMA------------EEA
H1G9C9_LISIO/4-96------------------I--GIAACTSGI--AH---------------------------TYIA------------KEK
Q97EZ1_CLOAB/459-543------------------L--VLVLCASGA--TS---------------------------SMLA------------.NA
Q97EZ8_CLOAB/3-93------------------K--ILAACGAGV--NS---------------------------SHQI------------KDA
Q97M16_CLOAB/3-95------------------R--ILLFCSAGM--ST---------------------------SMLV------------.SK
Q98PX4_MYCPU/6-92------------------K--IIAACGNGM--GT---------------------------SMII------------KLK
Q98R81_MYCPU/174-266------------------V--AVASCPTGI--AH---------------------------TYLA------------AQR
Q99Z99_STRP1/408-490------------------R--VLVVCATGY--GS---------------------------AMML------------KNR
Q9CK39_PASMU/109-200------------------I--AITACPTGV--TQ---------------------------TFMA------------AEA
Q9K613_BACHD/3-95------------------K--ILLACSSGM--ST---------------------------SLLV------------.TK
Q9KG90_BACHD/2-85------------------K--ILCVCGLGQ--GT---------------------------SLIL------------KMN
Q9KG92_BACHD/420-498------------------K--ALIVCANGV--GT---------------------------SQFL------------KNQ
PTMCB_STRMU/384-469------------------Q--IIFACDAGM--GS---------------------------SAMG------------ASI
Q9RMF5_SPICI/165-257------------------I--GITACPTGI--AH---------------------------TYMA------------KEK
Q9RZP7_DEIRA/5-96------------------V--AVTACPTGI--AH---------------------------TFMA------------AEA

PF16809

Q7CHP4_YERPE/56-207KYNKIDQDTQETLKNINDK--LHRAF....--.----------------------------LLTS------------PEQ
Q7CJ61_YERPE/37-179NKDIKTEETEQFLEEIDAQ--MKVICAWEM--D----------------------------STTV------------DQC
Q74T71_YERPE/35-178DKNRLTLEQEKGLKDIKSS--IDDCYHNGI--S----------------------------TSTG------------RKK
Q7CHP3_YERPE/35-195NKNIINAETQHTINDIKQK--LSLIQERYN--A----------------------------STTA------------EFY

PF02383

T1KD31_TETUR/51-459------------------H..GLI....GK..FG..........................SDNLI------------VIR
D6WZ41_TRICA/49-416------------------D..GIV....GK..VE.....HS.......SV.........FDQRLL------------LIK
Q5KJH8_CRYNJ/63-433------------------D..GVL....GV..VS.....VP.......SERS.....PIPEIFLL------------LLT
A0A068X8S8_HYMMI/53-487------------------E..GIL....GK..FQ.....CSP.....ND..........D.SYLL------------LLS
A9UX69_MONBE/51-352------------------Y..ALY....GL..LR.....LL......SG............PYLV------------LVC
G2YY11_BOTF4/58-404------------------A..GIL....GM..IK.....LR.......L...........DKYIV------------VIT
N4V3L8_COLOR/63-521------------------F..GVV....GL..IT.....VS.......R...........LSYLI------------TIT
M0SC50_MUSAM/97-398------------------Y..GIV....GF..VR...............F........LGPYYML------------LIT
J7SAA4_KAZNA/59-372------------------H..GFI....GL..IS.....LN......DS............IFIG------------TIT
D3BK40_POLPA/68-358------------------F..GCV....GI..IN.....LL.......S...........GPQLM------------CIS
G4T741_SERID/59-349------------------Y..GIM....GI..LK.....LS.......T...........SDFLV------------LIT
E1JIS2_DROME/49-413------------------H..GIV....GV..IS.....LP.......NV.........YEPHLV------------VVK
A9SC07_PHYPA/102-403------------------Y..GIV....GF..IK...............F........KESYYMI------------LVT
E5SRB2_TRISP/64-411------------------F..GIV....GILRVD.....FI......GI............EHLL------------LIA
H2AUX3_KAZAF/59-348------------------S..ALL....GF..IR.....LK.......L...........NTYAI------------IAD
Q8IDF9_PLAF7/69-487------------------Y..GCL....GI..IK.....AE.......N...........INFLV------------IVS
W1QJT5_OGAPD/65-371------------------H..AVL....GI..VY.....MK......GL............VFVG------------FVT
E4V449_ARTGP/252-570------------------W..GLL....GF..IR...............F........TGSYYML------------VVT
C1FDJ4_MICCC/20-369------------------F..GCV....GT..IR.....LL.......A...........GYYLI------------VLT
Q6CA28_YARLI/61-406------------------H..GFL....GL..IN.....IS......SD............VFLC------------VIT
M4EB23_BRARP/94-392------------------Y..GII....GF..VR...............F........LGPYYIL------------VIR
C0H4Q9_PLAF7/75-370------------------E..GIF....GC..IR...............F........LNYPYLY------------VLI
M0RHT6_MUSAM/81-399------------------Y..GVL....GI..IR.....LI.......A...........GTYVL------------LIT
C5DSV8_ZYGRC/110-427------------------Y..GLL....GF..IR...............F........TACYYLV------------VVT
G0VA45_NAUCC/61-376------------------F..GFI....GL..IE.....ID......GL............LFVG------------AIT
G4TWM6_SERID/68-410------------------Q..GCL....GL..IN.....IE......NE............IFLA------------VVT
U9UKG2_RHIID/74-557------------------F..GVV....GF..LE.....LL.......T...........GRYII------------VIT
K4BN51_SOLLC/97-395------------------Y..GIV....GF..VK...............F........LGPYHML------------VIT
R7YYD7_CONA1/83-426------------------H..GTL....GL..IT.....VN......ND............VFLC------------VVS
U4LEW4_PYROM/81-430------------------M..GCL....GL..IS.....IG......RD............IFLC------------VIT
A5KCJ0_PLAVS/74-371------------------E..GIL....GC..IR...............F........LNYPYLY------------VIT
SAC2_ARATH/94-392------------------Y..GII....GF..IR...............F........LGPYYML------------IIT
W4YFI2_STRPU/9-340------------------...GAV....EM..LQ..............KE.........SEWRLL------------LIR
A7RZB6_NEMVE/49-414------------------Y..GVI....GK..IQ.....FF.......PG.........GDWKLL------------VIT
B9H663_POPTR/67-353------------------F..GVI....GM..LK.....LV.......A...........GSYLI------------VIT
G8BKP8_CANPC/62-375------------------Y..GCL....GL..IY.....VD......NQ............IFLS------------VIT
Q2HAV1_CHAGB/70-574------------------F..GIV....GL..VT.....VF.......H...........YSYLI------------SIT
M7UY11_BOTF1/63-530------------------F..GIV....GL..LT.....VS.......K...........SSFLI------------SIT
SAC5_ARATH/94-394------------------Y..GII....GF..VR...............F........LEPYYML------------LIT
L8G8J4_PSED2/218-537------------------W..GLL....GF..VR...............F........TGTYYML------------LIT
D2A1F9_TRICA/93-408------------------F..GIV....GF..IR...............F........LEGFYII------------LIT
J3LMS2_ORYBR/74-358------------------Y..GVV....GM..IR.....LL.......A...........GNYVL------------VIT
U9T620_RHIID/59-361------------------Y..GVF....GI..IN.....LL.......A...........GGYLI------------VIT
C3YI49_BRAFL/92-424------------------F..GIV....GF..VR...............F........LEGYYIV------------LIT
U9U990_RHIID/74-386------------------Y..GCL....GL..LQ.....VE......KD............MFLA------------AVT
J9JKG1_ACYPI/67-352------------------A..GIL....GV..VK.....LL.......I...........GPYII------------IIK
S3CHC2_OPHP1/64-622------------------F..GII....GL..IL.....VS.......K...........FSYLV------------SIT
F8PPL7_SERL3/66-403------------------K..GCL....GL..IC.....ID......NE............TFLA------------VIT
K5VD14_PHACS/1-299------------------...........M..VT.....LV.......M...........SEYII------------IIT
Q57WG4_TRYB2/116-428------------------A..ALF....GC..LR...............L.........DRMYFL------------VAT
T1J2C7_STRMM/56-343------------------C..GII....GI..IR.....LL.......A...........GPYLI------------VIT
E3KFB0_PUCGT/63-397------------------A..GLL....GI..IR.....LM.......K...........SDYLV------------LIQ
A8WW57_CAEBR/91-394------------------F..GIL....GV..VR...............F........VEGYYLI------------IIT
I2H9W8_TETBL/70-382------------------N..GLL....GL..IT.....VD......GG............IYIV------------VIS
I2G1X7_USTH4/203-723------------------S..GII....GL..SR.....FF.......S...........SSYLF------------VIT
F0ZK63_DICPU/56-372------------------Y..CVL....GI..FR.....IY......NE............CFLV------------VVT
U4LLP6_PYROM/58-388------------------A..GIL....GM..IQ.....LR.......L...........DKYII------------IIT
B6AEC7_CRYMR/97-504------------------F..CLI....GI..WR.....CD......WN...........ITKCL------------FVT
M2QTY4_COCSN/63-571------------------H..GII....GL..LK.....IA.......T...........SHFLI------------SIS
S3CNV5_GLAL2/57-404------------------A..GIL....GM..IK.....LR.......L...........DKYII------------VIT
A7ARQ4_BABBO/68-372------------------Y..GVF....GV..VQ...............F........LQGAYLV------------VIT
Q4WG39_ASPFU/70-407------------------H..GTL....GL..IA.....LD......GD............VFLC------------VVT
Q6FT79_CANGA/60-371------------------Y..AFI....GL..IE.....ID......GL............LFIG------------TIT
G8B4U5_CANPC/149-470------------------Y..GLL....GL..VR...............F........TRGYYLN------------LIT
M2MLD2_BAUCO/60-574------------------H..GIV....GL..LD.....LV.......S...........SSYLI------------SIT
H2YC96_CIOSA/60-348------------------H..AIF....GV..VN.....LT.......G...........GPHLI------------VVT
R0JZX9_SETT2/58-406------------------A..GIL....GI..IK.....LR.......L...........DKYII------------VIT
D8PS50_SCHCM/66-397------------------K..GCL....GL..IS.....IE......ND............LFLS------------VVT
R1FZR3_BOTPV/58-407------------------A..GVL....GM..IK.....LR.......L...........DKYII------------VIT
G9NW33_HYPAI/100-446------------------Y..GTL....GL..IS.....IN......GE............VFLS------------VIT
D7M050_ARALL/98-396------------------Y..GII....GF..IK...............F........LGPYYML------------LIT
L8FVQ8_PSED2/63-570------------------F..GIV....GL..LT.....VA.......Q...........TSYLI------------SIT
M0S1Z1_MUSAM/93-393------------------Y..GIV....GF..VK...............F........LGPYYML------------LIT
R9NVL5_PSEHS/14-526------------------F..GIV....GL..SR.....FF.......S...........SSYLF------------VIT
F6TPV9_XENTR/49-415------------------E..GII....GK..VQ.....LH.......TD.........LPWWLL------------LIR
M0SDD8_MUSAM/93-403------------------Y..GIA....GF..VK...............F........LGPYYML------------LIT
H6BTH0_EXODN/64-555------------------H..GII....GL..LS.....IA.......S...........TSFLI------------AIT
G2Q7U9_MYCTT/70-572------------------F..GIV....GL..VT.....VF.......H...........YSYLI------------SIT
I1F7K4_AMPQE/102-544------------------F..GLI....GK..LQ.....LL.......SN.........TGWYLL------------IIT
M5C6U0_THACB/61-365------------------Y..GVL....GI..LS.....LS.......A...........CDYLV------------LIT
K1QAG7_CRAGI/57-343------------------Y..GIF....GM..IR.....LI.......A...........GPYLI------------VIT
S2J015_MUCC1/152-470------------------Y..GIV....GF..VK...............F........TQGWYMI------------FIT
G2RDG2_THITE/59-406------------------A..GIL....GM..IR.....LR.......L...........DKYII------------IIT
G8BUQ8_TETPH/65-360------------------A..CLL....GF..IR.....LK.......L...........NRYAI------------VAN
G8YQ13_PICSO/63-388------------------Y..GCI....GL..IR.....IE......GQ............IFLA------------VIS
C4YAV6_CLAL4/166-486------------------F..GLI....GL..IK...............F........TRGYYLS------------VIT
C5GMD6_AJEDR/63-543------------------H..GVI....GL..LS.....LA.......S...........FSFLI------------SIT
G4TD48_SERID/149-672------------------R..GII....GI..IT.....LF.......S...........ASYLL------------VIT
G0VIB2_NAUCC/65-382------------------H..GFI....GL..ID.....IE......GL............IFVG------------VIT
B8M0V9_TALSN/70-410------------------W..GTL....GL..IS.....LN......RD............VFIC------------VVT
E9D6J0_COCPS/58-407------------------A..GIL....GI..IK.....LK.......L...........DKYII------------IIT
J3MPP7_ORYBR/89-387------------------Y..GIA....GC..IK...............F........LESYYLI------------LVT
T1G0U9_HELRO/100-430------------------F..GIV....GF..VR...............F........LEGYYMI------------LIT
I7MMS0_TETTS/67-353------------------S..AFL....GI..IN.....IL......NQ............NFLV------------FVE
I1CC69_RHIO9/32-317------------------Y..GIM....GF..IQ.....LL.......S...........GDYML------------TIT
U5H700_USTV1/88-588------------------E..GVA....GI..VH.....GF.......Q...........GSHII------------LIV
G2Q2Q6_MYCTT/104-444------------------Y..GTL....GL..IS.....IE......RD............VFLC------------VIT
G0V8J9_NAUCC/55-344------------------A..AVL....GF..IR.....LK.......L...........NKYVV------------IAN
S8E1N2_FOMPI/61-357------------------Y..GIY....GL..VS.....LA.......L...........SEYII------------VIT
A0CHV5_PARTE/61-365------------------F..AVY....GI..MQ.....LK.......N...........WSYLL------------LVT
D8PRQ3_SCHCM/58-384------------------H..AIY....GI..IS.....LS.......Q...........SEYLI------------IAT
T5AG39_OPHSC/60-517------------------F..GII....GL..IT.....VS.......K...........LSYLV------------SIV
N4VKU5_COLOR/59-404------------------A..GIL....GI..IQ.....LR.......L...........DKYVI------------VIT
G4MWX0_MAGO7/59-404------------------A..GIL....GI..IS.....LR.......L...........DKYVI------------IIT
R9ARV2_WALI9/55-340------------------Y..GIL....GI..IH.....LS.......T...........TPFLI------------AIS
K5XJD5_AGABU/60-364------------------Y..GIV....GI..IS.....LS.......L...........SEYII------------VIT
G7DXW9_MIXOS/226-550------------------Y..GIV....GF..IR...............F........TAGWYLV------------LVK
G0SBM9_CHATD/104-441------------------Y..GTL....GL..IS.....TG......RD............VFLC------------VIT
N1JCJ3_BLUG1/63-549------------------Y..GII....GL..LN.....VS.......N...........SYFLI------------SII
M5EN25_MALS4/346-692------------------F..GLV....GF..VR...............F........TSGYYMV------------LIS
Q5KH01_CRYNJ/95-408------------------Y..GLV....GF..IR...............F........TTCWYMI------------LMT
Q7S867_NEUCR/229-545------------------W..GLL....GF..IK...............F........TGPWYML------------LIT
K2RVQ9_MACPH/193-510------------------W..GLL....GF..IR...............F........TEAYYML------------VIT
W5J8M1_ANODA/80-394------------------Y..GVL....GF..VQ...............F........LEGYYLL------------LVT
SAC1_DICDI/54-340------------------K..GII....GC..IQ.....LV.......S...........GHYLM------------IFK
T1FUK8_HELRO/50-538------------------H..GLI....GK..FK.....TR.......LD.........GDWKLL------------LIK
B5RSQ8_DEBHA/66-392------------------F..GCL....GL..IS.....ID......KK............AFLA------------VIT
G2WYN2_VERDV/106-451------------------F..GTL....GL..IS.....VD......GD............VFLS------------VVT
A0A0C4DV87_MAGP6/68-562------------------F..GIV....GL..IT.....VP.......P...........HSYLV------------TIT
F1A1C9_DICPU/141-455------------------Y..GIL....GF..IR...............F........LHGYYII------------LIT
E6ZJS2_SPORE/66-367------------------Q..GIV....GI..IK.....LH.......S...........SEFLV------------VIT
H3E9S7_PRIPA/95-399------------------F..GVL....GV..VR...............F........TEGYYLI------------VIT
B7FP27_PHATC/51-352------------------Y..GIV....GF..IR...............F........LDCYYLT------------LIT
E2BYM7_HARSA/49-421------------------Y..GIV....GK..IE.....QA.......SV.........LEPRLM------------LIK
R7YH37_CONA1/209-526------------------W..GLI....GF..IR...............F........TEAYYML------------LIT
H2S7Z3_TAKRU/58-345------------------C..GIM....GT..IR.....LV.......A...........GMYLI------------VIT
E4ZG73_LEPMJ/81-424------------------H..GTL....GL..IT.....VN......GD............VFLV------------VVN
F1NY27_CHICK/49-415------------------E..GVI....GK..VQ.....LH.......TD.........LPWWLL------------LIR
G8XZ18_PICSO/153-482------------------F..GLL....GL..IK...............F........TKGYYLC------------IIT
A1CD55_ASPCL/70-407------------------Y..GTL....GL..IT.....LS......ED............VFLC------------VVT
J7SAB7_KAZNA/112-431------------------Y..GLL....GF..IR...............F........TSCYYLV------------VVT
W1P6E8_AMBTC/111-409------------------F..GIA....GC..IR...............F........LESYYLI------------LVT
K1W4F3_MARBU/56-525------------------F..GLV....GL..LT.....VS.......R...........SSFLI------------SIT
K7J697_NASVI/60-347------------------W..GII....GI..VR.....LL.......A...........CPYLI------------VID
E1C9A9_CHICK/88-418------------------F..GIV....GF..IR...............F........LEGYYIV------------LIT
Q7Q4S5_ANOGA/63-347------------------C..GVL....GM..VR.....LI.......S...........GLHLV------------VVT
N1Q039_DOTSN/60-549------------------H..GIV....GL..LD.....LV.......S...........SSYLI------------AIT
B0CP51_LACBS/1-312------------------Y..GII....GL..IS.....LS.......L...........SEYVI------------VIS
Q4XWC6_PLACH/488-921------------------K..TIN....GD..IKDLINNYYFNANNYDDMD.......KRDPYFM------------GIK
V2X4I3_MONRO/87-400------------------F..GIA....GF..IR...............F........TAGWYMI------------LIT
M2M475_BAUCO/75-417------------------Q..GTL....GL..VT.....IN......GD............IFLC------------IVN
C9S6N7_VERA1/63-529------------------F..GVV....GL..IT.....LS.......K...........LNFLI------------TIT
G1X0C6_ARTOA/174-493------------------W..GIL....GF..IR...............F........TTNYYML------------VIT
T1IJ69_STRMM/58-420------------------Y..GII....GK..IT.....IY.......PE.........FPPKLL------------IIK
T1KK25_TETUR/82-403------------------Y..GIF....GF..VR...............F........LEGYYMI------------LIT
C4Y2V5_CLAL4/62-393------------------H..GCL....GL..ID.....VE......GK............TYLA------------VIT
W4Z911_STRPU/96-400------------------F..GIA....GF..VR...............F........LEGYYII------------LIT
U1GCU4_ENDPU/60-539------------------H..GII....GL..LK.....IA.......S...........SSFLL------------CIT
C5KYE4_PERM5/105-416------------------......NGDSGN..RS.....VV......SR............SYLV------------LCT
A0A068Y4L0_ECHMU/154-489------------------V..GLV....GF..IR...............F........LAGYYLI------------VIT
G6D469_DANPL/92-449------------------F..GIV....GF..IR...............F........LEGYYII------------LVT
D5G7X8_TUBMM/58-350------------------A..GVL....GV..IR.....LR.......L...........DKYII------------IIT
T1HA14_RHOPR/64-351------------------Y..GIL....GV..IH.....LI.......S...........GPHLI------------VVT
M2ZGL2_PSEFD/203-520------------------W..GVL....GF..IR...............F........TEAYYML------------LIT
G3J4K6_CORMM/63-514------------------F..GVI....GL..IT.....VS.......K...........LSYLV------------TIT
G2X9Q0_VERDV/59-404------------------A..GIL....GI..VQ.....LR.......L...........DKYVI------------IIT
K4DFN4_SOLLC/93-391------------------Y..GII....GF..IK...............F........LGAHYLL------------VIT
G4UG08_NEUT9/64-544------------------F..GIV....GI..LT.....VF.......R...........YSYLI------------SIT
H3EHY7_PRIPA/69-367------------------Y..GVI....GT..IQ.....LV.......S...........GQALI------------VIK
G9NS38_HYPAI/134-451------------------W..GLL....GF..IK...............F........TGPYYML------------LIT
G3AVT2_SPAPN/62-376------------------Y..GCL....GL..AY.....VD......NQ............TYVA------------IIT
R1EXS4_BOTPV/89-431------------------H..GTL....GL..IT.....VN......ND............VFLC------------VVS
F2UG64_SALR5/53-346------------------F..GIL....GT..IN.....LV.......N...........GPCLI------------GID
E3QND3_COLGM/63-526------------------F..GVI....GL..IT.....VS.......R...........LSYLI------------TIT
M4A284_XIPMA/57-344------------------C..GVM....GT..IR.....LP.......A...........GMYLI------------VIT
D5G5P0_TUBMM/86-404------------------L..GTL....GL..IT.....LN......RD............VFLG------------VVT
E9GCU9_DAPPU/56-343------------------F..GIV....GT..IR.....LL.......A...........GPYLV------------VIT
J3NY79_GAGT3/66-554------------------F..GII....GL..IT.....VP.......P...........HSYLV------------TIT
M7NNF6_PNEMU/89-401------------------W..GIC....GF..IR...............F........TCGYYIS------------FIT
M1W8V7_CLAP2/63-523------------------F..GVI....GL..IT.....VS.......R...........LSYLI------------TIT
J0M7Q7_LOALO/94-405------------------F..GLL....GA..VR...............F........LEGYYLL------------IVT
G0SY29_RHOT2/56-378------------------R..GCL....GA..VR.....MK......GC............TFLA------------IVV
C5FSR6_ARTOC/58-407------------------A..GIL....GI..VK.....LK.......L...........DKYVI------------VIT
T1EGD7_HELRO/83-369------------------C..GIF....GI..IR.....LL.......A...........GPYLI------------VIT
A8NX18_COPC7/305-645------------------K..GCL....GL..IS.....VE......ND............IFLA------------VVT
F5HJH9_ANOGA/49-410------------------H..GIV....GT..IA.....LQ.......GV.........LDPHLI------------VIK
J9K0P5_ACYPI/67-375------------------F..GIV....GF..VR...............L........LEGYYMI------------LIT
S2K0S3_MUCC1/63-461------------------Y..GIV....GF..IE.....GF.......K...........EKYMV------------VIS
N1JLL1_BLUG1/178-497------------------W..GLL....GF..IR...............F........TGIYYML------------QIT
M7XAA6_RHOT1/139-465------------------F..GIA....GF..VR...............F........SCTIWMV------------VIT
Q755P1_ASHGO/68-383------------------Y..GFL....GL..IE.....IE......NK............IFIC------------TIT
A1CNM1_ASPCL/67-540------------------Y..GLV....GL..LS.....VA.......S...........YSFLI------------SIT
E9DU49_METAQ/65-527------------------....VIVHASGL..IT.....VS.......R...........LSYLI------------TIT
J5JGT1_BEAB2/63-517------------------F..GVI....GL..IT.....VS.......N...........LSYLV------------TIT
E3JUZ0_PUCGT/67-568------------------QLDGLI....GL..IQ.....LF.......Q...........DTYLI------------AIA
M0T7B0_MUSAM/134-451------------------Y..GVV....GI..IK.....LP.......A...........GTYVL------------LIT
M7PDU4_PNEMU/56-349------------------Y..GIL....GI..IR.....LK.......Y...........DKYLI------------IIT
K5WMU6_PHACS/79-408------------------F..GVA....GF..IR...............F........TAGWYMV------------LIS
M7PKE9_PNEMU/59-374------------------Y..GCM....GL..IS.....IE......NN............VFIC------------LIT
K0KNZ9_WICCF/70-494------------------L..GLI....GL..VE.....LG.......P............GYLV------------VIH
S2JAH7_MUCC1/65-379------------------F..GCL....GL..IT.....VR......NE............CFVA------------IVT
D3BTS0_POLPA/416-699------------------Y..GIV....GI..LN.....LL.......S...........GPHLV------------LIT
S2JK62_MUCC1/31-329------------------Y..GIL....GF..IK.....LQ.......A...........GEYMI------------VIT
J3KAJ5_COCIM/66-531------------------H..GVI....GI..LS.....VA.......S...........YSFLI------------SIT
F8PMF1_SERL3/60-358------------------Y..GIL....GL..IS.....LA.......L...........SEYVI------------VLT
D3BEB3_POLPA/93-442------------------N..ALL....GY..IV...............A........ERYSYLL------------VAT
B9RR38_RICCO/103-401------------------Y..GIV....GF..IK...............F........LGPYYML------------LIT
W5KWG7_ASTMX/57-344------------------C..GIM....GT..IR.....LV.......A...........GMYLI------------VII
K5WWZ1_AGABU/65-397------------------K..GCL....GL..IS.....ID......ND............IFLA------------VVT
J8PJ40_SACAR/104-423------------------Y..GLL....GF..IK...............F........TCWYYLI------------MVT
W1PGK4_AMBTC/137-423------------------Y..GLV....GM..LR.....LL.......A...........GAYMV------------VIT
L0P9K4_PNEJ8/58-354------------------Y..GII....GI..IQ.....LK.......Y...........DKYII------------VIT
M2RB20_CERS8/61-357------------------Y..GIF....GL..IS.....LA.......A...........SDYVI------------VIT
V5ERP5_KALBG/92-460------------------Y..GCL....GL..IN.....VG......QD............LFVA------------VVT
M7UQG4_BOTF1/85-439------------------H..GTL....GL..IT.....VS......ND............IFLC------------VIT
C4K056_UNCRE/73-415------------------Y..GTL....GL..LT.....LN......SD............VFLC------------IIA
G6D5Y6_DANPL/62-347------------------C..GFL....GS..IK.....LI.......S...........GLYLV------------VAK
H2APJ2_KAZAF/137-456------------------Y..GLL....GF..IK...............F........TGCYYLL------------VVT
K9G7Q7_PEND2/207-525------------------W..ALL....GF..IR...............F........TSVHYML------------LVT
U1NBL6_ASCSU/117-420------------------H..GIV....GI..IK.....LV.......SGIV....FDIAGYALI------------TIK
Q7RGR5_PLAYO/74-372------------------E..GIL....GC..IK...............F........LNYPYLY------------VVT
A3LXQ5_PICST/155-481------------------Y..GLL....GF..IK...............F........TKGYYLS------------IIT
M7X3K9_RHOT1/56-361------------------Y..GLF....GV..IS.....LL.......K...........SDYLI------------VIT
D8T3D8_SELML/87-387------------------Y..GIV....GF..IK...............F........RESHYML------------LVS
F0ZLJ6_DICPU/63-352------------------Y..GCL....GI..IN.....LL.......S...........GPYLL------------CIT
S3CVW2_GLAL2/85-433------------------H..GTL....GL..IT.....IN......ND............VFIS------------VVT
Q5BEV5_EMENI/68-546------------------Y..GLV....GL..LS.....VA.......S...........YSFLI------------AIT
F8Q9U6_SERL3/157-476------------------F..GVA....GF..VK...............F........TAGWYML------------IIS
G0VFD5_NAUCC/123-442------------------Y..GLL....GF..IK...............F........TSVYYLV------------VVT
G7YDP0_CLOSI/69-377------------------F..ACL....GV..LTFPASQVSDSNGPVPL............SYLV------------LVT
C0NEL5_AJECG/63-542------------------H..GVI....GL..LS.....LA.......S...........FSFLI------------SIT
K5V8W0_PHACS/67-406------------------K..GCL....GL..IS.....IA......GD............VFLA------------VIT
C4QZW2_KOMPG/56-382------------------H..GFL....GL..IN.....VN......ED............VFLC------------VIT
J7S204_KAZNA/64-390------------------Y..GFV....GL..IE.....IE......GL............IFLG------------AIT
R0IK60_SETT2/63-571------------------H..GII....GL..LQ.....VA.......T...........SHFLI------------SIS
S8AY78_PENO1/64-401------------------Y..GTL....GL..VT.....LN......ED............VFVC------------VIT
F0XU31_GROCL/59-398------------------K..GIL....GM..IQ.....LR.......L...........DKYVI------------VIT
F2UM54_SALR5/103-411------------------F..GIF....GV..VR...............F........LSGYYIL------------VIT
E0VIK7_PEDHC/67-354------------------F..GVI....GT..IK.....LI.......A...........GNYLV------------VVT
H9JM50_BOMMO/74-434------------------F..GIV....GF..IR...............F........LEGYYII------------LVT
I2GXX5_TETBL/61-376------------------N..GFI....GL..IQ.....MQ......GL............IFIC------------VIT
Q5K7Z5_CRYNJ/67-502------------------G..GVL....GV..AR.....LW.......D...........AAYLF------------VFL
G9P6U6_HYPAI/63-529------------------L..GVI....GL..IT.....VS.......R...........LTYLV------------TIT
U5H9Z9_USTV1/58-361------------------Y..GLF....GI..IT.....LL.......R...........SDYLV------------VVT
SAC7_ARATH/66-352------------------F..GVV....GM..LK.....LL.......A...........GSYLV------------VVT
A8N188_COPC7/59-367------------------Y..GIM....GL..IS.....LS.......L...........SDYII------------VIT
G0W400_NAUDC/113-407------------------EVPILL....GF..IQ.....LK.......L...........NKYVV------------VGT
U4L6E4_PYROM/71-583------------------Q..GIV....GL..LN.....VS......PT...........NSFLV------------AIT
A0A023B5B8_GRENI/87-665------------------H..VIL....GI..LV.....LK......GR............RFLM------------VVA
C4JIM2_UNCRE/66-550------------------H..GIV....GL..LS.....VA.......S...........YSFLI------------SIT
B9IGB3_POPTR/77-364------------------Y..GVV....GT..IR.....LV.......V...........GTYML------------VII
FIG4_SCHPO/85-387------------------Y..AIL....GL..FR...............F........TAGYYLY------------LCT
H6BRI4_EXODN/217-536------------------W..GLL....GF..IR...............F........TAHYYML------------YVT
F4PLM6_DICFS/403-721------------------Y..GII....GV..IK.....LI.......S...........GPHLI------------LIT
W5JX57_ANODA/49-417------------------H..GIV....GT..VE.....LP.......GV.........LEPHLL------------VVR
R7YKY3_CONA1/58-410------------------A..GIL....GI..IK.....LR.......L...........DKYIV------------AIT
A9SVI0_PHYPA/101-401------------------Y..GIV....GF..IK...............F........MESHYMI------------LVT
A9TGA3_PHYPA/98-398------------------Y..GIV....GF..IN...............F........LECYYML------------LVT
Q38DV2_TRYB2/90-462------------------Y..ALF....GV..LR...............I........GSASILL------------YVS
C4QYI5_KOMPG/118-436------------------I..GLL....GF..IR...............F........TSYYYLC------------VIT
M9LTC1_PSEA3/99-467------------------H..GCL....GL..IN.....VG......QD............LFVA------------VVT
Q6CA45_YARLI/45-333------------------A..AIV....GT..IR.....LL.......A...........SQYII------------VAS
F2SHH0_TRIRC/69-406------------------L..GTL....GL..IA.....LAA.....GE............VFIC------------IVN
S3C7S4_OPHP1/59-400------------------R..GIL....GV..IQ.....LR.......L...........DKYVV------------VIT
R9APB7_WALI9/204-510------------------Y..GVL....GF..IK...............F........TKFPYLI------------LIT
E9HJ60_DAPPU/49-412------------------H..GIV....GK..LN.....SF.......PD.........TDPQLL------------VIE
S9X0I5_SCHCR/60-378------------------Y..GTL....GL..IE.....LE......NS............NFLC------------VIT
R4XFI4_TAPDE/61-378------------------Y..GTL....GL..IC.....LN......DH............VFVG------------VVS
N4TSS6_FUSC1/102-443------------------Y..GTL....GL..IT.....VN......SE............VFLS------------VIT
D8M8J8_BLAHO/51-349------------------YCAGIL....GAYKLS..............R...........EIFIA------------FIT
F0VP05_NEOCL/74-613------------------Y..GLF....GV..TQ.....IF.......G...........CAYVI------------CIA
I7MFX4_TETTS/90-393------------------S..GFL....GI..IN.....IA......GV............NFLM------------FVK
U5H307_USTV1/71-482------------------H..GCL....GL..LS.....VG......ND............TFVP------------IVT
K3YPZ5_SETIT/92-387------------------Y..GII....GF..IK...............F........LGPYYML------------IIT
B0CRZ9_LACBS/104-639------------------Y..GIV....GV..LE.....LF.......S...........CSYLL------------VIS
U9TPB3_RHIID/125-431------------------Y..GIV....GF..IK...............F........TEGYYIS------------LIT
I1J8D3_SOYBN/67-353------------------F..GVV....GM..LK.....LL.......A...........GSYLL------------VIT
K9GWQ7_PEND2/64-401------------------Y..GTL....GL..VT.....LN......ED............VFVC------------VVT
Q0CM80_ASPTN/66-539------------------Y..GLV....GL..LS.....VA.......S...........HSFLI------------PIT
V5E649_KALBG/360-756------------------F..GIV....GF..IR...............F........TSTYYMV------------LIS
M2N031_BAUCO/78-395------------------W..GLL....GF..IR...............F........TEAYYMQ------------VIT
Q6FW72_CANGA/117-438------------------D..ALL....GF..IR...............F........TSCYYLV------------VVT
D5G596_TUBMM/71-526------------------H..GIV...AGL..LN.....VSP.....AS............AFLI------------AVT
V5G570_BYSSN/73-413------------------H..GTL....GL..IT.....LN......HD............VFIC------------VVT
D6WSC5_TRICA/58-346------------------C..GVL....GS..IT.....LL.......A...........GRYLV------------IVT
F4RZS2_MELLP/79-405------------------W..GIV....GF..IK...............F........TGPYYLV------------TIK
M2MCP4_BAUCO/58-408------------------S..GIL....GI..IK.....LR.......L...........DSYVI------------IIS
B6QHK8_TALMQ/59-408------------------A..GIL....GI..IK.....LK.......L...........DKYII------------VIT
G0NPG8_CAEBE/50-367------------------E..LLI....GK..IS.....YE......ND...........QHFLF------------FVV
B8CEM3_THAPS/99-401------------------Y..GVL....GF..IK...............F........LDCYYLT------------LIT
I1P187_ORYGL/69-354------------------Y..GVI....GV..LK.....LS.......V...........GSYFL------------VIT
F0Z8Z2_DICPU/116-570------------------L..AIL....GY..II...............S........EKSSHLL------------VAT
F0Y2V1_AURAN/93-401------------------Y..GLL....GF..AR...............F........LDCYYVI------------LVT
G4VJY3_SCHMA/54-384------------------Y..GIW....GL..VR.....LV.......S...........GFYLI------------VIK
V2Z2N6_MONRO/62-365------------------Y..GIM....GI..IS.....LT.......L...........SEYVV------------IIT
S3CB92_OPHP1/298-644------------------W..GLL....GF..IR...............F........TGPYYMM------------LIT
G9N9F4_HYPVG/62-525------------------L..GVV....GL..IT.....VS.......R...........LTYLV------------TIT
F1KWA4_ASCSU/56-368------------------S..GVV....GS..LR.....AA.......N...........ERYLL------------LIT
K3X1K0_PYTUL/68-363------------------D..AIY....GV..FT.....LL.......R...........GPYLA------------VVT
Q6FXM3_CANGA/62-377------------------H..GFI....GM..IE.....IE......GY............IFLG------------AIT
D0N9N5_PHYIT/457-752------------------D..AIY....GV..FW.....LL.......R...........GPYLA------------VVT
Q7SFD6_NEUCR/59-406------------------A..GIL....GV..VR.....LR.......L...........DKYII------------VIT
W5N090_LEPOC/49-415------------------E..GVI....GK..IQ.....LH.......TD.........LPLGLI------------LIR
J4UUT4_BEAB2/65-407------------------A..GIL....GV..IQ.....LK.......L...........DKYVV------------IIN
W5NKP0_LEPOC/92-421------------------Y..GIV....GF..VR...............F........LEGYYII------------LIT
I1RZZ0_GIBZE/63-521------------------F..GVI....GL..IT.....VS.......K...........SSYLV------------TIT
Q6C3P9_YARLI/116-436------------------W..GLL....GF..IR...............F........TDGYYMV------------VVT
K4A7S2_SETIT/85-382------------------Y..GIV....GF..VK...............F........LGPYYMV------------VIT
D8U580_VOLCA/69-435------------------P..YIL....GYVVIG..............Q............WGLL------------LVA
M5BXF8_THACB/50-382------------------H..GIV....GF..VR...............F........TAGWYIV------------LIT
A7SHY2_NEMVE/60-347------------------F..GIM....GI..IH.....LL.......A...........GPYLI------------VIT
A5E694_LODEL/62-377------------------S..GCL....GL..IY.....IE......KQ............IYLA------------VIT
R8B9N9_TOGMI/59-405------------------A..GIL....GI..IQ.....LR.......L...........DKYVI------------VIT
A8PZV0_MALGO/62-371------------------H..GIL....GI..IS.....LH.......T...........SEFLV------------VIT
Q2HCU6_CHAGB/59-407------------------S..GIL....GM..IQ.....LR.......L...........DKYII------------VIT
A9S875_PHYPA/67-358------------------F..GLA....GI..LR.....LV.......A...........GKSQL------------VIT
Q75AB9_ASHGO/67-380------------------K..GLL....GV..IH.....VR......NQ............VFIG------------LIT
E3S8U9_PYRTT/63-566------------------H..GII....GL..LK.....VA.......T...........SYFLI------------SIS
C1EI08_MICCC/1-307------------------..............MR...............L........LTGHHLL------------LVT
D5GL45_TUBMM/206-523------------------W..GLL....GF..IR...............F........TGAYYML------------LIT
K2RHQ7_MACPH/63-584------------------H..GIV....GL..LQ.....AA.......K...........SSFLI------------AIS
A3LSB9_PICST/57-382------------------F..GCL....GL..IH.....LD......HQ............VFVA------------VIT
R8BX46_TOGMI/190-506------------------W..GLL....GF..IK...............F........TGPYYMI------------LIT
K0T420_THAOC/246-622------------------E..GIY....GVYNLP...............C.........SGPHVV------------LIT
A1CHB7_ASPCL/59-407------------------A..GIL....GI..IK.....LK.......L...........DKYLI------------VIT
C5DRM7_ZYGRC/63-377------------------Y..GFI....GL..IE.....VE......GL............IFVG------------AIT
G1XSX4_ARTOA/106-449------------------R..GTL....GL..IS.....LN......GD............VFLC------------VVT
D8QIA7_SCHCM/119-439------------------F..GIA....GF..IR...............F........TAGWYMV------------LVS
F0UW46_AJEC8/71-411------------------H..GTI....GL..IA.....LN......SD............IFLC------------TIS
E7M0C0_YEASV/61-376------------------F..GVI....GL..IE.....VN......GL............LFVG------------TIT
SAC8_ARATH/65-349------------------Y..GVG....GT..IR.....LL.......A...........GTYLL------------VIT
B0CXX2_LACBS/65-402------------------K..GCL....GL..IS.....VE......ND............VFVA------------LVT
M0RUH2_MUSAM/69-366------------------F..GVI....GI..LK.....LL.......L...........GAYLL------------VIT
V2YDR2_MONRO/117-646------------------Y..GIV....GV..LE.....LF.......S...........ASYLL------------VVT
E9GGD2_DAPPU/93-412------------------F..GIV....GF..VR...............F........LEGYYIV------------LIT
K0KIW2_WICCF/59-391------------------H..GFL....GL..IE.....VN......ND............SYLC------------AIT
F6YQ60_CIOIN/94-424------------------F..GIV....GF..IR...............F........KEGYYLI------------LIT
R4XDH4_TAPDE/83-393------------------C..GLI....GL..IR...............F........TANYYLS------------IIT
U7Q401_SPOS1/64-615------------------F..GIV....GL..IL.....VS.......K...........FSYLV------------SIT
Q6CIW0_KLULA/61-376------------------H..GFI....GL..IE.....LE......GS............IFIG------------TIT
Q171G2_AEDAE/58-344------------------C..GIL....GV..IK.....LI.......S...........GFHLV------------VMT
K0KUB6_WICCF/106-423------------------F..GLL....GF..IR...............F........TDCYYLC------------VVT
R4XES2_TAPDE/54-355------------------F..GIM....GI..SQ.....LK.......L...........DRYLL------------VIT
U5H2H4_USTV1/303-633------------------Y..GIV....GF..IR...............F........TDPYYIV------------LIK
U1HDN8_ENDPU/79-424------------------Q..GTL....GL..IT.....LN......ND............VFLC------------AII
A0A068X7S8_HYMMI/60-385------------------F..GIL....GT..IR.....LL.......S...........GRFLV------------TID
G4MSQ4_MAGO7/226-542------------------W..GLL....GF..IK...............F........TSHYYML------------LIT
V5FEA0_BYSSN/84-553------------------H..GIV....GL..LS.....VA.......S...........YSFLV------------SIT
A0A087ZZ41_APIME/60-348------------------W..GIV....GT..IR.....LL.......A...........CRYLI------------VIT
K1XWR0_MARBU/58-404------------------A..GIL....GT..IK.....LR.......L...........DKYII------------VIT
F4PK20_DICFS/141-569------------------C..AIL....GY..IV...............A........DRSAHLL------------VAT
T1I6W2_RHOPR/151-496------------------W..ILV...LGF..VR...............F........MEGYYMI------------LVT
M0ZMN6_SOLTU/66-352------------------F..GVI....GI..LK.....LL.......A...........GSYVL------------VIT
M4EQB3_BRARP/94-390------------------Y..GII....GF..VR...............F........LGPYYML------------VIK
A0A068YD93_ECHMU/53-484------------------E..GVL....GK..FQ.....CI......AN..........SNWHLL------------LIS
F4R4S1_MELLP/79-584------------------EFDGLV....GI..LK.....LF.......H...........DSYLI------------LIS
M2RI52_CERS8/45-553------------------Y..GLI....GI..LK.....LF.......S...........TSYLL------------VIS
H2VH91_CAEJA/48-364------------------E..FLV....GQ..LE.....IE.......E...........QNFLF------------FVT
A0A0D8JYP1_COCIM/278-596------------------W..GLL....GF..IK...............F........TGTYYML------------LVT
J4UQV1_BEAB2/229-548------------------W..GLL....GF..IR...............F........TGCYYML------------LIT
I2H1V7_TETBL/62-389------------------E..GFI....GL..VE.....IN......GL............IFIG------------TIT
N1JQ64_BLUG1/84-435------------------H..GTL....GL..IT.....IK......ND............IFLC------------VVS
M3BU07_SPHMS/13-351------------------Q..GTL....GL..VT.....VN......GD............VFLC------------VVN
G1XJC3_ARTOA/63-523------------------V..GIA....GL..LS.....VP.......S...........GSWLI------------AIT
E6ZYF2_SPORE/202-727------------------F..GIV....GL..SR.....FW.......S...........SSYLF------------VIT
H2AQU9_KAZAF/62-377------------------Y..GFI....GL..ID.....LQ......GL............VFIA------------AIT
F0XEY5_GROCL/231-602------------------W..GLL....GF..IR...............F........TGPYYMM------------LIT
R8BNS4_TOGMI/62-534------------------F..GII....GL..VT.....VS.......K...........FSYLV------------SIT
A0A0C4DL23_MAGP6/59-407------------------A..GIL....GI..IS.....LR.......L...........DKYVL------------IIT
E4X6F3_OIKDI/14-319------------------F..GII....GL..VR...............F........FNGYYLY------------HVK
M1ZIU8_LEPMJ/95-595------------------H..S.S....GL..LQ.....VA.......N...........SRFLI------------SIC
Q385L9_TRYB2/103-442------------------K..ALL....GC..VR...............F........TSGYYLL------------LAT
W1QK01_OGAPD/120-439------------------V..GLL....GF..IK...............F........TKHYYLC------------VVT
SYJ1_SCHPO/60-377------------------Y..GTL....GL..IE.....LE......GS............NFLC------------VIS
I1H036_BRADI/86-382------------------C..GII....GF..IK...............F........LGPYYML------------IIT
B4LY57_DROVI/49-415------------------H..GIV....GV..IS.....LP.......NV.........YEPHLV------------VIK
A7TNF4_VANPO/107-426------------------E..GLL....GF..IR...............F........TSCYYLV------------VIT
K9FLP7_PEND2/68-535------------------Y..GLI....GL..LS.....VA.......S...........YTFLV------------SIT
F0ZKL7_DICPU/414-728------------------Y..GIV....GI..IN.....LI.......S...........GPYLI------------VIT
F4WW49_ACREC/60-347------------------W..GLV....GT..IH.....LL.......A...........CRYLI------------VVT
L2FV04_COLGN/63-521------------------F..GVI....GL..IT.....VS.......R...........LSYLI------------TIT
G8C2D4_TETPH/116-435------------------Y..GLL....GF..IR...............F........TSCYYLI------------VIT
G3XS78_ASPNA/67-544------------------Y..GLV....GL..LS.....VA.......S...........YSFLI------------SIT
G1WY88_ARTOA/58-387------------------A..GIL....GM..IR.....LR.......L...........DKYLI------------VIT
G8BV77_TETPH/61-376------------------F..GFI....GL..IE.....VN......GL............IFIG------------TIV
G3B088_CANTC/166-495------------------Y..GLL....GL..IK...............F........TKGYYLS------------LIT
M9MGE9_PSEA3/199-726------------------S..GII....GL..SR.....FF.......N...........SSYLF------------VIT
K7KZM4_SOYBN/102-401------------------Y..GII....GF..IK...............F........LEPYYML------------LIT
G3BAP8_CANTC/60-400------------------S..GCL....GF..IN.....VD......NQ............VFIA------------VIT
G2YQB6_BOTF4/203-523------------------W..GIL....GF..IR...............F........TGCYYMH------------MIT
L8G0F1_PSED2/58-404------------------A..GIL....GM..IR.....LR.......L...........DKYII------------VIT
Q75AW5_ASHGO/111-428------------------H..GLL....GF..IR...............F........TDCYYLV------------VVT
A5DP81_PICGU/164-490------------------Y..GII....GL..IR...............F........TRGYYLS------------IIT
A0A0D2WLC0_CAPO3/58-346------------------A..ALL....GV..IH.....LL.......A...........GPYLL------------LIT
G8JU22_ERECY/65-378------------------K..GLL....GI..IQ.....VK......SL............VFIG------------LII
S8E0C2_FOMPI/117-659------------------Y..GIL....GI..FT.....LF.......T...........ASYLL------------VIT
U6GRB2_EIMAC/88-488------------------W..GVF....GV..................YAE.......PRGGCLL------------LIE
D8U819_VOLCA/63-369------------------L..GLL....GICKLQ..............K...........GVALV------------AIT
G9P9K2_HYPAI/65-411------------------S..GIL....GI..IQ.....LP.......L...........DKYVI------------IIS
M7X4J7_RHOT1/67-437------------------S..GCL....GV..LA.....VG......NE............TFLS------------IIT
D8LRT7_ECTSI/100-430------------------Y..GIV....GF..VR...............F........LDCYYLN------------FIT
G3VY24_SARHA/59-351------------------F..GIL....GT..IR.....LV.......A...........GSYLI------------VIT
D7SY24_VITVI/66-366------------------Y..GVV....GT..IR.....LL.......A...........GTYLL------------VIT
J3K3G0_COCIM/72-412------------------H..GTL....GL..LT.....LD......ND............VFLC------------VIS
T1HFL4_RHOPR/49-398------------------Y..GLV....GK..ID.....FQ.......ID.........GEYRLM------------LIK
A0A0C4DS40_MAGP6/107-438------------------Y..GTL....GL..LS.....IG......RD............VFIC------------VIT
M3CQW1_SPHMS/62-513------------------H..GIV....GL..LN.....LV.......S...........QSYLV------------TIT
M2R9E8_CERS8/164-483------------------F..GVA....GF..VK...............F........TAGWYMI------------VIA
B8M1Z6_TALSN/68-538------------------Y..GLV....GL..LN.....IA.......S...........SSFLI------------PIT
F4PHK8_DICFS/156-470------------------Y..GIL....GF..IQ...............F........LHGYYII------------LIT
Q0CU53_ASPTN/71-411------------------F..GTL....GL..VT.....LD......ED............VFLC------------VVT
M4A062_XIPMA/49-420------------------E..GVI....GK..IQ.....LH.......TD.........LPLGLV------------LIR
E3MX15_CAERE/70-362------------------Y..GIL....GT..IK.....LV.......S...........GYALI------------VIT
N1RGN0_FUSC4/63-520------------------F..GVI....GI..IA.....VS.......K...........LNYLV------------TIT
K7L1W1_SOYBN/70-357------------------Y..GVV....GT..IR.....LV.......V...........GTYAI------------VIT
E3M900_CAERE/50-368------------------E..FLI....GK..IS.....FE.......E...........KVYLF------------FVV
F4NY82_BATDJ/75-379------------------F..GIF....GF..VR...............F........LEGYYAI------------LIT
C7YR56_NECH7/63-519------------------F..GVI....GL..IT.....VS.......K...........LSYLI------------TIT
R7YKA2_CONA1/63-568------------------H..GIV....GL..LK.....IA.......S...........SSFLI------------SIS
A9TMN3_PHYPA/63-355------------------F..GLV....GI..LR.....LV.......AGK.......QYCAHAL------------VIT
Q5AFL6_CANAL/63-387------------------F..GCL....GL..IY.....VE......DQ............IYLA------------IIT
B6QBU1_TALMQ/301-783------------------Y..GLV....GL..LD.....IA.......S...........SSFLI------------PIT
Q4WZK2_ASPFU/222-540------------------W..ALL....GF..IR...............F........TGAYYML------------LVT
E0VJW7_PEDHC/61-431------------------Y..GII....GK..VQ.....ID.......SI.........VEPRLV------------LIK
Q22MH2_TETTS/82-382------------------S..GFL....GI..IN.....VL......GV............NFLV------------LVK
C5M8L2_CANTT/185-509------------------Y..GML....GL..IR...............F........TQGYYLC------------LIT
Q4Z2U3_PLABA/68-477------------------F..GCL....GI..IK.....AD.......N...........INFLV------------IVS
M0SB11_MUSAM/97-462------------------Y..GIA....GF..VK...............F........LGPYYML------------LIT
M3ASK6_PSEFD/76-415------------------Q..GTL....GM..VT.....IN......GD............VFLC------------VVN
M7TG37_EUTLA/64-558------------------F..GII....GF..FT.....VS.......R...........LSYLI------------SIT
C1MUH6_MICPC/47-416------------------D..ACL....GVVAVG..............D............AVLL------------LLA
B6JUS9_SCHJY/61-377------------------Y..GTL....GL..ID.....FD......GA............IFLC------------VIS
W1Q7N6_OGAPD/57-375------------------L..GFL....GL..IE.....MN......GN............VFLA------------VIT
I4YAK8_WALMC/63-352------------------Y..GVL....GI..IN.....LT.......T...........TPFLV------------VIS
F4NZ03_BATDJ/66-391------------------Y..GCL....GT..VT.....IE......ND............IFIS------------LVL
A0D6M4_PARTE/91-395------------------S..GII....GF..IK...............L........VQGYYVM------------FIK
G0SGL9_CHATD/94-625------------------F..GVV....GL..IR.....VF.......R...........HIYLV------------TIT
E4XH43_OIKDI/51-338------------------L..GLF....GM..IR.....LP.......S...........GNHLV------------VIK
G0SXZ0_RHOT2/87-545------------------D..CVA....GL..LV.....GF.......Q...........DSFLI------------VVT
M2Y276_DOTSN/75-414------------------Q..GTL....GL..VT.....VN......ND............VFLC------------VVN
Q22GV5_TETTS/98-414------------------Y..GIV....GF..YK...............F........LEGYYMV------------YIK
K1P4T1_CRAGI/90-396------------------F..GIA....GF..VR...............F........LEGYYVI------------LIT
H6BLM4_EXODN/81-424------------------K..GTL....GL..IT.....LN......ND............VFLC------------VIT
D2V1Q3_NAEGR/8-298------------------F..GIM....GI..VT.....LV.......S...........GPFLI------------VVL
S8AE10_DACHA/63-524------------------V..GIA....GL..LS.....VP.......S...........GSWLI------------AIT
A5DA48_PICGU/63-401------------------Y..GCL....GL..VS.....IE......KQ............TYLA------------VIT
F1A0H4_DICPU/55-340------------------K..GII....GI..IQ.....LV.......S...........GYYLM------------VFK
S8EEX6_FOMPI/66-403------------------R..GCL....GL..IS.....VS......NE............IFLV------------VIT
M1W422_CLAP2/65-409------------------A..GIL....GV..IQ.....LR.......L...........DKYVI------------IIN
A7TNA1_VANPO/61-376------------------F..GFI....GL..IE.....ID......GL............IFIG------------TII
B3RV87_TRIAD/12-299------------------F..GIF....GI..IH.....LI.......S...........CPYLI------------IIT
D8SNB9_SELML/62-371------------------Y..GIL....GM..IRLLAGMLLFSKVWTAFFFFFFRFARVSGTYIF------------VIT
I2H7F8_TETBL/109-428------------------Y..GLA....GF..IK...............F........TYCYYLI------------FIT
D8PSS9_SCHCM/115-618------------------Y..GLL....GS..LD.....LF.......S...........GAYVL------------VIT
G3JLG2_CORMM/92-437------------------Y..GTL....GL..MT.....AN......NE............VFLS------------VIT
M2R948_CERS8/66-409------------------R..GCL....GL..IS.....IS......ND............MFLA------------MIT
G0WCS7_NAUDC/75-411------------------H..GFI....GL..IE.....IN......NF............IFIG------------LIT
Q2UDW8_ASPOR/69-409------------------L..GTL....GL..IT.....LG......EE............VFLC------------IVT
K5WWD2_AGABU/576-898------------------Q..GLV....GF..IR...............F........TAGWYMV------------IIV
U1HUJ9_ENDPU/216-535------------------W..GLL....GF..LR...............F........TGAYYML------------FVT
A0A0H5SHC1_BRUMA/86-382------------------H..GIV....GI..IK.....LV.......S...........GNALI------------TIT
E1FIL7_LOALO/46-353------------------V..AFI....GK..IL.....VE.......N...........ECYLL------------VAV
T1KBK4_TETUR/62-349------------------Q..GIL....GI..IN.....LL.......A...........GPYLV------------VVT
Q5ATU2_EMENI/70-403------------------Y..GTL....GL..VT.....ID......HD............VFVC------------VVT
G0SHY3_CHATD/59-402------------------A..GIL....GV..IR.....LR.......L...........DKYVV------------LIT
A0A0D1E449_USTMA/198-726------------------F..GIV....GL..SR.....FF.......S...........SSYLF------------VIT
Q5K7Y1_CRYNJ/78-396------------------Y..GII....GI..LS.....LA.......T...........TDFLL------------IVT
J8Q038_SACAR/61-401------------------F..GFI....GL..IE.....IE......GL............IFIA------------AIT
V2X5P7_MONRO/66-402------------------K..GCL....GL..IS.....VE......NE............IFLA------------LVT
D8S829_SELML/70-359------------------Y..GVA....GA..IK.....LL.......A...........GLYIL------------VIT
F0XLR8_GROCL/64-599------------------F..GII....GL..IS.....LS.......K...........FSYLI------------SIT
H6BJX1_EXODN/58-406------------------A..GIL....GI..IK.....LK.......L...........DKYVI------------VIT
A5K2F0_PLAVS/71-474------------------F..GCL....GI..VK.....AE.......H...........TNFLV------------IVS
B0WKN6_CULQU/80-395------------------Y..GVL....GF..VK...............F........LEGYYLI------------LVT
Q6FNF7_CANGA/56-345------------------A..ALL....GF..IR.....LK.......L...........NKYAI------------IAD
G4MRY1_MAGO7/65-538------------------F..GIV....GV..IT.....VP.......P...........ESYLV------------SIT
C1H752_PARBA/186-504------------------W..GLL....GF..IR...............F........TGPYYML------------LVT
S8AUP9_PENO1/147-624------------------Y..GLV....GL..LS.....VA.......S...........YSFLV------------SIT
U1NXE9_ASCSU/95-406------------------F..GLA....GA..VR...............F........LEGYYIL------------LVT
U3IXX2_ANAPL/60-347------------------Y..GIL....GT..IR.....LV.......A...........GTYLI------------VIT
S3DBC9_GLAL2/200-519------------------W..GLL....GF..IR...............F........TGVYYML------------LIT
Q86HL0_DICDI/575-901------------------Y..GIV....GI..IN.....LL.......S...........GPYLI------------VIT
E4V272_ARTGP/62-525------------------H..GLI....GL..LS.....VA.......S...........YSFLI------------SIT
B6HA03_PENRW/68-535------------------C..GLV....GL..LS.....VA.......S...........YSFLV------------SIT
W4Y1R6_STRPU/56-343------------------C..GIM....GI..IK.....LL.......R...........GSYLV------------VIT
C5LTF6_PERM5/72-402------------------ALLGTIVVSSGN...............................AFLV------------LVS
G6D9G1_DANPL/49-444------------------E..GII....GK..VE.....HS.......NI.........YEPRLM------------IIK
U7Q403_SPOS1/102-445------------------Y..GTL....GL..IA.....VN......QD............VFLS------------VIT
Q54X05_DICDI/79-666------------------F..AIL....GY..II...............S........EKSSHLL------------VAT
Q6CPU6_KLULA/101-418------------------Y..GLL....GV..IR...............F........TACYYLV------------VIT
B7PMB2_IXOSC/95-407------------------F..GIV....GF..VR...............F........LEGYYMI------------LIT
M7T7L9_EUTLA/59-403------------------A..GIL....GI..IS.....LR.......L...........DKYVI------------VIT
F4NVB4_BATDJ/76-408------------------M..GVV....GL..LS.....LV.......Y...........GQYLV------------GIT
N1QAE4_PSEFD/58-405------------------S..GIL....GI..IK.....LR.......L...........DSYVI------------IIT
A9UU96_MONBE/2-308------------------....IF....VL..FQ...............SF.......LKGYYLI------------VVT
A0A0P8XTM3_DROAN/61-344------------------C..GVL....GT..IH.....LL.......S...........CDYLL------------VAT
S2JE51_MUCC1/52-350------------------Y..GLL....GF..IK.....LF.......A...........GDYML------------TIT
F4NY81_BATDJ/60-355------------------H..GIL....GI..IR.....LN.......A...........GDHIV------------VIS
L8FMK0_PSED2/82-421------------------Y..GTL....GL..IT.....VE......ND............VFIC------------IVT
S3CZT1_GLAL2/65-552------------------F..GVV....GL..LN.....VS.......N...........TSFLI------------SIT
A8NJH4_COPC7/86-404------------------F..GVA....GF..IK...............F........TAGWYMI------------LIS
T5AAR7_OPHSC/65-411------------------A..GIL....GI..VQ.....LR.......L...........DKYVV------------VIS
Q7RJM2_PLAYO/596-1033------------------K..TIN....GD..IKDLINNYYFNGSNYEDTE.......KRDSYFM------------GIK
M0U1B8_MUSAM/128-426------------------Y..GIV....GF..VK...............F........LGPYYML------------LIT
D8LLP5_ECTSI/180-623------------------D..GLF....GV..YD.....LL.......S...........GPFVA------------VIS
C5MI82_CANTT/58-366------------------F..GCL....GL..IY.....IS......QQ............IYLA------------VVT
K3WWY9_PYTUL/62-438------------------H..AVY....GI..YS.....LL.......S...........GPYLA------------VIQ
D8TDE9_SELML/56-341------------------Y..GVL....GA..VK.....LL.......T...........GTYVL------------VIT
U7PNF0_SPOS1/59-451------------------K..GIL....GM..IQ.....LR.......L...........DKYVI------------VIT
F8Q7H4_SERL3/120-629------------------Y..GIV....GI..LE.....LF.......S...........ASYLL------------VIT
G7YQE9_CLOSI/49-571------------------D..GVI....GK..LR.....YY......PD..........SPWRLF------------LIE
E1ZQ36_CHLVA/69-366------------------F..GVL....GIARLE..............A...........GPALV------------VIT
E9EHE6_METAQ/175-491------------------W..GII....GF..IK...............F........TGPYYML------------FIT
G0RDR8_HYPJQ/62-529------------------L..GVI....GL..IT.....VS.......R...........LTYLV------------TIT
Q2UQT5_ASPOR/66-523------------------F..GLV....GL..LT.....VA.......S...........YSFLI------------SVT
M2T548_COCSN/198-515------------------W..GLL....GF..IR...............F........TEAYYML------------LIS
B8MR04_TALSN/218-536------------------W..ALL....GF..VR...............F........TSAYYML------------LVT
A8Q3I3_MALGO/353-697------------------F..GIV....GF..VR...............F........TAGYYMV------------LIS
E1Z4S4_CHLVA/77-390------------------S..AIV....GV..VQ...............L........LEGPYLL------------LVT
U1HX54_ENDPU/57-401------------------A..GIL....GI..IK.....LK.......L...........DKYVI------------VIT
E9DSD9_METAQ/101-446------------------Y..GTL....GL..IS.....AN......GE............VFLS------------VIT
M4C4W1_HYAAE/255-562------------------V..AMV....GC..IR...............F........LRGYYFI------------FVT
A7ASJ0_BABBO/67-430------------------YADAIL....GLININ.........................RSLYLN------------VVV
A7TR63_VANPO/68-383------------------H..GFI....GL..IE.....ID......GL............VFIG------------TIT
B6H455_PENRW/59-404------------------A..GIL....GI..LK.....LK.......L...........DKYII------------VIT
A2R155_ASPNC/70-406------------------Y..GTL....GL..VT.....LD......DE............VFLC------------VVT
Q0UIC4_PHANO/636-953------------------W..GLL....GF..IR...............F........TEAYYML------------LIT
A0A0D2XAU6_FUSO4/65-411------------------A..GIL....GI..IQ.....LR.......L...........DKYVI------------FIT
B4JQR9_DROGR/85-407------------------Y..GVL....GF..VR...............F........LEGYYLV------------LVT
A0A125YG01_TOXGV/65-560------------------Y..GLF....GV..TQ.....IF.......G...........SAYLI------------CIS
K1WW52_MARBU/84-433------------------R..GTL....GL..IT.....IN......ND............VFLC------------VVT
C5DGY0_LACTC/61-377------------------H..GFI....GL..IE.....LE......GF............IFIC------------TIT

PF03162

YNF3_SCHPO/80-256--------------------------------------------------------------------------------
OCA6_YEAST/3-180--------------------------------------------------------------------------------
Q9U0Z9_LEIMA/398-559--------------------------------------------------------------------------------
OCA1_YEAST/67-236--------------------------------------------------------------------------------
OCA4_YEAST/62-220--------------------------------------------------------------------------------
Y1500_ARATH/53-215--------------------------------------------------------------------------------
SIW14_YEAST/116-280--------------------------------------------------------------------------------
OCA2_YEAST/3-169--------------------------------------------------------------------------------

PF13350

E9T5X0_RHOHA/81-325--------------------------------------------------------------------------------
A6T6R5_KLEP7/12-260--------------------------------------------------------------------------------
D4K940_9FIRM/333-585--------------------------------------------------------------------------------
Q82ML8_STRAW/10-265--------------------------------------------------------------------------------
A0QNM9_MYCS2/9-268--------------------------------------------------------------------------------
A1CBV7_ASPCL/27-276--------------------------------------------------------------------------------
D1ARM6_SEBTE/10-235--------------------------------------------------------------------------------
Q47PY0_THEFY/64-302--------------------------------------------------------------------------------
D9TDL5_MICAI/5-241--------------------------------------------------------------------------------
A5FUX1_ACICJ/2-255--------------------------------------------------------------------------------
Q1G872_LACDA/6-252--------------------------------------------------------------------------------
R7EFW7_9BACE/108-352--------------------------------------------------------------------------------
G0FRX0_AMYMS/1-250--------------------------------------------------------------------------------
A4FAM6_SACEN/7-242--------------------------------------------------------------------------------
Q185E4_PEPD6/1-246--------------------------------------------------------------------------------
Q8EMV0_OCEIH/13-243--------------------------------------------------------------------------------
Q8XJ09_CLOPE/79-332--------------------------------------------------------------------------------
G0FYB0_AMYMS/111-325--------------------------------------------------------------------------------
Y669_CUPNH/32-272--------------------------------------------------------------------------------
Q6BSM6_DEBHA/334-619--------------------------------------------------------------------------------
Q2H3W5_CHAGB/12-268--------------------------------------------------------------------------------
B4E7J5_BURCJ/46-292--------------------------------------------------------------------------------
Q03NX9_LACBA/62-314--------------------------------------------------------------------------------
D3VBS7_XENNA/12-260--------------------------------------------------------------------------------
E2PZ53_STRC2/19-274--------------------------------------------------------------------------------
C4Y7T2_CLAL4/371-653--------------------------------------------------------------------------------
R7D4X4_9FIRM/95-350--------------------------------------------------------------------------------
Q04DP2_OENOB/7-260--------------------------------------------------------------------------------
Q1WS71_LACS1/6-259--------------------------------------------------------------------------------
D0IYE3_COMT2/16-254--------------------------------------------------------------------------------
Q2J7B2_FRASC/1-245--------------------------------------------------------------------------------
A2FYW1_TRIVA/7-254--------------------------------------------------------------------------------
B5H4K5_STRPR/34-289--------------------------------------------------------------------------------
A1SQF4_NOCSJ/19-265--------------------------------------------------------------------------------
A4SW99_POLSQ/41-300--------------------------------------------------------------------------------
F2RJF7_STRVP/4-263--------------------------------------------------------------------------------
E8N8B3_MICTS/54-273--------------------------------------------------------------------------------
D9TEE3_MICAI/9-246--------------------------------------------------------------------------------
D4YX60_SPHJU/14-261--------------------------------------------------------------------------------
Q5AQS5_EMENI/18-272--------------------------------------------------------------------------------
W8VBL2_YEREN/12-265--------------------------------------------------------------------------------
R6K7N0_9BACE/108-352--------------------------------------------------------------------------------
Q2NBB0_ERYLH/7-258--------------------------------------------------------------------------------
D7GCQ3_PROFC/25-281--------------------------------------------------------------------------------
D5UQX9_TSUPD/1-244--------------------------------------------------------------------------------
C0ZYT8_RHOE4/49-269--------------------------------------------------------------------------------
F2I8X4_AERUA/3-235--------------------------------------------------------------------------------
G2SRY4_LACRR/1-254--------------------------------------------------------------------------------
E3IX14_FRASU/5-257--------------------------------------------------------------------------------
A5V7W0_SPHWW/16-277--------------------------------------------------------------------------------
Q5FHZ9_LACAC/7-257--------------------------------------------------------------------------------
Q0D202_ASPTN/36-281--------------------------------------------------------------------------------
D8QAJ5_SCHCM/11-261--------------------------------------------------------------------------------
C5DRB4_ZYGRC/374-639--------------------------------------------------------------------------------
V4IBR2_9ACTN/4-259--------------------------------------------------------------------------------
C0ZR41_RHOE4/10-265--------------------------------------------------------------------------------
Q1WR92_LACS1/8-263--------------------------------------------------------------------------------
A4X4B1_SALTO/17-252--------------------------------------------------------------------------------
R5R190_9FIRM/11-244--------------------------------------------------------------------------------
E9FC74_METRA/34-295--------------------------------------------------------------------------------
D1BJX8_SANKS/41-309--------------------------------------------------------------------------------
E9ESJ0_METRA/41-283--------------------------------------------------------------------------------
E4UT41_ARTGP/16-268--------------------------------------------------------------------------------
C0ZYF0_RHOE4/68-302--------------------------------------------------------------------------------
E4NFP1_KITSK/132-367--------------------------------------------------------------------------------
E3GQR7_EUBLK/9-245--------------------------------------------------------------------------------
D9R4N1_CLOSW/7-227--------------------------------------------------------------------------------
Q8Y5X0_LISMO/78-326--------------------------------------------------------------------------------
Q0C2M9_HYPNA/7-259--------------------------------------------------------------------------------
Q5FMM6_LACAC/10-266--------------------------------------------------------------------------------
D6CZI7_9BACE/108-353--------------------------------------------------------------------------------
C9A549_ENTCA/5-259--------------------------------------------------------------------------------
Q036B0_LACC3/6-262--------------------------------------------------------------------------------
Q033X0_LACC3/1-250--------------------------------------------------------------------------------
C0NGW7_AJECG/39-284--------------------------------------------------------------------------------
F5WQX8_ERYRF/1-242--------------------------------------------------------------------------------
A8G8B5_SERP5/12-260--------------------------------------------------------------------------------
D0L2R1_GORB4/12-270--------------------------------------------------------------------------------
B4RDR9_PHEZH/6-257--------------------------------------------------------------------------------
C7YRI4_NECH7/35-278--------------------------------------------------------------------------------
C7MQT5_SACVD/3-253--------------------------------------------------------------------------------
D2PLN7_KRIFD/10-240--------------------------------------------------------------------------------
E9T363_RHOHA/13-270--------------------------------------------------------------------------------
E6SDK7_INTC7/7-271--------------------------------------------------------------------------------
C6W152_DYAFD/64-316--------------------------------------------------------------------------------
Q03Q03_LACBA/76-297--------------------------------------------------------------------------------
A5VF96_SPHWW/104-349--------------------------------------------------------------------------------
C6XQ14_HIRBI/6-256--------------------------------------------------------------------------------
Q74LQ6_LACJO/10-266--------------------------------------------------------------------------------
Q03TS5_LACBA/7-264--------------------------------------------------------------------------------
C7QBN3_CATAD/19-253--------------------------------------------------------------------------------
E9T5X1_RHOHA/57-304--------------------------------------------------------------------------------
E1R7L9_SPISS/7-227--------------------------------------------------------------------------------
R6FZZ0_9FIRM/12-240--------------------------------------------------------------------------------
A5VM96_LACRD/8-263--------------------------------------------------------------------------------
F2N8T3_CORGP/30-270--------------------------------------------------------------------------------
R6VR32_9FIRM/7-245--------------------------------------------------------------------------------
A6LFZ6_PARD8/108-351--------------------------------------------------------------------------------
Q1GC11_LACDA/9-264--------------------------------------------------------------------------------
B1VMV2_STRGG/7-263--------------------------------------------------------------------------------
Q5LB73_BACFN/30-260--------------------------------------------------------------------------------
D3Q281_STANL/17-248--------------------------------------------------------------------------------
C0ZZF5_RHOE4/21-266--------------------------------------------------------------------------------
Q6AJA2_DESPS/33-282--------------------------------------------------------------------------------
D6Y3T5_THEBD/6-263--------------------------------------------------------------------------------
D1CIH8_THET1/11-246--------------------------------------------------------------------------------
D9T566_MICAI/6-265--------------------------------------------------------------------------------
F9US87_LACPL/1-247--------------------------------------------------------------------------------
C7RGV1_ANAPD/9-240--------------------------------------------------------------------------------
D2ARP8_STRRD/5-223--------------------------------------------------------------------------------
C6D6T4_PAESJ/11-261--------------------------------------------------------------------------------
Q04GW5_OENOB/7-259--------------------------------------------------------------------------------
C7PF99_CHIPD/28-269--------------------------------------------------------------------------------
G8PQS7_PSEUV/50-308--------------------------------------------------------------------------------
C0ZWU0_RHOE4/37-298--------------------------------------------------------------------------------
A5VME4_LACRD/7-260--------------------------------------------------------------------------------
Q6CBD6_YARLI/399-649--------------------------------------------------------------------------------
Q0S1R9_RHOJR/87-304--------------------------------------------------------------------------------
C4JST8_UNCRE/37-283--------------------------------------------------------------------------------
Q752H2_ASHGO/397-662--------------------------------------------------------------------------------
F5WUH9_ERYRF/1-251--------------------------------------------------------------------------------
Q2G5U2_NOVAD/7-261--------------------------------------------------------------------------------
A5DGM7_PICGU/335-615--------------------------------------------------------------------------------
F2RG23_STRVP/16-271--------------------------------------------------------------------------------
F3Z7Q4_9ACTN/23-278--------------------------------------------------------------------------------
C6WQQ9_ACTMD/112-345--------------------------------------------------------------------------------
Q2UG77_ASPOR/38-277--------------------------------------------------------------------------------
D7BYZ2_STRBB/13-268--------------------------------------------------------------------------------
Q7MZ78_PHOLL/12-260--------------------------------------------------------------------------------
Q6CPF1_KLULA/356-621--------------------------------------------------------------------------------
F2R3Z6_STRVP/5-244--------------------------------------------------------------------------------
F0XI08_GROCL/211-472--------------------------------------------------------------------------------
Q5YQK3_NOCFA/10-248--------------------------------------------------------------------------------
D6S3F4_9LACO/10-266--------------------------------------------------------------------------------
Q6DAR7_PECAS/12-260--------------------------------------------------------------------------------
A4X9J4_SALTO/6-265--------------------------------------------------------------------------------
C5GJJ3_AJEDR/10-263--------------------------------------------------------------------------------
C5DFC4_LACTC/350-613--------------------------------------------------------------------------------
A5UVJ7_ROSS1/8-243--------------------------------------------------------------------------------
E0S1S1_BUTPB/212-437--------------------------------------------------------------------------------
D6X883_STRPR/4-264--------------------------------------------------------------------------------
C7Q4Y5_CATAD/4-228--------------------------------------------------------------------------------
C6CXY5_PAESJ/14-250--------------------------------------------------------------------------------
F9URK9_LACPL/11-267--------------------------------------------------------------------------------
A8NYE3_COPC7/24-276--------------------------------------------------------------------------------
A7TQ59_VANPO/366-638--------------------------------------------------------------------------------
Q89MM7_BRADU/9-246--------------------------------------------------------------------------------
R5CAC0_9FIRM/93-348--------------------------------------------------------------------------------
E9D9N7_COCPS/41-287--------------------------------------------------------------------------------
D4MTX1_ANAHA/4-256--------------------------------------------------------------------------------
B8DWE7_BIFA0/8-251--------------------------------------------------------------------------------
Q6MPS3_BDEBA/1-249--------------------------------------------------------------------------------
Q0BU45_GRABC/14-254--------------------------------------------------------------------------------
A8L360_FRASN/22-269--------------------------------------------------------------------------------
E9T131_RHOHA/41-275--------------------------------------------------------------------------------
C7N3J9_SLAHD/11-269--------------------------------------------------------------------------------
E3IY94_FRASU/26-299--------------------------------------------------------------------------------
Q2J949_FRASC/31-266--------------------------------------------------------------------------------
D3Q8Q6_STANL/7-262--------------------------------------------------------------------------------
E8NB10_MICTS/3-236--------------------------------------------------------------------------------
D7B332_NOCDD/12-265--------------------------------------------------------------------------------
R6WSD4_9PORP/110-354--------------------------------------------------------------------------------
Q5Z372_NOCFA/73-330--------------------------------------------------------------------------------
Q837I3_ENTFA/1-249--------------------------------------------------------------------------------
E2SBJ5_9ACTN/1-228--------------------------------------------------------------------------------
B1ML15_MYCA9/15-276--------------------------------------------------------------------------------
Q4QBX1_LEIMA/8-252--------------------------------------------------------------------------------
A5V449_SPHWW/42-306--------------------------------------------------------------------------------
B0RGK3_CLAMS/55-275--------------------------------------------------------------------------------
D4LM77_9FIRM/95-346--------------------------------------------------------------------------------
Q38Z00_LACSS/8-265--------------------------------------------------------------------------------
D0LBL7_GORB4/46-264--------------------------------------------------------------------------------
D4K261_9FIRM/333-586--------------------------------------------------------------------------------
D5G972_TUBMM/23-279--------------------------------------------------------------------------------
Q82PC9_STRAW/5-245--------------------------------------------------------------------------------
D9QLA9_BRESC/6-259--------------------------------------------------------------------------------
B1VTU1_STRGG/9-264--------------------------------------------------------------------------------
Q6AJA3_DESPS/33-292--------------------------------------------------------------------------------
Q1G875_LACDA/17-265--------------------------------------------------------------------------------
Q74HI5_LACJO/7-258--------------------------------------------------------------------------------
A8FDZ3_BACP2/6-257--------------------------------------------------------------------------------
D6ZCQ9_SEGRD/35-285--------------------------------------------------------------------------------
C7MM04_CRYCD/2-255--------------------------------------------------------------------------------
Q2G3Q6_NOVAD/42-292--------------------------------------------------------------------------------
D8PJU6_SCHCM/23-275--------------------------------------------------------------------------------
D1CHG9_THET1/7-244--------------------------------------------------------------------------------
Q099H2_STIAD/12-265--------------------------------------------------------------------------------
C4R0W7_KOMPG/332-602--------------------------------------------------------------------------------
E3QF10_COLGM/18-282--------------------------------------------------------------------------------
Q9CEK1_LACLA/1-245--------------------------------------------------------------------------------
Q03H83_PEDPA/7-263--------------------------------------------------------------------------------
B8MD83_TALSN/42-300--------------------------------------------------------------------------------
Q0ASN4_MARMM/5-255--------------------------------------------------------------------------------
Q1LQX9_CUPMC/38-278--------------------------------------------------------------------------------
A2SP34_METPP/1-237--------------------------------------------------------------------------------
A7F170_SCLS1/15-271--------------------------------------------------------------------------------
B2HLU1_MYCMM/6-276--------------------------------------------------------------------------------
E6SMS6_BACT6/108-352--------------------------------------------------------------------------------
C0ZL96_RHOE4/58-311--------------------------------------------------------------------------------
C0ZRI9_RHOE4/63-310--------------------------------------------------------------------------------
D5ULT5_CELFN/46-302--------------------------------------------------------------------------------
Q38ZB6_LACSS/6-262--------------------------------------------------------------------------------
D2QHX9_SPILD/32-275--------------------------------------------------------------------------------
B4EWC6_PROMH/12-260--------------------------------------------------------------------------------
C8WJC8_EGGLE/31-290--------------------------------------------------------------------------------
A1TVR0_ACIAC/8-246--------------------------------------------------------------------------------
C2X0Y4_BACCE/98-348--------------------------------------------------------------------------------
C8XE08_NAKMY/7-249--------------------------------------------------------------------------------
E4NDQ8_KITSK/19-243--------------------------------------------------------------------------------
D4LU94_9FIRM/95-350--------------------------------------------------------------------------------
A9BQC1_DELAS/36-274--------------------------------------------------------------------------------
Q5LIW3_BACFN/108-351--------------------------------------------------------------------------------
Q1GTR8_SPHAL/9-261--------------------------------------------------------------------------------
K0HYW0_9BURK/11-249--------------------------------------------------------------------------------
G2SRM1_LACRR/8-261--------------------------------------------------------------------------------
E9DC06_COCPS/15-267--------------------------------------------------------------------------------
Q6BTL3_DEBHA/324-606--------------------------------------------------------------------------------
E3QK75_COLGM/39-281--------------------------------------------------------------------------------
Q74HM0_LACJO/7-261--------------------------------------------------------------------------------
Q0S331_RHOJR/4-261--------------------------------------------------------------------------------
D1A3M0_THECD/94-341--------------------------------------------------------------------------------
D3EZY0_CONWI/13-271--------------------------------------------------------------------------------
C9A985_ENTCA/5-233--------------------------------------------------------------------------------
C7YNH4_NECH7/9-263--------------------------------------------------------------------------------
D5ELA1_CORAD/7-258--------------------------------------------------------------------------------
D6S2F7_9LACO/6-260--------------------------------------------------------------------------------
Q215M3_RHOPB/9-249--------------------------------------------------------------------------------
Q03P16_LACBA/45-256--------------------------------------------------------------------------------
B0CXN9_LACBS/22-274--------------------------------------------------------------------------------
Q0SFJ4_RHOJR/74-321--------------------------------------------------------------------------------
Q1G8A2_LACDA/6-259--------------------------------------------------------------------------------
Q38ZP0_LACSS/6-262--------------------------------------------------------------------------------
A8L7R7_FRASN/5-251--------------------------------------------------------------------------------
A4X2U1_SALTO/27-253--------------------------------------------------------------------------------
Q03Q47_LACBA/6-261--------------------------------------------------------------------------------
B9THB6_RICCO/25-274--------------------------------------------------------------------------------
B2JI11_PARP8/75-321--------------------------------------------------------------------------------
C6CR88_PAESJ/127-376--------------------------------------------------------------------------------
B0SYG0_CAUSK/6-257--------------------------------------------------------------------------------
D2PUS2_KRIFD/4-236--------------------------------------------------------------------------------
E0SLI9_DICD3/12-260--------------------------------------------------------------------------------
Q03H84_PEDPA/7-259--------------------------------------------------------------------------------
C7QFP3_CATAD/5-243--------------------------------------------------------------------------------
Q0RP91_FRAAA/25-264--------------------------------------------------------------------------------
R7CLZ0_9FIRM/95-350--------------------------------------------------------------------------------
E3GPJ0_EUBLK/71-318--------------------------------------------------------------------------------
E3J517_FRASU/11-255--------------------------------------------------------------------------------
A8L1T3_FRASN/11-255--------------------------------------------------------------------------------
B6GYK5_PENRW/34-284--------------------------------------------------------------------------------
C0ZQ41_RHOE4/12-244--------------------------------------------------------------------------------
D2S5X4_GEOOG/17-283--------------------------------------------------------------------------------
C8V371_EMENI/34-281--------------------------------------------------------------------------------
F2RHW5_STRVP/42-300--------------------------------------------------------------------------------
Q0RE18_FRAAA/5-251--------------------------------------------------------------------------------
V4J3P9_9ACTN/10-268--------------------------------------------------------------------------------
Q4Q3Q1_LEIMA/11-258--------------------------------------------------------------------------------
C9ABV6_ENTCA/6-260--------------------------------------------------------------------------------
C7QCX6_CATAD/4-219--------------------------------------------------------------------------------

PF04273

Q9A9Q0_CAUCR/3-111--------------------------------------------------------------------------------
BLH_XYLFA/2-111--------------------------------------------------------------------------------
Q98J12_RHILO/2-111--------------------------------------------------------------------------------
Q983I8_RHILO/2-111--------------------------------------------------------------------------------
D5AUD0_RHOCB/2-109--------------------------------------------------------------------------------

PF00581

Q3UQ26_MOUSE/92-215--------------------------------------------------------------------------------
UBP7_YEAST/319-444--------------------------------------------------------------------------------
A6DRQ7_9BACT/39-134--------------------------------------------------------------------------------
Q7RS06_PLAYO/48-151--------------------------------------------------------------------------------
A6Q9B1_SULNB/104-220--------------------------------------------------------------------------------
Q0S745_RHOJR/147-268--------------------------------------------------------------------------------
A6Q7I9_SULNB/15-111--------------------------------------------------------------------------------
A2W0V1_9BURK/34-136--------------------------------------------------------------------------------
UBP4_ASHGO/163-290--------------------------------------------------------------------------------
A6ZRA1_YEAS7/148-277--------------------------------------------------------------------------------
PYP1_SCHPO/41-159--------------------------------------------------------------------------------
Q2GUP8_CHAGB/320-441--------------------------------------------------------------------------------
PTP3_YEAST/99-226--------------------------------------------------------------------------------
PYP2_SCHPO/13-124--------------------------------------------------------------------------------
A8BJL6_GIAIC/25-144--------------------------------------------------------------------------------
Q5V0H7_HALMA/7-124--------------------------------------------------------------------------------
A0LFK9_SYNFM/381-492--------------------------------------------------------------------------------
Q6Q1E2_9FIRM/37-149--------------------------------------------------------------------------------
A4YDN1_METS5/6-113--------------------------------------------------------------------------------
Q6APH8_DESPS/54-166--------------------------------------------------------------------------------
A5GEA5_GEOUR/46-159--------------------------------------------------------------------------------
A0A0E8MSC5_MYCTX/46-156--------------------------------------------------------------------------------
Q1ZSD2_PHOAS/164-271--------------------------------------------------------------------------------
Q2S417_SALRD/398-522--------------------------------------------------------------------------------
A6UVI6_META3/92-215--------------------------------------------------------------------------------
Q79HS1_WOLSU/43-148--------------------------------------------------------------------------------
B8FP35_DESHD/222-317--------------------------------------------------------------------------------
A4ARX6_MARSH/58-153--------------------------------------------------------------------------------
A0LFK9_SYNFM/238-331--------------------------------------------------------------------------------
Q5ZT59_LEGPH/41-131--------------------------------------------------------------------------------
Q7CPH6_SALTY/41-135--------------------------------------------------------------------------------
Q1JVT3_DESAC/182-288--------------------------------------------------------------------------------
Q14PT6_SPICI/14-105--------------------------------------------------------------------------------
Q4RJE9_TETNG/806-939--------------------------------------------------------------------------------
A2SM11_METPP/221-317--------------------------------------------------------------------------------
Q9HKF8_THEAC/96-184--------------------------------------------------------------------------------
A0DUQ2_PARTE/119-217--------------------------------------------------------------------------------
CE41A_XENLA/168-268--------------------------------------------------------------------------------
A6H0K8_FLAPJ/365-456--------------------------------------------------------------------------------
Q5ZV71_LEGPH/281-372--------------------------------------------------------------------------------
A8G773_PROM2/285-378--------------------------------------------------------------------------------
A5CVJ0_VESOH/26-121--------------------------------------------------------------------------------
Q5HKB3_STAEQ/351-442--------------------------------------------------------------------------------
Q2ST45_MYCCT/8-101--------------------------------------------------------------------------------
A4ADQ3_9GAMM/250-346--------------------------------------------------------------------------------
A5GWB7_SYNR3/27-124--------------------------------------------------------------------------------
Q8FSR3_COREF/397-486--------------------------------------------------------------------------------
Q5KY63_GEOKA/370-461--------------------------------------------------------------------------------
Q21SC0_RHOFT/40-138--------------------------------------------------------------------------------
Q6W140_SINFN/664-759--------------------------------------------------------------------------------
D4FJ51_STAEP/34-123--------------------------------------------------------------------------------
A3YZ19_9SYNE/28-121--------------------------------------------------------------------------------
DIN1_RAPSA/74-177--------------------------------------------------------------------------------
UBA4_KLULA/334-436--------------------------------------------------------------------------------
Q9A4H1_CAUCR/10-101--------------------------------------------------------------------------------
C1DFE4_AZOVD/270-360--------------------------------------------------------------------------------
A6ERQ8_9BACT/41-135--------------------------------------------------------------------------------
Q14BE0_MOUSE/63-178--------------------------------------------------------------------------------
MOEB_PYRYE/276-370--------------------------------------------------------------------------------
A7SQG4_NEMVE/62-168--------------------------------------------------------------------------------
A0A0D1CKZ8_USTMA/79-181--------------------------------------------------------------------------------
A4ARX3_MARSH/58-152--------------------------------------------------------------------------------
Q97TR5_CLOAB/14-103--------------------------------------------------------------------------------
Q99IY6_9BACT/162-268--------------------------------------------------------------------------------
A3JNH0_9RHOB/144-234--------------------------------------------------------------------------------
A4P043_HAEIF/7-97--------------------------------------------------------------------------------
Q65H01_BACLD/7-107--------------------------------------------------------------------------------
Q1V0S6_PELUQ/18-119--------------------------------------------------------------------------------
A6F9M6_9GAMM/22-116--------------------------------------------------------------------------------
A3W0C4_9RHOB/45-145--------------------------------------------------------------------------------
A4YZA0_BRASO/20-119--------------------------------------------------------------------------------
A4SWZ6_POLSQ/197-315--------------------------------------------------------------------------------
YPSL_SYNEL/8-105--------------------------------------------------------------------------------
Q3UB30_MOUSE/23-142--------------------------------------------------------------------------------
A8MLP3_ALKOO/6-124--------------------------------------------------------------------------------
A3I8D3_9BACI/4-124--------------------------------------------------------------------------------
Q4DV84_TRYCC/37-153--------------------------------------------------------------------------------
A0LIE9_SYNFM/201-298--------------------------------------------------------------------------------
A0ZKG4_NODSP/153-275--------------------------------------------------------------------------------
Q4H3P4_CIOIN/10-132--------------------------------------------------------------------------------
DUS2_HUMAN/14-138--------------------------------------------------------------------------------
Q13649_HUMAN/50-170--------------------------------------------------------------------------------
A0RUH8_CENSY/140-246--------------------------------------------------------------------------------
A5G4J8_GEOUR/39-135--------------------------------------------------------------------------------
A0C532_PARTE/163-271--------------------------------------------------------------------------------
Q3UMM5_MOUSE/11-131--------------------------------------------------------------------------------
Q1N257_9GAMM/148-263--------------------------------------------------------------------------------
A0L4Y3_MAGMM/160-274--------------------------------------------------------------------------------
Q8YQB5_NOSS1/164-277--------------------------------------------------------------------------------
Q2SDR5_HAHCH/155-271--------------------------------------------------------------------------------
B9LNB2_HALLT/200-323--------------------------------------------------------------------------------
Q8YQ45_NOSS1/19-112--------------------------------------------------------------------------------
U5LJ54_9BACI/173-289--------------------------------------------------------------------------------
B3EJ38_CHLPB/8-115--------------------------------------------------------------------------------
Q0IM09_ORYSJ/261-378--------------------------------------------------------------------------------
A0B705_METTP/164-279--------------------------------------------------------------------------------
A5EER6_BRASB/151-263--------------------------------------------------------------------------------
A7H0S5_CAMC5/36-127--------------------------------------------------------------------------------
Q315B7_DESAG/88-191--------------------------------------------------------------------------------
A6Q5F5_NITSB/6-109--------------------------------------------------------------------------------
A2FS10_TRIVA/10-117--------------------------------------------------------------------------------
Q1A5X4_PTEVI/11-119--------------------------------------------------------------------------------
A5DGW6_PICGU/15-119--------------------------------------------------------------------------------
A2G462_TRIVA/58-168--------------------------------------------------------------------------------
MPIP_SCHPO/422-527--------------------------------------------------------------------------------
A8WPE1_CAEBR/64-173--------------------------------------------------------------------------------
Q2H1E1_CHAGB/18-128--------------------------------------------------------------------------------
A6Q615_NITSB/27-142--------------------------------------------------------------------------------
A0A090M8W4_OSTTA/62-164--------------------------------------------------------------------------------
A5D3B0_PELTS/64-178--------------------------------------------------------------------------------
Q1NX08_9DELT/38-134--------------------------------------------------------------------------------
Q3M5Q3_ANAVT/51-164--------------------------------------------------------------------------------
Q30TU2_SULDN/21-134--------------------------------------------------------------------------------
Q31H13_THICR/25-133--------------------------------------------------------------------------------
D5B939_ZUNPS/260-354--------------------------------------------------------------------------------
Q2T7N9_BURTA/15-135--------------------------------------------------------------------------------
Q18C56_PEPD6/6-129--------------------------------------------------------------------------------
Q2SQQ3_HAHCH/41-139--------------------------------------------------------------------------------
THT2_CAEEL/12-156--------------------------------------------------------------------------------
A8XWD8_CAEBR/8-147--------------------------------------------------------------------------------
Q92UU7_RHIME/29-150--------------------------------------------------------------------------------
A4WTF3_RHOS5/29-148--------------------------------------------------------------------------------
Q87VI1_PSESM/12-123--------------------------------------------------------------------------------
B3EN19_CHLPB/61-161--------------------------------------------------------------------------------
A3KIP2_STRAM/342-438--------------------------------------------------------------------------------
Q18FK5_HALWD/10-106--------------------------------------------------------------------------------
A7BRE1_9GAMM/28-117--------------------------------------------------------------------------------
A4YEV3_METS5/22-109--------------------------------------------------------------------------------
A5DMM8_PICGU/110-238--------------------------------------------------------------------------------
A4RQH3_OSTLU/25-155--------------------------------------------------------------------------------
Q7NLN3_GLOVI/208-308--------------------------------------------------------------------------------
R7G243_9FIRM/6-94--------------------------------------------------------------------------------
A1K7U1_AZOSB/23-116--------------------------------------------------------------------------------
Q10W62_TRIEI/22-136--------------------------------------------------------------------------------
Q64AN8_9ARCH/226-334--------------------------------------------------------------------------------
A7HA14_ANADF/61-157--------------------------------------------------------------------------------
B9LNB2_HALLT/62-175--------------------------------------------------------------------------------
Q6ANQ7_DESPS/26-124--------------------------------------------------------------------------------
A9WET4_CHLAA/163-266--------------------------------------------------------------------------------
Q1K257_DESAC/30-123--------------------------------------------------------------------------------
Q926L9_LISIN/458-550--------------------------------------------------------------------------------
D2ADU7_SHIF2/20-111--------------------------------------------------------------------------------

PF00102

O01555_CAEEL/93-327V......................K..........FPGLASD..YIHANYL...................GTAT.N...PK
PTPR_CAEEL/1160-1401L.....................P...........PTIGHADSSYINASHI...................KGYF......F
PTN14_MOUSE/935-1181L................................IPTKENNT.GYINASHI...................KVVV.GG.SEW
Q9U1Q9_CAEEL/1009-1238V.................................IVNGQRV..PIHANWV...................PTPG.H...PH
PTPRC_MOUSE/664-898LS....................E.I........NGDAG.ST..YINASYI...................DGFK.E...PR
O01913_CAEEL/714-963M.....................S..........SDQPDDCD..FYDACHVFPWQ..........EVFEKVAHK.Y...KN
PTPRO_HUMAN/962-1194LV....................S..........MNEEEGAD..YINANYI...................PGYN.S...PQ
PTN12_MOUSE/58-292LT....................L..........KTPSQDSD..YINANFI...................KGVY.G...PK
PTN2_HUMAN/42-274LQ....................N..........A...E.ND..YINASLV...................DIEE.A...QR
Q9W324_DROME/532-778LA....................H.E........DGDEP.SD..YINANFV...................DGYK.Q...KN
PTN13_HUMAN/2237-2466L................................GDEGG.....YINASFI...................KIPVGK..EEF
O17889_CAEEL/879-1129L................................VGFPDP....FINANVM....................KFG.....EI
PTN22_HUMAN/54-288LS....................L.I........TSDED.SS..YINANFI...................KGVY.G...PK
Q18652_CAEEL/243-468L......................................TDSSYIHANWV...................DLNS.....SK
P91568_CAEEL/223-451L....................................TDDPHFYIHANLV....................SSGPN...PR
PTN7_HUMAN/119-349LG....................R.A........QSQED.GD..YINANYI...................RGYDGK...EK
PYP1_SCHPO/295-538L.................................KRTSPSELDYINASFI...................KTE......TS
PTPRF_RAT/1655-1888LQ....................P.I........RGVEG.SD..YINASFL...................DGYR.Q...QK
PTPRE_MOUSE/450-687LS....................M.K........RGQEF.TD..YINASFI...................DGYR.Q...KD
PYP2_SCHPO/458-697L................................AVPKGCSD..YINASHI.........................DVGNK
O01736_CAEEL/142-375L................................QNRPPDND..FIHANWM.....................TMPD...KF
PTPRT_HUMAN/1202-1436L.................................ISVDGESSNYINAALM...................DSHKQ....PA
P91498_CAEEL/98-327L.....................K..........WPEDSPSD..YIHANWV........................KINGAN
PTN9_HUMAN/327-573LT....................K.R........SGHTQ.TD..YINASFM...................DGYK.Q...KN
PTPRV_RAT/1174-1408LT....................Q.L........PGEPH.SD..YINANFI...................PGYS.H...TQ
PTN3_HUMAN/670-900L................................QGNE...D..YINASYVNM...............EIPAAN.L...VN
PTPRZ_RAT/1751-1992LTQ..................LA.E........KDGKL.TD..YINANYV...................DGYN.R...PK
LAR_DROME/1497-1728LP....................A.V........EGVVG.SD..YINANYC...................DGYR.K...HN
PTPRK_HUMAN/1200-1434L.................................ITIDGESSNYINAALM...................DSYRQ....PA
PTP99_DROME/789-1015L................................TPKPGEDGSDYINASWL...................HGFRR....LR
Q20108_CAEEL/150-375L.................................KDGYPGD..YVHANYV...................KGT......KP
PTPRG_CHICK/1152-1386L................................APLPGMKGTDYINASYI...................MGYYR....SN
LAR_CAEEL/1670-1901LS....................N.V........EGYPG.MD..YINANYV...................DGYD.K...PR
PTN5_HUMAN/322-554LT....................S.P........DPDDPLSS..YINANYI...................RGYGGE...EK
PTP3_DICDI/470-714LT....................P..........I.ESGDGD..YINANYI...................NGEVPN..SYR
O01435_CAEEL/295-520I....................................DDDPDFYIHANIV....................SSA.K...YR
Q21297_CAEEL/18-256L.................................GGAWPHE..YIHANYV....................STPTN...PK
O44901_CAEEL/79-316L.................................HPPWPHD..YIHANFV....................STPSN...PR
Q20252_CAEEL/164-398G....................................GGEADFFYHGSTL...................TIPSVT...TK
Q22668_CAEEL/151-376L.................................SDGGDGD..YIHANYV...................NGL......NA
PYP3_SCHPO/49-291L.....................D..........PMWKEACD..YINASIV...................KIPS.....GK
Q20402_CAEEL/237-513LNDGLGRLDDRNELRNGMFSDEHEFLQEEGYTAKSTYGTTD..FIHANYV...................KGGP.L...LN
O01556_CAEEL/90-324L................................TTDGASSD..YIHANYV....................GISIK...PK
PTPRA_HUMAN/558-790IP....................V.K........RGEEN.TD..YVNASFI...................DGYR.Q...KD
PTPRK_HUMAN/910-1140LQ....................P.V........EDDPS.SD..YINANYI...................DGYQ.R...PS
Q9W4F5_DROME/1353-1583LQ....................P.V........DDDDG.SD..YINANYM...................PGHN.S...PR
Q22158_CAEEL/87-334A...................................VHRQGHNYLNSSWI.......................DGYRETR
PTP61_DROME/60-295LK....................R..........G...S.VD..YINANLV...................QLER.A...ER
P91147_CAEEL/72-332C.....................................GSDEEFFPGQYV......................RME...GA
PTP1_CAEEL/777-1010L................................QASPS.GD..YINANYVNM...............EIPSSG.I...VN
PTP69_DROME/917-1155LA....................V.I........NGLQT.TD..YINANFV...................IGYK.E...RK
PTN6_MOUSE/270-514LQ...................GR.D........SNIPG.SD..YINANYVKNQL...........LGPDENS.......K
PTN20_MOUSE/189-417L...................................GKNKD..YINASYI...................RIVNHE..EEY
PTPRN_RAT/738-972LK....................V.E........SSPSR.SD..YINASPI...................IEHDPR...MP
PTP2_YEAST/408-736LPHSPKPPAVSEASTTETKTDKSYPMCP.VDAKNHSCKPND..YINANYL...................KLTQIN..PDF
PTPRM_HUMAN/1213-1447L.................................ITIDGESSNYINAALM...................DSYKQ....PS
PTN18_HUMAN/56-290LS....................L.L........QEEGH.SD..YINGNFI...................RGVD.G...SL
Q22852_CAEEL/84-312L................................KERDPSND..YIHASWM.....................VMPD...GF
Q18385_CAEEL/174-407L...................................ADPNIVYYIHANHI.......................MFDHLKK
PTPRZ_RAT/2049-2282I................................SSLSG.EGTDYINASYI...................MGYYQ....SN
PTP1_ARATH/87-325LN...................PC.K........D..SSAKG..YVNASLI..................KTSESES...IS
PTN1_RAT/40-276LH....................Q..........E...D.ND..YINASLI...................KMEE.A...QR
O01923_CAEEL/808-1045L................................KDYGTLFNDDYIHANRV........................TCSHGL
Q9XWA6_CAEEL/1194-1423V................................MDNGKRVP...IHANWI...................PTHGH....PH
Q9VUH6_DROME/1557-1788L....................................DKQTDDYINAAYM......................KNLSAGCP
PTP99_DROME/502-740LHP..................TP.G........QK.KN.LD..YINANFI...................DGYQ.K...GH
PTPRG_CHICK/851-1095LRP..................LP.G........KDSKH.SD..YINANYV...................SGYN.K...AK
PTN23_RAT/1080-1306L..................................RSGKDD..YINASCV...................EGLSPY...CP
PTP69_DROME/1213-1449L................................TPLPMRENSTYINASFI...................EGYD.N...SE
Q9VJ95_DROME/428-672L................................TSFQGNAFTDYINSVFV...................DGYTK....PR
O45095_CAEEL/243-500L.................................NRPGHEDVNYINASVITLTDVCRRMACVPAYVHLVVLYFVIFQFEH
Q9VJ95_DROME/125-368LE....................K.V........GGLQD.SD..YVNASYV...................DSLL.K...PN
Q20179_CAEEL/225-455L......................................SDSSYIHASYL...................ELDT.....QK
PTPRU_MOUSE/913-1143LH....................P.M........LADPD.AD..YISANYI...................DGYH.R...SN
O44180_CAEEL/290-520LK....................F.K........MPNKNSTD..YIHANYI...................RSPF.L...KR
Q18301_CAEEL/158-391V....................................QMCKDDYINGSKI.......................NVPHFTP
O61789_CAEEL/432-660L................................QFPRGQYLGDFIHANRI...................SGKPLF....N
PTPRM_HUMAN/923-1153LQ....................T.I........EGDTN.SD..YINGNYI...................DGYH.R...PN
PTPRJ_CHICK/1134-1366LS....................N..........PSCTT.DD..YINANYM...................PGYS.S...KK
O45079_CAEEL/180-408N....................................PAQPDSYVNMSSV.......................IVPHCRY
O17840_CAEEL/203-436L..................................KNHDRD..YIHASWM...................RMPGKD...QS
LAR_CAEEL/1958-2191MR....................L.L........PGADG.SD..YINASWI...................DGYK.E...RG
PTN21_RAT/922-1167LV....................P..........TKENN.TG..YINASHIKV...............SVSGIE.W...D.
B4JBQ7_DROGR/1040-1276L................................TPSMDNRH.GYVNASYI...................SATVGT..KQR
F1NVB1_CHICK/901-1159IRSEEEQSK......EGEHDSED.SSD....EDSDCEESSR..YINASFI...................TGYW.G...PK
F1P3M5_CHICK/271-506LT....................P.V........EGVPD.SD..YINASFI...................NGYQ.E...KN
F6ZV27_ORNAN/52-283LL....................P.I........EGLVG.SD..YINANYI...................DGYR.K...QN
F7BMX4_XENTR/425-671LG....................L..........VGTDETTD..YINASFM...................DDYK.R...KN
G1QLI5_NOMLE/189-423LK....................A..........ENSHSHSD..YINASPI...................MDHDPR...NP
I1LD92_SOYBN/86-325LK...................SS.T........DYRPEAQG..YINASLV...................STSS.AG.NVS
M3WBW9_FELCA/273-519LH....................D.G........DPNEPVSD..YINANIIMPEF...........ETKCNNSK.P...KK
PTN20_HUMAN/183-411L...................................GKSKD..YINASYI...................RIVNCG..EEY
PTN4_MOUSE/679-909L...................................KGNED..YINANYI...................NMEIPSSSIIN
S4R1M0_MOUSE/794-1051LKHELEMSK......ESEPESDE.SSD....DDSDSEETSK..YINASFV...................MSYW.K...PE

PF00782

Q22707_CAEEL/65-203--------------------------------------------------------------------------------
Q19388_CAEEL/18-146--------------------------------------------------------------------------------
DUS5_HUMAN/186-316--------------------------------------------------------------------------------
VHP1_CAEEL/183-315--------------------------------------------------------------------------------
STYX_MOUSE/36-168--------------------------------------------------------------------------------
CDC14_YEAST/198-335--------------------------------------------------------------------------------
DUS1_HUMAN/181-311--------------------------------------------------------------------------------
DUS2_HUMAN/180-310--------------------------------------------------------------------------------
DUS3_HUMAN/37-176--------------------------------------------------------------------------------
DUS6_HUMAN/214-346--------------------------------------------------------------------------------
MSG5_YEAST/242-372--------------------------------------------------------------------------------
DUS8_MOUSE/168-299--------------------------------------------------------------------------------
PMP1_SCHPO/69-211--------------------------------------------------------------------------------
PVH1_SCHPO/54-184--------------------------------------------------------------------------------
Q84621_PBCV1/32-162--------------------------------------------------------------------------------
DUSP_MYXVL/34-169--------------------------------------------------------------------------------
Q93592_CAEEL/21-151--------------------------------------------------------------------------------
Q93622_CAEEL/10-138--------------------------------------------------------------------------------
SDP1_YEAST/68-193--------------------------------------------------------------------------------
YNBD_ECOLI/306-430--------------------------------------------------------------------------------
DUSP_VACCW/34-166--------------------------------------------------------------------------------
CPP1_CANAL/437-575--------------------------------------------------------------------------------

PF14566

Q5KH69_CRYNJ/229-383T------------------------------------------PYQT.L.----------------------------..
E1BUS7_CHICK/161-329N------------------------------------------LHEN.LH----------------------------S.
E1BUS7_CHICK/545-692S------------------------------------------LDQL.I.----------------------------P.
E1BH07_BOVIN/161-330N------------------------------------------LHEN.LQ----------------------------G.
E3JPZ2_PUCGT/669-828V------------------------------------------GLRN.LK----------------------------S.
A4HD18_LEIBR/578-733D------------------------------------------PLKP.I.----------------------------I.
A4HD18_LEIBR/955-1112A------------------------------------------SHDS.AE----------------------------HG
A4HD18_LEIBR/1405-1567A------------------------------------------PYVN..V----------------------------E.
A7S980_NEMVE/79-248S------------------------------------------LKGN.I.----------------------------A.
A8NUG9_COPC7/152-312E------------------------------------------PRRS.L.----------------------------..
A8NUG9_COPC7/652-809F------------------------------------------SLRN.VK----------------------------D.
A8NUG9_COPC7/1085-1245K------------------------------------------PLEN.L.----------------------------E.
A8PWR7_MALGO/105-261K------------------------------------------PKQT.L.----------------------------..
A8PWR7_MALGO/1010-1170E------------------------------------------PLTN.M.----------------------------E.
A9SKI5_PHYPA/87-242R------------------------------------------PFTN.L.----------------------------E.
A9SKI5_PHYPA/507-663R------------------------------------------PYKN.ML----------------------------E.
A9SKI5_PHYPA/942-1102Q------------------------------------------PAST.L.----------------------------K.
B3S659_TRIAD/150-328D------------------------------------------LDST.TI----------------------------D.
B3S659_TRIAD/514-665N------------------------------------------LNQL.L.----------------------------L.
D0NS27_PHYIT/226-388M------------------------------------------LNEN..D----------------------------L.
D0NS27_PHYIT/608-784D------------------------------------------LMVN..V----------------------------E.
D7LSR9_ARALL/949-1107K------------------------------------------PVDT.L.----------------------------K.
D8Q3Q5_SCHCM/576-728F------------------------------------------SLRN.MK----------------------------D.
D8Q3Q5_SCHCM/1008-1168R------------------------------------------PLEN..V----------------------------E.
D8QMN2_SELML/93-248R------------------------------------------PFTN.L.----------------------------E.
D8QMN2_SELML/507-663R------------------------------------------PYKN.ML----------------------------E.
D8TQ16_VOLCA/99-254Q------------------------------------------PFCN.L.----------------------------E.
D8TQ16_VOLCA/549-710R------------------------------------------PLKN.MA----------------------------E.
E1ZN66_CHLVA/161-316R------------------------------------------PFSN.L.----------------------------E.
E1ZN66_CHLVA/570-738R------------------------------------------PFKN.LL----------------------------E.
E6ZVY8_SPORE/227-382R------------------------------------------PVST.F.----------------------------..
E6ZVY8_SPORE/725-885M------------------------------------------SLRN.IK----------------------------A.
E6ZVY8_SPORE/1211-1371Q------------------------------------------PITN.I.----------------------------E.
PALD_XENTR/164-333N------------------------------------------LHEN.LH----------------------------D.
PALD_XENTR/549-696N------------------------------------------LEQQ.I.----------------------------A.
PALD_DANRE/152-321N------------------------------------------LHEN.LQ----------------------------H.
PALD_DANRE/539-686R------------------------------------------VEQC.I.----------------------------R.
B7ZD37_DANRE/177-345N------------------------------------------LHEN.LH----------------------------D.
D3HQA5_LEGLN/106-249D------------------------------------------WINR.G.----------------------------K.
F8L2G7_PARAV/112-247G------------------------------------------WSNR.GK----------------------------T.
G0VLV4_MEGEL/130-269D------------------------------------------WGNI.GK----------------------------S.
G3NCI0_GASAC/546-691C------------------------------------------PDQH.I.----------------------------P.
G4Q6F9_ACIIR/130-269N------------------------------------------WANR.EK----------------------------G.
K7MZP3_SOYBN/503-659R------------------------------------------PYKN.ML----------------------------E.
Q57YX2_TRYB2/395-546D------------------------------------------PTTP.I.----------------------------I.
Q5ZRR1_LEGPH/106-249N------------------------------------------WINL.GK----------------------------S.
Q97TT3_CLOAB/105-246D------------------------------------------DANLNLT----------------------------SS
R5T921_9FIRM/138-277D------------------------------------------WGNI.G.----------------------------..

PF04179

C1GPQ9_PARBA/356-466..................------------------------------------------------------------.S
S8AI90_DACHA/404-517..................------------------------------------------------------------.S
E9DAT9_COCPS/337-447..................------------------------------------------------------------.S
G9MHA9_HYPVG/367-492..................------------------------------------------------------------.S
R9PDR6_PSEHS/404-524..................------------------------------------------------------------.L
U5GYA0_USTV1/383-496..................------------------------------------------------------------.Y
D8RSU0_SELML/381-489..................------------------------------------------------------------.R
C7YUH6_NECH7/338-448..................------------------------------------------------------------.S
F0XM43_GROCL/358-471..................------------------------------------------------------------.S
H6C7Z6_EXODN/346-456..................------------------------------------------------------------.S
M2SJZ2_COCSN/342-454..................------------------------------------------------------------.S
B9ILU0_POPTR/385-495..................------------------------------------------------------------.R
H1V029_COLHI/347-462..................------------------------------------------------------------.S
E1Z633_CHLVA/380-483..................------------------------------------------------------------.R
M9MG34_PSEA3/410-530..................------------------------------------------------------------.L
C5DDT7_LACTC/364-473..................------------------------------------------------------------.S
A3GEW1_PICST/430-536..................------------------------------------------------------------.S
YAW6_SCHPO/327-444..................------------------------------------------------------------.A
B8P5G6_POSPM/342-456..................------------------------------------------------------------QI
U5D482_AMBTC/451-561..................------------------------------------------------------------.R
Q5Z9S3_ORYSJ/423-533..................------------------------------------------------------------.R
M2YX40_PSEFD/338-447..................------------------------------------------------------------.S
G1XCX2_ARTOA/414-526..................------------------------------------------------------------.S
X6N575_RETFI/407-503..................------------------------------------------------------------.K
G8JSC9_ERECY/371-479..................------------------------------------------------------------.S
R7YVR8_CONA1/342-453..................------------------------------------------------------------.S
I1RME2_GIBZE/335-448..................------------------------------------------------------------.S
I1K5Y8_SOYBN/394-504..................------------------------------------------------------------.R
G8ZND5_TORDC/376-488..................------------------------------------------------------------.S
K1WJY4_MARBU/341-452..................------------------------------------------------------------.S
G8BB49_CANPC/346-447..................------------------------------------------------------------.S
G8BXA9_TETPH/379-492..................------------------------------------------------------------.S
S3C242_OPHP1/408-502..................------------------------------------------------------------.G
E5AAV6_LEPMJ/344-453..................------------------------------------------------------------.S
H2AQP4_KAZAF/367-482..................------------------------------------------------------------.S
S2J0U1_MUCC1/357-464..................------------------------------------------------------------.Q
M7U0Y5_BOTF1/340-461..................------------------------------------------------------------.S
B2B700_PODAN/339-458..................------------------------------------------------------------.S
M1W3J9_CLAP2/425-535..................------------------------------------------------------------.S
G2XEA9_VERDV/363-481..................------------------------------------------------------------.S
Q5K8J8_CRYNJ/362-504..................------------------------------------------------------------.G
R0IX52_SETT2/342-453..................------------------------------------------------------------.S
A6RFJ3_AJECN/420-530..................------------------------------------------------------------.S
K5X0D2_AGABU/371-488P.................------------------------------------------------------------DA
E3KA19_PUCGT/393-503..................------------------------------------------------------------.S
C5E0N9_ZYGRC/359-471..................------------------------------------------------------------.S
G9P8X7_HYPAI/362-484..................------------------------------------------------------------.S
V5GDC2_BYSSN/340-449..................------------------------------------------------------------.S
V2XTW4_MONRO/357-466..................------------------------------------------------------------QM
E7KT28_YEASL/399-512..................------------------------------------------------------------.S
U7Q4K7_SPOS1/379-495..................------------------------------------------------------------.G
C8VDH2_EMENI/343-469..................------------------------------------------------------------.G
S8EAV7_FOMPI/344-458..................------------------------------------------------------------QI
N1JAB6_BLUG1/339-458..................------------------------------------------------------------.S
Q752X2_ASHGO/363-471..................------------------------------------------------------------.S
B6HQQ9_PENRW/338-448..................------------------------------------------------------------.S
M7XLM4_RHOT1/359-476Y.................------------------------------------------------------------NS
F4SBX2_MELLP/374-492DDGKEVFQIEGDQSVLKN------------------------------------------------------------FS
C4Y409_CLAL4/373-474..................------------------------------------------------------------.A
C5GAQ9_AJEDR/362-472..................------------------------------------------------------------.S
D5GAF8_TUBMM/380-486..................------------------------------------------------------------.A
A5DDJ2_PICGU/366-468..................------------------------------------------------------------.S
B8M9U3_TALSN/348-458..................------------------------------------------------------------.S
K5VFS6_PHACS/357-468..................------------------------------------------------------------QK
S8A0J5_PENO1/340-450..................------------------------------------------------------------.S
G3AWZ7_CANTC/338-437..................------------------------------------------------------------.S
K2R165_MACPH/343-477..................------------------------------------------------------------.S
F4Q8M0_DICFS/386-509..................------------------------------------------------------------.K
L2G6S0_COLGN/344-454..................------------------------------------------------------------.S
G4MYV2_MAGO7/371-492..................------------------------------------------------------------.S
Q7S7X7_NEUCR/344-470..................------------------------------------------------------------.S
B6K0F6_SCHJY/330-447..................------------------------------------------------------------.A
M4DKF4_BRARP/403-513..................------------------------------------------------------------.R
F4NTS2_BATDJ/373-483..................------------------------------------------------------------.Q
G3AS11_SPAPN/393-494..................------------------------------------------------------------.S
F9XI17_ZYMTI/344-452..................------------------------------------------------------------.S
K0KV37_WICCF/348-447..................------------------------------------------------------------.S
J7RB50_KAZNA/385-498..................------------------------------------------------------------.S
G2Q8H3_MYCTT/361-480..................------------------------------------------------------------.S
N4V8M2_COLOR/342-452..................------------------------------------------------------------.S
Q7Y230_ARATH/402-512..................------------------------------------------------------------.R
G2QSG8_THITE/366-478..................------------------------------------------------------------.S
G8YD06_PICSO/413-517..................------------------------------------------------------------.S
A1CAM8_ASPCL/342-452..................------------------------------------------------------------.S
L8GDB1_PSED2/342-457..................------------------------------------------------------------.S
I2G2Q6_USTH4/409-522..................------------------------------------------------------------.M
A9S2G5_PHYPA/392-501..................------------------------------------------------------------.R
K7VV88_MAIZE/422-532..................------------------------------------------------------------.R
W1QIL3_OGAPD/335-432..................------------------------------------------------------------.G
M2MJZ2_BAUCO/346-453..................------------------------------------------------------------.S
A7TSQ7_VANPO/375-488..................------------------------------------------------------------.S
G0RHH7_HYPJQ/349-476..................------------------------------------------------------------.S
B0DXY4_LACBS/355-474G................D------------------------------------------------------------TP
G0VC18_NAUCC/373-485..................------------------------------------------------------------.S
G7XWH4_ASPKW/344-454..................------------------------------------------------------------.S
E4UTV7_ARTGP/337-447..................------------------------------------------------------------.S
M2YPJ4_DOTSN/341-449..................------------------------------------------------------------.S
K4DBT3_SOLLC/405-515..................------------------------------------------------------------.R
E9EIX2_METAQ/356-466..................------------------------------------------------------------.S
B9RKG8_RICCO/398-508..................------------------------------------------------------------.R
M0RLY9_MUSAM/414-524..................------------------------------------------------------------.R
I1HUK5_BRADI/428-538..................------------------------------------------------------------.R
J3NGW3_GAGT3/398-531..................------------------------------------------------------------.S
F2UJ91_SALR5/411-524..................------------------------------------------------------------.K
E3RT85_PYRTT/341-451..................------------------------------------------------------------.S
U4LI63_PYROM/344-451..................------------------------------------------------------------.N
G0WHG3_NAUDC/380-503..................------------------------------------------------------------.S
Q6CSF9_KLULA/375-488..................------------------------------------------------------------.S
Q6BMH5_DEBHA/431-537..................------------------------------------------------------------.S
M2Q805_CERS8/351-462..................------------------------------------------------------------QT
D7TBG8_VITVI/401-511..................------------------------------------------------------------.R
F0ZEU9_DICPU/383-509..................------------------------------------------------------------.K
E6ZXK3_SPORE/413-527..................------------------------------------------------------------.L
D3B088_POLPA/398-512..................------------------------------------------------------------.K

PF06602

MTMR9_CAEEL/119-461.RL.............................................ML.................STDAFRIS.SVNE
C9JEX3_HUMAN/120-457.RQ.............................................GI.................PNESWRIT.KINE
D6W9S3_TRICA/203-540.RM.............................................GV.................NNDMWKIS.RINE
C3XWL9_BRAFL/127-466.RQ.............................................GL.................PNNRWVHS.PINK
S3C8M7_OPHP1/129-641.RQ.............................................GIS...EKL......PDRG....WRIS.TINK
D3ZTB0_RAT/68-407.RM.............................................GL.................PDNYWQLS.DVNR
M7X0W0_RHOT1/149-559.RM.............................................GLG...TR.......SKA.....WRFT.DINA
D6WMP8_TRICA/113-453.KLL...........................................A....................SEEWRIS.HINK
L8G7Q2_PSED2/120-600.RQ.............................................GIS...EKG......IDQG....WRIS.TINS
F6YKJ2_CIOIN/154-495.RQ.............................................GL.................PVEGWRFT.KANS
R0KQU7_SETT2/121-609.RL.............................................GIS...PKD......TEKG....WRIS.EVNK
G1PXE9_MYOLU/11-349.LY............................................S..................SATSDWRLS.YVNK
A0A0J9Y087_BRUMA/150-497.RQ.............................................GI....G..........TADDRKWKIT.DFNT
C5MAZ5_CANTT/147-657.RL.............................................GLI...QSD......DTY.....WRVT.DINN
K4D528_SOLLC/172-591.RL............................................LGMGFYQASIRAIEDGAFTLSNEWWRIS.SVNC
B7PN04_IXOSC/107-444.RM.............................................GV.................PNNYWAAT.KINQ
N1Q257_DOTSN/240-741.RM.............................................GIG...GK.......AAEGPGSAWRIT.DINS
W5LHV8_ASTMX/109-447.QT............................................E..................RLWDRWRLS.KVNS
I1I9E0_BRADI/148-576.RL............................................FRKWFSHSSSSGLEVEKDSLRNAWWRVT.SVNS
E0VHL9_PEDHC/552-891.RM.............................................GV...............QYPNDMWRIT.KINE
K1PF27_CRAGI/141-481.RM.............................................GV.................PNQLWTLS.SLNN
Q55E04_DICDI/741-1092.RF.............................................NI....Y.........GDSENSGWKFT.NINK
F0ZYE9_DICPU/163-502.RM.............................................GIS...Q..........SYKTSPWAIS.LINF
YMR1_YEAST/136-572.RQ.............................................GLD.S............KDETCPWRLS.TVNE
A7S8S7_NEMVE/126-517.RM.............................................GFE.T.GV.......DSP.....WRIS.DANS
Q17AB3_AEDAE/129-469.RM.............................................GV....N..........SANNDTWRIT.RIND
E3QC99_COLGM/127-595.RQ.............................................GIS...EKS......ADKG....WRIS.NINK
A7SNP0_NEMVE/110-450.RM.............................................GV.................PSDLWTAT.QLNK
G8YJX9_PICSO/151-634.RL.............................................GLL...SDS......EDY.....WRLS.SVNA
M0TWG6_MUSAM/151-572.RL............................................LGKGSFHASSTG.IGDGLSLSNNWWRIT.SINS
H3GBH0_PHYRM/684-1027.RI.............................................GL...............LSFPDHLRCI.DQSP
U1GMS5_ENDPU/916-1439.RM.............................................GVG...DTS......RKTK....WRIS.NINL
T1L1W1_TETUR/108-448.KI............................................M..................MYSDAWRIS.YVNK
S7ZC40_PENO1/121-601.RQ.............................................GLY...KE........TSG....WRVS.EINH
F2SBK2_TRIRC/123-609.RL.............................................GVG...RAD......QDSN....WRIS.CINT
H9JUN7_BOMMO/136-493.RL.............................................GFT.E.K.........GA.....WRVT.SVNS
K3WGY1_PYTUL/996-1356.RQVGGDPL................................AQPFFKF............................YQNA
G4VLK6_SCHMA/68-454......................................................NNI......NELLSVGSWRIS.QLNE
G8BAA5_CANPC/161-694.RL.............................................GLI.P.NES.....DKQF.....WRMT.EVNA
G7DS70_MIXOS/120-515.RM.............................................GLG.R.KDA.....RSAA.....WRWS.DVNK
G3UQ85_MELGA/102-441.RM.............................................GI.................PNDYWEIT.DLNK
I3MZ61_ICTTR/109-450.RV............................................A..................RETNAWRLS.EVNQ
Q7KK51_DROME/57-394.HM.............................................LV.................PNEAWTLC.SMNE
G2YGM0_BOTF4/130-610.RL.............................................GIS...EKG......VDRG....WRLS.KMNH
X6M9G5_RETFI/187-542.RM.............................................GI....PK.......TTKTKICEYRRS.NANA
W4Z9C7_STRPU/168-567.RQ.............................................GFD.L.K.........KA.....WRIF.D.NS
A0A0E1RWX6_COCIM/121-608.RL.............................................GVG...NPD......SPSG....WRLS.AINS
E3NKD1_CAERE/151-493.RL.............................................GIPKSR...........L.....WEIV.DINK
U1M373_ASCSU/150-497.RQ.............................................GI....G..........TADKQLWRVT.DFNI
A7THB1_VANPO/138-578.RQ.............................................GLH.I............NDSNSQWRIS.KINE
J9KAQ2_ACYPI/156-493.RM.............................................NV.................PNESWSLT.TLNQ
B3RSS9_TRIAD/196-531TKYANSME..................................GLAKTGGVPSYRKISDYESELDHLKTPKIWCINEDANR
Q5KP89_CRYNJ/121-513.RQ.............................................GLG...TR.......TKA.....WRFT.DINK
I2H614_TETBL/171-633.RQ.............................................GLD.L............ISSNCPWRIS.DINK
F6I5V0_VITVI/167-590.RL............................................LGKGSCHASMDTIEDGSFTLSNDLWRIS.GINS
K1Y4Z5_MARBU/125-608.RQ.............................................GIS...DKG......VDRG....WRIS.KINT
H9J1I9_BOMMO/114-451.KVL...........................................A....................TEEWRVS.RANQ
A7SR96_NEMVE/108-448.KVC...........................................S...................STQSWRIS.HVNI
U4LJB1_PYROM/115-607.RM.............................................GVG...TE.......RVPG....WRIT.DINK
C5DH60_LACTC/126-560.RQ.............................................GLA.L.............DHACPWRLS.DINK
B3RX90_TRIAD/107-446.RL.............................................EV.................PSDLWRKT.DINK
M5BN64_THACB/239-656.RM.............................................GLG...TR.......TKA.....WRFT.EVNK
K0KB78_WICCF/101-495.RQ.............................................GLK.F.DHNN....NHDEESFTNWRIS.QINS
A0EGI5_PARTE/166-524.RM.............................................GVL.I.QQE.....SQQQQMNVLYKYV.N.NE
U7Q4J5_SPOS1/160-660.RQ.............................................GIN...EKL......PDRG....WRIS.HINK
Q4RR78_TETNG/108-446.DL............................................E..................SMTDEWRLS.DVNK
I7M0W4_TETTS/279-641.RM.............................................RINIYDPTQQ...NSNSNQEQFYYKYL.N.NE
N1QIY4_SPHMS/120-622.RM.............................................GIG...AK.......AAEGVGSAWRIS.TINE
Q5CWV5_CRYPI/401-807.RQ.............................................GVP.I.SSGLI..NENTSRFP..LRFT.NVNQ
V5EUK4_KALBG/132-595.RQ.............................................GIG...AR.......SKA.....WRFT.DINA
M3YJJ4_MUSPF/154-491.RQ.............................................GL.................PNESWKIS.KVNS
D0NRZ1_PHYIT/258-667.RL.............................................GI...............SSSTSRWRLS.YVNE
M4ACQ9_XIPMA/114-453.RM.............................................GV.................PNNLWVAT.AANS
M2RH09_CERS8/106-508.RM.............................................GVG...TR.......TKA.....WRLT.DINK
G3SD46_GORGO/127-525.RM.............................................GFD.M.N.........NA.....WRIS.NINE
B3SBP9_TRIAD/113-452.RMVR........................................TRRGL.....................WKTT.DINN
W5KWS3_ASTMX/220-557.RQ.............................................GL.................PNESWTIS.KINS
Q6CPC9_KLULA/127-533.RQ.............................................GLN.F.G..........DEECCKWRVS.DINE
M3XJ57_LATCH/108-446.CM............................................A..................CPTDFWRLS.YVNK
K7IWE5_NASVI/115-459.RLL...........................................A..................AHGDEWRIC.HLNR
U9W3E6_NEUCR/121-581.RQ.............................................GIS...EKS......RELG....WRIS.TINK
E0W3N5_PEDHC/130-511.RL.............................................KFD.V.N.........GA.....WRIS.QANS
K7J4U1_NASVI/112-448.RQ.............................................GV.................PNEEWSLS.YLNV
B3MMR2_DROAN/166-509.RL.............................................GV.................PNDMWRAT.KINE
Q7KSP6_DROME/1137-1547.RL.............................................GFDAESQ.........RG.....FRIS.NANT
H3AE55_LATCH/1065-1482.RL.............................................GLGTLSNSLSR..SKNEP.....FRIS.TVNR
G1X052_ARTOA/190-629.RQ.............................................GIT...Q..........D.....WRLS.NINS
I1GF95_AMPQE/360-681TEL.............................................KLKTDWNVEAQLHTDMARMMSDNWKES.PLNC
D3B3I4_POLPA/600-998.RQ.............................................GV...............GRSSSGWRIT.RINE
K1R474_CRAGI/111-449.RF............................................K..................ECADEWRVT.NINR
L0PBM5_PNEJ8/153-547.RQ.............................................GVG...IR.......TKN.....WRIT.DINS
J7R4V3_KAZNA/137-557.RQ.............................................GLK.L............GQDSCPWRIT.DINQ
B8M5V2_TALSN/121-609.RQ.............................................GVG...REG......SNAN....WRIS.TINA
D1ZZL4_TRICA/106-443.RM.............................................GV.................PNDQWCVT.KLNT
Q75D71_ASHGO/126-524.RQ.............................................GLT.L.............DRGSPWRST.AIND
A0A068XB07_HYMMI/118-483.RQ.............................................NVVNNG.................WRIS.KVNE
F6VED7_XENTR/133-471.KMR...........................................A...................ETDDWRLS.EVNL
K7LKG8_SOYBN/170-592.RL............................................LCLGSYRSSINIIENGSFTLSNDLWRIS.SVNC
D3BMG4_POLPA/223-606.RQ.............................................GLL.A..............TGSEWRLT.KINM
K5X3K1_AGABU/106-510.RM.............................................GLG...TR.......IKA.....WRFT.EVNK
M3HQM6_CANMX/147-671.RL.............................................GLI...RDD......DLY.....WRIT.NLNN
F1QFI4_DANRE/108-447.RM.............................................GV.................PCDQWQLT.DVNR
MYTM2_ARATH/168-589.RL............................................LGKSSQRASMNMIEDGSFTLSNDLWRIT.NLNS
G9NQC0_HYPAI/120-588.RQ.............................................GIS...EKL......PDKG....WRIT.NINH
D0MQT4_PHYIT/847-1207.RQIGGDPA................................VSPFLKY............................YKNE
W1PTA0_AMBTC/149-572.RL............................................LGMGSHHTSAIVAEDEVFA.SNQWWRIT.GVNS
C5E149_ZYGRC/135-556.RQ.............................................GLE.L............GSEQSPWRIS.TINE
F9WY32_ZYMTI/108-611.RM.............................................GIS...AK.......AAEGPGSAWRIS.DINH
G3APU7_SPAPN/134-605.RL.............................................NLI...EN.......EKY.....WRVT.NINE
E0VBZ2_PEDHC/111-451.KLV...........................................S..................TCPDEWRFT.NVNK
B8NRV4_ASPFN/121-606.RQ.............................................GVD...RD........NHG....WRIS.RINT
F0Z8X8_DICPU/405-761.RM.............................................GVPSPD.................WRVS.DANY
X1WTU1_ACYPI/150-503.RL.............................................NIS.V.LSD......NSK.....WRIS.KVNW
G2RA16_THITE/121-606.RQ.............................................GIS...EKS......ADLG....WRIS.TINK
D8MA50_BLAHO/20-365.RV.............................................GL................LNCPKLRLY...VQ
T1KVR9_TETUR/130-468.RL.............................................GL.................PSESWKI..KHNE
C4R4B0_KOMPG/124-506.RQ.............................................GLK.L.NSPN...SSSEHPGDKMWRMS.NINE
W5JLC3_ANODA/114-451.KLL...........................................A...................NGDEWRLT.TVNS
C4XXZ6_CLAL4/140-622.RQ.............................................DLI.S.EDS.....ETQP.....WRLT.SINE
G2X7C1_VERDV/122-582.RQ.............................................GIS...EKS......TDKG....WRIT.WINK
E9H2A7_DAPPU/111-452.KLV...........................................M..................QQQEDWRIS.YVNK
B7PU64_IXOSC/108-448.RI............................................K..................LLSDEWRIS.TVNK
W4XXX3_STRPU/73-410.RQ.............................................GL.................PTESWRIS.RINE
K9FL89_PEND2/117-597.RQ.............................................GCL...DE........GKT....WRLS.EINV
I7MHG2_TETTS/341-702.RQ.............................................GVI.IQPVEFDKSQTDKDYASSPFKYM.D.NS
I1FRW6_AMPQE/108-447.RM.............................................GV.................PNEHWVCT.ELNK
G8ZRV1_TORDC/132-558.RQ.............................................GLD.L............TSSECGWRLS.NLNN
D3AZN8_POLPA/434-774.RQ.............................................EL.................NFKLWRTS.EVNC
G3PJV3_GASAC/127-519.RM.............................................GFD.T.Q.........NA.....WRIS.DINS
MTMR_DICDI/332-721.RQ.............................................GLI.G.N..........SNGSDEWRLT.KMNS
Q0C7A8_AEDAE/114-449.KLL...........................................A....................TDEWRLT.TVNQ
YMR1_SCHPO/103-493.RM.............................................GVG...DST......QADGAGGNWRIT.KINE
T1JCY3_STRMM/107-462.KI............................................L..................RTTDEWRIS.HVNK
I3KM64_ORENI/109-448.RM.............................................GL.................PNSLWKLS.PVNQ
E3KNU9_PUCGT/155-581.RM.............................................KVI...GES......SKKSENNPWRLT.TINK
MTMR3_CAEEL/220-576.RL.............................................GMS.E............H.....FQIS.SVNE
K3X024_PYTUL/242-585.RM.............................................GVN.L..............VNGPFRVT.EMNA
S3D1P6_GLAL2/140-615.RQ.............................................GIS...DKE......PDRG....WRIS.KINV
C3ZSP5_BRAFL/108-434.RLF...........................................G.....................EDWRIS.YVNK
W1QEY9_OGAPD/121-491.RQ.............................................GLD.M.VA........GP.....WRLS.SLNS
U3JCZ0_FICAL/108-444.QL............................................S..................SQTSQWRPP.PPPP
K5UY85_PHACS/106-506.RM.............................................GIG...SR.......TKA.....WRLT.DINK
G6DQM0_DANPL/94-431.RM.............................................NV.................PNEQWTLC.NANR
F2UN43_SALR5/141-483.RM.............................................GIPEDK.................WRVT.SINA
Q54PL3_DICDI/527-866.RQ.............................................GI....LS.......ETAGYNMKWRYS.EKNI
U5G1I7_POPTR/62-484.RL............................................LGKGLCRASMDMIDNGSYTMSNELWRIC.NVNS
H3CF16_TETNG/109-447.RM.............................................GL.................PNSLWKLS.SVNQ
B7Q0U6_IXOSC/131-468.RQ.............................................GL.................PTESWRVS.RANE
H2YV90_CIOSA/105-444.QM.............................................GL.................PTRYWKIS.RINN
G3WI64_SARHA/131-469.RQ.............................................SS.................PEQSPQLK.ITNS
F4P5V0_BATDJ/5-397SRM.............................................GVG...ST.......CAS.....WRLS.TINQ
F1A1E7_DICPU/40-385.RQ.............................................GLI.C..............PGGEWRLS.KINQ
W5L8J5_ASTMX/122-513.RM.............................................GFS.N.H.........SA.....WRIS.DINN
Q6FWK8_CANGA/123-582.RQ.............................................GLD.L.DG........SKEGQPTWRVS.NINA
E9GCX0_DAPPU/107-444.RM.............................................GV.................PNANWTMT.NLNK
E9EEP8_METAQ/46-510.RQ.............................................GIS...EKL......PDKG....WRVT.TINK
A0E8R1_PARTE/249-601.RM.............................................GIN.I.LQE......NSQTQNGLFKYL.N.NE
A5DEK5_PICGU/124-584.RQ.............................................GLK...S.........DH.....WRTT.EIND
A3LPR3_PICST/165-655.RQ.............................................GLL...REN......DDY.....WRMS.RVNE
B2AWC6_PODAN/121-613.RQ.............................................GIS...EKS......ADLG....WRIT.NINK
F6ZST8_XENTR/107-446.RM.............................................GV.................PNSYWQLS.DVNR
D8PSV3_SCHCM/106-510.RM.............................................GVG...TR.......SKA.....WRFT.DINK
F7FF42_MONDO/108-447.QV............................................A..................LETDAWRLS.TVNR
F6Z7M4_ORNAN/48-386.RV............................................S..................RETDAWRLS.TVNA
G6D5H7_DANPL/140-498.RL.............................................GFT.M.K.........GA.....WRVS.AANV
G1NGC4_MELGA/109-447.RM.............................................GI.................PNSYWQIS.DVNR
F6ZL94_CIOIN/125-462.DLC...........................................K...................KSDQWRIS.SINL
D3BLJ5_POLPA/497-918.RQ.............................................GVSWDE.................WCVN.TTNS
T0JZF0_COLGC/134-596.RQ.............................................GIS...EKS......ADLG....WRIS.NINK
Q5APM2_CANAL/145-654.RL.............................................ELV...QEN......SQY.....WRVT.NLNT
G0QMH5_ICHMG/105-461.RQ.............................................GID.VAPININIQDSNIQNQNYMFRYI.D.NS
Q54TD5_DICDI/133-525.RM.............................................GIS...N..........SMKTCPWAIS.LINL
E0VBG7_PEDHC/106-443.RM.............................................RV.................PNDVWIAT.DLNI
E9IZM6_SOLIN/85-430.RLL...........................................A..................AHGDEWRIS.YLNR
A0A0D2US15_CAPO3/152-487.RM.............................................GL.................PNERWTLT.TANM
T1FQ89_HELRO/187-525.RQ.............................................GV.................PNDSWRVT.KINE
E5SCK8_TRISP/125-471.RL.............................................GL.................PNDNWTIS.DLNK
A0A0C4E2G4_MAGP6/114-593.RQ.............................................GIS...AKS......KDRG....WRIT.NINK
H9G937_ANOCA/109-448.QV............................................A..................SRTGAWRLS.VVNE
C0NUC9_AJECG/125-612.RL.............................................GVG...KPD......SKCG....WRIS.TINQ
Q6C4T9_YARLI/175-567.RQ.............................................GAF...AK........NK.....WRMT.SLNE
B0WIZ7_CULQU/133-522.RL.............................................QFD.L.Q.........GA.....WRIS.HANA
D3BK85_POLPA/1613-1970.RM.............................................GVPSVD.................WKFS.HSNT
MTMR8_DANRE/109-448.RM.............................................GL.................SNDYWEIS.HINK
H6BK64_EXODN/119-622.RM.............................................GIG...DDT......KKLN....WRIS.KINQ
D3BT00_POLPA/890-1235.RM.............................................GIPNES.................WRVT.NFNN
C3ZL63_BRAFL/350-687.RL.............................................GL.................PNDAWRIT.KVNE
A0A087ZQW5_APIME/106-441.RQ.............................................GV.................PNEEWSLT.YLNT
N1JPV3_BLUG1/121-602.RQ.............................................GIS...SKS......KDRG....WRIS.RINA
F1QHK9_DANRE/109-448.RM.............................................GL.................PNKLWHVT.PINR
F2TYL0_SALR5/61-399.RM.............................................GV.................PCDEWRLS.TVNE
D8LMG1_ECTSI/530-890.RM.............................................GVL...KP.......RRNKGVSPWRET.QLNA
MTMR8_HUMAN/109-448.RM.............................................GI.................PNRNWTIT.DANR
S2IWP4_MUCC1/104-488.RM.............................................GV...............DVSTDTWRFT.LVNR
U9TMA9_RHIID/106-487.RM.............................................GVF...SK.......SSA.....WRFS.SINE
T1IU07_STRMM/107-444.RM.............................................DA.................PNKYWSLT.TINK
H3GSF1_PHYRM/503-868.RL.............................................GFL.S.AKK.....QPEEEGVITWRLL..KNS
H9G424_ANOCA/127-521.RM.............................................GFD.L.Q.........NV.....WRVS.DINN
G0S6I8_CHATD/121-606.RQ.............................................GIS...EKS......ADIG....WRIS.TINK
M2LKW6_BAUCO/231-739.RM.............................................GIG...GK.......APEGPGSAWRVS.DINE
R7YNQ0_CONA1/121-615.RL.............................................GVS...AKD......VDKG....WRIS.EINA
U3I3P9_ANAPL/154-491.RQ.............................................GL.................PNERWRVT.FINE
Q8SZY7_DROME/117-513.KLISGVGMGGASSPNVANITICMPSTSTSTLTVGAGIPHPLQNGYAIEALACGVGGVGGGALQSPQASCEWRIT.NVNR
F4W7J4_ACREC/132-505.RL.............................................KFN.L.H.........GT.....WRVS.QINK
J9F2D0_WUCBA/113-457.KLV...........................................I..................RCKDGWRIS.AVNK
S8A4K0_DACHA/201-638.RQ.............................................GIT...Q..........D.....WRLS.TINS
M4BZT0_HYAAE/106-466.RM.............................................GIA.L.G..........SDSSCALRVT.ELNA
I3JN82_ORENI/109-447.QM............................................K..................ELYEKWRLS.TVNR
N1Q744_PSEFD/131-638.RM.............................................GIG...SK.......AVEGPGSAWRIT.EINA
G7X8Z5_ASPKW/122-607.RQ.............................................GVD...QA........GSG....WRIS.QLNT
C7YZ12_NECH7/125-589.RQ.............................................GIS...EKL......PDRG....WRIT.HINK
G8BY17_TETPH/154-600.RQ.............................................GLD.L............ESESCPWRIS.SINC
B3S431_TRIAD/109-445.RLT...........................................A...................GSRDFRVL.EVNK
E1C6W8_CHICK/133-471.QL............................................A..................LQTTQWRLS.DVNR
E9GCQ5_DAPPU/55-392.RQ.............................................GL.................PNESWRIT.KLNE
B4NIH7_DROWI/1151-1559.RL.............................................GFDAESQ.........RG.....FRIS.NANA
R8BFR7_TOGMI/133-610.RQ.............................................GIS...EKS......ADRG....WRIS.TLNK
F0XCQ4_GROCL/128-618.RQ.............................................GIS...EKL......PDRG....WRIS.SINL
Q0U936_PHANO/60-557.RL.............................................GIS...PKD......TEKG....WRIS.EINI
T1FWY3_HELRO/128-515.RM.............................................AFN.L.NYE......RRP.....WRIC.HANE
I3K4K8_ORENI/127-519.RM.............................................GFD.T.Q.........NI.....WRVS.DINC
G3JPP9_CORMM/121-586.RQ.............................................GIS...EKL......PDKG....WRIT.NINK
G3B9W7_CANTC/149-641.RL.............................................DLF.K.DDG.....SASF.....WRIT.NVNE
V2X5H5_MONRO/106-511.RM.............................................GVG...TR.......TKA.....WRFT.DVNK
W4Z0A3_STRPU/8-344.RL................................................................ASDDWRIS.YVNK
E7F7A8_DANRE/108-448.RM.............................................GI.................PSNLWHVT.AANH
G0W991_NAUDC/135-608.RQ.............................................GLQ.L.IGNND..EHTEHGETFPWRLS.LINS
Q6BWJ6_DEBHA/171-652.RQ.............................................GLV...SEN......ETY.....WRIS.RIND
G0VIM8_NAUCC/129-542.RQ.............................................GLN.L............HDEG.PWRIS.NINK
W5M3F3_LEPOC/109-447.QI............................................A..................IHSERWRLS.DVNR
R4XBG5_TAPDE/92-499.RQ.............................................GLG...TK.......FPQ.....WRLT.NLNH
N4V3P3_COLOR/126-589.RQ.............................................GIS...EKS......QDKG....WRIT.DINK
G7YT25_CLOSI/395-762.RQ.............................................NIFTNG.................WKLT.KINV

PF05706

CDKN3_MOUSE/1-167--------------------------------------------------------------------------------
CDKN3_HUMAN/1-168--------------------------------------------------------------------------------

PF14671

F8W600_DANRE/16-155--------------------------------------------------------------------------------
D7EK71_TRICA/13-154--------------------------------------------------------------------------------
K0KJP3_WICCF/11-150--------------------------------------------------------------------------------
I7MMU0_TETTS/24-160--------------------------------------------------------------------------------
I1FMG0_AMPQE/9-149--------------------------------------------------------------------------------
G3ATW9_SPAPN/12-151--------------------------------------------------------------------------------
B8LD57_THAPS/3-141--------------------------------------------------------------------------------
G3PNM2_GASAC/13-155--------------------------------------------------------------------------------
I3LR09_PIG/13-152--------------------------------------------------------------------------------
W1QLT9_OGAPD/11-150--------------------------------------------------------------------------------
R9AL04_WALI9/16-166--------------------------------------------------------------------------------
G4VP89_SCHMA/22-162--------------------------------------------------------------------------------
C5K4Q5_PERM5/141-284--------------------------------------------------------------------------------
G6DSP0_DANPL/12-151--------------------------------------------------------------------------------
E0VM64_PEDHC/25-167--------------------------------------------------------------------------------
E1Z501_CHLVA/14-153--------------------------------------------------------------------------------
G0PKI5_CAEBE/23-174--------------------------------------------------------------------------------
G3W790_SARHA/1-138--------------------------------------------------------------------------------
J9K1D6_ACYPI/24-176--------------------------------------------------------------------------------
B3S2H1_TRIAD/24-161--------------------------------------------------------------------------------
Q231C6_TETTS/26-165--------------------------------------------------------------------------------
D8RE91_SELML/15-157--------------------------------------------------------------------------------
H3G9E5_PHYRM/15-152--------------------------------------------------------------------------------
H2Z9U8_CIOSA/79-219--------------------------------------------------------------------------------
D2V4G7_NAEGR/6-143--------------------------------------------------------------------------------
J9LPV5_ACYPI/24-165--------------------------------------------------------------------------------
K7ILY6_NASVI/81-224--------------------------------------------------------------------------------
W5JWJ6_ANODA/39-180--------------------------------------------------------------------------------
W5LJ29_ASTMX/11-152--------------------------------------------------------------------------------
B7P3Q9_IXOSC/14-156--------------------------------------------------------------------------------
D8MAX5_BLAHO/11-148--------------------------------------------------------------------------------
A7SE41_NEMVE/11-159--------------------------------------------------------------------------------
A0A068XI37_HYMMI/20-160--------------------------------------------------------------------------------
A2E6A0_TRIVA/11-149--------------------------------------------------------------------------------
C3YLS9_BRAFL/12-152--------------------------------------------------------------------------------
M3IHD8_CANMX/15-150--------------------------------------------------------------------------------
H3DGY5_TETNG/16-155--------------------------------------------------------------------------------
I7M1U6_TETTS/21-159--------------------------------------------------------------------------------
U1M7Q1_ASCSU/35-174--------------------------------------------------------------------------------
U3JL01_FICAL/14-153--------------------------------------------------------------------------------
F7DZD0_XENTR/4-141--------------------------------------------------------------------------------
F0Y4C3_AURAN/14-158--------------------------------------------------------------------------------
T1JBF3_STRMM/13-155--------------------------------------------------------------------------------
T1FPZ6_HELRO/9-158--------------------------------------------------------------------------------
D6WTN6_TRICA/12-153--------------------------------------------------------------------------------
A0E9G0_PARTE/15-154--------------------------------------------------------------------------------
E4XMY0_OIKDI/19-159--------------------------------------------------------------------------------
B6AF18_CRYMR/16-159--------------------------------------------------------------------------------
H9J4Q3_BOMMO/12-152--------------------------------------------------------------------------------
A2E639_TRIVA/12-150--------------------------------------------------------------------------------
T1G889_HELRO/11-149--------------------------------------------------------------------------------
G7YJ36_CLOSI/755-894--------------------------------------------------------------------------------
K3WJ76_PYTUL/19-174--------------------------------------------------------------------------------
U6GC88_EIMAC/15-154--------------------------------------------------------------------------------
Q6C5Q7_YARLI/8-145--------------------------------------------------------------------------------
H2VRY9_CAEJA/25-178--------------------------------------------------------------------------------
M7NMG0_PNEMU/11-152--------------------------------------------------------------------------------
Q245B2_TETTS/17-158--------------------------------------------------------------------------------
H3ANX2_LATCH/13-152--------------------------------------------------------------------------------
A2FHE7_TRIVA/8-146--------------------------------------------------------------------------------
I7MAY6_TETTS/46-184--------------------------------------------------------------------------------
K7IWZ3_NASVI/56-198--------------------------------------------------------------------------------
A8BAI9_GIAIC/9-149--------------------------------------------------------------------------------
Q24BA7_TETTS/21-158--------------------------------------------------------------------------------
A7SDJ9_NEMVE/1-137--------------------------------------------------------------------------------
G1KVB1_ANOCA/12-152--------------------------------------------------------------------------------
H2TD44_TAKRU/17-156--------------------------------------------------------------------------------
E2BNA0_HARSA/13-155--------------------------------------------------------------------------------
E1FZN0_LOALO/18-157--------------------------------------------------------------------------------
B4JEI3_DROGR/16-157--------------------------------------------------------------------------------
F4NXK9_BATDJ/27-166--------------------------------------------------------------------------------
F7GR37_CALJA/13-152--------------------------------------------------------------------------------
Q5CXY2_CRYPI/16-159--------------------------------------------------------------------------------
W5MS44_LEPOC/34-171--------------------------------------------------------------------------------
S9X9G0_SCHCR/13-156--------------------------------------------------------------------------------
Q22LZ6_TETTS/7-143--------------------------------------------------------------------------------
H3B231_LATCH/13-153--------------------------------------------------------------------------------
C4QXD7_KOMPG/34-173--------------------------------------------------------------------------------
I2H3N6_TETBL/12-151--------------------------------------------------------------------------------
T1KJ59_TETUR/37-178--------------------------------------------------------------------------------
R4XCT9_TAPDE/7-148--------------------------------------------------------------------------------
K3WHJ0_PYTUL/14-154--------------------------------------------------------------------------------
T1G2U9_HELRO/2-137--------------------------------------------------------------------------------
B0WM71_CULQU/13-156--------------------------------------------------------------------------------

PF04722

M3CM17_SPHMS/6-267--------------------------------------------------------------------------------
U9TR51_RHIID/6-196--------------------------------------------------------------------------------
K1VN79_TRIAC/179-363--------------------------------------------------------------------------------
G3VJW4_SARHA/6-194--------------------------------------------------------------------------------
C4V7E6_NOSCE/1-185--------------------------------------------------------------------------------
A5DSB2_LODEL/6-221--------------------------------------------------------------------------------
J9D665_EDHAE/2-208--------------------------------------------------------------------------------
W5P9P6_SHEEP/6-194--------------------------------------------------------------------------------
I2H6G9_TETBL/4-202--------------------------------------------------------------------------------
C9SH87_VERA1/28-258--------------------------------------------------------------------------------
Q7Q339_ANOGA/9-197--------------------------------------------------------------------------------
R0MEC6_NOSB1/1-179--------------------------------------------------------------------------------
A4S8K5_OSTLU/6-199--------------------------------------------------------------------------------
C5DD47_LACTC/9-206--------------------------------------------------------------------------------
E6ZMC2_SPORE/52-240--------------------------------------------------------------------------------
G5C5J8_HETGA/6-194--------------------------------------------------------------------------------
Q9VWE4_DROME/7-195--------------------------------------------------------------------------------
A9T8M1_PHYPA/3-193--------------------------------------------------------------------------------
G3RMY0_GORGO/6-194--------------------------------------------------------------------------------
G1QGE4_MYOLU/6-194--------------------------------------------------------------------------------
D6WNM1_TRICA/7-194--------------------------------------------------------------------------------
E7KHF5_YEASA/9-206--------------------------------------------------------------------------------
M3W044_FELCA/6-198--------------------------------------------------------------------------------
F7AUY7_CIOIN/4-192--------------------------------------------------------------------------------
M3J959_CANMX/9-226--------------------------------------------------------------------------------
A8NX74_COPC7/95-281--------------------------------------------------------------------------------
I3NBA4_ICTTR/6-194--------------------------------------------------------------------------------
B9RPG0_RICCO/3-193--------------------------------------------------------------------------------
M3WPM1_FELCA/6-196--------------------------------------------------------------------------------
B7PE44_IXOSC/5-193--------------------------------------------------------------------------------
E4XFN7_OIKDI/13-201--------------------------------------------------------------------------------
G2R3A5_THITE/27-257--------------------------------------------------------------------------------
G1QFZ8_MYOLU/6-195--------------------------------------------------------------------------------
T1G229_HELRO/3-191--------------------------------------------------------------------------------
M2NKA1_BAUCO/33-271--------------------------------------------------------------------------------
A3LQU1_PICST/6-217--------------------------------------------------------------------------------
E1G566_LOALO/7-197--------------------------------------------------------------------------------
A5DEF6_PICGU/6-223--------------------------------------------------------------------------------
E9FS49_DAPPU/5-192--------------------------------------------------------------------------------
A8J0V7_CHLRE/6-199--------------------------------------------------------------------------------
L5M545_MYODS/28-217--------------------------------------------------------------------------------
A9URK0_MONBE/6-196--------------------------------------------------------------------------------
S3BQX5_OPHP1/29-259--------------------------------------------------------------------------------
Q22453_CAEEL/7-197--------------------------------------------------------------------------------
D8TZN0_VOLCA/4-192--------------------------------------------------------------------------------
E2C7C7_HARSA/7-195--------------------------------------------------------------------------------
T1J4B9_STRMM/5-193--------------------------------------------------------------------------------
F1RF63_PIG/7-195--------------------------------------------------------------------------------
A0A0E1S3B5_COCIM/65-299--------------------------------------------------------------------------------
Q8SRQ6_ENCCU/1-188--------------------------------------------------------------------------------
K3WTR6_PYTUL/19-217--------------------------------------------------------------------------------
M7WK09_RHOT1/118-306--------------------------------------------------------------------------------
M0RRI2_MUSAM/5-212--------------------------------------------------------------------------------
A2FVC5_TRIVA/7-200--------------------------------------------------------------------------------
S2JY24_MUCC1/3-191--------------------------------------------------------------------------------
D8SHD7_SELML/3-194--------------------------------------------------------------------------------
G3JK05_CORMM/45-273--------------------------------------------------------------------------------
W1QG60_OGAPD/3-223--------------------------------------------------------------------------------
SSU72_DICDI/22-214--------------------------------------------------------------------------------
G5E5U5_BOVIN/6-194--------------------------------------------------------------------------------
L5KNK4_PTEAL/5-193--------------------------------------------------------------------------------
C3YRI6_BRAFL/4-196--------------------------------------------------------------------------------
H0WPH8_OTOGA/6-194--------------------------------------------------------------------------------
J9JXC9_ACYPI/6-194--------------------------------------------------------------------------------
Q00U02_OSTTA/10-205--------------------------------------------------------------------------------
F7BTU0_HORSE/6-194--------------------------------------------------------------------------------
E3L5J3_PUCGT/78-267--------------------------------------------------------------------------------
E0W1I3_PEDHC/7-195--------------------------------------------------------------------------------
C4M1T3_ENTHI/14-201--------------------------------------------------------------------------------
I4YAY0_WALMC/36-224--------------------------------------------------------------------------------
G4TIH3_SERID/79-265--------------------------------------------------------------------------------
D0N2F3_PHYIT/2-199--------------------------------------------------------------------------------
F4NZ84_BATDJ/4-201--------------------------------------------------------------------------------
G3SBQ4_GORGO/6-194--------------------------------------------------------------------------------
G8C1Y0_TETPH/6-202--------------------------------------------------------------------------------
G3B7X8_CANTC/13-230--------------------------------------------------------------------------------
F2TVW4_SALR5/85-275--------------------------------------------------------------------------------
L9LDJ3_TUPCH/6-194--------------------------------------------------------------------------------
F7GUF1_CALJA/6-194--------------------------------------------------------------------------------
E4ZJL7_LEPMJ/56-286--------------------------------------------------------------------------------
M7NPB3_PNEMU/8-196--------------------------------------------------------------------------------
D8PRF9_SCHCM/6-190--------------------------------------------------------------------------------
R4XAN6_TAPDE/3-195--------------------------------------------------------------------------------
SSU72_ASHGO/84-281--------------------------------------------------------------------------------
A7S9J1_NEMVE/5-193--------------------------------------------------------------------------------
B6K4R2_SCHJY/7-197--------------------------------------------------------------------------------
SSU72_KLULA/10-207--------------------------------------------------------------------------------
H6BZX6_EXODN/113-347--------------------------------------------------------------------------------
U1HX26_ENDPU/75-307--------------------------------------------------------------------------------
SSU72_YARLI/4-193--------------------------------------------------------------------------------
C1N6C2_MICPC/1-181--------------------------------------------------------------------------------
D5GG44_TUBMM/44-259--------------------------------------------------------------------------------
C5M3Z1_CANTT/9-226--------------------------------------------------------------------------------
T1KEB8_TETUR/6-193--------------------------------------------------------------------------------
G8BC17_CANPC/6-220--------------------------------------------------------------------------------
I3KRS9_ORENI/6-194--------------------------------------------------------------------------------
D3B2Q4_POLPA/40-232--------------------------------------------------------------------------------
H3GZW6_PHYRM/33-222--------------------------------------------------------------------------------
G1XE66_ARTOA/50-284--------------------------------------------------------------------------------
L8Y7B4_TUPCH/6-194--------------------------------------------------------------------------------
F7BYE3_MONDO/6-195--------------------------------------------------------------------------------
C4XWG9_CLAL4/6-225--------------------------------------------------------------------------------
I1R4D5_ORYGL/9-200--------------------------------------------------------------------------------
SSU72_DEBHA/6-223--------------------------------------------------------------------------------
G4N6I8_MAGO7/29-259--------------------------------------------------------------------------------
C4QYQ1_KOMPG/5-230--------------------------------------------------------------------------------
W4ZD81_STRPU/3-191--------------------------------------------------------------------------------
B3S0A9_TRIAD/4-192--------------------------------------------------------------------------------
B8M8F3_TALSN/57-290--------------------------------------------------------------------------------
S9XIA9_SCHCR/7-197--------------------------------------------------------------------------------
G3HMJ7_CRIGR/6-194--------------------------------------------------------------------------------
A7EL18_SCLS1/31-260--------------------------------------------------------------------------------
A2QP66_ASPNC/32-250--------------------------------------------------------------------------------
R4FPS1_RHOPR/6-194--------------------------------------------------------------------------------
Q9C9T0_ARATH/3-193--------------------------------------------------------------------------------
E1BBD9_BOVIN/6-192--------------------------------------------------------------------------------
R7Z2W6_CONA1/31-261--------------------------------------------------------------------------------

PF01451

Y328_SYNY3/3-148--------------------------------------------------------------------------------
WZB_ECOLI/5-139--------------------------------------------------------------------------------
PPAL_YEAST/10-157--------------------------------------------------------------------------------
PPAL_SCHPO/7-152--------------------------------------------------------------------------------
PAP_BACSU/3-142--------------------------------------------------------------------------------
O66881_AQUAE/3-130--------------------------------------------------------------------------------
ARSC_HALSA/9-135--------------------------------------------------------------------------------
ETP_ECOLI/9-143--------------------------------------------------------------------------------
PPAC_HUMAN/9-154--------------------------------------------------------------------------------
YFKJ_BACSU/4-147--------------------------------------------------------------------------------
PTPA_STRCO/5-152--------------------------------------------------------------------------------
O66910_AQUAE/3-135--------------------------------------------------------------------------------
G3XD22_PSEAE/3-134--------------------------------------------------------------------------------
EPSP_RALSO/5-138--------------------------------------------------------------------------------
PTPA_MYCTU/7-148--------------------------------------------------------------------------------

PF02302

Q8Y9U3_LISMO/6-98--------------------------------------------------------------------------------
A0A0B8R667_LISMN/405-496--------------------------------------------------------------------------------
A0A0E0USS5_LISMM/3-94--------------------------------------------------------------------------------
A0A0E0ZVT8_LISMN/4-96--------------------------------------------------------------------------------
A8LVB0_SALAI/11-93--------------------------------------------------------------------------------
Q8YA08_LISMO/4-94--------------------------------------------------------------------------------
Q8Y3Q2_LISMO/3-94--------------------------------------------------------------------------------
B1ZC18_METPB/5-96--------------------------------------------------------------------------------
B0K249_THEPX/6-89--------------------------------------------------------------------------------
B0K277_THEPX/391-475--------------------------------------------------------------------------------
B0K278_THEPX/415-493--------------------------------------------------------------------------------
A9B4K5_HERA2/12-92--------------------------------------------------------------------------------
A9VR06_BACWK/171-262--------------------------------------------------------------------------------
A0A075SKV8_STRSU/407-489--------------------------------------------------------------------------------
A0A126ULG0_STRSU/171-262--------------------------------------------------------------------------------
B0KBP1_THEP3/4-96--------------------------------------------------------------------------------
B0K7D7_THEP3/11-95--------------------------------------------------------------------------------
A8L503_FRASN/11-93--------------------------------------------------------------------------------
A0AL58_LISW6/3-94--------------------------------------------------------------------------------
A0AMB6_LISW6/405-496--------------------------------------------------------------------------------
A0KFQ8_AERHH/380-464--------------------------------------------------------------------------------
A0NIU2_OENOE/10-101--------------------------------------------------------------------------------
A0NKC3_OENOE/2-89--------------------------------------------------------------------------------
A0PYT1_CLONN/2-86--------------------------------------------------------------------------------
A0RA56_BACAH/2-94--------------------------------------------------------------------------------
Q81X06_BACAN/2-94--------------------------------------------------------------------------------
PTFB1_ECOLI/6-98--------------------------------------------------------------------------------
A1T0H1_PSYIN/4-95--------------------------------------------------------------------------------
A1TV02_ACIAC/5-99--------------------------------------------------------------------------------
Q9KR21_VIBCH/165-256--------------------------------------------------------------------------------
A3CN00_STRSV/2-91--------------------------------------------------------------------------------
Q8Y5T3_LISMO/2-82--------------------------------------------------------------------------------
Q8Y3Q0_LISMO/405-496--------------------------------------------------------------------------------
Q92EF3_LISMO/5-90--------------------------------------------------------------------------------
A0A0B1Y986_9BACI/2-82--------------------------------------------------------------------------------
Q9HY57_PSEAE/4-95--------------------------------------------------------------------------------
A3N2Z8_ACTP2/501-584--------------------------------------------------------------------------------
A3N313_ACTP2/2-85--------------------------------------------------------------------------------
A3UUG8_VIBS1/382-474--------------------------------------------------------------------------------
A4ALK2_9ACTN/177-268--------------------------------------------------------------------------------
A4BB46_9GAMM/4-93--------------------------------------------------------------------------------
Q8Y8I8_LISMO/3-95--------------------------------------------------------------------------------
A4E6N6_9ACTN/7-100--------------------------------------------------------------------------------
A4EB76_9ACTN/4-100--------------------------------------------------------------------------------
A4SM92_AERS4/4-95--------------------------------------------------------------------------------
A4VI86_PSEU5/4-95--------------------------------------------------------------------------------
A4VY52_STRSY/3-96--------------------------------------------------------------------------------
A4VY53_STRSY/407-489--------------------------------------------------------------------------------
A4W4U8_ENT38/3-95--------------------------------------------------------------------------------
A4WQ54_RHOS5/5-99--------------------------------------------------------------------------------
A5CU90_CLAM3/4-88--------------------------------------------------------------------------------
A5EVD5_DICNV/160-251--------------------------------------------------------------------------------
A5FUY5_ACICJ/5-96--------------------------------------------------------------------------------
A5IZ78_MYCAP/2-87--------------------------------------------------------------------------------
R5QWP1_9FIRM/174-265--------------------------------------------------------------------------------
A5KWZ6_VIBBS/3-87--------------------------------------------------------------------------------
A0A0B7LQ27_STREE/1-66--------------------------------------------------------------------------------
G6LWB5_STREE/5-99--------------------------------------------------------------------------------
G6JAR1_STREE/463-547--------------------------------------------------------------------------------
A5LK37_STREE/457-551--------------------------------------------------------------------------------
A0A0U0GRH3_STREE/457-551--------------------------------------------------------------------------------
J0UTL7_STREE/3-93--------------------------------------------------------------------------------
A0A0B7L304_STREE/457-551--------------------------------------------------------------------------------
A5Z556_9FIRM/8-91--------------------------------------------------------------------------------
A5ZAC0_9FIRM/2-92--------------------------------------------------------------------------------
A6CWH3_9VIBR/2-94--------------------------------------------------------------------------------
A6D1Q5_9VIBR/4-96--------------------------------------------------------------------------------
A6D1R0_9VIBR/5-97--------------------------------------------------------------------------------
A6F1Q1_9ALTE/4-95--------------------------------------------------------------------------------
A6LQT5_CLOB8/389-473--------------------------------------------------------------------------------
A6LS05_CLOB8/2-95--------------------------------------------------------------------------------
A6LWT9_CLOB8/2-80--------------------------------------------------------------------------------
A6LX11_CLOB8/2-87--------------------------------------------------------------------------------
A6LZZ9_CLOB8/3-94--------------------------------------------------------------------------------
A6M2G2_CLOB8/3-95--------------------------------------------------------------------------------
A6NRV7_9FIRM/3-95--------------------------------------------------------------------------------
A6T5D3_KLEP7/3-85--------------------------------------------------------------------------------
A6T9A2_KLEP7/4-96--------------------------------------------------------------------------------
A6T9A6_KLEP7/3-86--------------------------------------------------------------------------------
A6TVQ8_ALKMQ/3-95--------------------------------------------------------------------------------
A6V1N4_PSEA7/123-214--------------------------------------------------------------------------------
A6VLW3_ACTSZ/4-100--------------------------------------------------------------------------------
D7HCF5_VIBCL/127-218--------------------------------------------------------------------------------
Q0WJQ9_YERPE/6-98--------------------------------------------------------------------------------
A7GIU6_CLOBL/3-95--------------------------------------------------------------------------------
M9WXN5_MANHA/366-450--------------------------------------------------------------------------------
A7MI94_CROS8/168-260--------------------------------------------------------------------------------
A0A017I5Q2_ECOLX/5-97--------------------------------------------------------------------------------
A8AKT6_CITK8/3-95--------------------------------------------------------------------------------
A0A0F2D688_STRMT/3-86--------------------------------------------------------------------------------
A0A0F2CZG4_STRMT/3-97--------------------------------------------------------------------------------
A8F9K0_BACP2/4-96--------------------------------------------------------------------------------
A8FC85_BACP2/4-86--------------------------------------------------------------------------------
A8FIW5_BACP2/3-99--------------------------------------------------------------------------------
A8GJM8_SERP5/3-95--------------------------------------------------------------------------------
D5AMJ5_RHOCB/5-96--------------------------------------------------------------------------------
D5AMJ5_RHOCB/120-211--------------------------------------------------------------------------------
PTF3A_MYCGE/169-261--------------------------------------------------------------------------------
MNGA_ECOLI/187-279--------------------------------------------------------------------------------
Q034F1_LACC3/4-88--------------------------------------------------------------------------------
Q03GK6_PEDPA/4-95--------------------------------------------------------------------------------
Q03HS3_PEDPA/7-98--------------------------------------------------------------------------------
Q03UQ7_LEUMM/2-88--------------------------------------------------------------------------------
Q03XM7_LEUMM/5-97--------------------------------------------------------------------------------
Q03XN8_LEUMM/3-102--------------------------------------------------------------------------------
A0A087QC51_LACGS/22-116--------------------------------------------------------------------------------
Q04H52_OENOB/3-90--------------------------------------------------------------------------------
Q8DQZ0_STRR6/457-551--------------------------------------------------------------------------------
Q08XD4_STIAD/4-95--------------------------------------------------------------------------------
Q0SL49_BORAP/2-94