Sequence alignment for CL0032

PF07876

Q748N1_GEOSL/2-96--------------------------------------------------------------------------------
A9CJX0_AGRT5/2-102--------------------------------------------------------------------------------
Q740A8_MYCPA/82-179--------------------------------------------------------------------------------
Q7S333_NEUCR/57-160--------------------------------------------------------------------------------
Q98H26_RHILO/2-102--------------------------------------------------------------------------------
Y4036_STRCO/2-97--------------------------------------------------------------------------------
Q89RS9_BRADU/5-102--------------------------------------------------------------------------------
Q9SYD8_ARATH/116-206--------------------------------------------------------------------------------
Q9SYD8_ARATH/5-102--------------------------------------------------------------------------------
Q8XM37_CLOPE/2-100--------------------------------------------------------------------------------
Q98BN1_RHILO/2-96--------------------------------------------------------------------------------
Q7MWG5_PORGI/2-100--------------------------------------------------------------------------------
Q7UFZ5_RHOBA/16-113--------------------------------------------------------------------------------
POP3_ARATH/8-104--------------------------------------------------------------------------------
Y5258_ARATH/6-100--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/40-141--------------------------------------------------------------------------------
Q7N2N7_PHOLL/12-107--------------------------------------------------------------------------------
Q9SIP1_ARATH/158-254--------------------------------------------------------------------------------
Q7SEW8_NEUCR/10-117--------------------------------------------------------------------------------
Q7D0A2_AGRT5/2-93--------------------------------------------------------------------------------
Q726I9_DESVH/2-101--------------------------------------------------------------------------------
Q7URH4_RHOBA/33-129--------------------------------------------------------------------------------
Q97LN9_CLOAB/2-94--------------------------------------------------------------------------------
Q6LGQ4_PHOPR/2-98--------------------------------------------------------------------------------
Q8KCZ4_CHLTE/2-100--------------------------------------------------------------------------------
Q7S418_NEUCR/3-107--------------------------------------------------------------------------------
Q8ABC5_BACTN/2-99--------------------------------------------------------------------------------
Q6LYV0_METMP/2-100--------------------------------------------------------------------------------
Q82QQ6_STRAW/2-93--------------------------------------------------------------------------------
Q9F304_STRCO/2-93--------------------------------------------------------------------------------
Q9SIP1_ARATH/49-144--------------------------------------------------------------------------------
Q8RF81_FUSNN/2-98--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/154-248--------------------------------------------------------------------------------
Q9A628_CAUCR/2-100--------------------------------------------------------------------------------
B9HX68_POPTR/9-106--------------------------------------------------------------------------------
B9HX69_POPTR/16-111--------------------------------------------------------------------------------
H2VFL6_ZYMMO/42-154--------------------------------------------------------------------------------
H7C7T4_BRADU/2-94--------------------------------------------------------------------------------
Q2YP23_BRUA2/2-92--------------------------------------------------------------------------------
Q8LQD2_ORYSJ/11-106--------------------------------------------------------------------------------

PF03992

HMOA_BACSU/1-78--------------------------------------------------------------------------------
Q930A7_RHIME/30-107--------------------------------------------------------------------------------
Q9L164_STRCO/44-120--------------------------------------------------------------------------------
Q930L9_RHIME/3-79--------------------------------------------------------------------------------
HDOX_LISMO/1-86--------------------------------------------------------------------------------
WH42_STRCO/45-121--------------------------------------------------------------------------------
Q8Y476_LISMO/1-77--------------------------------------------------------------------------------
Q98L66_RHILO/1-81--------------------------------------------------------------------------------
Q98HA4_RHILO/1-77--------------------------------------------------------------------------------
Q9A6W1_CAUCR/113-186--------------------------------------------------------------------------------
O33291_MYCTU/2-75--------------------------------------------------------------------------------
Q8YAL6_LISMO/1-77--------------------------------------------------------------------------------
Q5LR19_RUEPO/12-92--------------------------------------------------------------------------------
NECA1_HUMAN/251-326--------------------------------------------------------------------------------
Q8XYB2_RALSO/23-99--------------------------------------------------------------------------------
Q9CLF6_PASMU/1-77--------------------------------------------------------------------------------
Q8NLF1_CORGL/2-78--------------------------------------------------------------------------------
O06569_MYCTU/1-77--------------------------------------------------------------------------------
Q8NRX5_CORGL/1-76--------------------------------------------------------------------------------
Q9I1R9_PSEAE/4-80--------------------------------------------------------------------------------
Q9I267_PSEAE/43-119--------------------------------------------------------------------------------
Q9RTW6_DEIRA/23-100--------------------------------------------------------------------------------
Q9RXN8_DEIRA/1-77--------------------------------------------------------------------------------
Q9FC02_STRCO/14-92--------------------------------------------------------------------------------
Q9K649_BACHD/1-78--------------------------------------------------------------------------------
Q92MY2_RHIME/1-77--------------------------------------------------------------------------------
HDOX_BACHD/1-78--------------------------------------------------------------------------------
Q9RX23_DEIRA/3-80--------------------------------------------------------------------------------
Q92N21_RHIME/1-81--------------------------------------------------------------------------------
NECA2_HUMAN/285-360--------------------------------------------------------------------------------
Q8XW80_RALSO/11-88--------------------------------------------------------------------------------
Q9HY51_PSEAE/4-80--------------------------------------------------------------------------------
Q97V29_SULSO/1-78--------------------------------------------------------------------------------
Y1783_SYNY3/49-125--------------------------------------------------------------------------------
A9CGS9_AGRT5/10-86--------------------------------------------------------------------------------
Y2021_HALSA/401-477--------------------------------------------------------------------------------
Q8UIT6_AGRT5/6-83--------------------------------------------------------------------------------
Q8NRX6_CORGL/1-76--------------------------------------------------------------------------------
Q9ABN2_CAUCR/2-78--------------------------------------------------------------------------------
Q9YCC3_AERPE/2-78--------------------------------------------------------------------------------
Q8TTU6_METAC/1-76--------------------------------------------------------------------------------
Q9X9W3_STRCO/128-214--------------------------------------------------------------------------------
O54100_STRCO/29-106--------------------------------------------------------------------------------
Q9CFE4_LACLA/2-80--------------------------------------------------------------------------------
Q92Y06_RHIME/4-80--------------------------------------------------------------------------------
YQJZ_BACSU/12-86--------------------------------------------------------------------------------
Q8PEE0_XANCP/7-83--------------------------------------------------------------------------------
A9CLL3_AGRT5/1-78--------------------------------------------------------------------------------
Q9HYL5_PSEAE/1-78--------------------------------------------------------------------------------
Q7CRR7_AGRT5/5-81--------------------------------------------------------------------------------
Q9HHS4_HALSA/1-77--------------------------------------------------------------------------------
Q9I5L9_PSEAE/2-79--------------------------------------------------------------------------------
Q8KL47_RHIEC/8-84--------------------------------------------------------------------------------
LSRG_ECOLI/1-77--------------------------------------------------------------------------------
Q98HP0_RHILO/1-74--------------------------------------------------------------------------------
Q8Y824_LISMO/4-80--------------------------------------------------------------------------------
Q9I6L9_PSEAE/2-78--------------------------------------------------------------------------------
Q9KLV5_VIBCH/1-77--------------------------------------------------------------------------------
Q983R7_RHILO/10-88--------------------------------------------------------------------------------
NECA3_HUMAN/295-370--------------------------------------------------------------------------------
Q8NMA1_CORGL/2-78--------------------------------------------------------------------------------
Q9RSM4_DEIRA/18-94--------------------------------------------------------------------------------
Y0793_MYCTU/4-79--------------------------------------------------------------------------------
Q9JYI1_NEIMB/3-79--------------------------------------------------------------------------------
Q9A6G2_CAUCR/1-78--------------------------------------------------------------------------------
Q9I1K5_PSEAE/247-321--------------------------------------------------------------------------------
Q97DS8_CLOAB/1-78--------------------------------------------------------------------------------
Q9CHY3_LACLA/1-77--------------------------------------------------------------------------------
A9CJ79_AGRT5/1-77--------------------------------------------------------------------------------
Q98DQ1_RHILO/1-77--------------------------------------------------------------------------------
HMOB_BACSU/65-140--------------------------------------------------------------------------------
YCZJ_BACSU/1-78--------------------------------------------------------------------------------
Q9RSI3_DEIRA/10-86--------------------------------------------------------------------------------
Q92VV2_RHIME/1-77--------------------------------------------------------------------------------
Q8RDZ4_FUSNN/112-188--------------------------------------------------------------------------------
A9CHT4_AGRT5/1-79--------------------------------------------------------------------------------
Q9RKA2_STRCO/1-77--------------------------------------------------------------------------------
Q9ZBJ4_STRCO/2-77--------------------------------------------------------------------------------
Q9RX69_DEIRA/1-77--------------------------------------------------------------------------------
YCNE_BACSU/1-77--------------------------------------------------------------------------------
A5FGC9_FLAJ1/1-73--------------------------------------------------------------------------------
A9WHE0_CHLAA/1-72--------------------------------------------------------------------------------
H7C6P0_BRADU/1-79--------------------------------------------------------------------------------
YGIN_ECOLI/1-87--------------------------------------------------------------------------------
MHUD_MYCTU/3-76--------------------------------------------------------------------------------
Q2FV13_STAA8/45-118--------------------------------------------------------------------------------
HDOX1_STAA8/3-78--------------------------------------------------------------------------------
HDOX2_STAA8/1-77--------------------------------------------------------------------------------
Q2K560_RHIEC/1-80--------------------------------------------------------------------------------
Q2YKI2_BRUA2/1-80--------------------------------------------------------------------------------
Q2YLT4_BRUA2/1-77--------------------------------------------------------------------------------
Q79ZD9_STRAW/18-90--------------------------------------------------------------------------------
Q8CZ78_STRR6/12-86--------------------------------------------------------------------------------
X2H731_9GAMM/1-76--------------------------------------------------------------------------------

PF11695

Q9A5F4_CAUCR/31-168--------------------------------------------------------------------------------
F8EE97_RUNSL/6-145--------------------------------------------------------------------------------
A4XU80_PSEMY/15-152--------------------------------------------------------------------------------
G8TAU1_NIAKG/5-143--------------------------------------------------------------------------------
Q0RPH8_FRAAA/6-148--------------------------------------------------------------------------------
Q0RBQ9_FRAAA/10-153--------------------------------------------------------------------------------
G0FWI4_AMYMS/6-149--------------------------------------------------------------------------------
E0TC84_PARBH/7-144--------------------------------------------------------------------------------
Q9XAE9_STRCO/9-147--------------------------------------------------------------------------------
U5W6J8_9ACTO/6-143--------------------------------------------------------------------------------
C6WHE5_ACTMD/7-164--------------------------------------------------------------------------------
Q0APS8_MARMM/5-139--------------------------------------------------------------------------------
Q163R1_ROSDO/8-148--------------------------------------------------------------------------------
E4N6J1_KITSK/26-165--------------------------------------------------------------------------------
I2EVC9_EMTOG/6-144--------------------------------------------------------------------------------
G0L103_ZOBGA/6-144--------------------------------------------------------------------------------
M4ZXH9_9ACTN/6-146--------------------------------------------------------------------------------
D2QP51_SPILD/3-141--------------------------------------------------------------------------------
A1WRH2_VEREI/5-143--------------------------------------------------------------------------------
K0EXQ7_9NOCA/7-138--------------------------------------------------------------------------------
U5QGK2_9CYAN/8-146--------------------------------------------------------------------------------
S6AKH1_PSERE/7-144--------------------------------------------------------------------------------
I0K5K2_9BACT/3-141--------------------------------------------------------------------------------
D2ATU4_STRRD/6-142--------------------------------------------------------------------------------
M4XI80_PSEDE/7-145--------------------------------------------------------------------------------
Q027R7_SOLUE/5-143--------------------------------------------------------------------------------
A4FAH4_SACEN/6-145--------------------------------------------------------------------------------
E2Q5L4_STRC2/8-147--------------------------------------------------------------------------------
E3J464_FRASU/10-153--------------------------------------------------------------------------------
B0T5Z4_CAUSK/7-144--------------------------------------------------------------------------------
F4KSW9_HALH1/6-143--------------------------------------------------------------------------------
K0C7N6_ALCDB/6-143--------------------------------------------------------------------------------
I0HGL4_ACTM4/6-144--------------------------------------------------------------------------------
Q0BYF9_HYPNA/5-155--------------------------------------------------------------------------------
C7QH43_CATAD/16-156--------------------------------------------------------------------------------
D6X6B2_STRPR/13-151--------------------------------------------------------------------------------
G8SIB6_ACTS5/6-144--------------------------------------------------------------------------------
B9JB79_AGRRK/2-147--------------------------------------------------------------------------------
B9JTF5_AGRVS/7-155--------------------------------------------------------------------------------
A9B229_HERA2/6-143--------------------------------------------------------------------------------
R4LEJ6_9ACTO/5-162--------------------------------------------------------------------------------
D7B9L7_NOCDD/15-153--------------------------------------------------------------------------------
F4AZ85_KROS4/5-144--------------------------------------------------------------------------------
V9VXL5_9RHOB/7-167--------------------------------------------------------------------------------
C5BJX2_TERTT/5-143--------------------------------------------------------------------------------
M9R7J4_9RHOB/3-143--------------------------------------------------------------------------------
F3ZD85_9ACTO/31-189--------------------------------------------------------------------------------
A1K291_AZOSB/3-140--------------------------------------------------------------------------------
H2JWD5_STRHJ/4-164--------------------------------------------------------------------------------
S5VG62_STRCU/12-150--------------------------------------------------------------------------------
Q2JDS7_FRASC/6-148--------------------------------------------------------------------------------
Q15UR5_PSEA6/3-141--------------------------------------------------------------------------------

PF07682

C7LRC9_DESBD/11-306--------------------------------------------------------------------------------
L0DXR4_THIND/8-328--------------------------------------------------------------------------------
F8I6C7_SULAT/3-301--------------------------------------------------------------------------------
O66762_AQUAE/8-332--------------------------------------------------------------------------------
Q6L0W6_PICTO/3-301--------------------------------------------------------------------------------
F4B4D5_ACIHW/1-294--------------------------------------------------------------------------------
G0JQP4_9GAMM/4-306--------------------------------------------------------------------------------
D0L035_HALNC/5-309--------------------------------------------------------------------------------
L0DTB9_THIND/25-315--------------------------------------------------------------------------------
Q972K4_SULTO/3-303--------------------------------------------------------------------------------

PF07978

Q7PGV6_ANOGA/173-270--------------------------------------------------------------------------------
Q7SGJ2_NEUCR/232-329--------------------------------------------------------------------------------
Q5LMH4_RUEPO/1-102--------------------------------------------------------------------------------
Q6W252_RHISN/3-102--------------------------------------------------------------------------------
Q98EJ3_RHILO/1-102--------------------------------------------------------------------------------
Q89P12_BRADU/7-101--------------------------------------------------------------------------------
Q89KU9_BRADU/3-106--------------------------------------------------------------------------------
Q82QD1_STRAW/4-107--------------------------------------------------------------------------------
NIPS2_MOUSE/182-279--------------------------------------------------------------------------------
Q98DQ0_RHILO/2-103--------------------------------------------------------------------------------
Q98IN9_RHILO/48-151--------------------------------------------------------------------------------
Q89JD9_BRADU/9-109--------------------------------------------------------------------------------
Q5M949_RAT/37-136--------------------------------------------------------------------------------
Q7VX89_BORPE/3-102--------------------------------------------------------------------------------
Q983U2_RHILO/146-257--------------------------------------------------------------------------------
NIPS1_MOUSE/185-282--------------------------------------------------------------------------------
Q88JP3_PSEPK/3-104--------------------------------------------------------------------------------
Q6C7U3_YARLI/393-490--------------------------------------------------------------------------------
Q5M949_RAT/146-245--------------------------------------------------------------------------------
Q89P26_BRADU/3-96--------------------------------------------------------------------------------
Q89P26_BRADU/107-202--------------------------------------------------------------------------------
Q983U2_RHILO/19-118--------------------------------------------------------------------------------
A9CLJ4_AGRT5/3-102--------------------------------------------------------------------------------
NPS3A_PONAB/37-136--------------------------------------------------------------------------------
A9CJ80_AGRT5/1-102--------------------------------------------------------------------------------
YMQ1_CAEEL/427-524--------------------------------------------------------------------------------
Q63UF8_BURPS/3-102--------------------------------------------------------------------------------
Q6N5T9_RHOPA/71-174--------------------------------------------------------------------------------
Q7UP06_RHOBA/160-263--------------------------------------------------------------------------------
A6VZH8_MARMS/5-99--------------------------------------------------------------------------------
F1QWR0_DANRE/62-160--------------------------------------------------------------------------------
F6W3L2_XENTR/18-115--------------------------------------------------------------------------------
Q0P468_DANRE/179-276--------------------------------------------------------------------------------
Q2YLT3_BRUA2/5-100--------------------------------------------------------------------------------
S6AQW2_PSERE/106-203--------------------------------------------------------------------------------

PF07237

B5GYT2_STRC2/1-95--------------------------------------------------------------------------------
Q28SF7_JANSC/2-97--------------------------------------------------------------------------------
B9J727_AGRRK/3-103--------------------------------------------------------------------------------
Q8PBE1_XANCP/2-103--------------------------------------------------------------------------------
D2R596_PIRSD/2-117--------------------------------------------------------------------------------
J7QVW7_METSZ/2-102--------------------------------------------------------------------------------
Q0C3F1_HYPNA/123-216--------------------------------------------------------------------------------
Q1D7D3_MYXXD/125-223--------------------------------------------------------------------------------
V5S991_9RHIZ/2-103--------------------------------------------------------------------------------
G8ATI6_AZOBR/2-107--------------------------------------------------------------------------------
A6X0L9_OCHA4/2-103--------------------------------------------------------------------------------
K0CB81_ALCDB/2-104--------------------------------------------------------------------------------
K9SFX5_9CYAN/2-103--------------------------------------------------------------------------------
Q0ANC9_MARMM/2-101--------------------------------------------------------------------------------
Q82XJ8_NITEU/2-114--------------------------------------------------------------------------------
X4ZS72_9BORD/3-104--------------------------------------------------------------------------------
E3F379_KETVY/2-102--------------------------------------------------------------------------------
B2FL05_STRMK/2-104--------------------------------------------------------------------------------
Q89NE4_BRADU/4-102--------------------------------------------------------------------------------
Q2NCG7_ERYLH/1-101--------------------------------------------------------------------------------
F6IFW1_9SPHN/2-103--------------------------------------------------------------------------------
A4YT03_BRASO/13-113--------------------------------------------------------------------------------
B8EQ30_METSB/3-103--------------------------------------------------------------------------------
G2IQJ1_9SPHN/7-107--------------------------------------------------------------------------------
B8IJU9_METNO/2-103--------------------------------------------------------------------------------
C7RAK3_KANKD/4-105--------------------------------------------------------------------------------
I3U9U4_ADVKW/2-103--------------------------------------------------------------------------------
A1W852_ACISJ/5-103--------------------------------------------------------------------------------
A9FY32_SORC5/2-103--------------------------------------------------------------------------------
W0AJL6_9SPHN/125-224--------------------------------------------------------------------------------
I4B2R6_TURPD/2-101--------------------------------------------------------------------------------
I0HMS9_RUBGI/2-107--------------------------------------------------------------------------------
Q89LX7_BRADU/1-101--------------------------------------------------------------------------------
M4S0F5_9SPHN/3-103--------------------------------------------------------------------------------
S6AFX9_PSERE/2-103--------------------------------------------------------------------------------
D7A8V6_STAND/2-103--------------------------------------------------------------------------------
Q21G53_SACD2/2-103--------------------------------------------------------------------------------
C7R6A1_KANKD/1-102--------------------------------------------------------------------------------
B2JM74_BURP8/2-103--------------------------------------------------------------------------------
E1V408_HALED/2-103--------------------------------------------------------------------------------
Q92NA2_RHIME/2-103--------------------------------------------------------------------------------
C5CJX4_VARPS/4-105--------------------------------------------------------------------------------
F5XY16_RAMTT/2-117--------------------------------------------------------------------------------
A1B4H4_PARDP/2-102--------------------------------------------------------------------------------
A7HVY2_PARL1/2-102--------------------------------------------------------------------------------
I3TII5_TISMK/5-105--------------------------------------------------------------------------------
Q09CK7_STIAD/2-103--------------------------------------------------------------------------------
D0J6R4_COMT2/2-106--------------------------------------------------------------------------------
B6ITX3_RHOCS/21-122--------------------------------------------------------------------------------
Q0C3F1_HYPNA/2-102--------------------------------------------------------------------------------
G8R5I7_OWEHD/3-96--------------------------------------------------------------------------------
N0B831_9RHIZ/2-103--------------------------------------------------------------------------------
A9C096_DELAS/2-104--------------------------------------------------------------------------------
B2ID24_BEII9/3-104--------------------------------------------------------------------------------
Q0K872_CUPNH/2-103--------------------------------------------------------------------------------
F7QJ30_9BRAD/2-105--------------------------------------------------------------------------------
G2IQA6_9SPHN/2-100--------------------------------------------------------------------------------
B3PD68_CELJU/3-105--------------------------------------------------------------------------------
A9IUP3_BORPD/4-105--------------------------------------------------------------------------------
E6WPA7_PSEUU/2-104--------------------------------------------------------------------------------
Q984U4_RHILO/2-103--------------------------------------------------------------------------------
B4RHI4_PHEZH/3-103--------------------------------------------------------------------------------
B2ID24_BEII9/126-226--------------------------------------------------------------------------------
Q15TI8_PSEA6/2-104--------------------------------------------------------------------------------
F8J4V4_HYPSM/2-103--------------------------------------------------------------------------------
Q12MS1_SHEDO/2-103--------------------------------------------------------------------------------
G8MEM7_9BURK/3-106--------------------------------------------------------------------------------
R9VVL6_9ENTR/2-103--------------------------------------------------------------------------------
D0LSP9_HALO1/2-102--------------------------------------------------------------------------------
E8RPL4_ASTEC/2-103--------------------------------------------------------------------------------
Q7VWQ1_BORPE/3-103--------------------------------------------------------------------------------
C7NJF5_KYTSD/19-131--------------------------------------------------------------------------------
A9WHX6_CHLAA/3-114--------------------------------------------------------------------------------
W0AJL6_9SPHN/2-103--------------------------------------------------------------------------------
B1ZRB2_OPITP/3-106--------------------------------------------------------------------------------
K9UEC3_9CHRO/2-102--------------------------------------------------------------------------------
Q984U4_RHILO/125-217--------------------------------------------------------------------------------
D4Z3X9_SPHJU/2-103--------------------------------------------------------------------------------
G4RAE0_PELHB/3-101--------------------------------------------------------------------------------
K9RSJ8_SYNP3/2-117--------------------------------------------------------------------------------
A8AJZ2_CITK8/2-103--------------------------------------------------------------------------------
A7HVY2_PARL1/124-224--------------------------------------------------------------------------------
E0TG43_PARBH/2-101--------------------------------------------------------------------------------
A5V8A2_SPHWW/3-103--------------------------------------------------------------------------------
W6RB51_9RHIZ/2-103--------------------------------------------------------------------------------
E1WZE7_BACMS/3-105--------------------------------------------------------------------------------
E3HXD2_ACHXA/3-103--------------------------------------------------------------------------------
E3F379_KETVY/124-225--------------------------------------------------------------------------------
Q3J6F6_RHOS4/3-101--------------------------------------------------------------------------------
C6XML8_HIRBI/2-102--------------------------------------------------------------------------------
D2S2U1_HALTV/4-110--------------------------------------------------------------------------------
B8IGF6_METNO/2-102--------------------------------------------------------------------------------
B6JDI6_OLICO/2-105--------------------------------------------------------------------------------
Q6MH99_BDEBA/3-105--------------------------------------------------------------------------------
Q1GX81_SPHAL/125-226--------------------------------------------------------------------------------
Q1GX81_SPHAL/2-103--------------------------------------------------------------------------------
F5Y4J2_RAMTT/2-105--------------------------------------------------------------------------------
Q98HZ3_RHILO/2-103--------------------------------------------------------------------------------
E8RPL3_ASTEC/12-111--------------------------------------------------------------------------------
M4NEX2_9GAMM/2-102--------------------------------------------------------------------------------
U4KCB2_9VIBR/2-103--------------------------------------------------------------------------------
M4VN50_9DELT/3-103--------------------------------------------------------------------------------
B8GIK1_METPE/2-107--------------------------------------------------------------------------------
Q11C17_CHESB/2-101--------------------------------------------------------------------------------
D3SAH4_THISK/2-95--------------------------------------------------------------------------------
K4KKH1_SIMAS/2-104--------------------------------------------------------------------------------
Q1D7D3_MYXXD/2-103--------------------------------------------------------------------------------
W0JAW7_9BACT/3-105--------------------------------------------------------------------------------
H5WRE5_9BURK/2-103--------------------------------------------------------------------------------
D9QND0_BRESC/3-101--------------------------------------------------------------------------------
E3I2U0_RHOVT/2-102--------------------------------------------------------------------------------
B0T2P9_CAUSK/2-103--------------------------------------------------------------------------------
A7HS11_PARL1/2-103--------------------------------------------------------------------------------
A1U2N5_MARAV/2-103--------------------------------------------------------------------------------
A2SLW6_METPP/28-129--------------------------------------------------------------------------------

PF05336

E8N7B3_MICTS/3-106--------------------------------------------------------------------------------
G8NW33_GRAMM/3-106--------------------------------------------------------------------------------
R6A9X3_9BACT/17-125--------------------------------------------------------------------------------
Q2G5L0_NOVAD/2-105--------------------------------------------------------------------------------
E3J5G6_FRASU/3-105--------------------------------------------------------------------------------
RHAM_CLOB8/3-103--------------------------------------------------------------------------------
F3Y8K3_MELPT/17-117--------------------------------------------------------------------------------
D1BAI9_SANKS/1-101--------------------------------------------------------------------------------
R6EFZ5_9FIRM/3-103--------------------------------------------------------------------------------
E8V1U4_TERSS/3-109--------------------------------------------------------------------------------
Q8A1J5_BACTN/18-126--------------------------------------------------------------------------------
G8UKT9_TANFA/3-106--------------------------------------------------------------------------------
R7BFW5_9FIRM/6-107--------------------------------------------------------------------------------
C6VV82_DYAFD/7-106--------------------------------------------------------------------------------
X2H2T6_9GAMM/3-103--------------------------------------------------------------------------------
X6NJ28_RETFI/26-133--------------------------------------------------------------------------------
RHAM_ROSDO/4-104--------------------------------------------------------------------------------
R6NFT0_9BACE/3-109--------------------------------------------------------------------------------
C6Y2X4_PEDHD/3-103--------------------------------------------------------------------------------
M9R5B0_9RHOB/4-104--------------------------------------------------------------------------------
D8MRW2_ERWBE/3-103--------------------------------------------------------------------------------
S6C4A1_9ACTN/4-102--------------------------------------------------------------------------------
R7J4V8_9PORP/3-106--------------------------------------------------------------------------------
L0G2V5_ECHVK/4-110--------------------------------------------------------------------------------
R6YJI9_9BACE/3-109--------------------------------------------------------------------------------
D7CRS7_TRURR/5-108--------------------------------------------------------------------------------
M4WU28_PSEDE/4-110--------------------------------------------------------------------------------
E8WVL5_ACISM/3-109--------------------------------------------------------------------------------
R5F8H2_9CLOT/21-121--------------------------------------------------------------------------------
Q017X5_OSTTA/20-125--------------------------------------------------------------------------------
V2XST4_MONRO/8-118--------------------------------------------------------------------------------
RHAM_BURXL/3-103--------------------------------------------------------------------------------
D3FCI7_CONWI/3-103--------------------------------------------------------------------------------
F5YG46_TREAZ/3-104--------------------------------------------------------------------------------
X5DE39_9BACT/3-103--------------------------------------------------------------------------------
C7MF49_BRAFD/3-102--------------------------------------------------------------------------------
A6KWX7_BACV8/17-125--------------------------------------------------------------------------------
G2R0M2_THITE/36-147--------------------------------------------------------------------------------
R5CS86_9BACT/17-125--------------------------------------------------------------------------------
R5GT53_9BACT/20-128--------------------------------------------------------------------------------
U5VPP9_9ACTO/2-101--------------------------------------------------------------------------------
D1AQR2_SEBTE/6-106--------------------------------------------------------------------------------
F0RIC4_CELLC/5-113--------------------------------------------------------------------------------
H1YCQ6_9SPHI/3-103--------------------------------------------------------------------------------
RHAM_RHISN/3-103--------------------------------------------------------------------------------
M3CIR2_SPHMS/7-117--------------------------------------------------------------------------------
H6MRG6_GORPV/6-114--------------------------------------------------------------------------------
R6W2E5_9BACT/17-125--------------------------------------------------------------------------------
H1W373_COLHI/35-146--------------------------------------------------------------------------------
B7FV54_PHATC/57-181--------------------------------------------------------------------------------
R6RUK4_9BACE/17-125--------------------------------------------------------------------------------
G0FMG2_AMYMS/3-105--------------------------------------------------------------------------------
C6XPT9_HIRBI/4-112--------------------------------------------------------------------------------
RHAM_FLAJ1/6-106--------------------------------------------------------------------------------
RHAM_DINSH/3-103--------------------------------------------------------------------------------
E8V2R3_TERSS/3-104--------------------------------------------------------------------------------
Q8A896_BACTN/19-127--------------------------------------------------------------------------------
G8MFN0_9BURK/3-103--------------------------------------------------------------------------------
Q7CW72_AGRT5/3-108--------------------------------------------------------------------------------
L8GD23_PSED2/77-185--------------------------------------------------------------------------------
M2SXV3_COCH5/9-120--------------------------------------------------------------------------------
T2KM13_9FLAO/3-103--------------------------------------------------------------------------------
F2RHJ8_STRVP/6-108--------------------------------------------------------------------------------
N1PM30_MYCP1/6-116--------------------------------------------------------------------------------
Q9HK61_THEAC/2-100--------------------------------------------------------------------------------
A4AQM8_MARSH/3-108--------------------------------------------------------------------------------
C4Z7U2_EUBE2/3-103--------------------------------------------------------------------------------
C6XTA6_PEDHD/3-103--------------------------------------------------------------------------------
W0F136_9SPHI/3-111--------------------------------------------------------------------------------
Q5LC58_BACFN/3-109--------------------------------------------------------------------------------
I0IAI8_PHYMF/3-105--------------------------------------------------------------------------------
J0WX79_AURDE/7-117--------------------------------------------------------------------------------
R6LCZ2_9BACE/19-127--------------------------------------------------------------------------------
R6SDC5_9BACE/16-124--------------------------------------------------------------------------------
R6ARE3_9BACT/15-123--------------------------------------------------------------------------------
W0HYB7_9ENTR/6-109--------------------------------------------------------------------------------
B2JWP2_BURP8/2-109--------------------------------------------------------------------------------
RHAM_VEREI/5-105--------------------------------------------------------------------------------
R7JMG1_9PORP/19-127--------------------------------------------------------------------------------
W0EWF3_9SPHI/3-103--------------------------------------------------------------------------------
G2PEQ1_STRVO/2-106--------------------------------------------------------------------------------
I2ETX1_EMTOG/3-109--------------------------------------------------------------------------------
S0DRY9_GIBF5/8-120--------------------------------------------------------------------------------
W5VZF1_9PSEU/4-102--------------------------------------------------------------------------------
F0SAK4_PEDSD/3-109--------------------------------------------------------------------------------
RHAM_ENTFA/3-103--------------------------------------------------------------------------------
C1D3L6_DEIDV/10-112--------------------------------------------------------------------------------
D3AYF8_POLPA/5-111--------------------------------------------------------------------------------
Q63M67_BURPS/2-109--------------------------------------------------------------------------------
G3B870_CANTC/9-119--------------------------------------------------------------------------------
G8TJY9_NIAKG/2-108--------------------------------------------------------------------------------
A9WV51_RENSM/8-106--------------------------------------------------------------------------------
F8ENG6_RUNSL/3-109--------------------------------------------------------------------------------
G0FVD6_AMYMS/4-107--------------------------------------------------------------------------------
C7Q375_CATAD/3-106--------------------------------------------------------------------------------
C6CYW6_PAESJ/6-107--------------------------------------------------------------------------------
C7PCA4_CHIPD/3-109--------------------------------------------------------------------------------
T0N5S5_9EURY/2-100--------------------------------------------------------------------------------
Q0C0B4_HYPNA/3-108--------------------------------------------------------------------------------
G8TRD5_NIAKG/34-141--------------------------------------------------------------------------------
B5HUQ0_9ACTO/3-106--------------------------------------------------------------------------------
C9SC44_VERA1/35-148--------------------------------------------------------------------------------
U5HAV4_USTV1/5-115--------------------------------------------------------------------------------
C1E6C4_MICSR/5-111--------------------------------------------------------------------------------
S0ART8_FERAC/2-99--------------------------------------------------------------------------------
D8J110_HERSS/4-109--------------------------------------------------------------------------------
H1XZT2_9SPHI/4-110--------------------------------------------------------------------------------
F1A024_DICPU/9-113--------------------------------------------------------------------------------
A0M226_GRAFK/6-114--------------------------------------------------------------------------------
H1YA87_9SPHI/12-120--------------------------------------------------------------------------------
A1WK61_VEREI/3-108--------------------------------------------------------------------------------
F0S6E2_PEDSD/2-101--------------------------------------------------------------------------------
D8MW19_ERWBE/6-112--------------------------------------------------------------------------------
J4GG69_FIBRA/8-118--------------------------------------------------------------------------------
RHAM_TOLAT/3-103--------------------------------------------------------------------------------
R5RHB4_9FIRM/4-102--------------------------------------------------------------------------------
R7CUY6_9BACE/4-107--------------------------------------------------------------------------------
F4GKH0_SPICD/4-103--------------------------------------------------------------------------------
M2QQB6_CERS8/8-118--------------------------------------------------------------------------------
R4LU20_9ACTO/8-112--------------------------------------------------------------------------------
RHAM_AGRVS/6-106--------------------------------------------------------------------------------
A1RAY8_ARTAT/2-103--------------------------------------------------------------------------------
A0K063_ARTS2/2-106--------------------------------------------------------------------------------
G8TPW3_NIAKG/3-103--------------------------------------------------------------------------------
Q15XN8_PSEA6/5-113--------------------------------------------------------------------------------
G2TP17_BACCO/3-103--------------------------------------------------------------------------------
D9QN17_BRESC/8-108--------------------------------------------------------------------------------
H8KVT5_SOLCM/4-109--------------------------------------------------------------------------------
G3JAD5_CORMM/9-118--------------------------------------------------------------------------------
F0LZS0_VIBFN/7-107--------------------------------------------------------------------------------
E8RLZ9_ASTEC/5-104--------------------------------------------------------------------------------
R6U745_9FIRM/3-103--------------------------------------------------------------------------------
E0RYP0_BUTPB/3-103--------------------------------------------------------------------------------
W0A8U2_9SPHN/5-114--------------------------------------------------------------------------------
F0RTW9_SPHGB/2-102--------------------------------------------------------------------------------
V5XRE7_ENTMU/3-103--------------------------------------------------------------------------------
W0JTK6_9EURY/7-109--------------------------------------------------------------------------------
F4C6L3_SPHS2/2-101--------------------------------------------------------------------------------
R5MDS1_9BACE/17-125--------------------------------------------------------------------------------
Q92VL4_RHIME/3-108--------------------------------------------------------------------------------
D5EY64_PRER2/19-127--------------------------------------------------------------------------------
E8NDA4_MICTS/4-105--------------------------------------------------------------------------------
E6SPU6_BACT6/19-127--------------------------------------------------------------------------------
C6WNL3_ACTMD/3-105--------------------------------------------------------------------------------
R7NTA6_9BACE/19-127--------------------------------------------------------------------------------
Q826A8_STRAW/2-103--------------------------------------------------------------------------------
M1VWH7_CLAP2/35-145--------------------------------------------------------------------------------
C7PNE2_CHIPD/2-102--------------------------------------------------------------------------------
A0QQ10_MYCS2/3-105--------------------------------------------------------------------------------
S8E4Q7_FOMPI/8-118--------------------------------------------------------------------------------
F4KPV2_HALH1/6-106--------------------------------------------------------------------------------
E6WCQ8_PANSA/3-103--------------------------------------------------------------------------------
D7CBT4_STRBB/3-105--------------------------------------------------------------------------------
R5V6F4_9BACE/15-123--------------------------------------------------------------------------------
F8EFY7_RUNSL/5-113--------------------------------------------------------------------------------
D2UB54_XANAP/3-111--------------------------------------------------------------------------------
R6AY66_9BACT/3-104--------------------------------------------------------------------------------
B9TP76_RICCO/180-279--------------------------------------------------------------------------------
A6L884_PARD8/3-111--------------------------------------------------------------------------------
E1VAZ6_HALED/5-103--------------------------------------------------------------------------------
H5X507_9PSEU/6-107--------------------------------------------------------------------------------
G8TKN8_NIAKG/3-111--------------------------------------------------------------------------------
E4RWF7_LEAB4/3-103--------------------------------------------------------------------------------
R5P2W9_9PORP/3-109--------------------------------------------------------------------------------
H2ISM0_RAHAC/3-103--------------------------------------------------------------------------------
C6XWC2_PEDHD/4-110--------------------------------------------------------------------------------
D2AYI7_STRRD/2-103--------------------------------------------------------------------------------
R7B568_9ACTN/14-112--------------------------------------------------------------------------------
D4LLT3_9FIRM/2-100--------------------------------------------------------------------------------
R5IF69_9FIRM/3-101--------------------------------------------------------------------------------
F8EDF5_RUNSL/27-127--------------------------------------------------------------------------------
F4BQP6_CARS1/3-103--------------------------------------------------------------------------------
Q9RJV5_STRCO/9-112--------------------------------------------------------------------------------
F4L4I5_HALH1/3-109--------------------------------------------------------------------------------
F4PHW1_DICFS/4-111--------------------------------------------------------------------------------
K7ARV7_9ALTE/6-114--------------------------------------------------------------------------------
A6W650_KINRD/4-107--------------------------------------------------------------------------------
R7LE58_9BACT/21-129--------------------------------------------------------------------------------
F4H154_CELFA/3-103--------------------------------------------------------------------------------
B0T1B6_CAUSK/4-110--------------------------------------------------------------------------------
G0GFQ6_SPITZ/3-103--------------------------------------------------------------------------------
Q1J3P3_DEIGD/12-114--------------------------------------------------------------------------------
RHAM_BACSU/3-103--------------------------------------------------------------------------------
I6Z2E3_MELRP/3-103--------------------------------------------------------------------------------
R6LHQ9_9BACE/3-103--------------------------------------------------------------------------------
D8PU32_SCHCM/8-118--------------------------------------------------------------------------------
D8IVV1_HERSS/3-103--------------------------------------------------------------------------------
FUCM_XANCP/5-113--------------------------------------------------------------------------------
B9KXQ9_THERP/5-109--------------------------------------------------------------------------------
A4RYA8_OSTLU/7-113--------------------------------------------------------------------------------
RHAM_BURP8/3-103--------------------------------------------------------------------------------
RHAM_LISMO/3-103--------------------------------------------------------------------------------
R5XB53_9FIRM/3-102--------------------------------------------------------------------------------
F4C913_SPHS2/3-109--------------------------------------------------------------------------------
G8QUN9_SPHPG/4-104--------------------------------------------------------------------------------
G2YVL3_BOTF4/62-172--------------------------------------------------------------------------------
RHAM_CLOPH/3-103--------------------------------------------------------------------------------
C1N719_MICPC/4-111--------------------------------------------------------------------------------
E8RTW3_ASTEC/4-112--------------------------------------------------------------------------------
Q7CTD6_AGRT5/3-108--------------------------------------------------------------------------------
I4F5E5_MODMB/3-101--------------------------------------------------------------------------------
D1ARY4_SEBTE/3-103--------------------------------------------------------------------------------
A9WGG2_CHLAA/3-106--------------------------------------------------------------------------------
F5XNH4_MICPN/3-114--------------------------------------------------------------------------------
RHAM_LEPCP/5-105--------------------------------------------------------------------------------
RHAM_LACPL/3-103--------------------------------------------------------------------------------
D2Q2I3_KRIFD/3-102--------------------------------------------------------------------------------
M2MAG9_BAUCO/7-117--------------------------------------------------------------------------------
A3HRM9_9BACT/4-104--------------------------------------------------------------------------------
RHAM_MANSM/3-103--------------------------------------------------------------------------------
I2EVY4_EMTOG/3-103--------------------------------------------------------------------------------
L0FZ10_ECHVK/4-104--------------------------------------------------------------------------------
F9XB02_MYCGM/6-116--------------------------------------------------------------------------------
Q5KCR2_CRYNJ/19-129--------------------------------------------------------------------------------
D2QR00_SPILD/3-103--------------------------------------------------------------------------------
R4X772_TAPDE/13-123--------------------------------------------------------------------------------
K6YYZ3_9ALTE/4-112--------------------------------------------------------------------------------
R5A8F9_9CLOT/2-102--------------------------------------------------------------------------------
F8Q6Q2_SERL3/8-118--------------------------------------------------------------------------------
Q1GLV0_RUEST/3-108--------------------------------------------------------------------------------
D3F8C9_CONWI/3-101--------------------------------------------------------------------------------
I3UF06_ADVKW/5-111--------------------------------------------------------------------------------
C1DMX3_AZOVD/1-96--------------------------------------------------------------------------------
RHAM_RHILO/4-104--------------------------------------------------------------------------------
C7MA53_BRAFD/20-118--------------------------------------------------------------------------------
W0AGC7_9SPHN/4-103--------------------------------------------------------------------------------
D7BV13_STRBB/3-105--------------------------------------------------------------------------------
C4R5P5_PICPG/10-120--------------------------------------------------------------------------------
B8N6B4_ASPFN/5-114--------------------------------------------------------------------------------
R5PSD2_9BACT/21-129--------------------------------------------------------------------------------
RHAM_OPITP/3-103--------------------------------------------------------------------------------
V6JFG7_STRNV/3-106--------------------------------------------------------------------------------
I0KE28_9BACT/2-108--------------------------------------------------------------------------------
I3ZKM1_TERRK/3-103--------------------------------------------------------------------------------
D5BBC0_ZUNPS/5-111--------------------------------------------------------------------------------
D1BY74_XYLCX/3-102--------------------------------------------------------------------------------
RHAM_OCEIH/3-103--------------------------------------------------------------------------------
J9RIB0_9ACTO/6-114--------------------------------------------------------------------------------
R6WAC2_9BACT/17-125--------------------------------------------------------------------------------
A8G9F9_SERP5/10-116--------------------------------------------------------------------------------
G0J5Y4_CYCMS/28-127--------------------------------------------------------------------------------
C7YLU2_NECH7/7-118--------------------------------------------------------------------------------
U5RUK3_9CLOT/3-103--------------------------------------------------------------------------------
C5CZB7_VARPS/2-109--------------------------------------------------------------------------------
R5BLL2_9FIRM/265-367--------------------------------------------------------------------------------
R5B7U2_9BACE/23-126--------------------------------------------------------------------------------
A3I2P4_9BACT/3-110--------------------------------------------------------------------------------
F6FU80_ISOV2/2-98--------------------------------------------------------------------------------
R6Y9M4_9PORP/17-125--------------------------------------------------------------------------------
R5UEH6_9FIRM/3-103--------------------------------------------------------------------------------
Q5YUK3_NOCFA/7-108--------------------------------------------------------------------------------
R5T0T1_9CLOT/5-103--------------------------------------------------------------------------------
E8V6H3_TERSS/3-109--------------------------------------------------------------------------------
Q7AJX0_BACHD/6-107--------------------------------------------------------------------------------
W0LD07_SERFO/3-103--------------------------------------------------------------------------------
D5ET23_PRER2/3-104--------------------------------------------------------------------------------
T5AGB0_OPHSC/41-152--------------------------------------------------------------------------------
B6QAY9_PENMQ/10-121--------------------------------------------------------------------------------
R5FKH4_9ACTN/13-112--------------------------------------------------------------------------------
S3CGR6_GLAL2/40-151--------------------------------------------------------------------------------
E9QYL7_ASPFU/6-125--------------------------------------------------------------------------------
D2PT68_KRIFD/3-105--------------------------------------------------------------------------------
RHAM_BACSK/3-103--------------------------------------------------------------------------------
R6YNW1_9BACT/15-123--------------------------------------------------------------------------------
Y3871_DICDI/8-118--------------------------------------------------------------------------------
A1RB67_ARTAT/4-103--------------------------------------------------------------------------------
A5FI86_FLAJ1/3-109--------------------------------------------------------------------------------
H2JUV0_STRHJ/2-103--------------------------------------------------------------------------------
E4RRT9_LEAB4/3-109--------------------------------------------------------------------------------
RHAM_OCHA4/5-105--------------------------------------------------------------------------------
D3VH42_XENNA/3-116--------------------------------------------------------------------------------
L8X683_THACA/10-129--------------------------------------------------------------------------------
W0F1J4_9SPHI/6-112--------------------------------------------------------------------------------
D2QDE5_SPILD/2-108--------------------------------------------------------------------------------
A0RPU5_CAMFF/263-366--------------------------------------------------------------------------------
RHAM_RHIEC/5-105--------------------------------------------------------------------------------
W0HUK9_9ENTR/3-103--------------------------------------------------------------------------------
R9VMZ1_9ENTR/3-103--------------------------------------------------------------------------------
I2B3V9_SHIBC/8-108--------------------------------------------------------------------------------
RHAM_PECAS/3-103--------------------------------------------------------------------------------
A4FGN1_SACEN/3-102--------------------------------------------------------------------------------
G0R4U7_ICHMG/11-113--------------------------------------------------------------------------------
Q0S9A0_RHOSR/3-104--------------------------------------------------------------------------------
Q0U0I1_PHANO/10-124--------------------------------------------------------------------------------
G9MQ27_HYPVG/10-118--------------------------------------------------------------------------------
R5YL30_9BACE/19-127--------------------------------------------------------------------------------
G0J6H2_CYCMS/3-109--------------------------------------------------------------------------------
G0AEI2_COLFT/99-206--------------------------------------------------------------------------------
RHAM_AGRT5/6-106--------------------------------------------------------------------------------
Q0PB25_CAMJE/3-104--------------------------------------------------------------------------------
RHAM_LACS1/4-107--------------------------------------------------------------------------------
A7RJ94_NEMVE/13-125--------------------------------------------------------------------------------
H2YJ08_CIOSA/7-118--------------------------------------------------------------------------------
A3I067_9BACT/3-104--------------------------------------------------------------------------------
R6D3Z6_9BACE/3-103--------------------------------------------------------------------------------
Q986Z5_RHILO/3-108--------------------------------------------------------------------------------
Q21TQ6_ALBFT/2-109--------------------------------------------------------------------------------
H2J1A2_RAHAC/4-110--------------------------------------------------------------------------------
Q3XZK3_ENTFC/3-103--------------------------------------------------------------------------------
C5AGH1_BURGB/2-109--------------------------------------------------------------------------------
I3ZIT1_TERRK/3-109--------------------------------------------------------------------------------
C9YZZ6_STRSW/2-102--------------------------------------------------------------------------------
RHAM_ACICJ/3-103--------------------------------------------------------------------------------
Q01TX0_SOLUE/3-104--------------------------------------------------------------------------------
W0J174_9BACT/3-103--------------------------------------------------------------------------------
RHAM_JANSC/3-103--------------------------------------------------------------------------------
I0HD26_ACTM4/3-105--------------------------------------------------------------------------------
R6CWI8_9BACE/3-109--------------------------------------------------------------------------------
R5IKI3_9PORP/15-123--------------------------------------------------------------------------------
C5C310_BEUC1/3-105--------------------------------------------------------------------------------

PF13826

Q5B835_EMENI/129-253--------------------------------------------------------------------------------
Q7NL77_GLOVI/17-135--------------------------------------------------------------------------------
C0ZHQ2_BREBN/17-134--------------------------------------------------------------------------------
B1XXV3_LEPCP/17-135--------------------------------------------------------------------------------
D3EAC5_GEOS4/17-135--------------------------------------------------------------------------------
Q65NQ4_BACLD/18-134--------------------------------------------------------------------------------
D0L3R6_GORB4/18-133--------------------------------------------------------------------------------
A8FJ75_BACP2/18-135--------------------------------------------------------------------------------
Q0SFP1_RHOSR/17-134--------------------------------------------------------------------------------
B2IYY5_NOSP7/17-135--------------------------------------------------------------------------------
Q8ELJ8_OCEIH/18-135--------------------------------------------------------------------------------
Q9K5Y3_BACHD/18-135--------------------------------------------------------------------------------
Q82JR6_STRAW/18-140--------------------------------------------------------------------------------
C8X6B7_NAKMY/17-134--------------------------------------------------------------------------------
C9Z558_STRSW/19-141--------------------------------------------------------------------------------
D7B5B0_NOCDD/17-134--------------------------------------------------------------------------------
D2SAG2_GEOOG/17-134--------------------------------------------------------------------------------
D2Q510_KRIFD/15-133--------------------------------------------------------------------------------
C6XKE2_HIRBI/17-135--------------------------------------------------------------------------------
D2RPK7_HALTV/35-154--------------------------------------------------------------------------------
A1R2W1_ARTAT/19-136--------------------------------------------------------------------------------
Q5WGK6_BACSK/15-132--------------------------------------------------------------------------------
B1YGH8_EXIS2/12-125--------------------------------------------------------------------------------
A6R852_AJECN/119-243--------------------------------------------------------------------------------
D5UWZ5_TSUPD/14-139--------------------------------------------------------------------------------
Q2TWA6_ASPOR/121-245--------------------------------------------------------------------------------
B6QJL8_PENMQ/116-242--------------------------------------------------------------------------------
Q0CTD2_ASPTN/81-205--------------------------------------------------------------------------------
Q2GR33_CHAGB/122-248--------------------------------------------------------------------------------
C7YU85_NECH7/113-235--------------------------------------------------------------------------------
B8MRW9_TALSN/40-166--------------------------------------------------------------------------------
Q7S613_NEUCR/120-245--------------------------------------------------------------------------------
Q01W86_SOLUE/18-128--------------------------------------------------------------------------------
A5G2Z4_ACICJ/18-128--------------------------------------------------------------------------------
B1LSK9_METRJ/27-140--------------------------------------------------------------------------------
B0U9U6_METS4/19-131--------------------------------------------------------------------------------
B8EMQ3_METSB/15-128--------------------------------------------------------------------------------
C5AWG2_METEA/27-137--------------------------------------------------------------------------------
F2F0V8_SOLSS/20-135--------------------------------------------------------------------------------
G7XTL7_ASPKW/119-243--------------------------------------------------------------------------------
Q4WAZ2_ASPFU/113-235--------------------------------------------------------------------------------

PF13816

Q0C7P1_ASPTN/36-346--------------------------------------------------------------------------------
C0ZVD3_RHOE4/61-360--------------------------------------------------------------------------------
L2FQ62_COLGN/47-355--------------------------------------------------------------------------------
M7SDY7_EUTLA/46-400--------------------------------------------------------------------------------
F9G6T4_FUSOF/15-335--------------------------------------------------------------------------------
E9EGK8_METAQ/37-344--------------------------------------------------------------------------------
G9MZH7_HYPVG/2-314--------------------------------------------------------------------------------
C7ZI82_NECH7/15-335--------------------------------------------------------------------------------
S3DKC9_GLAL2/17-348--------------------------------------------------------------------------------
A5V4Y9_SPHWW/44-337--------------------------------------------------------------------------------
Q5B890_EMENI/326-643--------------------------------------------------------------------------------
U1HNF8_ENDPU/45-351--------------------------------------------------------------------------------
T0K4N5_COLGC/37-343--------------------------------------------------------------------------------
B2WMJ9_PYRTR/7-318--------------------------------------------------------------------------------
R8BIH2_TOGMI/17-327--------------------------------------------------------------------------------
G3XZK7_ASPNA/17-337--------------------------------------------------------------------------------
R8BET2_TOGMI/15-336--------------------------------------------------------------------------------
C7ZFH7_NECH7/16-326--------------------------------------------------------------------------------
Q6FBU3_ACIAD/44-342--------------------------------------------------------------------------------
S0DLH6_GIBF5/58-358--------------------------------------------------------------------------------
Q4WIY1_ASPFU/14-338--------------------------------------------------------------------------------
K2SG27_MACPH/15-335--------------------------------------------------------------------------------
I1S1Z5_GIBZE/37-347--------------------------------------------------------------------------------
T0KQZ3_COLGC/16-328--------------------------------------------------------------------------------
M2V8J7_COCH5/50-359--------------------------------------------------------------------------------
C5FDU1_ARTOC/82-390--------------------------------------------------------------------------------
K9GEU7_PEND2/14-335--------------------------------------------------------------------------------
C7Z148_NECH7/37-347--------------------------------------------------------------------------------
G9P8B6_HYPAI/42-386--------------------------------------------------------------------------------
A7IFL4_XANP2/40-340--------------------------------------------------------------------------------
E6WMT6_PANSA/44-342--------------------------------------------------------------------------------
A1R5Y5_ARTAT/55-350--------------------------------------------------------------------------------
M7TNP5_BOTF1/17-355--------------------------------------------------------------------------------
D8MJY1_ERWBE/44-340--------------------------------------------------------------------------------
A1CFW9_ASPCL/36-355--------------------------------------------------------------------------------
N1QD40_MYCFI/15-330--------------------------------------------------------------------------------
M3B660_SPHMS/50-394--------------------------------------------------------------------------------
C9STN6_VERA1/46-354--------------------------------------------------------------------------------
C0SHU3_PARBP/2-309--------------------------------------------------------------------------------
F8J9L9_HYPSM/46-346--------------------------------------------------------------------------------
B8NMG3_ASPFN/17-331--------------------------------------------------------------------------------
N4VS79_COLOR/45-355--------------------------------------------------------------------------------
B8NPL1_ASPFN/37-350--------------------------------------------------------------------------------
C9SXX8_VERA1/37-348--------------------------------------------------------------------------------
I1RQY0_GIBZE/15-329--------------------------------------------------------------------------------
F9X370_MYCGM/46-354--------------------------------------------------------------------------------
F9WY10_MYCGM/41-342--------------------------------------------------------------------------------
K2RZK8_MACPH/39-345--------------------------------------------------------------------------------
Q0U2P3_PHANO/37-344--------------------------------------------------------------------------------
N4V6I5_COLOR/37-346--------------------------------------------------------------------------------
C5G803_AJEDR/45-352--------------------------------------------------------------------------------
G9MHE5_HYPVG/42-380--------------------------------------------------------------------------------
Q0CF39_ASPTN/15-333--------------------------------------------------------------------------------
H6BUX5_EXODN/41-346--------------------------------------------------------------------------------
C6WDR0_ACTMD/40-337--------------------------------------------------------------------------------
N1S900_FUSC4/37-346--------------------------------------------------------------------------------
D4AMZ1_ARTBC/45-352--------------------------------------------------------------------------------
C5CKL2_VARPS/44-346--------------------------------------------------------------------------------
D8J0A9_HERSS/44-342--------------------------------------------------------------------------------
N1Q9B6_MYCFI/42-344--------------------------------------------------------------------------------

PF03795

E8VI80_BACST/6-82--------------------------------------------------------------------------------
A0A022NQM5_PSEAI/1-116--------------------------------------------------------------------------------
Q98EG6_RHILO/1-116--------------------------------------------------------------------------------
Q9AB44_CAUCR/10-125--------------------------------------------------------------------------------
A0A022NRR0_PSEAI/1-123--------------------------------------------------------------------------------
Q98I36_RHILO/1-116--------------------------------------------------------------------------------
Q98DP4_RHILO/1-116--------------------------------------------------------------------------------
Q98HH2_RHILO/1-118--------------------------------------------------------------------------------
Q98H82_RHILO/1-116--------------------------------------------------------------------------------
Q984U5_RHILO/1-115--------------------------------------------------------------------------------
F7UNU3_SYNYG/2-86--------------------------------------------------------------------------------
Q983T6_RHILO/165-255--------------------------------------------------------------------------------
Q9RVF8_DEIRA/6-88--------------------------------------------------------------------------------
F0KED5_CLOAE/1-82--------------------------------------------------------------------------------
D6EF87_STRLI/1-82--------------------------------------------------------------------------------
Q98H68_RHILO/7-87--------------------------------------------------------------------------------
Q16CW5_ROSDO/1-86--------------------------------------------------------------------------------
Q9AJZ7_STRCO/1-88--------------------------------------------------------------------------------
Q45075_BURCE/1-92--------------------------------------------------------------------------------
Q98EI5_RHILO/1-89--------------------------------------------------------------------------------
B8GXF8_CAUCN/2-87--------------------------------------------------------------------------------
Q0K0V2_CUPNH/1-88--------------------------------------------------------------------------------
A0A037VEJ0_HAEIF/1-95--------------------------------------------------------------------------------
A0A016XA68_VIBCL/1-95--------------------------------------------------------------------------------
A0A009E788_ECOLX/1-95--------------------------------------------------------------------------------
A0A022NMR8_PSEAI/1-95--------------------------------------------------------------------------------

PF02426

F4CSZ3_PSEUX/1-89--------------------------------------------------------------------------------
C7QDL9_CATAD/1-93--------------------------------------------------------------------------------
Q7WWV8_CUPNH/1-90--------------------------------------------------------------------------------
H6RKG3_BLASD/1-91--------------------------------------------------------------------------------
D7CBD2_STRBB/1-90--------------------------------------------------------------------------------
CATC_ACIAD/1-90--------------------------------------------------------------------------------
A0QTP0_MYCS2/1-90--------------------------------------------------------------------------------
C7QDL9_CATAD/107-197--------------------------------------------------------------------------------
O07243_MYCTU/1-93--------------------------------------------------------------------------------
B2HNZ0_MYCMM/1-93--------------------------------------------------------------------------------
G8ML29_9BURK/1-90--------------------------------------------------------------------------------
S5UNN6_STRCU/3-92--------------------------------------------------------------------------------
H2JTH6_STRHJ/3-92--------------------------------------------------------------------------------
G2J3C0_PSEUL/4-93--------------------------------------------------------------------------------
D3F6M4_CONWI/1-88--------------------------------------------------------------------------------
H2FYU2_OCESG/1-90--------------------------------------------------------------------------------
R4SVN0_AMYOR/1-90--------------------------------------------------------------------------------
H6RX66_BLASD/1-89--------------------------------------------------------------------------------
B1VQ91_STRGG/37-126--------------------------------------------------------------------------------
M1NRR9_9CORY/1-90--------------------------------------------------------------------------------
B4EMK5_BURCJ/1-90--------------------------------------------------------------------------------
F2JV84_MARM1/1-90--------------------------------------------------------------------------------
Q5YTX0_NOCFA/1-90--------------------------------------------------------------------------------
L0IVL4_MYCSM/1-90--------------------------------------------------------------------------------
O07243_MYCTU/108-199--------------------------------------------------------------------------------
F6A976_PSEF1/1-90--------------------------------------------------------------------------------
B2HNZ0_MYCMM/108-199--------------------------------------------------------------------------------
Q0SE60_RHOSR/3-91--------------------------------------------------------------------------------
Q0K0V3_CUPNH/1-90--------------------------------------------------------------------------------
Q82MX8_STRAW/120-209--------------------------------------------------------------------------------
S5TF72_9CORY/1-89--------------------------------------------------------------------------------
M4XFM6_PSEDE/1-90--------------------------------------------------------------------------------
F4CMA9_PSEUX/1-90--------------------------------------------------------------------------------
B2UBI3_RALPJ/1-90--------------------------------------------------------------------------------
A4FHX7_SACEN/1-90--------------------------------------------------------------------------------
H6L7V8_SAPGL/7-88--------------------------------------------------------------------------------
G2P2X2_STRVO/1-89--------------------------------------------------------------------------------
X5DVA1_9CORY/3-91--------------------------------------------------------------------------------
B1WUL0_CYAA5/8-98--------------------------------------------------------------------------------
D4Z421_SPHJU/1-90--------------------------------------------------------------------------------
A9BYG6_DELAS/1-90--------------------------------------------------------------------------------
D8IP00_HERSS/1-90--------------------------------------------------------------------------------
Q73Y30_MYCPA/110-202--------------------------------------------------------------------------------
D2SB83_GEOOG/4-92--------------------------------------------------------------------------------
E1W0V2_ARTAR/1-90--------------------------------------------------------------------------------
W0PJH0_9BURK/1-90--------------------------------------------------------------------------------
F4CK66_PSEUX/1-90--------------------------------------------------------------------------------
Q13YI1_BURXL/1-90--------------------------------------------------------------------------------
A9IEP3_BORPD/1-90--------------------------------------------------------------------------------
A9IEC2_BORPD/1-90--------------------------------------------------------------------------------
K0IEU1_NITGG/8-95--------------------------------------------------------------------------------
B9JQ22_AGRRK/1-90--------------------------------------------------------------------------------
A6VZS3_MARMS/1-90--------------------------------------------------------------------------------
G8RL90_MYCRN/1-90--------------------------------------------------------------------------------
B8IBD4_METNO/1-90--------------------------------------------------------------------------------
Q1LE87_RALME/1-90--------------------------------------------------------------------------------
G7ZC79_AZOL4/19-108--------------------------------------------------------------------------------
H5X6M8_9PSEU/1-90--------------------------------------------------------------------------------
R7Y1A3_9ACTO/1-90--------------------------------------------------------------------------------
A0QZJ3_MYCS2/4-90--------------------------------------------------------------------------------
Q8NN13_CORGL/1-90--------------------------------------------------------------------------------
W8T9C2_EUBAC/1-86--------------------------------------------------------------------------------
Q1LDN7_RALME/1-90--------------------------------------------------------------------------------
K9ZDB7_ANACC/1-91--------------------------------------------------------------------------------
W0L7T9_SERFO/1-90--------------------------------------------------------------------------------
H5WYU9_9PSEU/14-101--------------------------------------------------------------------------------
A1TU43_ACIAC/1-90--------------------------------------------------------------------------------
D0L556_GORB4/1-90--------------------------------------------------------------------------------
B2JPE7_BURP8/1-90--------------------------------------------------------------------------------
A8I5Y7_AZOC5/1-90--------------------------------------------------------------------------------
Q73Y30_MYCPA/1-93--------------------------------------------------------------------------------
A4XFH7_NOVAD/1-90--------------------------------------------------------------------------------
A6T9N4_KLEP7/1-90--------------------------------------------------------------------------------
A5V4X7_SPHWW/1-90--------------------------------------------------------------------------------
A0JW94_ARTS2/1-90--------------------------------------------------------------------------------
I2B8Q1_SHIBC/1-90--------------------------------------------------------------------------------
F4CJL4_PSEUX/1-89--------------------------------------------------------------------------------
B1LT49_METRJ/1-90--------------------------------------------------------------------------------
M4S3X1_9SPHN/1-90--------------------------------------------------------------------------------
A1SEX5_NOCSJ/1-90--------------------------------------------------------------------------------
A1B186_PARDP/1-90--------------------------------------------------------------------------------

PF09448

O51799_CUPNE/2-113--------------------------------------------------------------------------------
Q7WWV7_CUPNH/2-112--------------------------------------------------------------------------------

PF07110

Q98J67_RHILO/10-91--------------------------------------------------------------------------------
YTH4_RHOER/10-90--------------------------------------------------------------------------------
Q89V09_BRADU/21-102--------------------------------------------------------------------------------
B8Y4U8_9NOCA/10-91--------------------------------------------------------------------------------
Q9KGB0_BACHD/16-96--------------------------------------------------------------------------------
E2M9K4_PSEUB/10-93--------------------------------------------------------------------------------
Q2N8F2_ERYLH/12-112--------------------------------------------------------------------------------
D0J371_COMT2/26-114--------------------------------------------------------------------------------
I8IBK1_ASPO3/43-139--------------------------------------------------------------------------------
C9S7C3_VERA1/40-151--------------------------------------------------------------------------------
Q0UAA8_PHANO/20-125--------------------------------------------------------------------------------
B6QRR3_PENMQ/18-114--------------------------------------------------------------------------------
C9SY64_VERA1/65-158--------------------------------------------------------------------------------
B8MSU2_TALSN/18-112--------------------------------------------------------------------------------
A5VH99_SPHWW/138-221--------------------------------------------------------------------------------
A5V521_SPHWW/98-177--------------------------------------------------------------------------------
B9K152_AGRVS/13-109--------------------------------------------------------------------------------
B2W3U7_PYRTR/13-127--------------------------------------------------------------------------------
Q0U4N6_PHANO/13-123--------------------------------------------------------------------------------
B2WDV2_PYRTR/13-120--------------------------------------------------------------------------------
Q0U5I6_PHANO/13-111--------------------------------------------------------------------------------
A2QB94_ASPNC/13-115--------------------------------------------------------------------------------
A2QVN7_ASPNC/13-122--------------------------------------------------------------------------------
B8MPG2_TALSN/43-154--------------------------------------------------------------------------------
Q2UT25_ASPOR/23-122--------------------------------------------------------------------------------
C9Z9Q5_STRSW/12-103--------------------------------------------------------------------------------
A2R8B5_ASPNC/14-111--------------------------------------------------------------------------------
A5VH99_SPHWW/12-106--------------------------------------------------------------------------------
Q396J2_BURS3/130-221--------------------------------------------------------------------------------
A6GBX1_9DELT/12-106--------------------------------------------------------------------------------
C9Z9Q5_STRSW/139-234--------------------------------------------------------------------------------
B5HPI7_9ACTO/138-233--------------------------------------------------------------------------------
A8L3R3_FRASN/10-95--------------------------------------------------------------------------------
A5V7F6_SPHWW/12-99--------------------------------------------------------------------------------
A5V7F6_SPHWW/139-229--------------------------------------------------------------------------------
A4XEJ1_NOVAD/13-101--------------------------------------------------------------------------------
C7Z3Q5_NECH7/37-130--------------------------------------------------------------------------------
Q140F8_BURXL/125-207--------------------------------------------------------------------------------
C8ND54_9GAMM/12-105--------------------------------------------------------------------------------
C2M2M0_CAPGI/12-107--------------------------------------------------------------------------------
Q93AB2_YERPE/18-98--------------------------------------------------------------------------------
B8MF02_TALSN/21-117--------------------------------------------------------------------------------
C8VQ65_EMENI/29-132--------------------------------------------------------------------------------
C5FQT1_ARTOC/22-118--------------------------------------------------------------------------------
Q2GSS6_CHAGB/53-131--------------------------------------------------------------------------------
B8NJL1_ASPFN/19-113--------------------------------------------------------------------------------
C8VTL3_EMENI/15-109--------------------------------------------------------------------------------
Q0UIY9_PHANO/18-106--------------------------------------------------------------------------------
A2QH37_ASPNC/566-663--------------------------------------------------------------------------------
B6QDA9_PENMQ/20-117--------------------------------------------------------------------------------
A2QDU1_ASPNC/19-117--------------------------------------------------------------------------------
B0YAX3_ASPFC/21-118--------------------------------------------------------------------------------
B2WLL6_PYRTR/30-124--------------------------------------------------------------------------------
Q4P1P8_USTMA/29-132--------------------------------------------------------------------------------
C7Z0I7_NECH7/17-115--------------------------------------------------------------------------------
Q9F3V8_9PSEU/12-93--------------------------------------------------------------------------------

PF07045

Q0C383_HYPNA/2-97--------------------------------------------------------------------------------
Q98DD6_RHILO/3-95--------------------------------------------------------------------------------
A8LJW3_DINSH/3-95--------------------------------------------------------------------------------
Q1GHA0_RUEST/2-94--------------------------------------------------------------------------------
A1B208_PARDP/2-94--------------------------------------------------------------------------------
A0R1N9_MYCS2/3-94--------------------------------------------------------------------------------
B2U9C2_RALPJ/3-96--------------------------------------------------------------------------------
Q1LPI6_RALME/3-96--------------------------------------------------------------------------------
Q0RXH4_RHOSR/2-95--------------------------------------------------------------------------------
Q129N1_POLSJ/11-101--------------------------------------------------------------------------------
B2JPM5_BURP8/3-96--------------------------------------------------------------------------------
Q21DJ6_SACD2/2-95--------------------------------------------------------------------------------
A1B8D1_PARDP/3-95--------------------------------------------------------------------------------
Q0C268_HYPNA/2-95--------------------------------------------------------------------------------
A1K1N9_AZOSB/2-94--------------------------------------------------------------------------------
Q65SN3_MANSM/24-117--------------------------------------------------------------------------------
Q0RQX9_FRAAA/2-95--------------------------------------------------------------------------------
Q3J0R2_RHOS4/3-95--------------------------------------------------------------------------------
Q1GHQ7_RUEST/2-96--------------------------------------------------------------------------------
Q5NR08_ZYMMO/2-95--------------------------------------------------------------------------------
A8L5T2_FRASN/12-105--------------------------------------------------------------------------------
Q742V7_MYCPA/6-97--------------------------------------------------------------------------------
Q165U6_ROSDO/2-94--------------------------------------------------------------------------------
A4XTJ7_PSEMY/2-95--------------------------------------------------------------------------------
A5V7J9_SPHWW/2-96--------------------------------------------------------------------------------
Q5YTA0_NOCFA/2-95--------------------------------------------------------------------------------
Q128E5_POLSJ/3-96--------------------------------------------------------------------------------
Q65QR7_MANSM/19-113--------------------------------------------------------------------------------
Q2VZK5_MAGSA/2-96--------------------------------------------------------------------------------
Q7VAI4_PROMA/7-101--------------------------------------------------------------------------------
Q28P24_JANSC/6-100--------------------------------------------------------------------------------
B2JHP1_BURP8/2-95--------------------------------------------------------------------------------
Q984S8_RHILO/2-95--------------------------------------------------------------------------------
Q89JB1_BRADU/14-107--------------------------------------------------------------------------------
A1AZL7_PARDP/2-94--------------------------------------------------------------------------------
A8LL19_DINSH/2-94--------------------------------------------------------------------------------
A8KZG9_FRASN/2-95--------------------------------------------------------------------------------
Q11KJ1_CHESB/3-95--------------------------------------------------------------------------------
Q6NCX9_RHOPA/3-96--------------------------------------------------------------------------------
Q1GFX6_RUEST/3-95--------------------------------------------------------------------------------
A1TLS8_ACIAC/3-96--------------------------------------------------------------------------------
Q46KM6_PROMT/7-101--------------------------------------------------------------------------------
Q127Z9_POLSJ/2-95--------------------------------------------------------------------------------
Q5FU37_GLUOX/2-95--------------------------------------------------------------------------------
Q98JP1_RHILO/45-139--------------------------------------------------------------------------------
Q98CT4_RHILO/9-101--------------------------------------------------------------------------------
A5V7D8_SPHWW/2-97--------------------------------------------------------------------------------
A4XXX9_PSEMY/17-110--------------------------------------------------------------------------------
A1BAV2_PARDP/2-95--------------------------------------------------------------------------------
Q28QV7_JANSC/3-95--------------------------------------------------------------------------------
Q28KV2_JANSC/2-96--------------------------------------------------------------------------------
A6WA35_KINRD/13-106--------------------------------------------------------------------------------
Q89BY8_BRADU/66-159--------------------------------------------------------------------------------
Q11E97_CHESB/2-98--------------------------------------------------------------------------------
Q6F9F1_ACIAD/2-94--------------------------------------------------------------------------------
Q16DN6_ROSDO/3-95--------------------------------------------------------------------------------
A9BN41_DELAS/3-96--------------------------------------------------------------------------------
A4X3R6_SALTO/2-95--------------------------------------------------------------------------------
Q0C4G1_HYPNA/2-95--------------------------------------------------------------------------------
Q2KDF1_RHIEC/3-95--------------------------------------------------------------------------------
Q1D8Q3_MYXXD/2-95--------------------------------------------------------------------------------
Q47EX6_DECAR/3-96--------------------------------------------------------------------------------
A7IC73_XANP2/114-206--------------------------------------------------------------------------------
Q15VR2_PSEA6/29-121--------------------------------------------------------------------------------
A6VY75_MARMS/2-96--------------------------------------------------------------------------------
Q28SX7_JANSC/3-95--------------------------------------------------------------------------------
A7HSS3_PARL1/2-95--------------------------------------------------------------------------------
Q87W43_PSESM/6-100--------------------------------------------------------------------------------
Q89X32_BRADU/22-115--------------------------------------------------------------------------------
A5FY88_ACICJ/3-95--------------------------------------------------------------------------------
Q28UH1_JANSC/27-121--------------------------------------------------------------------------------
A0QZT5_MYCS2/2-95--------------------------------------------------------------------------------
A1B124_PARDP/3-95--------------------------------------------------------------------------------
Q98G06_RHILO/23-116--------------------------------------------------------------------------------
Q215U7_RHOPB/2-95--------------------------------------------------------------------------------
A7IC73_XANP2/3-95--------------------------------------------------------------------------------
B2HIJ1_MYCMM/2-95--------------------------------------------------------------------------------
B4EJY9_BURCJ/2-95--------------------------------------------------------------------------------
H7C7V4_BRADU/3-95--------------------------------------------------------------------------------
Q2YQU8_BRUA2/3-95--------------------------------------------------------------------------------
Q4FP83_PELUB/2-95--------------------------------------------------------------------------------
Q63KP2_BURPS/3-94--------------------------------------------------------------------------------
Q7VW78_BORPE/2-94--------------------------------------------------------------------------------
Q882F9_PSESM/2-94--------------------------------------------------------------------------------

PF03927

Q0PAA5_CAMJE/4-75--------------------------------------------------------------------------------
A6Q707_SULNB/2-77--------------------------------------------------------------------------------
E6X0J9_NITSE/1-76--------------------------------------------------------------------------------
Q6LTW0_PHOPR/6-81--------------------------------------------------------------------------------
C5B7B8_EDWI9/6-82--------------------------------------------------------------------------------
C0QTT2_PERMH/1-76--------------------------------------------------------------------------------
C4K982_THASP/1-77--------------------------------------------------------------------------------
W6EFK7_SULMU/1-76--------------------------------------------------------------------------------
F7YR78_VIBA7/6-81--------------------------------------------------------------------------------
S6CGZ1_9GAMM/4-79--------------------------------------------------------------------------------
Q9CKL9_PASMU/13-89--------------------------------------------------------------------------------
E6WCW8_PANSA/7-83--------------------------------------------------------------------------------
H7C6L0_BRADU/34-109--------------------------------------------------------------------------------
V5SFH9_9RHIZ/10-84--------------------------------------------------------------------------------
Q9I4G2_PSEAE/5-80--------------------------------------------------------------------------------
D4ZL47_SHEVD/11-86--------------------------------------------------------------------------------
A4XWL9_PSEMY/5-79--------------------------------------------------------------------------------
H2FWI7_OCESG/6-81--------------------------------------------------------------------------------
Q080B9_SHEFN/5-79--------------------------------------------------------------------------------
F2NPP1_MARHT/1-76--------------------------------------------------------------------------------
Q1LFZ4_RALME/19-94--------------------------------------------------------------------------------
Q2W3T0_MAGSA/19-94--------------------------------------------------------------------------------
G8PIR3_PSEUV/16-91--------------------------------------------------------------------------------
F8AE25_THEID/3-76--------------------------------------------------------------------------------
Q7VPJ8_HAEDU/10-86--------------------------------------------------------------------------------
Q6D5Z1_PECAS/5-81--------------------------------------------------------------------------------
B8CTJ0_SHEPW/5-79--------------------------------------------------------------------------------
B0URQ2_HISS2/14-89--------------------------------------------------------------------------------
A0RQ30_CAMFF/1-74--------------------------------------------------------------------------------
Q487G3_COLP3/11-86--------------------------------------------------------------------------------
E6WPJ5_PSEUU/9-82--------------------------------------------------------------------------------
B2V814_SULSY/6-77--------------------------------------------------------------------------------
E1SPK5_FERBD/5-80--------------------------------------------------------------------------------
A1S9X8_SHEAM/5-80--------------------------------------------------------------------------------
A8Z6H5_CAMC1/2-74--------------------------------------------------------------------------------
E3HM72_ACHXA/16-91--------------------------------------------------------------------------------
G8AUD4_AZOBR/16-89--------------------------------------------------------------------------------
NAPD_HAEIN/14-90--------------------------------------------------------------------------------
Q21AR5_RHOPB/30-104--------------------------------------------------------------------------------
A1K384_AZOSB/7-82--------------------------------------------------------------------------------
A7I3Z3_CAMHC/1-75--------------------------------------------------------------------------------
Q7VJT0_HELHP/1-77--------------------------------------------------------------------------------
Q79HQ5_WOLSU/1-76--------------------------------------------------------------------------------
E8RJB8_DESPD/3-76--------------------------------------------------------------------------------
Q5E3J5_VIBF1/10-85--------------------------------------------------------------------------------
F6AJN2_PSEF1/5-79--------------------------------------------------------------------------------
M9X453_PASHA/11-87--------------------------------------------------------------------------------
Q87GW7_VIBPA/6-81--------------------------------------------------------------------------------
B6IR09_RHOCS/9-83--------------------------------------------------------------------------------
G7Z2F9_AZOL4/7-81--------------------------------------------------------------------------------
A3QDT7_SHELP/7-80--------------------------------------------------------------------------------
W6RRD8_9RHIZ/8-82--------------------------------------------------------------------------------
A9I7M2_BORPD/2-76--------------------------------------------------------------------------------
C9R7H4_AGGAD/15-91--------------------------------------------------------------------------------
G7ZD38_AZOL4/15-89--------------------------------------------------------------------------------
E7A9K1_HELFC/1-76--------------------------------------------------------------------------------
A1BB87_PARDP/30-103--------------------------------------------------------------------------------
E4U743_OCEP5/2-76--------------------------------------------------------------------------------
A8GHJ5_SERP5/6-82--------------------------------------------------------------------------------
D6E6X0_9ACTN/3-75--------------------------------------------------------------------------------
I2B9N7_SHIBC/5-81--------------------------------------------------------------------------------
S6CE21_9ACTN/6-80--------------------------------------------------------------------------------
A3QHX3_SHELP/5-80--------------------------------------------------------------------------------
I0DQX7_PROSM/5-81--------------------------------------------------------------------------------
M1PB12_DESSD/3-76--------------------------------------------------------------------------------
Q13I16_BURXL/18-93--------------------------------------------------------------------------------
A0KIM0_AERHH/5-80--------------------------------------------------------------------------------
A1SWQ1_PSYIN/6-81--------------------------------------------------------------------------------
A6Q5Z8_NITSB/2-76--------------------------------------------------------------------------------
C5ZXD4_9HELI/11-84--------------------------------------------------------------------------------
B8CPC6_SHEPW/6-81--------------------------------------------------------------------------------
V6F139_9PROT/20-94--------------------------------------------------------------------------------
G8QFB1_AZOSU/1-76--------------------------------------------------------------------------------
E1SPK8_FERBD/5-79--------------------------------------------------------------------------------
F8E847_FLESM/4-77--------------------------------------------------------------------------------
Q92Z35_RHIME/8-82--------------------------------------------------------------------------------
M4U4Q1_9GAMM/6-81--------------------------------------------------------------------------------
A4Z0A0_BRASO/31-105--------------------------------------------------------------------------------
C7N4I2_SLAHD/2-77--------------------------------------------------------------------------------
Q5P545_AROAE/99-172--------------------------------------------------------------------------------
Q47A86_DECAR/4-79--------------------------------------------------------------------------------
V9VYJ2_9RHOB/5-78--------------------------------------------------------------------------------
C8WHW5_EGGLE/3-75--------------------------------------------------------------------------------
E1SPL2_FERBD/5-80--------------------------------------------------------------------------------
Q32I07_SHIDS/5-81--------------------------------------------------------------------------------
Q2SGV8_HAHCH/5-80--------------------------------------------------------------------------------
D7A7N1_STAND/6-78--------------------------------------------------------------------------------
Q12P45_SHEDO/5-78--------------------------------------------------------------------------------
R5ED13_9BURK/4-77--------------------------------------------------------------------------------
F8KQ14_HELBC/1-77--------------------------------------------------------------------------------
H5WUJ8_9BURK/2-77--------------------------------------------------------------------------------
Q3IV44_RHOS4/6-80--------------------------------------------------------------------------------
D1B0Z4_SULD5/1-76--------------------------------------------------------------------------------
F4H9V5_GALAU/13-88--------------------------------------------------------------------------------
Q7WXC4_CUPNH/19-94--------------------------------------------------------------------------------
S6AI66_9PROT/1-76--------------------------------------------------------------------------------
G8B0E5_AZOBR/4-78--------------------------------------------------------------------------------
A1KCK3_AZOSB/2-77--------------------------------------------------------------------------------
Q0WCM9_YERPE/6-81--------------------------------------------------------------------------------
R5QDQ6_9BURK/4-76--------------------------------------------------------------------------------
F2KF43_PSEBN/5-78--------------------------------------------------------------------------------
Q8EIJ0_SHEON/5-80--------------------------------------------------------------------------------
A4VJ12_PSEU5/21-93--------------------------------------------------------------------------------
L0F5T8_DESDL/3-76--------------------------------------------------------------------------------
D0J758_COMT2/1-75--------------------------------------------------------------------------------
I7H569_9HELI/1-77--------------------------------------------------------------------------------
Q9KLR5_VIBCH/18-93--------------------------------------------------------------------------------
R7C3D0_9BURK/5-78--------------------------------------------------------------------------------
Q21PN2_SACD2/11-86--------------------------------------------------------------------------------
K4KH51_SIMAS/8-79--------------------------------------------------------------------------------
C1D9G2_LARHH/1-73--------------------------------------------------------------------------------
F7UYF5_EEGSY/3-75--------------------------------------------------------------------------------
A9CGL4_AGRT5/8-82--------------------------------------------------------------------------------
C7RM77_ACCPU/1-76--------------------------------------------------------------------------------
B0UD65_METS4/21-95--------------------------------------------------------------------------------
K4RIQ3_HELHE/1-77--------------------------------------------------------------------------------
B1Y6A7_LEPCP/2-77--------------------------------------------------------------------------------
B2UBL6_RALPJ/21-96--------------------------------------------------------------------------------
M4R765_BIBTR/2-75--------------------------------------------------------------------------------
B3E654_GEOLS/3-76--------------------------------------------------------------------------------
H0Q103_9RHOO/2-77--------------------------------------------------------------------------------
E4U3K5_SULKY/1-73--------------------------------------------------------------------------------
A8LLZ0_DINSH/2-76--------------------------------------------------------------------------------
B8F7K3_HAEPS/16-92--------------------------------------------------------------------------------

PF01037

GRP_ZYMMO/71-144--------------------------------------------------------------------------------
ZRP_ZYMMO/68-141--------------------------------------------------------------------------------
Q92MD2_RHIME/86-156--------------------------------------------------------------------------------
Q7D0A6_AGRT5/69-139--------------------------------------------------------------------------------
Q8XUT3_RALSO/72-151--------------------------------------------------------------------------------
Q6FBR8_ACIAD/74-148--------------------------------------------------------------------------------
Q5UYW6_HALMA/69-139--------------------------------------------------------------------------------
O28651_ARCFU/68-142--------------------------------------------------------------------------------
Q97KE2_CLOAB/74-146--------------------------------------------------------------------------------
Q6LFY1_PHOPR/75-149--------------------------------------------------------------------------------
Q9KKN4_VIBCH/69-143--------------------------------------------------------------------------------
Q88Q35_PSEPK/72-143--------------------------------------------------------------------------------
LRPB_BACSU/69-136--------------------------------------------------------------------------------
Q8ELF6_OCEIH/69-140--------------------------------------------------------------------------------
Q7P0K6_CHRVO/67-134--------------------------------------------------------------------------------
Q5LQ65_RUEPO/71-144--------------------------------------------------------------------------------
Q6NDU4_RHOPA/81-154--------------------------------------------------------------------------------
Q8XS36_RALSO/102-176--------------------------------------------------------------------------------
Q6N2H6_RHOPA/71-144--------------------------------------------------------------------------------
Q9RT71_DEIRA/109-183--------------------------------------------------------------------------------
Q87GT1_VIBPA/66-140--------------------------------------------------------------------------------
Q6LY54_METMP/67-138--------------------------------------------------------------------------------
Q6L2L7_PICTO/21-92--------------------------------------------------------------------------------
Q5V2Q8_HALMA/69-143--------------------------------------------------------------------------------
Q9HQ13_HALSA/69-140--------------------------------------------------------------------------------
Q8E9E7_SHEON/75-150--------------------------------------------------------------------------------
A9CFY0_AGRT5/67-137--------------------------------------------------------------------------------
Q63VD1_BURPS/71-145--------------------------------------------------------------------------------
Q8XQA9_RALSO/69-143--------------------------------------------------------------------------------
Q6A8E6_PROAC/82-152--------------------------------------------------------------------------------
Q9L101_STRCO/68-139--------------------------------------------------------------------------------
Q5YPF7_NOCFA/74-144--------------------------------------------------------------------------------
Q98D73_RHILO/70-144--------------------------------------------------------------------------------
Q98F66_RHILO/68-135--------------------------------------------------------------------------------
Q9A2I8_CAUCR/74-148--------------------------------------------------------------------------------
Q9AAL7_CAUCR/79-153--------------------------------------------------------------------------------
Q5LQ72_RUEPO/75-142--------------------------------------------------------------------------------
A9CFA2_AGRT5/70-143--------------------------------------------------------------------------------
Q5ZSK0_LEGPH/69-144--------------------------------------------------------------------------------
Q98PB1_RHILO/72-146--------------------------------------------------------------------------------
Q92LN5_RHIME/67-137--------------------------------------------------------------------------------
Q92U21_RHIME/82-152--------------------------------------------------------------------------------
Q88GR4_PSEPK/67-141--------------------------------------------------------------------------------
Q5LX17_RUEPO/69-143--------------------------------------------------------------------------------
Q8KCK3_CHLTE/71-142--------------------------------------------------------------------------------
Q9I287_PSEAE/71-145--------------------------------------------------------------------------------
Q9A5B5_CAUCR/107-181--------------------------------------------------------------------------------
Q5YR66_NOCFA/67-141--------------------------------------------------------------------------------
Q8NMC1_CORGL/75-149--------------------------------------------------------------------------------
Q82QC2_STRAW/71-138--------------------------------------------------------------------------------
Q898A1_CLOTE/78-150--------------------------------------------------------------------------------
Q88H33_PSEPK/67-137--------------------------------------------------------------------------------
Q88DP7_PSEPK/70-145--------------------------------------------------------------------------------
Q9KYP0_STRCO/82-153--------------------------------------------------------------------------------
Q9EX07_STRCO/69-139--------------------------------------------------------------------------------
Q74NJ3_NANEQ/8-78--------------------------------------------------------------------------------
Q5UXF0_HALMA/63-134--------------------------------------------------------------------------------
LYSM_SULTO/67-138--------------------------------------------------------------------------------
Q7VRX6_BORPE/85-159--------------------------------------------------------------------------------
HOSA_SULTO/388-459--------------------------------------------------------------------------------
Q6L0M6_PICTO/71-145--------------------------------------------------------------------------------
Q7NXB3_CHRVO/75-142--------------------------------------------------------------------------------
Q8XJU9_CLOPE/76-148--------------------------------------------------------------------------------
Q82JE5_STRAW/69-138--------------------------------------------------------------------------------
Y4TD_RHISN/84-158--------------------------------------------------------------------------------
Q9K0L9_NEIMB/99-172--------------------------------------------------------------------------------
Q87PU4_VIBPA/76-146--------------------------------------------------------------------------------
Q5Z126_NOCFA/77-147--------------------------------------------------------------------------------
Q89LX8_BRADU/73-146--------------------------------------------------------------------------------
Q5LQW1_RUEPO/67-141--------------------------------------------------------------------------------
Q65N91_BACLD/69-136--------------------------------------------------------------------------------
Q92XD8_RHIME/73-147--------------------------------------------------------------------------------
Q8FLW4_COREF/255-325--------------------------------------------------------------------------------
Q5LTP6_RUEPO/68-142--------------------------------------------------------------------------------
Q8XVM9_RALSO/69-143--------------------------------------------------------------------------------
Q98KG1_RHILO/93-160--------------------------------------------------------------------------------
Q8A556_BACTN/73-147--------------------------------------------------------------------------------
Q7NU65_CHRVO/74-148--------------------------------------------------------------------------------
Q5NMJ8_ZYMMO/67-141--------------------------------------------------------------------------------
Q7VRX9_BORPE/76-153--------------------------------------------------------------------------------
Q6FCQ3_ACIAD/67-137--------------------------------------------------------------------------------
Q6A5I2_PROAC/64-135--------------------------------------------------------------------------------
Q8ZT22_PYRAE/67-153--------------------------------------------------------------------------------
Q9KFQ5_BACHD/69-136--------------------------------------------------------------------------------
Q63M55_BURPS/72-146--------------------------------------------------------------------------------
Q9RKY4_STRCO/86-156--------------------------------------------------------------------------------
Q89QF0_BRADU/95-169--------------------------------------------------------------------------------
Q7NH56_GLOVI/75-142--------------------------------------------------------------------------------
Q5WIR4_BACSK/69-136--------------------------------------------------------------------------------
Q82AJ9_STRAW/6-77--------------------------------------------------------------------------------
Q7VV34_BORPE/67-140--------------------------------------------------------------------------------
Q63K02_BURPS/70-144--------------------------------------------------------------------------------
Q9K6T5_BACHD/69-140--------------------------------------------------------------------------------
O29671_ARCFU/66-134--------------------------------------------------------------------------------
Q6AF01_LEIXX/80-150--------------------------------------------------------------------------------
Q98JQ8_RHILO/76-143--------------------------------------------------------------------------------
Q9XAG4_STRCO/72-142--------------------------------------------------------------------------------
Q92PN1_RHIME/74-147--------------------------------------------------------------------------------
O86743_STRCO/86-156--------------------------------------------------------------------------------
Q7VXK7_BORPE/69-143--------------------------------------------------------------------------------
Q9RK86_STRCO/67-136--------------------------------------------------------------------------------
Q9RXV6_DEIRA/89-157--------------------------------------------------------------------------------
O29606_ARCFU/6-76--------------------------------------------------------------------------------
Q6ANT7_DESPS/69-143--------------------------------------------------------------------------------
REG1_PYRFU/70-146--------------------------------------------------------------------------------
Q98K63_RHILO/72-146--------------------------------------------------------------------------------
Q9HLH1_THEAC/98-168--------------------------------------------------------------------------------
O29117_ARCFU/70-140--------------------------------------------------------------------------------
Q983I9_RHILO/78-152--------------------------------------------------------------------------------
Q972L7_SULTO/67-140--------------------------------------------------------------------------------
Q5V2P2_HALMA/69-140--------------------------------------------------------------------------------
Q87GV1_VIBPA/67-140--------------------------------------------------------------------------------
Q8XX00_RALSO/74-141--------------------------------------------------------------------------------
Q987B0_RHILO/72-146--------------------------------------------------------------------------------
Q9A3N3_CAUCR/116-190--------------------------------------------------------------------------------
Q7NT80_CHRVO/75-149--------------------------------------------------------------------------------
Q5LKR4_RUEPO/67-141--------------------------------------------------------------------------------
P71888_MYCTU/70-141--------------------------------------------------------------------------------
Q5LTI9_RUEPO/68-142--------------------------------------------------------------------------------
Q88E71_PSEPK/78-152--------------------------------------------------------------------------------
Q82M14_STRAW/244-315--------------------------------------------------------------------------------
Q5LX25_RUEPO/67-137--------------------------------------------------------------------------------
Q981V1_RHILO/75-149--------------------------------------------------------------------------------
Q97J19_CLOAB/69-136--------------------------------------------------------------------------------
Q89XH4_BRADU/78-152--------------------------------------------------------------------------------
Q984M5_RHILO/74-148--------------------------------------------------------------------------------
Q9HQ33_HALSA/67-138--------------------------------------------------------------------------------
Q93IX1_STRCO/72-139--------------------------------------------------------------------------------
Q975B9_SULTO/71-141--------------------------------------------------------------------------------
Q745M6_MYCPA/252-323--------------------------------------------------------------------------------
Q5LNM4_RUEPO/70-143--------------------------------------------------------------------------------
Q93IX5_STRCO/73-147--------------------------------------------------------------------------------
Q92MD5_RHIME/70-144--------------------------------------------------------------------------------
Q9RS40_DEIRA/9-80--------------------------------------------------------------------------------
Q5KVS2_GEOKA/71-145--------------------------------------------------------------------------------
Q5LUB6_RUEPO/69-143--------------------------------------------------------------------------------
BKDR_PSEAE/70-144--------------------------------------------------------------------------------
Q8ZX24_PYRAE/6-77--------------------------------------------------------------------------------
Q8XFM7_RALSO/75-142--------------------------------------------------------------------------------
REG8_PYRFU/69-139--------------------------------------------------------------------------------
Q5UZ96_HALMA/68-138--------------------------------------------------------------------------------
Q5QV65_IDILO/67-141--------------------------------------------------------------------------------
Q5LRE1_RUEPO/71-145--------------------------------------------------------------------------------
Q6D0Y1_PECAS/70-144--------------------------------------------------------------------------------
Q98N03_RHILO/69-143--------------------------------------------------------------------------------
Q880K0_PSESM/71-145--------------------------------------------------------------------------------
Q8ZWW2_PYRAE/87-153--------------------------------------------------------------------------------
Q986N0_RHILO/91-161--------------------------------------------------------------------------------
Q9HV24_PSEAE/67-134--------------------------------------------------------------------------------
Q6LS33_PHOPR/66-136--------------------------------------------------------------------------------
Q9A4E7_CAUCR/94-165--------------------------------------------------------------------------------
Q89D55_BRADU/68-142--------------------------------------------------------------------------------
Q6AIZ2_DESPS/68-140--------------------------------------------------------------------------------
Q5LTP5_RUEPO/70-144--------------------------------------------------------------------------------
Q88AX2_PSESM/73-147--------------------------------------------------------------------------------
Q8A637_BACTN/72-143--------------------------------------------------------------------------------
A9CJY9_AGRT5/67-141--------------------------------------------------------------------------------
Q826R1_STRAW/74-145--------------------------------------------------------------------------------
Q9KGA0_BACHD/67-134--------------------------------------------------------------------------------
Q8G6L1_BIFLO/70-140--------------------------------------------------------------------------------
Q6AQ93_DESPS/16-87--------------------------------------------------------------------------------
Q81G47_BACCR/69-136--------------------------------------------------------------------------------
Q5NRK7_ZYMMO/74-148--------------------------------------------------------------------------------
Q6FAP4_ACIAD/69-144--------------------------------------------------------------------------------
Q7VUI7_BORPE/70-140--------------------------------------------------------------------------------
AZLB_BACSU/71-145--------------------------------------------------------------------------------
O28824_ARCFU/64-138--------------------------------------------------------------------------------
Q6NCU7_RHOPA/67-141--------------------------------------------------------------------------------
Q5LMF1_RUEPO/70-144--------------------------------------------------------------------------------
Q5WDD1_BACSK/69-140--------------------------------------------------------------------------------
Q9XA32_STRCO/57-128--------------------------------------------------------------------------------
Q9A3M5_CAUCR/129-203--------------------------------------------------------------------------------
Q6L1Y9_PICTO/97-167--------------------------------------------------------------------------------
Q6W0Z0_RHISN/69-143--------------------------------------------------------------------------------
Q87WM3_PSESM/56-130--------------------------------------------------------------------------------
Q5NNH9_ZYMMO/73-147--------------------------------------------------------------------------------
PTR1_METJA/68-139--------------------------------------------------------------------------------
Q92NU2_RHIME/68-141--------------------------------------------------------------------------------
LRP_RHIME/73-147--------------------------------------------------------------------------------
Q8XU40_RALSO/70-144--------------------------------------------------------------------------------
Q65G37_BACLD/68-136--------------------------------------------------------------------------------
Y224_HAEIN/85-159--------------------------------------------------------------------------------
Q65E48_BACLD/78-149--------------------------------------------------------------------------------
Q6W241_RHISN/68-142--------------------------------------------------------------------------------
O28868_ARCFU/6-77--------------------------------------------------------------------------------
Q63I71_BURPS/69-143--------------------------------------------------------------------------------
O27261_METTH/78-148--------------------------------------------------------------------------------
Q5LWR4_RUEPO/91-158--------------------------------------------------------------------------------
Q9K655_BACHD/67-134--------------------------------------------------------------------------------
Q980N2_SULSO/6-77--------------------------------------------------------------------------------
Q5P347_AROAE/71-145--------------------------------------------------------------------------------
Q8NTP9_CORGL/72-146--------------------------------------------------------------------------------
Q5YZ22_NOCFA/6-77--------------------------------------------------------------------------------
Q92S84_RHIME/6-77--------------------------------------------------------------------------------
Q5LVX6_RUEPO/69-143--------------------------------------------------------------------------------
Q6FCJ8_ACIAD/71-145--------------------------------------------------------------------------------
Q9HVR3_PSEAE/69-143--------------------------------------------------------------------------------
Q5LXH4_RUEPO/67-141--------------------------------------------------------------------------------
Q8Y353_RALSO/69-136--------------------------------------------------------------------------------
A9CG60_AGRT5/77-149--------------------------------------------------------------------------------
A9IKA3_BORPD/73-141--------------------------------------------------------------------------------
B2FLQ0_STRMK/74-148--------------------------------------------------------------------------------
C1A292_RHOE4/70-138--------------------------------------------------------------------------------
D5AV63_RHOCB/70-137--------------------------------------------------------------------------------
F2KKC6_PSEBN/67-133--------------------------------------------------------------------------------
F2Z5Y7_SULAC/76-144--------------------------------------------------------------------------------
G4RMH4_THETK/397-468--------------------------------------------------------------------------------
YBAO_ECOLI/68-142--------------------------------------------------------------------------------
REG7_PYRFU/69-138--------------------------------------------------------------------------------
Q0K0V9_CUPNH/87-161--------------------------------------------------------------------------------
Q1DFS8_MYXXD/69-140--------------------------------------------------------------------------------
Q2K1K4_RHIEC/70-143--------------------------------------------------------------------------------
Q2YIU7_BRUA2/70-144--------------------------------------------------------------------------------
Q2YL25_BRUA2/72-139--------------------------------------------------------------------------------
Q2YQJ2_BRUA2/71-144--------------------------------------------------------------------------------
Q5JGT9_THEKO/6-76--------------------------------------------------------------------------------
Q5L7H5_BACFN/70-142--------------------------------------------------------------------------------
Q5LDE0_BACFN/71-144--------------------------------------------------------------------------------
Q5SK07_THET8/6-76--------------------------------------------------------------------------------
Q5ZVF4_LEGPH/88-161--------------------------------------------------------------------------------
Q63LV0_BURPS/69-143--------------------------------------------------------------------------------
Q63PU3_BURPS/81-154--------------------------------------------------------------------------------
Q63WP2_BURPS/72-146--------------------------------------------------------------------------------
Q79Z48_STRAW/82-148--------------------------------------------------------------------------------
Q7LX67_SULSO/76-145--------------------------------------------------------------------------------
Q7VSF7_BORPE/69-142--------------------------------------------------------------------------------
Q7VUR8_BORPE/71-143--------------------------------------------------------------------------------
Q7VUU2_BORPE/68-141--------------------------------------------------------------------------------
Q7VVL9_BORPE/71-144--------------------------------------------------------------------------------
Q81UN4_BACAN/77-147--------------------------------------------------------------------------------
Q88EQ3_PSEPK/70-143--------------------------------------------------------------------------------
Q88NA5_PSEPK/72-143--------------------------------------------------------------------------------
Q88QV0_PSEPK/75-144--------------------------------------------------------------------------------
Q8PE26_XANCP/73-147--------------------------------------------------------------------------------
REG6_PYRFU/71-140--------------------------------------------------------------------------------
Q8ZKW5_SALTY/74-143--------------------------------------------------------------------------------
Q98A93_RHILO/76-149--------------------------------------------------------------------------------
Q9HKJ0_THEAC/68-141--------------------------------------------------------------------------------
R9VS53_9ENTR/78-152--------------------------------------------------------------------------------

PF06778

F0SNH9_PLABD/43-266--------------------------------------------------------------------ERSRGVDAVCEL
C4KZ59_EXISA/42-244--------------------------------------------------------------------KREQMIEEFTAF
Q8FPI6_COREF/57-245--------------------------------------------------------------------DRTAVIEQAREF
L0ICT5_HALRX/35-243--------------------------------------------------------------------.RERALADGVAY
D9SZQ2_MICAI/35-220--------------------------------------------------------------------.RENVVDEVESL
Y1714_THET8/36-235--------------------------------------------------------------------AREDAWEELKGL
R7XV22_9ACTO/33-219--------------------------------------------------------------------DRDTEASEVEAL
Q0SJX2_RHOSR/31-217--------------------------------------------------------------------VRDEVVDDAHTY
Y2262_NATPD/37-243--------------------------------------------------------------------...RALETGTDY
B1VE13_CORU7/32-219--------------------------------------------------------------------DRAAVAEDFQKF
Q4JVC0_CORJK/33-220--------------------------------------------------------------------DRAEAAADFQAF
L0JIJ1_NATP1/34-241--------------------------------------------------------------------RRERAIEEGIDY
T0LXR6_9EURY/32-214--------------------------------------------------------------------....VVEALNVT
Q9YFL1_AERPE/25-208--------------------------------------------------------------------.....AEAWRSV
E1VXL5_ARTAR/41-226--------------------------------------------------------------------.SEAAAAEFDAL
D6Y1B9_BACIE/32-233--------------------------------------------------------------------ERENILSEFHSH
W5XTF0_9CORY/31-219--------------------------------------------------------------------ERADVISEAQQF
A6W8D4_KINRD/44-230--------------------------------------------------------------------ERTDLTREVQDL
O69830_STRCO/44-230--------------------------------------------------------------------DRAGYADEVQEL
L0EGN4_THECK/32-234--------------------------------------------------------------------EREQAAGELRRM
F9VP99_SULTO/25-212--------------------------------------------------------------------ERKQILSRLNEV
B9LRB6_HALLT/32-240--------------------------------------------------------------------ERKRAIEEGKAF
A0LUP2_ACIC1/31-217--------------------------------------------------------------------DRSHVSAEVENL
S6D874_9EURY/34-244--------------------------------------------------------------------VRERAITEGETF
X4ZQL5_9BACL/32-236--------------------------------------------------------------------ERAVALDELNAF
C5CB90_MICLC/41-225--------------------------------------------------------------------..KKAAKEFDEA
B9L446_THERP/60-240--------------------------------------------------------------------....AVEEFVQL
Y1094_HALWD/33-240--------------------------------------------------------------------.REAAVGDGVEY
Q9RUB0_DEIRA/83-276--------------------------------------------------------------------EREEIKAEFQAA
C1F2S0_ACIC5/36-261--------------------------------------------------------------------DRQRMVAEAQAF
Q6NGV6_CORDI/32-220--------------------------------------------------------------------DRAEIVAQAQSF
D6Z8U5_SEGRD/32-219--------------------------------------------------------------------NREKIGAEALEF
Y3416_GEOKA/32-234--------------------------------------------------------------------EREAAISEFLAL
E6SBC9_INTC7/38-224--------------------------------------------------------------------DRESLSDELESF
C7Q1S6_CATAD/53-239--------------------------------------------------------------------ARADLAAEVETL
R5BEF5_9FIRM/53-249--------------------------------------------------------------------..IKALAEFKAF
E8NBZ8_MICTS/34-209--------------------------------------------------------------------...........L
D7AZW8_NOCDD/37-223--------------------------------------------------------------------DRAAAADELATL
D3F509_CONWI/26-209--------------------------------------------------------------------RRAAAAEEAQAA
D5WXV8_KYRT2/32-234--------------------------------------------------------------------ERRRMRDAFLDL
S0EWF5_CHTCT/28-217--------------------------------------------------------------------.REKDKADFTCA
Q73W63_MYCPA/31-218--------------------------------------------------------------------QRDEVVDDASRF
F5XEW4_MICPN/37-217--------------------------------------------------------------------SAWSAVNEATE.
K0IKJ2_NITGG/40-223--------------------------------------------------------------------.KEEAAKEFASL
D5UHH5_CELFN/40-223--------------------------------------------------------------------.RAEVAADALRA
L0AIF2_NATGS/35-243--------------------------------------------------------------------.RERALEDGAAF
Q97WP2_SULSO/27-213--------------------------------------------------------------------ERRSAINEIESV
B0RBL8_CLAMS/291-473--------------------------------------------------------------------....AVDELDGI
V5XBV5_MYCNE/31-217--------------------------------------------------------------------DRSAVIDETATF
L0DE33_SINAD/64-283--------------------------------------------------------------------.....VEALKKV
D5DMA4_BACMD/32-233--------------------------------------------------------------------DRQAAIHEFLGL
B9E8M3_MACCJ/32-235--------------------------------------------------------------------ERTAMVEEFKAF
F8I7Y0_SULAT/32-233--------------------------------------------------------------------SRQEAIQELARE
D1AC74_THECD/41-225--------------------------------------------------------------------..EEAAGEVEEL
E3H4V1_ROTDC/66-250--------------------------------------------------------------------..AEAIAEFEQL
D7GH54_PROFC/34-213--------------------------------------------------------------------.......ALEQL
C3PGT0_CORA7/31-219--------------------------------------------------------------------EREEIVAQAQKF
W0K1G0_9EURY/32-240--------------------------------------------------------------------DREAALEEAESF
E4NLI1_HALBP/33-242--------------------------------------------------------------------.RNRAVGEGVEY
Q2JDC9_FRASC/32-218--------------------------------------------------------------------ERTPLIDEATAL
A9A1Z8_NITMS/29-212--------------------------------------------------------------------.KEESAKEVENI
Y235_STAEQ/32-235--------------------------------------------------------------------DREAMITELETF
Y3825_BACHD/32-235--------------------------------------------------------------------ERQQIINEFLDL
H5WWJ5_9PSEU/31-217--------------------------------------------------------------------DRGQAAAETAEY
U3GV86_9CORY/36-224--------------------------------------------------------------------TRQEAIEEARSF
Q5YTA7_NOCFA/31-218--------------------------------------------------------------------DREAAIKEAKAF
A4YEP6_METS5/23-205--------------------------------------------------------------------....ILGLVKEV
X5E9F8_9CORY/34-221--------------------------------------------------------------------ARAAVAADLESF
E6TY42_BACCJ/32-233--------------------------------------------------------------------ERETIMAEFFSL
I4F0Z5_MODMB/38-224--------------------------------------------------------------------QRGPAADEVTAL
D3EHI6_GEOS4/33-235--------------------------------------------------------------------.RAFALDELNAF
F4CMZ7_PSEUX/31-218--------------------------------------------------------------------DRGAVASQATEF
D1BQU3_VEIPT/32-230--------------------------------------------------------------------EKVAARNELKAF
D2B5C2_STRRD/36-222--------------------------------------------------------------------NREGMADEVDDL
T0MX07_9EURY/25-211--------------------------------------------------------------------KRNGVIERINST
G2MME7_9ARCH/32-240--------------------------------------------------------------------DRDRAVSEGVEY
C4LIZ4_CORK4/52-239--------------------------------------------------------------------DRDTVAQEMRDF
D1CGR6_THET1/37-235--------------------------------------------------------------------.RSRLLEELLGF
G2TIY8_BACCO/32-236--------------------------------------------------------------------ERDATVKEFRQF
Y3023_OCEIH/32-235--------------------------------------------------------------------ERQAAIDEFQQL
W0JP72_9EURY/34-243--------------------------------------------------------------------RRQQAIEEGIEY
C6WBD6_ACTMD/33-219--------------------------------------------------------------------NRAAAATEAQEY
Y2113_LISMO/33-237--------------------------------------------------------------------.QELMLNELSHF
S5T2Z6_9CORY/39-226--------------------------------------------------------------------ERDALTAEARDF
D8J8S2_HALJB/34-241--------------------------------------------------------------------DREAAIEEGIAY
D7WCD0_9CORY/38-226--------------------------------------------------------------------DRSEIIAEAQRF
C0ZJF7_BREBN/34-236--------------------------------------------------------------------ERKEALDELNAL
L0A3P4_DEIPD/64-256--------------------------------------------------------------------EQAELKQEFTAA
R4VWV7_9EURY/32-241--------------------------------------------------------------------ERDRAIAEGREY
Y3912_BACSK/32-235--------------------------------------------------------------------EREQMLNEFEAL
E6SGY0_THEM7/77-282--------------------------------------------------------------------RRAAIAREAADF
E3E6Q2_PAEPS/44-245--------------------------------------------------------------------ERAGALDELQEF
F2NQ02_MARHT/63-253--------------------------------------------------------------------EKERAKAEFAEV
D6Y396_THEBD/38-224--------------------------------------------------------------------DRGGIADEVEEL
S0AP00_FERAC/25-209--------------------------------------------------------------------..ENVNSNIIHF
D2PNW4_KRIFD/45-231--------------------------------------------------------------------DREELTAELTDL
C7MH02_BRAFD/52-236--------------------------------------------------------------------...AALGDVTAL
M1XN90_NATM8/34-243--------------------------------------------------------------------DRESALGEGVEY
A0JYM8_ARTS2/42-224--------------------------------------------------------------------....AAADFEAL
Y2021_HALSA/32-240--------------------------------------------------------------------DRTAALDDAASF
D8PHP0_9BACT/31-221--------------------------------------------------------------------ERTRGKQEFLRA
G8QM51_AZOSU/74-268--------------------------------------------------------------------ERKGAAEEVKKL
I0JS76_HALH3/32-231--------------------------------------------------------------------EREQAIHEFQQM
Y3100_HALMA/40-244--------------------------------------------------------------------......SEGIGF
A1SMY6_NOCSJ/40-227--------------------------------------------------------------------DRAAEGAEVEQL
C7NI73_KYTSD/39-223--------------------------------------------------------------------..EEIATEAEAF
B7GML3_ANOFW/35-237--------------------------------------------------------------------ERQEAIQEFFTL
D5UN10_TSUPD/36-223--------------------------------------------------------------------SRAAAAAEAEAF
D4GSX4_HALVD/32-241--------------------------------------------------------------------ERRRAIEEGVAY
YWFI_BACSU/38-240--------------------------------------------------------------------ERQSIIHEFTGL
B1YHR9_EXIS2/43-244--------------------------------------------------------------------.RTKMVQEFQAF
C6CZS1_PAESJ/32-234--------------------------------------------------------------------ERSQALDELQSF
K4J0Y5_BIFAP/33-234--------------------------------------------------------------------QRRECLDEFKAL
H6NEC8_9BACL/32-234--------------------------------------------------------------------ERGRAEDELYGL
I3ZHU9_TERRK/71-263--------------------------------------------------------------------EKAAMKAAFIEV
C3ATM2_BACMY/35-236--------------------------------------------------------------------ERGQAMFEFLNV
Q02C59_SOLUE/42-265--------------------------------------------------------------------DRAAIAGEASTA
B3U4H7_9BACT/61-250--------------------------------------------------------------------...ISVAEVKGL
Y241_STACT/32-235--------------------------------------------------------------------DRIQIVQEFHDF
A0RXH1_CENSY/29-210--------------------------------------------------------------------..EESAREVENI
F6FS66_ISOV2/42-238--------------------------------------------------------------------ERAEIVAEAEAA
F8D9K2_HALXS/34-241--------------------------------------------------------------------RRERAIDEGIEF
M4NFE6_9GAMM/24-209--------------------------------------------------------------------DRIAAIKEVVDI
Q47NP0_THEFY/34-220--------------------------------------------------------------------DRAAAGDELTGL
W0RLA9_9BACT/56-280--------------------------------------------------------------------...AAGEAMRGA
E8SJH0_STAPH/32-235--------------------------------------------------------------------DRADMIAEFHRL
F8DZS9_CORRG/32-219--------------------------------------------------------------------DRQAIAEQFQDF
A9B544_HERA2/35-220--------------------------------------------------------------------.REDLREQFAQV
C8WXF6_ALIAD/35-233--------------------------------------------------------------------....VLRDFGAF
C7QZX0_JONDD/33-222--------------------------------------------------------------------ERRALIDDALTA
Q1IQ94_KORVE/57-277--------------------------------------------------------------------ERLGVIKDAEQT
Q4JCN7_SULAC/26-212--------------------------------------------------------------------.RRNILNRIEEL
M1MY31_9CORY/31-219--------------------------------------------------------------------DRSEIITEAREF
X2GJV6_9BACI/32-235--------------------------------------------------------------------ERQAAVEEFIAY
C8XF55_NAKMY/45-226--------------------------------------------------------------------.....TTELVEL

PF04261

Q9KQ59_VIBCH/5-294QTAILPEAGPFALYTLLKVRQNHAHVL..QALKALPALVEE.........................I.NQNQPGAELTVS
EFEN_BACSU/66-405QAGITTAHQTYVYFAALDVTAKDKSD.IITLFRNWTSLTQMLTSGKKMSAEQR..NQYLPPQDTGESADLS..PSNLTVT
Q98KG6_RHILO/13-313AQSVDAPLSQSAIFLVVTVAGEQPA......LAKVCSVLGELD...................DLVKTVGFRDLGGRLSCI
Q9FBY9_STRCO/10-309PQMVLSPLTSAAIFLVVTIDSGG.....EDTVRDLLSDVASLERA.....................VGFRAQPDGRLSCV
EFEB_ECOLI/61-411QAGILTPQQAAMMLVAFDVLASDKADL.ERLFRLLTQRFAFLTQGGAAPETP...NPRLPPLDSGILGGYIAP.DNLTIT
Q9K1P5_NEIMB/60-410QAGIVTPQQAFSIMCAFDVTAQSAKQL.ENLFRTLTARIEFLTQGGEYQDGD....DKLPPAGSGILGKAFN.PDGLTVT
Q9ZBW9_STRCO/87-434QPGITTPMQARGHLVAFDLAAGAGRKEAAALLRRWSDTARRLMAGEPA...........GSRDTDVA.RDAG.PSSLTVT
Q9CNH6_PASMU/4-293QSGVLLEHCKAAIYLEANITD.................LTVIPEASRQ............FCDKLAQLQQTYPDARLGAV
Q9RKQ2_STRCO/65-406QAGIATPVQDRLHFAAFDVTT.EDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEAL.GLKP.SRLTLT
YFEX_ECOLI/5-296QSGILPEHCRAAIWIEANVK................GEVDALRAASKT............FADKLATFEAKFPDAHLGAV
Q9K036_NEIMB/5-299QSAIIPDHAQAGIFIEADFAA...............NRLNDIKAACRA...........S.LDALTALKARFPDDILGLT
I6Y4U9_MYCTU/9-305.QPILAPLTPAAIFLVATIGADGEATV.HDALSKISGLVRA..........................IGFRDPTKHLSVV
Q2G130_STAA8/64-398QPGITTPTQKTCNFVALDLKSKDRDAI.KAMFKKWTVMADRMMDGDTVGKPSN..NPLMPPVDTGESIGL.G.ASKLTIT
Q5NM63_ZYMMO/7-304.QAIVTPITPAAIFLVVTLKEGK..EA.EDNIRSFCPDLSALRRT......................VSLRDRDARLTCV

PF07876

Q748N1_GEOSL/2-96--------------------------------------------------------------------------------
A9CJX0_AGRT5/2-102--------------------------------------------------------------------------------
Q740A8_MYCPA/82-179--------------------------------------------------------------------------------
Q7S333_NEUCR/57-160--------------------------------------------------------------------------------
Q98H26_RHILO/2-102--------------------------------------------------------------------------------
Y4036_STRCO/2-97--------------------------------------------------------------------------------
Q89RS9_BRADU/5-102--------------------------------------------------------------------------------
Q9SYD8_ARATH/116-206--------------------------------------------------------------------------------
Q9SYD8_ARATH/5-102--------------------------------------------------------------------------------
Q8XM37_CLOPE/2-100--------------------------------------------------------------------------------
Q98BN1_RHILO/2-96--------------------------------------------------------------------------------
Q7MWG5_PORGI/2-100--------------------------------------------------------------------------------
Q7UFZ5_RHOBA/16-113--------------------------------------------------------------------------------
POP3_ARATH/8-104--------------------------------------------------------------------------------
Y5258_ARATH/6-100--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/40-141--------------------------------------------------------------------------------
Q7N2N7_PHOLL/12-107--------------------------------------------------------------------------------
Q9SIP1_ARATH/158-254--------------------------------------------------------------------------------
Q7SEW8_NEUCR/10-117--------------------------------------------------------------------------------
Q7D0A2_AGRT5/2-93--------------------------------------------------------------------------------
Q726I9_DESVH/2-101--------------------------------------------------------------------------------
Q7URH4_RHOBA/33-129--------------------------------------------------------------------------------
Q97LN9_CLOAB/2-94--------------------------------------------------------------------------------
Q6LGQ4_PHOPR/2-98--------------------------------------------------------------------------------
Q8KCZ4_CHLTE/2-100--------------------------------------------------------------------------------
Q7S418_NEUCR/3-107--------------------------------------------------------------------------------
Q8ABC5_BACTN/2-99--------------------------------------------------------------------------------
Q6LYV0_METMP/2-100--------------------------------------------------------------------------------
Q82QQ6_STRAW/2-93--------------------------------------------------------------------------------
Q9F304_STRCO/2-93--------------------------------------------------------------------------------
Q9SIP1_ARATH/49-144--------------------------------------------------------------------------------
Q8RF81_FUSNN/2-98--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/154-248--------------------------------------------------------------------------------
Q9A628_CAUCR/2-100--------------------------------------------------------------------------------
B9HX68_POPTR/9-106--------------------------------------------------------------------------------
B9HX69_POPTR/16-111--------------------------------------------------------------------------------
H2VFL6_ZYMMO/42-154--------------------------------------------------------------------------------
H7C7T4_BRADU/2-94--------------------------------------------------------------------------------
Q2YP23_BRUA2/2-92--------------------------------------------------------------------------------
Q8LQD2_ORYSJ/11-106--------------------------------------------------------------------------------

PF03992

HMOA_BACSU/1-78--------------------------------------------------------------------------------
Q930A7_RHIME/30-107--------------------------------------------------------------------------------
Q9L164_STRCO/44-120--------------------------------------------------------------------------------
Q930L9_RHIME/3-79--------------------------------------------------------------------------------
HDOX_LISMO/1-86--------------------------------------------------------------------------------
WH42_STRCO/45-121--------------------------------------------------------------------------------
Q8Y476_LISMO/1-77--------------------------------------------------------------------------------
Q98L66_RHILO/1-81--------------------------------------------------------------------------------
Q98HA4_RHILO/1-77--------------------------------------------------------------------------------
Q9A6W1_CAUCR/113-186--------------------------------------------------------------------------------
O33291_MYCTU/2-75--------------------------------------------------------------------------------
Q8YAL6_LISMO/1-77--------------------------------------------------------------------------------
Q5LR19_RUEPO/12-92--------------------------------------------------------------------------------
NECA1_HUMAN/251-326--------------------------------------------------------------------------------
Q8XYB2_RALSO/23-99--------------------------------------------------------------------------------
Q9CLF6_PASMU/1-77--------------------------------------------------------------------------------
Q8NLF1_CORGL/2-78--------------------------------------------------------------------------------
O06569_MYCTU/1-77--------------------------------------------------------------------------------
Q8NRX5_CORGL/1-76--------------------------------------------------------------------------------
Q9I1R9_PSEAE/4-80--------------------------------------------------------------------------------
Q9I267_PSEAE/43-119--------------------------------------------------------------------------------
Q9RTW6_DEIRA/23-100--------------------------------------------------------------------------------
Q9RXN8_DEIRA/1-77--------------------------------------------------------------------------------
Q9FC02_STRCO/14-92--------------------------------------------------------------------------------
Q9K649_BACHD/1-78--------------------------------------------------------------------------------
Q92MY2_RHIME/1-77--------------------------------------------------------------------------------
HDOX_BACHD/1-78--------------------------------------------------------------------------------
Q9RX23_DEIRA/3-80--------------------------------------------------------------------------------
Q92N21_RHIME/1-81--------------------------------------------------------------------------------
NECA2_HUMAN/285-360--------------------------------------------------------------------------------
Q8XW80_RALSO/11-88--------------------------------------------------------------------------------
Q9HY51_PSEAE/4-80--------------------------------------------------------------------------------
Q97V29_SULSO/1-78--------------------------------------------------------------------------------
Y1783_SYNY3/49-125--------------------------------------------------------------------------------
A9CGS9_AGRT5/10-86--------------------------------------------------------------------------------
Y2021_HALSA/401-477--------------------------------------------------------------------------------
Q8UIT6_AGRT5/6-83--------------------------------------------------------------------------------
Q8NRX6_CORGL/1-76--------------------------------------------------------------------------------
Q9ABN2_CAUCR/2-78--------------------------------------------------------------------------------
Q9YCC3_AERPE/2-78--------------------------------------------------------------------------------
Q8TTU6_METAC/1-76--------------------------------------------------------------------------------
Q9X9W3_STRCO/128-214--------------------------------------------------------------------------------
O54100_STRCO/29-106--------------------------------------------------------------------------------
Q9CFE4_LACLA/2-80--------------------------------------------------------------------------------
Q92Y06_RHIME/4-80--------------------------------------------------------------------------------
YQJZ_BACSU/12-86--------------------------------------------------------------------------------
Q8PEE0_XANCP/7-83--------------------------------------------------------------------------------
A9CLL3_AGRT5/1-78--------------------------------------------------------------------------------
Q9HYL5_PSEAE/1-78--------------------------------------------------------------------------------
Q7CRR7_AGRT5/5-81--------------------------------------------------------------------------------
Q9HHS4_HALSA/1-77--------------------------------------------------------------------------------
Q9I5L9_PSEAE/2-79--------------------------------------------------------------------------------
Q8KL47_RHIEC/8-84--------------------------------------------------------------------------------
LSRG_ECOLI/1-77--------------------------------------------------------------------------------
Q98HP0_RHILO/1-74--------------------------------------------------------------------------------
Q8Y824_LISMO/4-80--------------------------------------------------------------------------------
Q9I6L9_PSEAE/2-78--------------------------------------------------------------------------------
Q9KLV5_VIBCH/1-77--------------------------------------------------------------------------------
Q983R7_RHILO/10-88--------------------------------------------------------------------------------
NECA3_HUMAN/295-370--------------------------------------------------------------------------------
Q8NMA1_CORGL/2-78--------------------------------------------------------------------------------
Q9RSM4_DEIRA/18-94--------------------------------------------------------------------------------
Y0793_MYCTU/4-79--------------------------------------------------------------------------------
Q9JYI1_NEIMB/3-79--------------------------------------------------------------------------------
Q9A6G2_CAUCR/1-78--------------------------------------------------------------------------------
Q9I1K5_PSEAE/247-321--------------------------------------------------------------------------------
Q97DS8_CLOAB/1-78--------------------------------------------------------------------------------
Q9CHY3_LACLA/1-77--------------------------------------------------------------------------------
A9CJ79_AGRT5/1-77--------------------------------------------------------------------------------
Q98DQ1_RHILO/1-77--------------------------------------------------------------------------------
HMOB_BACSU/65-140--------------------------------------------------------------------------------
YCZJ_BACSU/1-78--------------------------------------------------------------------------------
Q9RSI3_DEIRA/10-86--------------------------------------------------------------------------------
Q92VV2_RHIME/1-77--------------------------------------------------------------------------------
Q8RDZ4_FUSNN/112-188--------------------------------------------------------------------------------
A9CHT4_AGRT5/1-79--------------------------------------------------------------------------------
Q9RKA2_STRCO/1-77--------------------------------------------------------------------------------
Q9ZBJ4_STRCO/2-77--------------------------------------------------------------------------------
Q9RX69_DEIRA/1-77--------------------------------------------------------------------------------
YCNE_BACSU/1-77--------------------------------------------------------------------------------
A5FGC9_FLAJ1/1-73--------------------------------------------------------------------------------
A9WHE0_CHLAA/1-72--------------------------------------------------------------------------------
H7C6P0_BRADU/1-79--------------------------------------------------------------------------------
YGIN_ECOLI/1-87--------------------------------------------------------------------------------
MHUD_MYCTU/3-76--------------------------------------------------------------------------------
Q2FV13_STAA8/45-118--------------------------------------------------------------------------------
HDOX1_STAA8/3-78--------------------------------------------------------------------------------
HDOX2_STAA8/1-77--------------------------------------------------------------------------------
Q2K560_RHIEC/1-80--------------------------------------------------------------------------------
Q2YKI2_BRUA2/1-80--------------------------------------------------------------------------------
Q2YLT4_BRUA2/1-77--------------------------------------------------------------------------------
Q79ZD9_STRAW/18-90--------------------------------------------------------------------------------
Q8CZ78_STRR6/12-86--------------------------------------------------------------------------------
X2H731_9GAMM/1-76--------------------------------------------------------------------------------

PF11695

Q9A5F4_CAUCR/31-168--------------------------------------------------------------------------------
F8EE97_RUNSL/6-145--------------------------------------------------------------------------------
A4XU80_PSEMY/15-152--------------------------------------------------------------------------------
G8TAU1_NIAKG/5-143--------------------------------------------------------------------------------
Q0RPH8_FRAAA/6-148--------------------------------------------------------------------------------
Q0RBQ9_FRAAA/10-153--------------------------------------------------------------------------------
G0FWI4_AMYMS/6-149--------------------------------------------------------------------------------
E0TC84_PARBH/7-144--------------------------------------------------------------------------------
Q9XAE9_STRCO/9-147--------------------------------------------------------------------------------
U5W6J8_9ACTO/6-143--------------------------------------------------------------------------------
C6WHE5_ACTMD/7-164--------------------------------------------------------------------------------
Q0APS8_MARMM/5-139--------------------------------------------------------------------------------
Q163R1_ROSDO/8-148--------------------------------------------------------------------------------
E4N6J1_KITSK/26-165--------------------------------------------------------------------------------
I2EVC9_EMTOG/6-144--------------------------------------------------------------------------------
G0L103_ZOBGA/6-144--------------------------------------------------------------------------------
M4ZXH9_9ACTN/6-146--------------------------------------------------------------------------------
D2QP51_SPILD/3-141--------------------------------------------------------------------------------
A1WRH2_VEREI/5-143--------------------------------------------------------------------------------
K0EXQ7_9NOCA/7-138--------------------------------------------------------------------------------
U5QGK2_9CYAN/8-146--------------------------------------------------------------------------------
S6AKH1_PSERE/7-144--------------------------------------------------------------------------------
I0K5K2_9BACT/3-141--------------------------------------------------------------------------------
D2ATU4_STRRD/6-142--------------------------------------------------------------------------------
M4XI80_PSEDE/7-145--------------------------------------------------------------------------------
Q027R7_SOLUE/5-143--------------------------------------------------------------------------------
A4FAH4_SACEN/6-145--------------------------------------------------------------------------------
E2Q5L4_STRC2/8-147--------------------------------------------------------------------------------
E3J464_FRASU/10-153--------------------------------------------------------------------------------
B0T5Z4_CAUSK/7-144--------------------------------------------------------------------------------
F4KSW9_HALH1/6-143--------------------------------------------------------------------------------
K0C7N6_ALCDB/6-143--------------------------------------------------------------------------------
I0HGL4_ACTM4/6-144--------------------------------------------------------------------------------
Q0BYF9_HYPNA/5-155--------------------------------------------------------------------------------
C7QH43_CATAD/16-156--------------------------------------------------------------------------------
D6X6B2_STRPR/13-151--------------------------------------------------------------------------------
G8SIB6_ACTS5/6-144--------------------------------------------------------------------------------
B9JB79_AGRRK/2-147--------------------------------------------------------------------------------
B9JTF5_AGRVS/7-155--------------------------------------------------------------------------------
A9B229_HERA2/6-143--------------------------------------------------------------------------------
R4LEJ6_9ACTO/5-162--------------------------------------------------------------------------------
D7B9L7_NOCDD/15-153--------------------------------------------------------------------------------
F4AZ85_KROS4/5-144--------------------------------------------------------------------------------
V9VXL5_9RHOB/7-167--------------------------------------------------------------------------------
C5BJX2_TERTT/5-143--------------------------------------------------------------------------------
M9R7J4_9RHOB/3-143--------------------------------------------------------------------------------
F3ZD85_9ACTO/31-189--------------------------------------------------------------------------------
A1K291_AZOSB/3-140--------------------------------------------------------------------------------
H2JWD5_STRHJ/4-164--------------------------------------------------------------------------------
S5VG62_STRCU/12-150--------------------------------------------------------------------------------
Q2JDS7_FRASC/6-148--------------------------------------------------------------------------------
Q15UR5_PSEA6/3-141--------------------------------------------------------------------------------

PF07682

C7LRC9_DESBD/11-306--------------------------------------------------------------------------------
L0DXR4_THIND/8-328--------------------------------------------------------------------------------
F8I6C7_SULAT/3-301--------------------------------------------------------------------------------
O66762_AQUAE/8-332--------------------------------------------------------------------------------
Q6L0W6_PICTO/3-301--------------------------------------------------------------------------------
F4B4D5_ACIHW/1-294--------------------------------------------------------------------------------
G0JQP4_9GAMM/4-306--------------------------------------------------------------------------------
D0L035_HALNC/5-309--------------------------------------------------------------------------------
L0DTB9_THIND/25-315--------------------------------------------------------------------------------
Q972K4_SULTO/3-303--------------------------------------------------------------------------------

PF07978

Q7PGV6_ANOGA/173-270--------------------------------------------------------------------------------
Q7SGJ2_NEUCR/232-329--------------------------------------------------------------------------------
Q5LMH4_RUEPO/1-102--------------------------------------------------------------------------------
Q6W252_RHISN/3-102--------------------------------------------------------------------------------
Q98EJ3_RHILO/1-102--------------------------------------------------------------------------------
Q89P12_BRADU/7-101--------------------------------------------------------------------------------
Q89KU9_BRADU/3-106--------------------------------------------------------------------------------
Q82QD1_STRAW/4-107--------------------------------------------------------------------------------
NIPS2_MOUSE/182-279--------------------------------------------------------------------------------
Q98DQ0_RHILO/2-103--------------------------------------------------------------------------------
Q98IN9_RHILO/48-151--------------------------------------------------------------------------------
Q89JD9_BRADU/9-109--------------------------------------------------------------------------------
Q5M949_RAT/37-136--------------------------------------------------------------------------------
Q7VX89_BORPE/3-102--------------------------------------------------------------------------------
Q983U2_RHILO/146-257--------------------------------------------------------------------------------
NIPS1_MOUSE/185-282--------------------------------------------------------------------------------
Q88JP3_PSEPK/3-104--------------------------------------------------------------------------------
Q6C7U3_YARLI/393-490--------------------------------------------------------------------------------
Q5M949_RAT/146-245--------------------------------------------------------------------------------
Q89P26_BRADU/3-96--------------------------------------------------------------------------------
Q89P26_BRADU/107-202--------------------------------------------------------------------------------
Q983U2_RHILO/19-118--------------------------------------------------------------------------------
A9CLJ4_AGRT5/3-102--------------------------------------------------------------------------------
NPS3A_PONAB/37-136--------------------------------------------------------------------------------
A9CJ80_AGRT5/1-102--------------------------------------------------------------------------------
YMQ1_CAEEL/427-524--------------------------------------------------------------------------------
Q63UF8_BURPS/3-102--------------------------------------------------------------------------------
Q6N5T9_RHOPA/71-174--------------------------------------------------------------------------------
Q7UP06_RHOBA/160-263--------------------------------------------------------------------------------
A6VZH8_MARMS/5-99--------------------------------------------------------------------------------
F1QWR0_DANRE/62-160--------------------------------------------------------------------------------
F6W3L2_XENTR/18-115--------------------------------------------------------------------------------
Q0P468_DANRE/179-276--------------------------------------------------------------------------------
Q2YLT3_BRUA2/5-100--------------------------------------------------------------------------------
S6AQW2_PSERE/106-203--------------------------------------------------------------------------------

PF07237

B5GYT2_STRC2/1-95--------------------------------------------------------------------------------
Q28SF7_JANSC/2-97--------------------------------------------------------------------------------
B9J727_AGRRK/3-103--------------------------------------------------------------------------------
Q8PBE1_XANCP/2-103--------------------------------------------------------------------------------
D2R596_PIRSD/2-117--------------------------------------------------------------------------------
J7QVW7_METSZ/2-102--------------------------------------------------------------------------------
Q0C3F1_HYPNA/123-216--------------------------------------------------------------------------------
Q1D7D3_MYXXD/125-223--------------------------------------------------------------------------------
V5S991_9RHIZ/2-103--------------------------------------------------------------------------------
G8ATI6_AZOBR/2-107--------------------------------------------------------------------------------
A6X0L9_OCHA4/2-103--------------------------------------------------------------------------------
K0CB81_ALCDB/2-104--------------------------------------------------------------------------------
K9SFX5_9CYAN/2-103--------------------------------------------------------------------------------
Q0ANC9_MARMM/2-101--------------------------------------------------------------------------------
Q82XJ8_NITEU/2-114--------------------------------------------------------------------------------
X4ZS72_9BORD/3-104--------------------------------------------------------------------------------
E3F379_KETVY/2-102--------------------------------------------------------------------------------
B2FL05_STRMK/2-104--------------------------------------------------------------------------------
Q89NE4_BRADU/4-102--------------------------------------------------------------------------------
Q2NCG7_ERYLH/1-101--------------------------------------------------------------------------------
F6IFW1_9SPHN/2-103--------------------------------------------------------------------------------
A4YT03_BRASO/13-113--------------------------------------------------------------------------------
B8EQ30_METSB/3-103--------------------------------------------------------------------------------
G2IQJ1_9SPHN/7-107--------------------------------------------------------------------------------
B8IJU9_METNO/2-103--------------------------------------------------------------------------------
C7RAK3_KANKD/4-105--------------------------------------------------------------------------------
I3U9U4_ADVKW/2-103--------------------------------------------------------------------------------
A1W852_ACISJ/5-103--------------------------------------------------------------------------------
A9FY32_SORC5/2-103--------------------------------------------------------------------------------
W0AJL6_9SPHN/125-224--------------------------------------------------------------------------------
I4B2R6_TURPD/2-101--------------------------------------------------------------------------------
I0HMS9_RUBGI/2-107--------------------------------------------------------------------------------
Q89LX7_BRADU/1-101--------------------------------------------------------------------------------
M4S0F5_9SPHN/3-103--------------------------------------------------------------------------------
S6AFX9_PSERE/2-103--------------------------------------------------------------------------------
D7A8V6_STAND/2-103--------------------------------------------------------------------------------
Q21G53_SACD2/2-103--------------------------------------------------------------------------------
C7R6A1_KANKD/1-102--------------------------------------------------------------------------------
B2JM74_BURP8/2-103--------------------------------------------------------------------------------
E1V408_HALED/2-103--------------------------------------------------------------------------------
Q92NA2_RHIME/2-103--------------------------------------------------------------------------------
C5CJX4_VARPS/4-105--------------------------------------------------------------------------------
F5XY16_RAMTT/2-117--------------------------------------------------------------------------------
A1B4H4_PARDP/2-102--------------------------------------------------------------------------------
A7HVY2_PARL1/2-102--------------------------------------------------------------------------------
I3TII5_TISMK/5-105--------------------------------------------------------------------------------
Q09CK7_STIAD/2-103--------------------------------------------------------------------------------
D0J6R4_COMT2/2-106--------------------------------------------------------------------------------
B6ITX3_RHOCS/21-122--------------------------------------------------------------------------------
Q0C3F1_HYPNA/2-102--------------------------------------------------------------------------------
G8R5I7_OWEHD/3-96--------------------------------------------------------------------------------
N0B831_9RHIZ/2-103--------------------------------------------------------------------------------
A9C096_DELAS/2-104--------------------------------------------------------------------------------
B2ID24_BEII9/3-104--------------------------------------------------------------------------------
Q0K872_CUPNH/2-103--------------------------------------------------------------------------------
F7QJ30_9BRAD/2-105--------------------------------------------------------------------------------
G2IQA6_9SPHN/2-100--------------------------------------------------------------------------------
B3PD68_CELJU/3-105--------------------------------------------------------------------------------
A9IUP3_BORPD/4-105--------------------------------------------------------------------------------
E6WPA7_PSEUU/2-104--------------------------------------------------------------------------------
Q984U4_RHILO/2-103--------------------------------------------------------------------------------
B4RHI4_PHEZH/3-103--------------------------------------------------------------------------------
B2ID24_BEII9/126-226--------------------------------------------------------------------------------
Q15TI8_PSEA6/2-104--------------------------------------------------------------------------------
F8J4V4_HYPSM/2-103--------------------------------------------------------------------------------
Q12MS1_SHEDO/2-103--------------------------------------------------------------------------------
G8MEM7_9BURK/3-106--------------------------------------------------------------------------------
R9VVL6_9ENTR/2-103--------------------------------------------------------------------------------
D0LSP9_HALO1/2-102--------------------------------------------------------------------------------
E8RPL4_ASTEC/2-103--------------------------------------------------------------------------------
Q7VWQ1_BORPE/3-103--------------------------------------------------------------------------------
C7NJF5_KYTSD/19-131--------------------------------------------------------------------------------
A9WHX6_CHLAA/3-114--------------------------------------------------------------------------------
W0AJL6_9SPHN/2-103--------------------------------------------------------------------------------
B1ZRB2_OPITP/3-106--------------------------------------------------------------------------------
K9UEC3_9CHRO/2-102--------------------------------------------------------------------------------
Q984U4_RHILO/125-217--------------------------------------------------------------------------------
D4Z3X9_SPHJU/2-103--------------------------------------------------------------------------------
G4RAE0_PELHB/3-101--------------------------------------------------------------------------------
K9RSJ8_SYNP3/2-117--------------------------------------------------------------------------------
A8AJZ2_CITK8/2-103--------------------------------------------------------------------------------
A7HVY2_PARL1/124-224--------------------------------------------------------------------------------
E0TG43_PARBH/2-101--------------------------------------------------------------------------------
A5V8A2_SPHWW/3-103--------------------------------------------------------------------------------
W6RB51_9RHIZ/2-103--------------------------------------------------------------------------------
E1WZE7_BACMS/3-105--------------------------------------------------------------------------------
E3HXD2_ACHXA/3-103--------------------------------------------------------------------------------
E3F379_KETVY/124-225--------------------------------------------------------------------------------
Q3J6F6_RHOS4/3-101--------------------------------------------------------------------------------
C6XML8_HIRBI/2-102--------------------------------------------------------------------------------
D2S2U1_HALTV/4-110--------------------------------------------------------------------------------
B8IGF6_METNO/2-102--------------------------------------------------------------------------------
B6JDI6_OLICO/2-105--------------------------------------------------------------------------------
Q6MH99_BDEBA/3-105--------------------------------------------------------------------------------
Q1GX81_SPHAL/125-226--------------------------------------------------------------------------------
Q1GX81_SPHAL/2-103--------------------------------------------------------------------------------
F5Y4J2_RAMTT/2-105--------------------------------------------------------------------------------
Q98HZ3_RHILO/2-103--------------------------------------------------------------------------------
E8RPL3_ASTEC/12-111--------------------------------------------------------------------------------
M4NEX2_9GAMM/2-102--------------------------------------------------------------------------------
U4KCB2_9VIBR/2-103--------------------------------------------------------------------------------
M4VN50_9DELT/3-103--------------------------------------------------------------------------------
B8GIK1_METPE/2-107--------------------------------------------------------------------------------
Q11C17_CHESB/2-101--------------------------------------------------------------------------------
D3SAH4_THISK/2-95--------------------------------------------------------------------------------
K4KKH1_SIMAS/2-104--------------------------------------------------------------------------------
Q1D7D3_MYXXD/2-103--------------------------------------------------------------------------------
W0JAW7_9BACT/3-105--------------------------------------------------------------------------------
H5WRE5_9BURK/2-103--------------------------------------------------------------------------------
D9QND0_BRESC/3-101--------------------------------------------------------------------------------
E3I2U0_RHOVT/2-102--------------------------------------------------------------------------------
B0T2P9_CAUSK/2-103--------------------------------------------------------------------------------
A7HS11_PARL1/2-103--------------------------------------------------------------------------------
A1U2N5_MARAV/2-103--------------------------------------------------------------------------------
A2SLW6_METPP/28-129--------------------------------------------------------------------------------

PF05336

E8N7B3_MICTS/3-106--------------------------------------------------------------------------------
G8NW33_GRAMM/3-106--------------------------------------------------------------------------------
R6A9X3_9BACT/17-125--------------------------------------------------------------------------------
Q2G5L0_NOVAD/2-105--------------------------------------------------------------------------------
E3J5G6_FRASU/3-105--------------------------------------------------------------------------------
RHAM_CLOB8/3-103--------------------------------------------------------------------------------
F3Y8K3_MELPT/17-117--------------------------------------------------------------------------------
D1BAI9_SANKS/1-101--------------------------------------------------------------------------------
R6EFZ5_9FIRM/3-103--------------------------------------------------------------------------------
E8V1U4_TERSS/3-109--------------------------------------------------------------------------------
Q8A1J5_BACTN/18-126--------------------------------------------------------------------------------
G8UKT9_TANFA/3-106--------------------------------------------------------------------------------
R7BFW5_9FIRM/6-107--------------------------------------------------------------------------------
C6VV82_DYAFD/7-106--------------------------------------------------------------------------------
X2H2T6_9GAMM/3-103--------------------------------------------------------------------------------
X6NJ28_RETFI/26-133--------------------------------------------------------------------------------
RHAM_ROSDO/4-104--------------------------------------------------------------------------------
R6NFT0_9BACE/3-109--------------------------------------------------------------------------------
C6Y2X4_PEDHD/3-103--------------------------------------------------------------------------------
M9R5B0_9RHOB/4-104--------------------------------------------------------------------------------
D8MRW2_ERWBE/3-103--------------------------------------------------------------------------------
S6C4A1_9ACTN/4-102--------------------------------------------------------------------------------
R7J4V8_9PORP/3-106--------------------------------------------------------------------------------
L0G2V5_ECHVK/4-110--------------------------------------------------------------------------------
R6YJI9_9BACE/3-109--------------------------------------------------------------------------------
D7CRS7_TRURR/5-108--------------------------------------------------------------------------------
M4WU28_PSEDE/4-110--------------------------------------------------------------------------------
E8WVL5_ACISM/3-109--------------------------------------------------------------------------------
R5F8H2_9CLOT/21-121--------------------------------------------------------------------------------
Q017X5_OSTTA/20-125--------------------------------------------------------------------------------
V2XST4_MONRO/8-118--------------------------------------------------------------------------------
RHAM_BURXL/3-103--------------------------------------------------------------------------------
D3FCI7_CONWI/3-103--------------------------------------------------------------------------------
F5YG46_TREAZ/3-104--------------------------------------------------------------------------------
X5DE39_9BACT/3-103--------------------------------------------------------------------------------
C7MF49_BRAFD/3-102--------------------------------------------------------------------------------
A6KWX7_BACV8/17-125--------------------------------------------------------------------------------
G2R0M2_THITE/36-147--------------------------------------------------------------------------------
R5CS86_9BACT/17-125--------------------------------------------------------------------------------
R5GT53_9BACT/20-128--------------------------------------------------------------------------------
U5VPP9_9ACTO/2-101--------------------------------------------------------------------------------
D1AQR2_SEBTE/6-106--------------------------------------------------------------------------------
F0RIC4_CELLC/5-113--------------------------------------------------------------------------------
H1YCQ6_9SPHI/3-103--------------------------------------------------------------------------------
RHAM_RHISN/3-103--------------------------------------------------------------------------------
M3CIR2_SPHMS/7-117--------------------------------------------------------------------------------
H6MRG6_GORPV/6-114--------------------------------------------------------------------------------
R6W2E5_9BACT/17-125--------------------------------------------------------------------------------
H1W373_COLHI/35-146--------------------------------------------------------------------------------
B7FV54_PHATC/57-181--------------------------------------------------------------------------------
R6RUK4_9BACE/17-125--------------------------------------------------------------------------------
G0FMG2_AMYMS/3-105--------------------------------------------------------------------------------
C6XPT9_HIRBI/4-112--------------------------------------------------------------------------------
RHAM_FLAJ1/6-106--------------------------------------------------------------------------------
RHAM_DINSH/3-103--------------------------------------------------------------------------------
E8V2R3_TERSS/3-104--------------------------------------------------------------------------------
Q8A896_BACTN/19-127--------------------------------------------------------------------------------
G8MFN0_9BURK/3-103--------------------------------------------------------------------------------
Q7CW72_AGRT5/3-108--------------------------------------------------------------------------------
L8GD23_PSED2/77-185--------------------------------------------------------------------------------
M2SXV3_COCH5/9-120--------------------------------------------------------------------------------
T2KM13_9FLAO/3-103--------------------------------------------------------------------------------
F2RHJ8_STRVP/6-108--------------------------------------------------------------------------------
N1PM30_MYCP1/6-116--------------------------------------------------------------------------------
Q9HK61_THEAC/2-100--------------------------------------------------------------------------------
A4AQM8_MARSH/3-108--------------------------------------------------------------------------------
C4Z7U2_EUBE2/3-103--------------------------------------------------------------------------------
C6XTA6_PEDHD/3-103--------------------------------------------------------------------------------
W0F136_9SPHI/3-111--------------------------------------------------------------------------------
Q5LC58_BACFN/3-109--------------------------------------------------------------------------------
I0IAI8_PHYMF/3-105--------------------------------------------------------------------------------
J0WX79_AURDE/7-117--------------------------------------------------------------------------------
R6LCZ2_9BACE/19-127--------------------------------------------------------------------------------
R6SDC5_9BACE/16-124--------------------------------------------------------------------------------
R6ARE3_9BACT/15-123--------------------------------------------------------------------------------
W0HYB7_9ENTR/6-109--------------------------------------------------------------------------------
B2JWP2_BURP8/2-109--------------------------------------------------------------------------------
RHAM_VEREI/5-105--------------------------------------------------------------------------------
R7JMG1_9PORP/19-127--------------------------------------------------------------------------------
W0EWF3_9SPHI/3-103--------------------------------------------------------------------------------
G2PEQ1_STRVO/2-106--------------------------------------------------------------------------------
I2ETX1_EMTOG/3-109--------------------------------------------------------------------------------
S0DRY9_GIBF5/8-120--------------------------------------------------------------------------------
W5VZF1_9PSEU/4-102--------------------------------------------------------------------------------
F0SAK4_PEDSD/3-109--------------------------------------------------------------------------------
RHAM_ENTFA/3-103--------------------------------------------------------------------------------
C1D3L6_DEIDV/10-112--------------------------------------------------------------------------------
D3AYF8_POLPA/5-111--------------------------------------------------------------------------------
Q63M67_BURPS/2-109--------------------------------------------------------------------------------
G3B870_CANTC/9-119--------------------------------------------------------------------------------
G8TJY9_NIAKG/2-108--------------------------------------------------------------------------------
A9WV51_RENSM/8-106--------------------------------------------------------------------------------
F8ENG6_RUNSL/3-109--------------------------------------------------------------------------------
G0FVD6_AMYMS/4-107--------------------------------------------------------------------------------
C7Q375_CATAD/3-106--------------------------------------------------------------------------------
C6CYW6_PAESJ/6-107--------------------------------------------------------------------------------
C7PCA4_CHIPD/3-109--------------------------------------------------------------------------------
T0N5S5_9EURY/2-100--------------------------------------------------------------------------------
Q0C0B4_HYPNA/3-108--------------------------------------------------------------------------------
G8TRD5_NIAKG/34-141--------------------------------------------------------------------------------
B5HUQ0_9ACTO/3-106--------------------------------------------------------------------------------
C9SC44_VERA1/35-148--------------------------------------------------------------------------------
U5HAV4_USTV1/5-115--------------------------------------------------------------------------------
C1E6C4_MICSR/5-111--------------------------------------------------------------------------------
S0ART8_FERAC/2-99--------------------------------------------------------------------------------
D8J110_HERSS/4-109--------------------------------------------------------------------------------
H1XZT2_9SPHI/4-110--------------------------------------------------------------------------------
F1A024_DICPU/9-113--------------------------------------------------------------------------------
A0M226_GRAFK/6-114--------------------------------------------------------------------------------
H1YA87_9SPHI/12-120--------------------------------------------------------------------------------
A1WK61_VEREI/3-108--------------------------------------------------------------------------------
F0S6E2_PEDSD/2-101--------------------------------------------------------------------------------
D8MW19_ERWBE/6-112--------------------------------------------------------------------------------
J4GG69_FIBRA/8-118--------------------------------------------------------------------------------
RHAM_TOLAT/3-103--------------------------------------------------------------------------------
R5RHB4_9FIRM/4-102--------------------------------------------------------------------------------
R7CUY6_9BACE/4-107--------------------------------------------------------------------------------
F4GKH0_SPICD/4-103--------------------------------------------------------------------------------
M2QQB6_CERS8/8-118--------------------------------------------------------------------------------
R4LU20_9ACTO/8-112--------------------------------------------------------------------------------
RHAM_AGRVS/6-106--------------------------------------------------------------------------------
A1RAY8_ARTAT/2-103--------------------------------------------------------------------------------
A0K063_ARTS2/2-106--------------------------------------------------------------------------------
G8TPW3_NIAKG/3-103--------------------------------------------------------------------------------
Q15XN8_PSEA6/5-113--------------------------------------------------------------------------------
G2TP17_BACCO/3-103--------------------------------------------------------------------------------
D9QN17_BRESC/8-108--------------------------------------------------------------------------------
H8KVT5_SOLCM/4-109--------------------------------------------------------------------------------
G3JAD5_CORMM/9-118--------------------------------------------------------------------------------
F0LZS0_VIBFN/7-107--------------------------------------------------------------------------------
E8RLZ9_ASTEC/5-104--------------------------------------------------------------------------------
R6U745_9FIRM/3-103--------------------------------------------------------------------------------
E0RYP0_BUTPB/3-103--------------------------------------------------------------------------------
W0A8U2_9SPHN/5-114--------------------------------------------------------------------------------
F0RTW9_SPHGB/2-102--------------------------------------------------------------------------------
V5XRE7_ENTMU/3-103--------------------------------------------------------------------------------
W0JTK6_9EURY/7-109--------------------------------------------------------------------------------
F4C6L3_SPHS2/2-101--------------------------------------------------------------------------------
R5MDS1_9BACE/17-125--------------------------------------------------------------------------------
Q92VL4_RHIME/3-108--------------------------------------------------------------------------------
D5EY64_PRER2/19-127--------------------------------------------------------------------------------
E8NDA4_MICTS/4-105--------------------------------------------------------------------------------
E6SPU6_BACT6/19-127--------------------------------------------------------------------------------
C6WNL3_ACTMD/3-105--------------------------------------------------------------------------------
R7NTA6_9BACE/19-127--------------------------------------------------------------------------------
Q826A8_STRAW/2-103--------------------------------------------------------------------------------
M1VWH7_CLAP2/35-145--------------------------------------------------------------------------------
C7PNE2_CHIPD/2-102--------------------------------------------------------------------------------
A0QQ10_MYCS2/3-105--------------------------------------------------------------------------------
S8E4Q7_FOMPI/8-118--------------------------------------------------------------------------------
F4KPV2_HALH1/6-106--------------------------------------------------------------------------------
E6WCQ8_PANSA/3-103--------------------------------------------------------------------------------
D7CBT4_STRBB/3-105--------------------------------------------------------------------------------
R5V6F4_9BACE/15-123--------------------------------------------------------------------------------
F8EFY7_RUNSL/5-113--------------------------------------------------------------------------------
D2UB54_XANAP/3-111--------------------------------------------------------------------------------
R6AY66_9BACT/3-104--------------------------------------------------------------------------------
B9TP76_RICCO/180-279--------------------------------------------------------------------------------
A6L884_PARD8/3-111--------------------------------------------------------------------------------
E1VAZ6_HALED/5-103--------------------------------------------------------------------------------
H5X507_9PSEU/6-107--------------------------------------------------------------------------------
G8TKN8_NIAKG/3-111--------------------------------------------------------------------------------
E4RWF7_LEAB4/3-103--------------------------------------------------------------------------------
R5P2W9_9PORP/3-109--------------------------------------------------------------------------------
H2ISM0_RAHAC/3-103--------------------------------------------------------------------------------
C6XWC2_PEDHD/4-110--------------------------------------------------------------------------------
D2AYI7_STRRD/2-103--------------------------------------------------------------------------------
R7B568_9ACTN/14-112--------------------------------------------------------------------------------
D4LLT3_9FIRM/2-100--------------------------------------------------------------------------------
R5IF69_9FIRM/3-101--------------------------------------------------------------------------------
F8EDF5_RUNSL/27-127--------------------------------------------------------------------------------
F4BQP6_CARS1/3-103--------------------------------------------------------------------------------
Q9RJV5_STRCO/9-112--------------------------------------------------------------------------------
F4L4I5_HALH1/3-109--------------------------------------------------------------------------------
F4PHW1_DICFS/4-111--------------------------------------------------------------------------------
K7ARV7_9ALTE/6-114--------------------------------------------------------------------------------
A6W650_KINRD/4-107--------------------------------------------------------------------------------
R7LE58_9BACT/21-129--------------------------------------------------------------------------------
F4H154_CELFA/3-103--------------------------------------------------------------------------------
B0T1B6_CAUSK/4-110--------------------------------------------------------------------------------
G0GFQ6_SPITZ/3-103--------------------------------------------------------------------------------
Q1J3P3_DEIGD/12-114--------------------------------------------------------------------------------
RHAM_BACSU/3-103--------------------------------------------------------------------------------
I6Z2E3_MELRP/3-103--------------------------------------------------------------------------------
R6LHQ9_9BACE/3-103--------------------------------------------------------------------------------
D8PU32_SCHCM/8-118--------------------------------------------------------------------------------
D8IVV1_HERSS/3-103--------------------------------------------------------------------------------
FUCM_XANCP/5-113--------------------------------------------------------------------------------
B9KXQ9_THERP/5-109--------------------------------------------------------------------------------
A4RYA8_OSTLU/7-113--------------------------------------------------------------------------------
RHAM_BURP8/3-103--------------------------------------------------------------------------------
RHAM_LISMO/3-103--------------------------------------------------------------------------------
R5XB53_9FIRM/3-102--------------------------------------------------------------------------------
F4C913_SPHS2/3-109--------------------------------------------------------------------------------
G8QUN9_SPHPG/4-104--------------------------------------------------------------------------------
G2YVL3_BOTF4/62-172--------------------------------------------------------------------------------
RHAM_CLOPH/3-103--------------------------------------------------------------------------------
C1N719_MICPC/4-111--------------------------------------------------------------------------------
E8RTW3_ASTEC/4-112--------------------------------------------------------------------------------
Q7CTD6_AGRT5/3-108--------------------------------------------------------------------------------
I4F5E5_MODMB/3-101--------------------------------------------------------------------------------
D1ARY4_SEBTE/3-103--------------------------------------------------------------------------------
A9WGG2_CHLAA/3-106--------------------------------------------------------------------------------
F5XNH4_MICPN/3-114--------------------------------------------------------------------------------
RHAM_LEPCP/5-105--------------------------------------------------------------------------------
RHAM_LACPL/3-103--------------------------------------------------------------------------------
D2Q2I3_KRIFD/3-102--------------------------------------------------------------------------------
M2MAG9_BAUCO/7-117--------------------------------------------------------------------------------
A3HRM9_9BACT/4-104--------------------------------------------------------------------------------
RHAM_MANSM/3-103--------------------------------------------------------------------------------
I2EVY4_EMTOG/3-103--------------------------------------------------------------------------------
L0FZ10_ECHVK/4-104--------------------------------------------------------------------------------
F9XB02_MYCGM/6-116--------------------------------------------------------------------------------
Q5KCR2_CRYNJ/19-129--------------------------------------------------------------------------------
D2QR00_SPILD/3-103--------------------------------------------------------------------------------
R4X772_TAPDE/13-123--------------------------------------------------------------------------------
K6YYZ3_9ALTE/4-112--------------------------------------------------------------------------------
R5A8F9_9CLOT/2-102--------------------------------------------------------------------------------
F8Q6Q2_SERL3/8-118--------------------------------------------------------------------------------
Q1GLV0_RUEST/3-108--------------------------------------------------------------------------------
D3F8C9_CONWI/3-101--------------------------------------------------------------------------------
I3UF06_ADVKW/5-111--------------------------------------------------------------------------------
C1DMX3_AZOVD/1-96--------------------------------------------------------------------------------
RHAM_RHILO/4-104--------------------------------------------------------------------------------
C7MA53_BRAFD/20-118--------------------------------------------------------------------------------
W0AGC7_9SPHN/4-103--------------------------------------------------------------------------------
D7BV13_STRBB/3-105--------------------------------------------------------------------------------
C4R5P5_PICPG/10-120--------------------------------------------------------------------------------
B8N6B4_ASPFN/5-114--------------------------------------------------------------------------------
R5PSD2_9BACT/21-129--------------------------------------------------------------------------------
RHAM_OPITP/3-103--------------------------------------------------------------------------------
V6JFG7_STRNV/3-106--------------------------------------------------------------------------------
I0KE28_9BACT/2-108--------------------------------------------------------------------------------
I3ZKM1_TERRK/3-103--------------------------------------------------------------------------------
D5BBC0_ZUNPS/5-111--------------------------------------------------------------------------------
D1BY74_XYLCX/3-102--------------------------------------------------------------------------------
RHAM_OCEIH/3-103--------------------------------------------------------------------------------
J9RIB0_9ACTO/6-114--------------------------------------------------------------------------------
R6WAC2_9BACT/17-125--------------------------------------------------------------------------------
A8G9F9_SERP5/10-116--------------------------------------------------------------------------------
G0J5Y4_CYCMS/28-127--------------------------------------------------------------------------------
C7YLU2_NECH7/7-118--------------------------------------------------------------------------------
U5RUK3_9CLOT/3-103--------------------------------------------------------------------------------
C5CZB7_VARPS/2-109--------------------------------------------------------------------------------
R5BLL2_9FIRM/265-367--------------------------------------------------------------------------------
R5B7U2_9BACE/23-126--------------------------------------------------------------------------------
A3I2P4_9BACT/3-110--------------------------------------------------------------------------------
F6FU80_ISOV2/2-98--------------------------------------------------------------------------------
R6Y9M4_9PORP/17-125--------------------------------------------------------------------------------
R5UEH6_9FIRM/3-103--------------------------------------------------------------------------------
Q5YUK3_NOCFA/7-108--------------------------------------------------------------------------------
R5T0T1_9CLOT/5-103--------------------------------------------------------------------------------
E8V6H3_TERSS/3-109--------------------------------------------------------------------------------
Q7AJX0_BACHD/6-107--------------------------------------------------------------------------------
W0LD07_SERFO/3-103--------------------------------------------------------------------------------
D5ET23_PRER2/3-104--------------------------------------------------------------------------------
T5AGB0_OPHSC/41-152--------------------------------------------------------------------------------
B6QAY9_PENMQ/10-121--------------------------------------------------------------------------------
R5FKH4_9ACTN/13-112--------------------------------------------------------------------------------
S3CGR6_GLAL2/40-151--------------------------------------------------------------------------------
E9QYL7_ASPFU/6-125--------------------------------------------------------------------------------
D2PT68_KRIFD/3-105--------------------------------------------------------------------------------
RHAM_BACSK/3-103--------------------------------------------------------------------------------
R6YNW1_9BACT/15-123--------------------------------------------------------------------------------
Y3871_DICDI/8-118--------------------------------------------------------------------------------
A1RB67_ARTAT/4-103--------------------------------------------------------------------------------
A5FI86_FLAJ1/3-109--------------------------------------------------------------------------------
H2JUV0_STRHJ/2-103--------------------------------------------------------------------------------
E4RRT9_LEAB4/3-109--------------------------------------------------------------------------------
RHAM_OCHA4/5-105--------------------------------------------------------------------------------
D3VH42_XENNA/3-116--------------------------------------------------------------------------------
L8X683_THACA/10-129--------------------------------------------------------------------------------
W0F1J4_9SPHI/6-112--------------------------------------------------------------------------------
D2QDE5_SPILD/2-108--------------------------------------------------------------------------------
A0RPU5_CAMFF/263-366--------------------------------------------------------------------------------
RHAM_RHIEC/5-105--------------------------------------------------------------------------------
W0HUK9_9ENTR/3-103--------------------------------------------------------------------------------
R9VMZ1_9ENTR/3-103--------------------------------------------------------------------------------
I2B3V9_SHIBC/8-108--------------------------------------------------------------------------------
RHAM_PECAS/3-103--------------------------------------------------------------------------------
A4FGN1_SACEN/3-102--------------------------------------------------------------------------------
G0R4U7_ICHMG/11-113--------------------------------------------------------------------------------
Q0S9A0_RHOSR/3-104--------------------------------------------------------------------------------
Q0U0I1_PHANO/10-124--------------------------------------------------------------------------------
G9MQ27_HYPVG/10-118--------------------------------------------------------------------------------
R5YL30_9BACE/19-127--------------------------------------------------------------------------------
G0J6H2_CYCMS/3-109--------------------------------------------------------------------------------
G0AEI2_COLFT/99-206--------------------------------------------------------------------------------
RHAM_AGRT5/6-106--------------------------------------------------------------------------------
Q0PB25_CAMJE/3-104--------------------------------------------------------------------------------
RHAM_LACS1/4-107--------------------------------------------------------------------------------
A7RJ94_NEMVE/13-125--------------------------------------------------------------------------------
H2YJ08_CIOSA/7-118--------------------------------------------------------------------------------
A3I067_9BACT/3-104--------------------------------------------------------------------------------
R6D3Z6_9BACE/3-103--------------------------------------------------------------------------------
Q986Z5_RHILO/3-108--------------------------------------------------------------------------------
Q21TQ6_ALBFT/2-109--------------------------------------------------------------------------------
H2J1A2_RAHAC/4-110--------------------------------------------------------------------------------
Q3XZK3_ENTFC/3-103--------------------------------------------------------------------------------
C5AGH1_BURGB/2-109--------------------------------------------------------------------------------
I3ZIT1_TERRK/3-109--------------------------------------------------------------------------------
C9YZZ6_STRSW/2-102--------------------------------------------------------------------------------
RHAM_ACICJ/3-103--------------------------------------------------------------------------------
Q01TX0_SOLUE/3-104--------------------------------------------------------------------------------
W0J174_9BACT/3-103--------------------------------------------------------------------------------
RHAM_JANSC/3-103--------------------------------------------------------------------------------
I0HD26_ACTM4/3-105--------------------------------------------------------------------------------
R6CWI8_9BACE/3-109--------------------------------------------------------------------------------
R5IKI3_9PORP/15-123--------------------------------------------------------------------------------
C5C310_BEUC1/3-105--------------------------------------------------------------------------------

PF13826

Q5B835_EMENI/129-253--------------------------------------------------------------------------------
Q7NL77_GLOVI/17-135--------------------------------------------------------------------------------
C0ZHQ2_BREBN/17-134--------------------------------------------------------------------------------
B1XXV3_LEPCP/17-135--------------------------------------------------------------------------------
D3EAC5_GEOS4/17-135--------------------------------------------------------------------------------
Q65NQ4_BACLD/18-134--------------------------------------------------------------------------------
D0L3R6_GORB4/18-133--------------------------------------------------------------------------------
A8FJ75_BACP2/18-135--------------------------------------------------------------------------------
Q0SFP1_RHOSR/17-134--------------------------------------------------------------------------------
B2IYY5_NOSP7/17-135--------------------------------------------------------------------------------
Q8ELJ8_OCEIH/18-135--------------------------------------------------------------------------------
Q9K5Y3_BACHD/18-135--------------------------------------------------------------------------------
Q82JR6_STRAW/18-140--------------------------------------------------------------------------------
C8X6B7_NAKMY/17-134--------------------------------------------------------------------------------
C9Z558_STRSW/19-141--------------------------------------------------------------------------------
D7B5B0_NOCDD/17-134--------------------------------------------------------------------------------
D2SAG2_GEOOG/17-134--------------------------------------------------------------------------------
D2Q510_KRIFD/15-133--------------------------------------------------------------------------------
C6XKE2_HIRBI/17-135--------------------------------------------------------------------------------
D2RPK7_HALTV/35-154--------------------------------------------------------------------------------
A1R2W1_ARTAT/19-136--------------------------------------------------------------------------------
Q5WGK6_BACSK/15-132--------------------------------------------------------------------------------
B1YGH8_EXIS2/12-125--------------------------------------------------------------------------------
A6R852_AJECN/119-243--------------------------------------------------------------------------------
D5UWZ5_TSUPD/14-139--------------------------------------------------------------------------------
Q2TWA6_ASPOR/121-245--------------------------------------------------------------------------------
B6QJL8_PENMQ/116-242--------------------------------------------------------------------------------
Q0CTD2_ASPTN/81-205--------------------------------------------------------------------------------
Q2GR33_CHAGB/122-248--------------------------------------------------------------------------------
C7YU85_NECH7/113-235--------------------------------------------------------------------------------
B8MRW9_TALSN/40-166--------------------------------------------------------------------------------
Q7S613_NEUCR/120-245--------------------------------------------------------------------------------
Q01W86_SOLUE/18-128--------------------------------------------------------------------------------
A5G2Z4_ACICJ/18-128--------------------------------------------------------------------------------
B1LSK9_METRJ/27-140--------------------------------------------------------------------------------
B0U9U6_METS4/19-131--------------------------------------------------------------------------------
B8EMQ3_METSB/15-128--------------------------------------------------------------------------------
C5AWG2_METEA/27-137--------------------------------------------------------------------------------
F2F0V8_SOLSS/20-135--------------------------------------------------------------------------------
G7XTL7_ASPKW/119-243--------------------------------------------------------------------------------
Q4WAZ2_ASPFU/113-235--------------------------------------------------------------------------------

PF13816

Q0C7P1_ASPTN/36-346----------------------------------------AYIGIQQHDDSAA............GQDAFRTAADVVREF
C0ZVD3_RHOE4/61-360----------------------------------------GYLGVQFRGEDQ.................RSAALQSMRDI
L2FQ62_COLGN/47-355----------------------------------------AVIGAQYEPNMK.........HD.......GSALRTMSEF
M7SDY7_EUTLA/46-400----------------------------------------AMIGVQYASKAD.........ADSDSNSDTGAGISKLSSF
F9G6T4_FUSOF/15-335----------------------------------------AIFGCQYHADTP..............STDKLELIEKFDNL
E9EGK8_METAQ/37-344----------------------------------------AYIGIQPLGAPKA...............AVDKAVKDIQSW
G9MZH7_HYPVG/2-314----------------------------------------AVIGAQFPSKTG.........KE.......EVAISKVNSF
C7ZI82_NECH7/15-335----------------------------------------SLFGCQYQAESP..............STAKLDLINKFEDL
S3DKC9_GLAL2/17-348----------------------------------------GLFGIQYTTLTP................EKTKAISTLYTI
A5V4Y9_SPHWW/44-337----------------------------------------ASYGVQGRESGD.................VAAALAHVRAL
Q5B890_EMENI/326-643----------------------------------------AVFGIQRLEANN.................ANLLIDAFNAV
U1HNF8_ENDPU/45-351----------------------------------------AIMGAQFSSASD.........DD.......GSAISKLMGH
T0K4N5_COLGC/37-343----------------------------------------AYIGVQPHSSDND................IEQVNAAVQAW
B2WMJ9_PYRTR/7-318----------------------------------------AIMGAQHACTIG.........AD.......SAGISTIKEF
R8BIH2_TOGMI/17-327----------------------------------------AIFGVQYQGEKP..............TGRQADFISMLGNL
G3XZK7_ASPNA/17-337----------------------------------------..TGTQPHTPPT....................LTTELSSL
R8BET2_TOGMI/15-336----------------------------------------TTFGAQYHGNTP..............SESKAALIAEFDTA
C7ZFH7_NECH7/16-326----------------------------------------GIYGIQYQGQSP..............SGRQLDLIQKFDEL
Q6FBU3_ACIAD/44-342----------------------------------------AYFGVQFKSEQK..................AIALKAMQHI
S0DLH6_GIBF5/58-358----------------------------------------..LGVQHLPSTD.................PADAIDTIRQA
Q4WIY1_ASPFU/14-338----------------------------------------AYIGVQQRGAQTD.EG........LLAESVDAAVNSIQRW
K2SG27_MACPH/15-335----------------------------------------SLFGCQYHSPQP..............DAKKTALIQNFDRL
I1S1Z5_GIBZE/37-347----------------------------------------AYIGVQKHSDTPE............AEDARDKSIAIIQSW
T0KQZ3_COLGC/16-328----------------------------------------GIFGVQYAGDEP..............AGRQLDLIQSFDAL
M2V8J7_COCH5/50-359----------------------------------------AIIGVQHEDSTN.........LQ.......GPAYQKLVSF
C5FDU1_ARTOC/82-390----------------------------------------AIIGAQYSSAAE.........ND.......GVAMSKVLEF
K9GEU7_PEND2/14-335----------------------------------------AVFGIQYPAGNP..............TDSQKALTGEFDGL
C7Z148_NECH7/37-347----------------------------------------AYIGIQKHSNDQA............TSDAQKEATSAIQAW
G9P8B6_HYPAI/42-386----------------------------------------TYIGIQPRHEENPAKGIHTELHAHVTSAVQRKVGAMIEDW
A7IFL4_XANP2/40-340----------------------------------------AYFGLQGQDLAW...................DEQKAFFDR
E6WMT6_PANSA/44-342----------------------------------------AYLGVQFREEQR..................AAAITAMQHI
A1R5Y5_ARTAT/55-350----------------------------------------AFLGVQSRAPLS..................HEAKVASAGM
M7TNP5_BOTF1/17-355----------------------------------------GIFGVQHEEFTP................EKAVFVSTLYKL
D8MJY1_ERWBE/44-340----------------------------------------AYFGIQARTCLD.....................ISALDEI
A1CFW9_ASPCL/36-355----------------------------------------AYIGVQDRESCAN........GQPIHNKAYQDAVEAIQTW
N1QD40_MYCFI/15-330----------------------------------------AIFGCQYHDEEP..............DASKSALIARFQSL
M3B660_SPHMS/50-394----------------------------------------AIIGVQHETPID.........PQ.......GTDYQKLVDF
C9STN6_VERA1/46-354----------------------------------------AVVGAQYPSASR.........ND.......GNAIKAVSSF
C0SHU3_PARBP/2-309----------------------------------------AVIGAQYAATPE.........ED.......GSAMSTLLGF
F8J9L9_HYPSM/46-346----------------------------------------SYFGVQVEGEEK.................KDQALAALQNI
B8NMG3_ASPFN/17-331----------------------------------------TLFGVQQPDDVQ..............SPATENLIRTFSHL
N4VS79_COLOR/45-355----------------------------------------AVIGAQYESIDK.........AD.......GGAVAQLTQF
B8NPL1_ASPFN/37-350----------------------------------------TYIGVQRHHGLDI...............GLTKCLAAIERW
C9SXX8_VERA1/37-348----------------------------------------AYIGVQRHAADEP............CLRADAQIASAIRAW
I1RQY0_GIBZE/15-329----------------------------------------SVFGCQYHAEAP..............SVEKTELICRFDKL
F9X370_MYCGM/46-354----------------------------------------AIIGVQRGGSID..............LRPHSAGFKEIVSF
F9WY10_MYCGM/41-342----------------------------------------.YVGIQSRGNGSA...............AQSKAESIVQAL
K2RZK8_MACPH/39-345----------------------------------------.YVGVQKHISNAT............TDAAATKAKNLLLEW
Q0U2P3_PHANO/37-344----------------------------------------AYIGVQQHIDDNE............AANSAAQAIQQVKKW
N4V6I5_COLOR/37-346----------------------------------------AYIGVQSHSGDSV..............EATETIRKSIENW
C5G803_AJEDR/45-352----------------------------------------AVVGAQYSTPTD.........ED.......GLAMSTVSGF
G9MHE5_HYPVG/42-380----------------------------------------SYIGIQPRHEEIPVRGSHTELNAHVSSAAQRTAATKIEEW
Q0CF39_ASPTN/15-333----------------------------------------AVFGCQYHGLQP..............NASKSALASEFNDL
H6BUX5_EXODN/41-346----------------------------------------.YLGVQCHAGDMN...............SLANVERIINEF
C6WDR0_ACTMD/40-337----------------------------------------ARFGVQTDDS....................AAGVKAIARV
N1S900_FUSC4/37-346----------------------------------------AYIGVQSHSDTQD............FDIARNKATEIIQAW
D4AMZ1_ARTBC/45-352----------------------------------------AIIGAQYASAAG.........ND.......GAAISKILEF
C5CKL2_VARPS/44-346----------------------------------------GYFGVQSRGAGM.................QGRACAALMKI
D8J0A9_HERSS/44-342----------------------------------------AYLGIQFKEEKR..................AQALQAMRHI
N1Q9B6_MYCFI/42-344----------------------------------------.YVGAQCHRGNTA...............ARERAEKVIEDI

PF03795

E8VI80_BACST/6-82--------------------------------------------------------------------------------
A0A022NQM5_PSEAI/1-116--------------------------------------------------------------------------------
Q98EG6_RHILO/1-116--------------------------------------------------------------------------------
Q9AB44_CAUCR/10-125--------------------------------------------------------------------------------
A0A022NRR0_PSEAI/1-123--------------------------------------------------------------------------------
Q98I36_RHILO/1-116--------------------------------------------------------------------------------
Q98DP4_RHILO/1-116--------------------------------------------------------------------------------
Q98HH2_RHILO/1-118--------------------------------------------------------------------------------
Q98H82_RHILO/1-116--------------------------------------------------------------------------------
Q984U5_RHILO/1-115--------------------------------------------------------------------------------
F7UNU3_SYNYG/2-86--------------------------------------------------------------------------------
Q983T6_RHILO/165-255--------------------------------------------------------------------------------
Q9RVF8_DEIRA/6-88--------------------------------------------------------------------------------
F0KED5_CLOAE/1-82--------------------------------------------------------------------------------
D6EF87_STRLI/1-82--------------------------------------------------------------------------------
Q98H68_RHILO/7-87--------------------------------------------------------------------------------
Q16CW5_ROSDO/1-86--------------------------------------------------------------------------------
Q9AJZ7_STRCO/1-88--------------------------------------------------------------------------------
Q45075_BURCE/1-92--------------------------------------------------------------------------------
Q98EI5_RHILO/1-89--------------------------------------------------------------------------------
B8GXF8_CAUCN/2-87--------------------------------------------------------------------------------
Q0K0V2_CUPNH/1-88--------------------------------------------------------------------------------
A0A037VEJ0_HAEIF/1-95--------------------------------------------------------------------------------
A0A016XA68_VIBCL/1-95--------------------------------------------------------------------------------
A0A009E788_ECOLX/1-95--------------------------------------------------------------------------------
A0A022NMR8_PSEAI/1-95--------------------------------------------------------------------------------

PF02426

F4CSZ3_PSEUX/1-89--------------------------------------------------------------------------------
C7QDL9_CATAD/1-93--------------------------------------------------------------------------------
Q7WWV8_CUPNH/1-90--------------------------------------------------------------------------------
H6RKG3_BLASD/1-91--------------------------------------------------------------------------------
D7CBD2_STRBB/1-90--------------------------------------------------------------------------------
CATC_ACIAD/1-90--------------------------------------------------------------------------------
A0QTP0_MYCS2/1-90--------------------------------------------------------------------------------
C7QDL9_CATAD/107-197--------------------------------------------------------------------------------
O07243_MYCTU/1-93--------------------------------------------------------------------------------
B2HNZ0_MYCMM/1-93--------------------------------------------------------------------------------
G8ML29_9BURK/1-90--------------------------------------------------------------------------------
S5UNN6_STRCU/3-92--------------------------------------------------------------------------------
H2JTH6_STRHJ/3-92--------------------------------------------------------------------------------
G2J3C0_PSEUL/4-93--------------------------------------------------------------------------------
D3F6M4_CONWI/1-88--------------------------------------------------------------------------------
H2FYU2_OCESG/1-90--------------------------------------------------------------------------------
R4SVN0_AMYOR/1-90--------------------------------------------------------------------------------
H6RX66_BLASD/1-89--------------------------------------------------------------------------------
B1VQ91_STRGG/37-126--------------------------------------------------------------------------------
M1NRR9_9CORY/1-90--------------------------------------------------------------------------------
B4EMK5_BURCJ/1-90--------------------------------------------------------------------------------
F2JV84_MARM1/1-90--------------------------------------------------------------------------------
Q5YTX0_NOCFA/1-90--------------------------------------------------------------------------------
L0IVL4_MYCSM/1-90--------------------------------------------------------------------------------
O07243_MYCTU/108-199--------------------------------------------------------------------------------
F6A976_PSEF1/1-90--------------------------------------------------------------------------------
B2HNZ0_MYCMM/108-199--------------------------------------------------------------------------------
Q0SE60_RHOSR/3-91--------------------------------------------------------------------------------
Q0K0V3_CUPNH/1-90--------------------------------------------------------------------------------
Q82MX8_STRAW/120-209--------------------------------------------------------------------------------
S5TF72_9CORY/1-89--------------------------------------------------------------------------------
M4XFM6_PSEDE/1-90--------------------------------------------------------------------------------
F4CMA9_PSEUX/1-90--------------------------------------------------------------------------------
B2UBI3_RALPJ/1-90--------------------------------------------------------------------------------
A4FHX7_SACEN/1-90--------------------------------------------------------------------------------
H6L7V8_SAPGL/7-88--------------------------------------------------------------------------------
G2P2X2_STRVO/1-89--------------------------------------------------------------------------------
X5DVA1_9CORY/3-91--------------------------------------------------------------------------------
B1WUL0_CYAA5/8-98--------------------------------------------------------------------------------
D4Z421_SPHJU/1-90--------------------------------------------------------------------------------
A9BYG6_DELAS/1-90--------------------------------------------------------------------------------
D8IP00_HERSS/1-90--------------------------------------------------------------------------------
Q73Y30_MYCPA/110-202--------------------------------------------------------------------------------
D2SB83_GEOOG/4-92--------------------------------------------------------------------------------
E1W0V2_ARTAR/1-90--------------------------------------------------------------------------------
W0PJH0_9BURK/1-90--------------------------------------------------------------------------------
F4CK66_PSEUX/1-90--------------------------------------------------------------------------------
Q13YI1_BURXL/1-90--------------------------------------------------------------------------------
A9IEP3_BORPD/1-90--------------------------------------------------------------------------------
A9IEC2_BORPD/1-90--------------------------------------------------------------------------------
K0IEU1_NITGG/8-95--------------------------------------------------------------------------------
B9JQ22_AGRRK/1-90--------------------------------------------------------------------------------
A6VZS3_MARMS/1-90--------------------------------------------------------------------------------
G8RL90_MYCRN/1-90--------------------------------------------------------------------------------
B8IBD4_METNO/1-90--------------------------------------------------------------------------------
Q1LE87_RALME/1-90--------------------------------------------------------------------------------
G7ZC79_AZOL4/19-108--------------------------------------------------------------------------------
H5X6M8_9PSEU/1-90--------------------------------------------------------------------------------
R7Y1A3_9ACTO/1-90--------------------------------------------------------------------------------
A0QZJ3_MYCS2/4-90--------------------------------------------------------------------------------
Q8NN13_CORGL/1-90--------------------------------------------------------------------------------
W8T9C2_EUBAC/1-86--------------------------------------------------------------------------------
Q1LDN7_RALME/1-90--------------------------------------------------------------------------------
K9ZDB7_ANACC/1-91--------------------------------------------------------------------------------
W0L7T9_SERFO/1-90--------------------------------------------------------------------------------
H5WYU9_9PSEU/14-101--------------------------------------------------------------------------------
A1TU43_ACIAC/1-90--------------------------------------------------------------------------------
D0L556_GORB4/1-90--------------------------------------------------------------------------------
B2JPE7_BURP8/1-90--------------------------------------------------------------------------------
A8I5Y7_AZOC5/1-90--------------------------------------------------------------------------------
Q73Y30_MYCPA/1-93--------------------------------------------------------------------------------
A4XFH7_NOVAD/1-90--------------------------------------------------------------------------------
A6T9N4_KLEP7/1-90--------------------------------------------------------------------------------
A5V4X7_SPHWW/1-90--------------------------------------------------------------------------------
A0JW94_ARTS2/1-90--------------------------------------------------------------------------------
I2B8Q1_SHIBC/1-90--------------------------------------------------------------------------------
F4CJL4_PSEUX/1-89--------------------------------------------------------------------------------
B1LT49_METRJ/1-90--------------------------------------------------------------------------------
M4S3X1_9SPHN/1-90--------------------------------------------------------------------------------
A1SEX5_NOCSJ/1-90--------------------------------------------------------------------------------
A1B186_PARDP/1-90--------------------------------------------------------------------------------

PF09448

O51799_CUPNE/2-113--------------------------------------------------------------------------------
Q7WWV7_CUPNH/2-112--------------------------------------------------------------------------------

PF07110

Q98J67_RHILO/10-91--------------------------------------------------------------------------------
YTH4_RHOER/10-90--------------------------------------------------------------------------------
Q89V09_BRADU/21-102--------------------------------------------------------------------------------
B8Y4U8_9NOCA/10-91--------------------------------------------------------------------------------
Q9KGB0_BACHD/16-96--------------------------------------------------------------------------------
E2M9K4_PSEUB/10-93--------------------------------------------------------------------------------
Q2N8F2_ERYLH/12-112--------------------------------------------------------------------------------
D0J371_COMT2/26-114--------------------------------------------------------------------------------
I8IBK1_ASPO3/43-139--------------------------------------------------------------------------------
C9S7C3_VERA1/40-151--------------------------------------------------------------------------------
Q0UAA8_PHANO/20-125--------------------------------------------------------------------------------
B6QRR3_PENMQ/18-114--------------------------------------------------------------------------------
C9SY64_VERA1/65-158--------------------------------------------------------------------------------
B8MSU2_TALSN/18-112--------------------------------------------------------------------------------
A5VH99_SPHWW/138-221--------------------------------------------------------------------------------
A5V521_SPHWW/98-177--------------------------------------------------------------------------------
B9K152_AGRVS/13-109--------------------------------------------------------------------------------
B2W3U7_PYRTR/13-127--------------------------------------------------------------------------------
Q0U4N6_PHANO/13-123--------------------------------------------------------------------------------
B2WDV2_PYRTR/13-120--------------------------------------------------------------------------------
Q0U5I6_PHANO/13-111--------------------------------------------------------------------------------
A2QB94_ASPNC/13-115--------------------------------------------------------------------------------
A2QVN7_ASPNC/13-122--------------------------------------------------------------------------------
B8MPG2_TALSN/43-154--------------------------------------------------------------------------------
Q2UT25_ASPOR/23-122--------------------------------------------------------------------------------
C9Z9Q5_STRSW/12-103--------------------------------------------------------------------------------
A2R8B5_ASPNC/14-111--------------------------------------------------------------------------------
A5VH99_SPHWW/12-106--------------------------------------------------------------------------------
Q396J2_BURS3/130-221--------------------------------------------------------------------------------
A6GBX1_9DELT/12-106--------------------------------------------------------------------------------
C9Z9Q5_STRSW/139-234--------------------------------------------------------------------------------
B5HPI7_9ACTO/138-233--------------------------------------------------------------------------------
A8L3R3_FRASN/10-95--------------------------------------------------------------------------------
A5V7F6_SPHWW/12-99--------------------------------------------------------------------------------
A5V7F6_SPHWW/139-229--------------------------------------------------------------------------------
A4XEJ1_NOVAD/13-101--------------------------------------------------------------------------------
C7Z3Q5_NECH7/37-130--------------------------------------------------------------------------------
Q140F8_BURXL/125-207--------------------------------------------------------------------------------
C8ND54_9GAMM/12-105--------------------------------------------------------------------------------
C2M2M0_CAPGI/12-107--------------------------------------------------------------------------------
Q93AB2_YERPE/18-98--------------------------------------------------------------------------------
B8MF02_TALSN/21-117--------------------------------------------------------------------------------
C8VQ65_EMENI/29-132--------------------------------------------------------------------------------
C5FQT1_ARTOC/22-118--------------------------------------------------------------------------------
Q2GSS6_CHAGB/53-131--------------------------------------------------------------------------------
B8NJL1_ASPFN/19-113--------------------------------------------------------------------------------
C8VTL3_EMENI/15-109--------------------------------------------------------------------------------
Q0UIY9_PHANO/18-106--------------------------------------------------------------------------------
A2QH37_ASPNC/566-663--------------------------------------------------------------------------------
B6QDA9_PENMQ/20-117--------------------------------------------------------------------------------
A2QDU1_ASPNC/19-117--------------------------------------------------------------------------------
B0YAX3_ASPFC/21-118--------------------------------------------------------------------------------
B2WLL6_PYRTR/30-124--------------------------------------------------------------------------------
Q4P1P8_USTMA/29-132--------------------------------------------------------------------------------
C7Z0I7_NECH7/17-115--------------------------------------------------------------------------------
Q9F3V8_9PSEU/12-93--------------------------------------------------------------------------------

PF07045

Q0C383_HYPNA/2-97--------------------------------------------------------------------------------
Q98DD6_RHILO/3-95--------------------------------------------------------------------------------
A8LJW3_DINSH/3-95--------------------------------------------------------------------------------
Q1GHA0_RUEST/2-94--------------------------------------------------------------------------------
A1B208_PARDP/2-94--------------------------------------------------------------------------------
A0R1N9_MYCS2/3-94--------------------------------------------------------------------------------
B2U9C2_RALPJ/3-96--------------------------------------------------------------------------------
Q1LPI6_RALME/3-96--------------------------------------------------------------------------------
Q0RXH4_RHOSR/2-95--------------------------------------------------------------------------------
Q129N1_POLSJ/11-101--------------------------------------------------------------------------------
B2JPM5_BURP8/3-96--------------------------------------------------------------------------------
Q21DJ6_SACD2/2-95--------------------------------------------------------------------------------
A1B8D1_PARDP/3-95--------------------------------------------------------------------------------
Q0C268_HYPNA/2-95--------------------------------------------------------------------------------
A1K1N9_AZOSB/2-94--------------------------------------------------------------------------------
Q65SN3_MANSM/24-117--------------------------------------------------------------------------------
Q0RQX9_FRAAA/2-95--------------------------------------------------------------------------------
Q3J0R2_RHOS4/3-95--------------------------------------------------------------------------------
Q1GHQ7_RUEST/2-96--------------------------------------------------------------------------------
Q5NR08_ZYMMO/2-95--------------------------------------------------------------------------------
A8L5T2_FRASN/12-105--------------------------------------------------------------------------------
Q742V7_MYCPA/6-97--------------------------------------------------------------------------------
Q165U6_ROSDO/2-94--------------------------------------------------------------------------------
A4XTJ7_PSEMY/2-95--------------------------------------------------------------------------------
A5V7J9_SPHWW/2-96--------------------------------------------------------------------------------
Q5YTA0_NOCFA/2-95--------------------------------------------------------------------------------
Q128E5_POLSJ/3-96--------------------------------------------------------------------------------
Q65QR7_MANSM/19-113--------------------------------------------------------------------------------
Q2VZK5_MAGSA/2-96--------------------------------------------------------------------------------
Q7VAI4_PROMA/7-101--------------------------------------------------------------------------------
Q28P24_JANSC/6-100--------------------------------------------------------------------------------
B2JHP1_BURP8/2-95--------------------------------------------------------------------------------
Q984S8_RHILO/2-95--------------------------------------------------------------------------------
Q89JB1_BRADU/14-107--------------------------------------------------------------------------------
A1AZL7_PARDP/2-94--------------------------------------------------------------------------------
A8LL19_DINSH/2-94--------------------------------------------------------------------------------
A8KZG9_FRASN/2-95--------------------------------------------------------------------------------
Q11KJ1_CHESB/3-95--------------------------------------------------------------------------------
Q6NCX9_RHOPA/3-96--------------------------------------------------------------------------------
Q1GFX6_RUEST/3-95--------------------------------------------------------------------------------
A1TLS8_ACIAC/3-96--------------------------------------------------------------------------------
Q46KM6_PROMT/7-101--------------------------------------------------------------------------------
Q127Z9_POLSJ/2-95--------------------------------------------------------------------------------
Q5FU37_GLUOX/2-95--------------------------------------------------------------------------------
Q98JP1_RHILO/45-139--------------------------------------------------------------------------------
Q98CT4_RHILO/9-101--------------------------------------------------------------------------------
A5V7D8_SPHWW/2-97--------------------------------------------------------------------------------
A4XXX9_PSEMY/17-110--------------------------------------------------------------------------------
A1BAV2_PARDP/2-95--------------------------------------------------------------------------------
Q28QV7_JANSC/3-95--------------------------------------------------------------------------------
Q28KV2_JANSC/2-96--------------------------------------------------------------------------------
A6WA35_KINRD/13-106--------------------------------------------------------------------------------
Q89BY8_BRADU/66-159--------------------------------------------------------------------------------
Q11E97_CHESB/2-98--------------------------------------------------------------------------------
Q6F9F1_ACIAD/2-94--------------------------------------------------------------------------------
Q16DN6_ROSDO/3-95--------------------------------------------------------------------------------
A9BN41_DELAS/3-96--------------------------------------------------------------------------------
A4X3R6_SALTO/2-95--------------------------------------------------------------------------------
Q0C4G1_HYPNA/2-95--------------------------------------------------------------------------------
Q2KDF1_RHIEC/3-95--------------------------------------------------------------------------------
Q1D8Q3_MYXXD/2-95--------------------------------------------------------------------------------
Q47EX6_DECAR/3-96--------------------------------------------------------------------------------
A7IC73_XANP2/114-206--------------------------------------------------------------------------------
Q15VR2_PSEA6/29-121--------------------------------------------------------------------------------
A6VY75_MARMS/2-96--------------------------------------------------------------------------------
Q28SX7_JANSC/3-95--------------------------------------------------------------------------------
A7HSS3_PARL1/2-95--------------------------------------------------------------------------------
Q87W43_PSESM/6-100--------------------------------------------------------------------------------
Q89X32_BRADU/22-115--------------------------------------------------------------------------------
A5FY88_ACICJ/3-95--------------------------------------------------------------------------------
Q28UH1_JANSC/27-121--------------------------------------------------------------------------------
A0QZT5_MYCS2/2-95--------------------------------------------------------------------------------
A1B124_PARDP/3-95--------------------------------------------------------------------------------
Q98G06_RHILO/23-116--------------------------------------------------------------------------------
Q215U7_RHOPB/2-95--------------------------------------------------------------------------------
A7IC73_XANP2/3-95--------------------------------------------------------------------------------
B2HIJ1_MYCMM/2-95--------------------------------------------------------------------------------
B4EJY9_BURCJ/2-95--------------------------------------------------------------------------------
H7C7V4_BRADU/3-95--------------------------------------------------------------------------------
Q2YQU8_BRUA2/3-95--------------------------------------------------------------------------------
Q4FP83_PELUB/2-95--------------------------------------------------------------------------------
Q63KP2_BURPS/3-94--------------------------------------------------------------------------------
Q7VW78_BORPE/2-94--------------------------------------------------------------------------------
Q882F9_PSESM/2-94--------------------------------------------------------------------------------

PF03927

Q0PAA5_CAMJE/4-75--------------------------------------------------------------------------------
A6Q707_SULNB/2-77--------------------------------------------------------------------------------
E6X0J9_NITSE/1-76--------------------------------------------------------------------------------
Q6LTW0_PHOPR/6-81--------------------------------------------------------------------------------
C5B7B8_EDWI9/6-82--------------------------------------------------------------------------------
C0QTT2_PERMH/1-76--------------------------------------------------------------------------------
C4K982_THASP/1-77--------------------------------------------------------------------------------
W6EFK7_SULMU/1-76--------------------------------------------------------------------------------
F7YR78_VIBA7/6-81--------------------------------------------------------------------------------
S6CGZ1_9GAMM/4-79--------------------------------------------------------------------------------
Q9CKL9_PASMU/13-89--------------------------------------------------------------------------------
E6WCW8_PANSA/7-83--------------------------------------------------------------------------------
H7C6L0_BRADU/34-109--------------------------------------------------------------------------------
V5SFH9_9RHIZ/10-84--------------------------------------------------------------------------------
Q9I4G2_PSEAE/5-80--------------------------------------------------------------------------------
D4ZL47_SHEVD/11-86--------------------------------------------------------------------------------
A4XWL9_PSEMY/5-79--------------------------------------------------------------------------------
H2FWI7_OCESG/6-81--------------------------------------------------------------------------------
Q080B9_SHEFN/5-79--------------------------------------------------------------------------------
F2NPP1_MARHT/1-76--------------------------------------------------------------------------------
Q1LFZ4_RALME/19-94--------------------------------------------------------------------------------
Q2W3T0_MAGSA/19-94--------------------------------------------------------------------------------
G8PIR3_PSEUV/16-91--------------------------------------------------------------------------------
F8AE25_THEID/3-76--------------------------------------------------------------------------------
Q7VPJ8_HAEDU/10-86--------------------------------------------------------------------------------
Q6D5Z1_PECAS/5-81--------------------------------------------------------------------------------
B8CTJ0_SHEPW/5-79--------------------------------------------------------------------------------
B0URQ2_HISS2/14-89--------------------------------------------------------------------------------
A0RQ30_CAMFF/1-74--------------------------------------------------------------------------------
Q487G3_COLP3/11-86--------------------------------------------------------------------------------
E6WPJ5_PSEUU/9-82--------------------------------------------------------------------------------
B2V814_SULSY/6-77--------------------------------------------------------------------------------
E1SPK5_FERBD/5-80--------------------------------------------------------------------------------
A1S9X8_SHEAM/5-80--------------------------------------------------------------------------------
A8Z6H5_CAMC1/2-74--------------------------------------------------------------------------------
E3HM72_ACHXA/16-91--------------------------------------------------------------------------------
G8AUD4_AZOBR/16-89--------------------------------------------------------------------------------
NAPD_HAEIN/14-90--------------------------------------------------------------------------------
Q21AR5_RHOPB/30-104--------------------------------------------------------------------------------
A1K384_AZOSB/7-82--------------------------------------------------------------------------------
A7I3Z3_CAMHC/1-75--------------------------------------------------------------------------------
Q7VJT0_HELHP/1-77--------------------------------------------------------------------------------
Q79HQ5_WOLSU/1-76--------------------------------------------------------------------------------
E8RJB8_DESPD/3-76--------------------------------------------------------------------------------
Q5E3J5_VIBF1/10-85--------------------------------------------------------------------------------
F6AJN2_PSEF1/5-79--------------------------------------------------------------------------------
M9X453_PASHA/11-87--------------------------------------------------------------------------------
Q87GW7_VIBPA/6-81--------------------------------------------------------------------------------
B6IR09_RHOCS/9-83--------------------------------------------------------------------------------
G7Z2F9_AZOL4/7-81--------------------------------------------------------------------------------
A3QDT7_SHELP/7-80--------------------------------------------------------------------------------
W6RRD8_9RHIZ/8-82--------------------------------------------------------------------------------
A9I7M2_BORPD/2-76--------------------------------------------------------------------------------
C9R7H4_AGGAD/15-91--------------------------------------------------------------------------------
G7ZD38_AZOL4/15-89--------------------------------------------------------------------------------
E7A9K1_HELFC/1-76--------------------------------------------------------------------------------
A1BB87_PARDP/30-103--------------------------------------------------------------------------------
E4U743_OCEP5/2-76--------------------------------------------------------------------------------
A8GHJ5_SERP5/6-82--------------------------------------------------------------------------------
D6E6X0_9ACTN/3-75--------------------------------------------------------------------------------
I2B9N7_SHIBC/5-81--------------------------------------------------------------------------------
S6CE21_9ACTN/6-80--------------------------------------------------------------------------------
A3QHX3_SHELP/5-80--------------------------------------------------------------------------------
I0DQX7_PROSM/5-81--------------------------------------------------------------------------------
M1PB12_DESSD/3-76--------------------------------------------------------------------------------
Q13I16_BURXL/18-93--------------------------------------------------------------------------------
A0KIM0_AERHH/5-80--------------------------------------------------------------------------------
A1SWQ1_PSYIN/6-81--------------------------------------------------------------------------------
A6Q5Z8_NITSB/2-76--------------------------------------------------------------------------------
C5ZXD4_9HELI/11-84--------------------------------------------------------------------------------
B8CPC6_SHEPW/6-81--------------------------------------------------------------------------------
V6F139_9PROT/20-94--------------------------------------------------------------------------------
G8QFB1_AZOSU/1-76--------------------------------------------------------------------------------
E1SPK8_FERBD/5-79--------------------------------------------------------------------------------
F8E847_FLESM/4-77--------------------------------------------------------------------------------
Q92Z35_RHIME/8-82--------------------------------------------------------------------------------
M4U4Q1_9GAMM/6-81--------------------------------------------------------------------------------
A4Z0A0_BRASO/31-105--------------------------------------------------------------------------------
C7N4I2_SLAHD/2-77--------------------------------------------------------------------------------
Q5P545_AROAE/99-172--------------------------------------------------------------------------------
Q47A86_DECAR/4-79--------------------------------------------------------------------------------
V9VYJ2_9RHOB/5-78--------------------------------------------------------------------------------
C8WHW5_EGGLE/3-75--------------------------------------------------------------------------------
E1SPL2_FERBD/5-80--------------------------------------------------------------------------------
Q32I07_SHIDS/5-81--------------------------------------------------------------------------------
Q2SGV8_HAHCH/5-80--------------------------------------------------------------------------------
D7A7N1_STAND/6-78--------------------------------------------------------------------------------
Q12P45_SHEDO/5-78--------------------------------------------------------------------------------
R5ED13_9BURK/4-77--------------------------------------------------------------------------------
F8KQ14_HELBC/1-77--------------------------------------------------------------------------------
H5WUJ8_9BURK/2-77--------------------------------------------------------------------------------
Q3IV44_RHOS4/6-80--------------------------------------------------------------------------------
D1B0Z4_SULD5/1-76--------------------------------------------------------------------------------
F4H9V5_GALAU/13-88--------------------------------------------------------------------------------
Q7WXC4_CUPNH/19-94--------------------------------------------------------------------------------
S6AI66_9PROT/1-76--------------------------------------------------------------------------------
G8B0E5_AZOBR/4-78--------------------------------------------------------------------------------
A1KCK3_AZOSB/2-77--------------------------------------------------------------------------------
Q0WCM9_YERPE/6-81--------------------------------------------------------------------------------
R5QDQ6_9BURK/4-76--------------------------------------------------------------------------------
F2KF43_PSEBN/5-78--------------------------------------------------------------------------------
Q8EIJ0_SHEON/5-80--------------------------------------------------------------------------------
A4VJ12_PSEU5/21-93--------------------------------------------------------------------------------
L0F5T8_DESDL/3-76--------------------------------------------------------------------------------
D0J758_COMT2/1-75--------------------------------------------------------------------------------
I7H569_9HELI/1-77--------------------------------------------------------------------------------
Q9KLR5_VIBCH/18-93--------------------------------------------------------------------------------
R7C3D0_9BURK/5-78--------------------------------------------------------------------------------
Q21PN2_SACD2/11-86--------------------------------------------------------------------------------
K4KH51_SIMAS/8-79--------------------------------------------------------------------------------
C1D9G2_LARHH/1-73--------------------------------------------------------------------------------
F7UYF5_EEGSY/3-75--------------------------------------------------------------------------------
A9CGL4_AGRT5/8-82--------------------------------------------------------------------------------
C7RM77_ACCPU/1-76--------------------------------------------------------------------------------
B0UD65_METS4/21-95--------------------------------------------------------------------------------
K4RIQ3_HELHE/1-77--------------------------------------------------------------------------------
B1Y6A7_LEPCP/2-77--------------------------------------------------------------------------------
B2UBL6_RALPJ/21-96--------------------------------------------------------------------------------
M4R765_BIBTR/2-75--------------------------------------------------------------------------------
B3E654_GEOLS/3-76--------------------------------------------------------------------------------
H0Q103_9RHOO/2-77--------------------------------------------------------------------------------
E4U3K5_SULKY/1-73--------------------------------------------------------------------------------
A8LLZ0_DINSH/2-76--------------------------------------------------------------------------------
B8F7K3_HAEPS/16-92--------------------------------------------------------------------------------

PF01037

GRP_ZYMMO/71-144--------------------------------------------------------------------------------
ZRP_ZYMMO/68-141--------------------------------------------------------------------------------
Q92MD2_RHIME/86-156--------------------------------------------------------------------------------
Q7D0A6_AGRT5/69-139--------------------------------------------------------------------------------
Q8XUT3_RALSO/72-151--------------------------------------------------------------------------------
Q6FBR8_ACIAD/74-148--------------------------------------------------------------------------------
Q5UYW6_HALMA/69-139--------------------------------------------------------------------------------
O28651_ARCFU/68-142--------------------------------------------------------------------------------
Q97KE2_CLOAB/74-146--------------------------------------------------------------------------------
Q6LFY1_PHOPR/75-149--------------------------------------------------------------------------------
Q9KKN4_VIBCH/69-143--------------------------------------------------------------------------------
Q88Q35_PSEPK/72-143--------------------------------------------------------------------------------
LRPB_BACSU/69-136--------------------------------------------------------------------------------
Q8ELF6_OCEIH/69-140--------------------------------------------------------------------------------
Q7P0K6_CHRVO/67-134--------------------------------------------------------------------------------
Q5LQ65_RUEPO/71-144--------------------------------------------------------------------------------
Q6NDU4_RHOPA/81-154--------------------------------------------------------------------------------
Q8XS36_RALSO/102-176--------------------------------------------------------------------------------
Q6N2H6_RHOPA/71-144--------------------------------------------------------------------------------
Q9RT71_DEIRA/109-183--------------------------------------------------------------------------------
Q87GT1_VIBPA/66-140--------------------------------------------------------------------------------
Q6LY54_METMP/67-138--------------------------------------------------------------------------------
Q6L2L7_PICTO/21-92--------------------------------------------------------------------------------
Q5V2Q8_HALMA/69-143--------------------------------------------------------------------------------
Q9HQ13_HALSA/69-140--------------------------------------------------------------------------------
Q8E9E7_SHEON/75-150--------------------------------------------------------------------------------
A9CFY0_AGRT5/67-137--------------------------------------------------------------------------------
Q63VD1_BURPS/71-145--------------------------------------------------------------------------------
Q8XQA9_RALSO/69-143--------------------------------------------------------------------------------
Q6A8E6_PROAC/82-152--------------------------------------------------------------------------------
Q9L101_STRCO/68-139--------------------------------------------------------------------------------
Q5YPF7_NOCFA/74-144--------------------------------------------------------------------------------
Q98D73_RHILO/70-144--------------------------------------------------------------------------------
Q98F66_RHILO/68-135--------------------------------------------------------------------------------
Q9A2I8_CAUCR/74-148--------------------------------------------------------------------------------
Q9AAL7_CAUCR/79-153--------------------------------------------------------------------------------
Q5LQ72_RUEPO/75-142--------------------------------------------------------------------------------
A9CFA2_AGRT5/70-143--------------------------------------------------------------------------------
Q5ZSK0_LEGPH/69-144--------------------------------------------------------------------------------
Q98PB1_RHILO/72-146--------------------------------------------------------------------------------
Q92LN5_RHIME/67-137--------------------------------------------------------------------------------
Q92U21_RHIME/82-152--------------------------------------------------------------------------------
Q88GR4_PSEPK/67-141--------------------------------------------------------------------------------
Q5LX17_RUEPO/69-143--------------------------------------------------------------------------------
Q8KCK3_CHLTE/71-142--------------------------------------------------------------------------------
Q9I287_PSEAE/71-145--------------------------------------------------------------------------------
Q9A5B5_CAUCR/107-181--------------------------------------------------------------------------------
Q5YR66_NOCFA/67-141--------------------------------------------------------------------------------
Q8NMC1_CORGL/75-149--------------------------------------------------------------------------------
Q82QC2_STRAW/71-138--------------------------------------------------------------------------------
Q898A1_CLOTE/78-150--------------------------------------------------------------------------------
Q88H33_PSEPK/67-137--------------------------------------------------------------------------------
Q88DP7_PSEPK/70-145--------------------------------------------------------------------------------
Q9KYP0_STRCO/82-153--------------------------------------------------------------------------------
Q9EX07_STRCO/69-139--------------------------------------------------------------------------------
Q74NJ3_NANEQ/8-78--------------------------------------------------------------------------------
Q5UXF0_HALMA/63-134--------------------------------------------------------------------------------
LYSM_SULTO/67-138--------------------------------------------------------------------------------
Q7VRX6_BORPE/85-159--------------------------------------------------------------------------------
HOSA_SULTO/388-459--------------------------------------------------------------------------------
Q6L0M6_PICTO/71-145--------------------------------------------------------------------------------
Q7NXB3_CHRVO/75-142--------------------------------------------------------------------------------
Q8XJU9_CLOPE/76-148--------------------------------------------------------------------------------
Q82JE5_STRAW/69-138--------------------------------------------------------------------------------
Y4TD_RHISN/84-158--------------------------------------------------------------------------------
Q9K0L9_NEIMB/99-172--------------------------------------------------------------------------------
Q87PU4_VIBPA/76-146--------------------------------------------------------------------------------
Q5Z126_NOCFA/77-147--------------------------------------------------------------------------------
Q89LX8_BRADU/73-146--------------------------------------------------------------------------------
Q5LQW1_RUEPO/67-141--------------------------------------------------------------------------------
Q65N91_BACLD/69-136--------------------------------------------------------------------------------
Q92XD8_RHIME/73-147--------------------------------------------------------------------------------
Q8FLW4_COREF/255-325--------------------------------------------------------------------------------
Q5LTP6_RUEPO/68-142--------------------------------------------------------------------------------
Q8XVM9_RALSO/69-143--------------------------------------------------------------------------------
Q98KG1_RHILO/93-160--------------------------------------------------------------------------------
Q8A556_BACTN/73-147--------------------------------------------------------------------------------
Q7NU65_CHRVO/74-148--------------------------------------------------------------------------------
Q5NMJ8_ZYMMO/67-141--------------------------------------------------------------------------------
Q7VRX9_BORPE/76-153--------------------------------------------------------------------------------
Q6FCQ3_ACIAD/67-137--------------------------------------------------------------------------------
Q6A5I2_PROAC/64-135--------------------------------------------------------------------------------
Q8ZT22_PYRAE/67-153--------------------------------------------------------------------------------
Q9KFQ5_BACHD/69-136--------------------------------------------------------------------------------
Q63M55_BURPS/72-146--------------------------------------------------------------------------------
Q9RKY4_STRCO/86-156--------------------------------------------------------------------------------
Q89QF0_BRADU/95-169--------------------------------------------------------------------------------
Q7NH56_GLOVI/75-142--------------------------------------------------------------------------------
Q5WIR4_BACSK/69-136--------------------------------------------------------------------------------
Q82AJ9_STRAW/6-77--------------------------------------------------------------------------------
Q7VV34_BORPE/67-140--------------------------------------------------------------------------------
Q63K02_BURPS/70-144--------------------------------------------------------------------------------
Q9K6T5_BACHD/69-140--------------------------------------------------------------------------------
O29671_ARCFU/66-134--------------------------------------------------------------------------------
Q6AF01_LEIXX/80-150--------------------------------------------------------------------------------
Q98JQ8_RHILO/76-143--------------------------------------------------------------------------------
Q9XAG4_STRCO/72-142--------------------------------------------------------------------------------
Q92PN1_RHIME/74-147--------------------------------------------------------------------------------
O86743_STRCO/86-156--------------------------------------------------------------------------------
Q7VXK7_BORPE/69-143--------------------------------------------------------------------------------
Q9RK86_STRCO/67-136--------------------------------------------------------------------------------
Q9RXV6_DEIRA/89-157--------------------------------------------------------------------------------
O29606_ARCFU/6-76--------------------------------------------------------------------------------
Q6ANT7_DESPS/69-143--------------------------------------------------------------------------------
REG1_PYRFU/70-146--------------------------------------------------------------------------------
Q98K63_RHILO/72-146--------------------------------------------------------------------------------
Q9HLH1_THEAC/98-168--------------------------------------------------------------------------------
O29117_ARCFU/70-140--------------------------------------------------------------------------------
Q983I9_RHILO/78-152--------------------------------------------------------------------------------
Q972L7_SULTO/67-140--------------------------------------------------------------------------------
Q5V2P2_HALMA/69-140--------------------------------------------------------------------------------
Q87GV1_VIBPA/67-140--------------------------------------------------------------------------------
Q8XX00_RALSO/74-141--------------------------------------------------------------------------------
Q987B0_RHILO/72-146--------------------------------------------------------------------------------
Q9A3N3_CAUCR/116-190--------------------------------------------------------------------------------
Q7NT80_CHRVO/75-149--------------------------------------------------------------------------------
Q5LKR4_RUEPO/67-141--------------------------------------------------------------------------------
P71888_MYCTU/70-141--------------------------------------------------------------------------------
Q5LTI9_RUEPO/68-142--------------------------------------------------------------------------------
Q88E71_PSEPK/78-152--------------------------------------------------------------------------------
Q82M14_STRAW/244-315--------------------------------------------------------------------------------
Q5LX25_RUEPO/67-137--------------------------------------------------------------------------------
Q981V1_RHILO/75-149--------------------------------------------------------------------------------
Q97J19_CLOAB/69-136--------------------------------------------------------------------------------
Q89XH4_BRADU/78-152--------------------------------------------------------------------------------
Q984M5_RHILO/74-148--------------------------------------------------------------------------------
Q9HQ33_HALSA/67-138--------------------------------------------------------------------------------
Q93IX1_STRCO/72-139--------------------------------------------------------------------------------
Q975B9_SULTO/71-141--------------------------------------------------------------------------------
Q745M6_MYCPA/252-323--------------------------------------------------------------------------------
Q5LNM4_RUEPO/70-143--------------------------------------------------------------------------------
Q93IX5_STRCO/73-147--------------------------------------------------------------------------------
Q92MD5_RHIME/70-144--------------------------------------------------------------------------------
Q9RS40_DEIRA/9-80--------------------------------------------------------------------------------
Q5KVS2_GEOKA/71-145--------------------------------------------------------------------------------
Q5LUB6_RUEPO/69-143--------------------------------------------------------------------------------
BKDR_PSEAE/70-144--------------------------------------------------------------------------------
Q8ZX24_PYRAE/6-77--------------------------------------------------------------------------------
Q8XFM7_RALSO/75-142--------------------------------------------------------------------------------
REG8_PYRFU/69-139--------------------------------------------------------------------------------
Q5UZ96_HALMA/68-138--------------------------------------------------------------------------------
Q5QV65_IDILO/67-141--------------------------------------------------------------------------------
Q5LRE1_RUEPO/71-145--------------------------------------------------------------------------------
Q6D0Y1_PECAS/70-144--------------------------------------------------------------------------------
Q98N03_RHILO/69-143--------------------------------------------------------------------------------
Q880K0_PSESM/71-145--------------------------------------------------------------------------------
Q8ZWW2_PYRAE/87-153--------------------------------------------------------------------------------
Q986N0_RHILO/91-161--------------------------------------------------------------------------------
Q9HV24_PSEAE/67-134--------------------------------------------------------------------------------
Q6LS33_PHOPR/66-136--------------------------------------------------------------------------------
Q9A4E7_CAUCR/94-165--------------------------------------------------------------------------------
Q89D55_BRADU/68-142--------------------------------------------------------------------------------
Q6AIZ2_DESPS/68-140--------------------------------------------------------------------------------
Q5LTP5_RUEPO/70-144--------------------------------------------------------------------------------
Q88AX2_PSESM/73-147--------------------------------------------------------------------------------
Q8A637_BACTN/72-143--------------------------------------------------------------------------------
A9CJY9_AGRT5/67-141--------------------------------------------------------------------------------
Q826R1_STRAW/74-145--------------------------------------------------------------------------------
Q9KGA0_BACHD/67-134--------------------------------------------------------------------------------
Q8G6L1_BIFLO/70-140--------------------------------------------------------------------------------
Q6AQ93_DESPS/16-87--------------------------------------------------------------------------------
Q81G47_BACCR/69-136--------------------------------------------------------------------------------
Q5NRK7_ZYMMO/74-148--------------------------------------------------------------------------------
Q6FAP4_ACIAD/69-144--------------------------------------------------------------------------------
Q7VUI7_BORPE/70-140--------------------------------------------------------------------------------
AZLB_BACSU/71-145--------------------------------------------------------------------------------
O28824_ARCFU/64-138--------------------------------------------------------------------------------
Q6NCU7_RHOPA/67-141--------------------------------------------------------------------------------
Q5LMF1_RUEPO/70-144--------------------------------------------------------------------------------
Q5WDD1_BACSK/69-140--------------------------------------------------------------------------------
Q9XA32_STRCO/57-128--------------------------------------------------------------------------------
Q9A3M5_CAUCR/129-203--------------------------------------------------------------------------------
Q6L1Y9_PICTO/97-167--------------------------------------------------------------------------------
Q6W0Z0_RHISN/69-143--------------------------------------------------------------------------------
Q87WM3_PSESM/56-130--------------------------------------------------------------------------------
Q5NNH9_ZYMMO/73-147--------------------------------------------------------------------------------
PTR1_METJA/68-139--------------------------------------------------------------------------------
Q92NU2_RHIME/68-141--------------------------------------------------------------------------------
LRP_RHIME/73-147--------------------------------------------------------------------------------
Q8XU40_RALSO/70-144--------------------------------------------------------------------------------
Q65G37_BACLD/68-136--------------------------------------------------------------------------------
Y224_HAEIN/85-159--------------------------------------------------------------------------------
Q65E48_BACLD/78-149--------------------------------------------------------------------------------
Q6W241_RHISN/68-142--------------------------------------------------------------------------------
O28868_ARCFU/6-77--------------------------------------------------------------------------------
Q63I71_BURPS/69-143--------------------------------------------------------------------------------
O27261_METTH/78-148--------------------------------------------------------------------------------
Q5LWR4_RUEPO/91-158--------------------------------------------------------------------------------
Q9K655_BACHD/67-134--------------------------------------------------------------------------------
Q980N2_SULSO/6-77--------------------------------------------------------------------------------
Q5P347_AROAE/71-145--------------------------------------------------------------------------------
Q8NTP9_CORGL/72-146--------------------------------------------------------------------------------
Q5YZ22_NOCFA/6-77--------------------------------------------------------------------------------
Q92S84_RHIME/6-77--------------------------------------------------------------------------------
Q5LVX6_RUEPO/69-143--------------------------------------------------------------------------------
Q6FCJ8_ACIAD/71-145--------------------------------------------------------------------------------
Q9HVR3_PSEAE/69-143--------------------------------------------------------------------------------
Q5LXH4_RUEPO/67-141--------------------------------------------------------------------------------
Q8Y353_RALSO/69-136--------------------------------------------------------------------------------
A9CG60_AGRT5/77-149--------------------------------------------------------------------------------
A9IKA3_BORPD/73-141--------------------------------------------------------------------------------
B2FLQ0_STRMK/74-148--------------------------------------------------------------------------------
C1A292_RHOE4/70-138--------------------------------------------------------------------------------
D5AV63_RHOCB/70-137--------------------------------------------------------------------------------
F2KKC6_PSEBN/67-133--------------------------------------------------------------------------------
F2Z5Y7_SULAC/76-144--------------------------------------------------------------------------------
G4RMH4_THETK/397-468--------------------------------------------------------------------------------
YBAO_ECOLI/68-142--------------------------------------------------------------------------------
REG7_PYRFU/69-138--------------------------------------------------------------------------------
Q0K0V9_CUPNH/87-161--------------------------------------------------------------------------------
Q1DFS8_MYXXD/69-140--------------------------------------------------------------------------------
Q2K1K4_RHIEC/70-143--------------------------------------------------------------------------------
Q2YIU7_BRUA2/70-144--------------------------------------------------------------------------------
Q2YL25_BRUA2/72-139--------------------------------------------------------------------------------
Q2YQJ2_BRUA2/71-144--------------------------------------------------------------------------------
Q5JGT9_THEKO/6-76--------------------------------------------------------------------------------
Q5L7H5_BACFN/70-142--------------------------------------------------------------------------------
Q5LDE0_BACFN/71-144--------------------------------------------------------------------------------
Q5SK07_THET8/6-76--------------------------------------------------------------------------------
Q5ZVF4_LEGPH/88-161--------------------------------------------------------------------------------
Q63LV0_BURPS/69-143--------------------------------------------------------------------------------
Q63PU3_BURPS/81-154--------------------------------------------------------------------------------
Q63WP2_BURPS/72-146--------------------------------------------------------------------------------
Q79Z48_STRAW/82-148--------------------------------------------------------------------------------
Q7LX67_SULSO/76-145--------------------------------------------------------------------------------
Q7VSF7_BORPE/69-142--------------------------------------------------------------------------------
Q7VUR8_BORPE/71-143--------------------------------------------------------------------------------
Q7VUU2_BORPE/68-141--------------------------------------------------------------------------------
Q7VVL9_BORPE/71-144--------------------------------------------------------------------------------
Q81UN4_BACAN/77-147--------------------------------------------------------------------------------
Q88EQ3_PSEPK/70-143--------------------------------------------------------------------------------
Q88NA5_PSEPK/72-143--------------------------------------------------------------------------------
Q88QV0_PSEPK/75-144--------------------------------------------------------------------------------
Q8PE26_XANCP/73-147--------------------------------------------------------------------------------
REG6_PYRFU/71-140--------------------------------------------------------------------------------
Q8ZKW5_SALTY/74-143--------------------------------------------------------------------------------
Q98A93_RHILO/76-149--------------------------------------------------------------------------------
Q9HKJ0_THEAC/68-141--------------------------------------------------------------------------------
R9VS53_9ENTR/78-152--------------------------------------------------------------------------------

PF06778

F0SNH9_PLABD/43-266LDENR...E.......GAPIRLQTSVVSGHR..ADLGLMMMDPDPLVIDRICQQLRA.TPLGPVLKPTYSFVSLTEISEY
C4KZ59_EXISA/42-244LASLE...EVEAKGE.G...SHAFYSILGQK..ADLVLMVLRPTFNELEDVERAFRK.TALYDYMIPSYSYVSVIELGMY
Q8FPI6_COREF/57-245FTNLV...NEGR......VVIRGIYNATGLRAEADYMIWWHAEEFDELQKAFADFRRTTILGQVSEVFWIGNGIHRPSEF
L0ICT5_HALRX/35-243LEAAE...AVADADS.G...GSTSVAVLGHE..ADLCFIHLRPTLSDLNALERRFER.TELAAFTEHSDSYVSVTEASGY
D9SZQ2_MICAI/35-220FTELA...GKD.......VTIRGTYDVAGLRADADLMIWWHSSSSDALQDAYLRFRR.TTLGRALTPVWSQMALHRPAEF
Y1714_THET8/36-235VREWR...ELEEAGQ.G...SYGIYQVVGHK..ADLLFLNLRPGLDPLLEAEARLSR.SAFARYLGRSYSFYSVVELGSQ
R7XV22_9ACTO/33-219FASQA...EED.......IVVRGLYDVSGLRADADLMVWWHAEDSEMLQSAYNTFRR.TTFGARLEPVWSQMALHRPAEF
Q0SJX2_RHOSR/31-217LDRVA...ESG.......VAIRGIYDVAGLRGDADFMMWTHADTVEELQAAYSGFRR.CRLGRACTTVWSAVALHRPAEF
Y2262_NATPD/37-243LQAHV...DLKDAEE.G...ASAVFSILGHK..ADFMVLHLRPTLDHLDHAERRFES.TALAEFTEQSSSYVSVTEVSGY
B1VE13_CORU7/32-219LDSYK...DSS.......VTVRGVYDLTGMRPEADIMFWIHGEKLEDLQAFYRAFRRETLLGKAAVPYRTNAALHRPAEF
Q4JVC0_CORJK/33-220IDSFE...DED.......LVIRGVYDLSALRAEADVMIWWHAEKMEDLQVAYRRFLKETKLGQACEPVWSNTCLHRPSEF
L0JIJ1_NATP1/34-241LEASE...AVDDADE.G...DSATFAVLGHK..ADLLVLHLRPTLGDIDALERQFEH.TALAEFTERADSYVSVTEVSGY
T0LXR6_9EURY/32-214FREYE.............GRLINLRMYRSIRHDCDVIFWMSSHDPMDMSRFKESIM..RAMGGYGSARYSMFSLYEHSPY
Q9YFL1_AERPE/25-208VSEAA...........ESSDATVSRAYLNISGPGHLSLVAAFTEAGGLGRLRLELSR....WGCVEEAVWWPAYYKESPY
E1VXL5_ARTAR/41-226IEQLA...AEG.......AIVRGIYDVSAMREDADVMIWVHGPAAELLQASMRKIRR.SALLEGTEIVYSTMAVHREAEF
D6Y1B9_BACIE/32-233LEKWD...AVEASQE.G...SHGMYKMMGQK..SDIMFMWLRPTMDELHEIEHAFNK.SGLAEFLIPNYSYVSVVELSNY
W5XTF0_9CORY/31-219FNAVE...EAGT......VIIRGIYDLSGMRDSADFMIWWHAEEFEDIQKVFSEFRRTTVLGQISDVTWIGNSLHRPAEF
A6W8D4_KINRD/44-230LDELT...GRG.......LVVRGSYDVAGLRADADLMFWWHAPTVELVQEAYRRLRR.TRLGRHLVPVWSVVGLHRPAEF
O69830_STRCO/44-230FDQLA...AKD.......VTIRGTYDLSGLRADADLMIWWHAETADQLQEAYNLFRR.TKLGRALEPVWSNMALHRPAEF
L0EGN4_THECK/32-234MEEWA...SVEAAKT.G...STAVYAIVGQK..ADILFMHLRETLDELQEVETAFNK.SAFADYTLPAYSYVSVVELSNY
F9VP99_SULTO/25-212EKEFS.............NKLVSLKRFISLRYDGDIIYWACDYNTTPLNDFRYSLL..SVSNSYLEEKVSFFSVFKPSPY
B9LRB6_HALLT/32-240LKHRE...LVADADE.G...DSGLFSVLGHK..ADLLFVHFRPTLDDLSSIERRFED.TALANFTERTTSYVSVTEVSGY
A0LUP2_ACIC1/31-217LAEAA...GKG.......VTTRGVYDISGFRADADVLIWWIGGEAEALQDAYQRLRR.TAFGQACEPAWTAIGVHREAEF
S6D874_9EURY/34-244FADAI...GVTDAAA.G...DSAVYAMLGHE..ADLLVVHLRPTTADVERLTRRFEH.TAFAGFTEPTDSFVSVTEASGY
X4ZQL5_9BACL/32-236IEEWS...GVEEAKL.G...SSAWYSIVGQK..ADFVMVHLRESLEELNKLEVAFNK.TAFAAFTTKAYSYVSIVELSNY
C5CB90_MICLC/41-225VARVA...ETG.......VTVRGVYDVSGMREAGDVMVWMYGQVPEDLQAAIRELRR.TRLLEGTTMVLSAMGADRMAEF
B9L446_THERP/60-240LERSE............GTALRGAYLATGFRPDVDLIFWLLGHDPAHFQDLALALRR.TALGRALPVRYAYFGMAGSSQY
Y1094_HALWD/33-240LRKHE...SIADAEE.G...SSAVFSVLGHK..ADILITHFRPTLDALSRAERQFEQ.TTFAGFTTQPTSYVSVAEISGY
Q9RUB0_DEIRA/83-276VEDWV......NDAEPRQGLILRSYSLVGIRDDVDFMLWRIAFDVNDFQAAQARLNR.TRMMGYLHQPATYLAMQKRSQY
C1F2S0_ACIC5/36-261LGPLE...AGAAEGHPN...QSAVFAQLGHK..GDLLFVHFRDSMEELARLERDLAK.LELSDYLEPSESYVSVVELGLY
Q6NGV6_CORDI/32-220FDGLE...TAGK......VEVRGIYDLAGCRAEADFMIWWIAEEFEEIQAAFARFRRETVLGQVSEVAWLGNSLHRPAEF
D6Z8U5_SEGRD/32-219FEERA...QEG.......VELRGVYDVSGLRADADFMLWTHAERVESLQAAYQGFRRATALGRASDAVWSAAALHRPAEF
Y3416_GEOKA/32-234VDQWE...TTESEKQ.G...SHAVYTIVGQK..ADILFMILRPTLDELHEIETALNK.TKLADYLLPAYSYVSVVELSNY
E6SBC9_INTC7/38-224LVTLA...AEG.......VVVRGIYDVAGLRGDADFMIWWHAATIEQLQSAYHRLLR.SELGAHLEPVWSSAALHRPAEF
C7Q1S6_CATAD/53-239LETLA...KDD.......VVLRGSYDVSGFRHDADFMLWLHAETSEALQDAYQRFRR.TAFGRLTEPVWSQMALHRPAEF
R5BEF5_9FIRM/53-249IAELE...AGHEAET.S...SYALYNVAGGK..GDIMIWFLQPTLEEVTAKEITLRK.LAIGAVLEPTASFVSVIEVSNY
E8NBZ8_MICTS/34-209TALIE...ADG.......VTVRGFYDVSGLRADADLMIWLHGPDPQALQRDLRRLRR.TELLKNLLPTWNAMGVHRDAEF
D7AZW8_NOCDD/37-223LDKAA...EQG.......VTTRGSYDVQGFRADADIMFWWVADSPEQVQDVYTAFRR.TRIGRVSTPVWSVVGLHRPAEF
D3F509_CONWI/26-209LDAAD.............VVVRGSYSLAGFRAEADLLLWLVAASADALQDAVVAFRH.TELGRSLDAHWTNIGVHREAEF
D5WXV8_KYRT2/32-234VAQWD...EIEATKQ.G...STALYTVVGQK..ADLVMVHLRPTLQDLEATELTFER.SEFATIARPAYSYVSVVELSNY
S0EWF5_CHTCT/28-217VE............EAADEMMIRSYSLTGIRGDVDLLLWMASPDLDLLRNHAARFLR.TGIGRWMTQPYCFLSMTKASQY
Q73W63_MYCPA/31-218FKQQE...ERG.......VVVRGLYDVAGMRADADFMIWTHAETVEALQATYADFRRTTALGRVCSPVWSSVALHRPAEF
F5XEW4_MICPN/37-217........GGD.......LTIRGWYDVAGLRADADLMVWWHAPTSETLQDAYHALRR.SDLGQRLVPVWSQLALHRPAEF
K0IKJ2_NITGG/40-223VDVAN......T......KMKVRTYSTLGLREDADIMFWMISDTVEKTQVMASKIYS.TVLGKYLTQSYVFLSAMRPSVY
D5UHH5_CELFN/40-223VAA.....DDD.......LVVRGWYDVAGLRADADLMVWWHAESVEQVQGAYHRLRA.SALGEVLTPVWSVVGLHRPAEF
L0AIF2_NATGS/35-243LADCE...SVADAED.G...DSATFAMLGHE..ADLLFMHIRPTMADVERLGRQFDG.TAFAEFTERTDSYVSVAEVSDY
Q97WP2_SULSO/27-213ESQFR.............NNLISLKRYISLRNDSDIIYWVTSSDTSKLLEFKYTLL..SKIRDLGYESLSLFSVYRSSPY
B0RBL8_CLAMS/291-473VHIVE...AEG.......VTVRGFYDVSGMRADADLMVWIHGPQMETLQWAFREIRR.ARLIRALIPSWSAAGVHRDAEF
V5XBV5_MYCNE/31-217LKQQE...EGD.......VVVRGLYDVSGFRADADYMIWTHAERVEDLQATYKAFRR.TTLGLASDPVWSVVALHRPAEF
L0DE33_SINAD/64-283LDPAA...P.......GAPNQLQCFAVPGHK..ADFGVMIAGTDLKAVHAIQIAIQA.SPLGPALVPAYSFYSITEVSEY
D5DMA4_BACMD/32-233IEKWK...GTEAEQQ.G...SHALYTVVGQK..ADFMLMLVRPTMEELNEIETEFNK.TKLAEFTIPTYSYVSVVELSNY
B9E8M3_MACCJ/32-235INTLE...DNHVAKE.G...SYALYNITGQK..ADLMLWLLRPEMKDLTALENKFNK.LAIRDFLIPTYSYVSVIELSNY
F8I7Y0_SULAT/32-233IEKYR...SV.AADQ.G...SFGLFQVIGHK..ADVLFLHFRPSVDALLTLETDFNQ.LRLGSAFPQSYSYFSVVELSKY
D1AC74_THECD/41-225LAQAA...GKD.......VTTRGVYDVSGFRADADFMFWWHAPTTDDLQEIYSRFRR.TALGRCCEPVWSQVALHRPAEF
E3H4V1_ROTDC/66-250IEELK...ADG.......VTLRGLYDVSAMRDNADVMVWTHGPTPEKLQAAVRKIRR.TALFSATTIVWSTMGVHREAEF
D7GH54_PROFC/34-213QAVAA...DTD.......LVIRGWYDVAGLRADADLMVWWHAHDYETLQRAYHVLRA.STLGNVLTPVWSQLALHRAAEF
C3PGT0_CORA7/31-219FSELE...EAGV......VTVRGIYDLSGMRESADYMIWWHAEEFADIQKAFADFRRETVLGQVSEVTWVGNALHRPAEF
W0K1G0_9EURY/32-240LEDRE...ALAQAED.G...DSAVFSITGHK..ADLLFVHFRESLDELDRIERSFEQ.TAFAGYTEQPHSYVSVTEISGY
E4NLI1_HALBP/33-242LRTHE...AVEDAED.G...TSAVFSILGHK..ADLLVIHFRPTLDALSRAERQFER.TALAAYTEQATSYVSVTEVSGY
Q2JDC9_FRASC/32-218LDGAL...AKD.......VYTRGVYEISGYRADADLMVWWTSPDPDLLQETYQRFRR.TALGGHLRPVWSAVGLHRPAEF
A9A1Z8_NITMS/29-212LKNS..............GIKYRAYSNLGLRDDADFLLWFVGSSLEEIQKAIEKLYK.TVFGKYIIPSRTYLSCSRPSIY
Y235_STAEQ/32-235VKDKA...VARESHQ.G...DHAIYNITGQK..ADLLLWFLRPEMKELNQIENEFNK.LRIADYLIPTYSYVSVIELSNY
Y3825_BACHD/32-235MEKWN...DTEAQGE.G...SHAVYTIVGQK..ADVMLMILRPSMEELNEIETAFNK.SRFAEFTVPAYSYVSVVELSNY
H5WWJ5_9PSEU/31-217LDALE...GKG.......VVVRGVYDVAGLRADADYMIWWHAEEPEQVQAAYTGFRR.TPLGRVSIPVWSQFALHRPAEF
U3GV86_9CORY/36-224FQQLQ...DRGL......VVTRGIYDVSGIREGADYMIWWHAEEIRDIQQAFNDFRRNTTLGRCSDNVWLASALHRPAEF
Q5YTA7_NOCFA/31-218FDGLA...EKD.......VVVRGIYDVAGMRADADFMVWTHAERVEDLQAAYADFRRTTELGRASDPVWSNVALHRPAEF
A4YEP6_METS5/23-205EEQEG.............KNFISIRRYASINRSSSLVYWLSSETTTPLVKFRSSLL..SALRGYADEDVLLFSVFRPSPY
X5E9F8_9CORY/34-221LASFD...DEE.......LTVRGVYDLTGQRAEADIMIWWHAEKFEDLQRAYRRFLRETTLGRACDGYWSNSALHRPAEF
E6TY42_BACCJ/32-233LEKWN...NTQSKFE.G...SHGLYTIVGQK..ADFMMMLLRPTMEELNDIENAFNK.TRLAEYTIPAHSYVSVVELSNY
I4F0Z5_MODMB/38-224FEELA...GKD.......VVVRGVYDVAGLRADADLMIWWHAETPEALQEAYSRFRR.TALGRHLEPVWSQMALHRPAEF
D3EHI6_GEOS4/33-235LAEWD...AVETAKQ.G...STAVYTIVGQK..ADFVFMHLRETLEELNAIENAFNK.TTFAQFTTKAYSYVSIVELSNY
F4CMZ7_PSEUX/31-218VEALA...GKG.......VVVRGVYDLAGLRADADYMIWWHAETVEALQAAYADLRRTTALGRASVPVWSQVALHRPAEF
D1BQU3_VEIPT/32-230LADLE...AKHQAKE.G...SYAFYDCNGAK..GDLILWILGPSLEYLAQVERKFRR.LAIASVLVQTYSYTSVTEVSTY
D2B5C2_STRRD/36-222LAQMA...EKD.......VVTRGLYDVTGFRADADFMFWWHAPSAEDLQETYARFRR.TDLGLLTEPVWSAMALHRPAEF
T0MX07_9EURY/25-211FMDYG.............KKLINLRMYRSIRHDSDIIFWLSSSDPMDISEFRKDIM..LAMSGYGIPEYSMFSLYEHSPY
G2MME7_9ARCH/32-240LSSHE...AVEDADE.G...TSAVFSVLGDK..ADLLVLHLRPSLDHLSTAERRFEG.TELGRFTDQTDSFVSVTEVSGY
C4LIZ4_CORK4/52-239IASYE...HED.......LTIRGIYNVSGIRAEADIMIWWHAEKMEDLQDAYNRFLRTTTLGRACTGVWSQAALHRPSEF
D1CGR6_THET1/37-235LGECA...SVEGVERGG...SSRAYRVITQK..ADLAVIHFRPDPAQLFDLQAGLWR.CGIADFLLPAYSYFSVIELSLY
G2TIY8_BACCO/32-236LQQLD...AIQSKHE.G...AYALYTITGQK..ADFVLWTMRPALEDLEEIETAFNK.LRIADFTIPAYSYIGVNELSNY
Y3023_OCEIH/32-235ISKWE...AVEEEKQ.G...SHGIYKVVGNK..ADFMFIFLRESFQELEQIKTEINK.TKLGDFLIPGYSYVSIIEKTMH
W0JP72_9EURY/34-243LSACE...RLEDAGE.G...DSATYGILGHK..ADLMFLHLRPSPADLDVLERRFEH.TALAEFTEQVDSYVSVTEVSGY
C6WBD6_ACTMD/33-219IDGLA...AKG.......VTVRGVYDLAGLRADADYMIWWHAEEIEQVQAAYTGFRH.TRVGALSTPVWSQVGLHRPAEF
Y2113_LISMO/33-237LSDME...ITKNIGE.G...EHTIYSILGQK..ADLVFFTLRDSLEALNEVENRFNK.LAIADYLLPTYSYISVVELSNY
S5T2Z6_9CORY/39-226FAALA...EEGK......VTVRGLYDVSAIRADADFMIWWHAENFDEIQDAYQRFRR.TTLGQSLETWWIGNGVHRPAEF
D8J8S2_HALJB/34-241LEDHA...AVEK....G...DTAVFSVLGHK..ADLLILHLRETLEELDRAEREFEG.CALAAFTDRTSSYLSITEASGY
D7WCD0_9CORY/38-226FSGLE...DEGK......VVVRGIYDISGIRAEADVMIWWHAENFDEIQEAYNAFRRTTVLGQALEVFWIGVGLHRPAEF
C0ZJF7_BREBN/34-236IRTWE...ANEGENQ.G...STAVYSILGHK..ADLVFMFLRPTMQELDEIKTVFNK.TRFAAYTEAPYSYVSVVELSNY
L0A3P4_DEIPD/64-256VEGWL.......DAPAEAGRILRTYSTVGTRAETDFMLWRMAFDLRDFNDAQARLNR.TRLAGYLTQPYNFISMQKRSQY
R4VWV7_9EURY/32-241LEDAV...AVADADG.G...DSAVFAVLGHE..ADLMVVHLRPTLDDLDYLERQFAQ.TALAGYTERTASYVSVTEASGY
Y3912_BACSK/32-235VSKWE...GTEKAGK.G...SHALYSIVGQK..ADIMIMLLRPTMEELNEIENAFNK.SGLAAYMIPTYSYVSVVELSNY
E6SGY0_THEM7/77-282LRQVA...EARDTGE.G...ASALYRVVGHK..ADLLWLHFRPALADLSDLEAALSR.TALGDYLEPAYSYVSVTELSFY
E3E6Q2_PAEPS/44-245MKEWS...VTEEAGL.G...SSAVYTIVGQK..ADFVMLHLRETLEDLNKLENEFNK.TTFAKYTTKTYSYVSVVELSNY
F2NQ02_MARHT/63-253VERW.........AERGEGFIVRTYSLVGVRSDADFMIWRIAFDVREFQAMQRELNR.THLAGYLTQPYSFLSMQKRSIY
D6Y396_THEBD/38-224LAQAS...QKG.......VVTRGCYDVAGLRADADYMFWWHAPTPEDVQEVYTRFRR.TALGRASEPVWSVTGLHRPAEF
S0AP00_FERAC/25-209INNYR.............KNLISIKYYKSIRHDNDILIWSASDMPINLEGLKEGIN..SAIGIYGKSEYSMFSLYEHSPY
D2PNW4_KRIFD/45-231VGKLA...ADD.......VVIRGWYDVEGFRADADFLVWWHAPTSDALQTAYHALRR.SRLGRHLAPVWSQLALHRPAEF
C7MH02_BRAFD/52-236IESDS...EGG.......AEILGFYDVSGFRAEADLMLWLAADDPASLQRGLREFER.SLPGTWLHREWAGVGVHRMAEF
M1XN90_NATM8/34-243LRSHV...DLEDADA.G...ASAVFSVVGHK..ADLMILHLRPTMAALDRAERRFES.TAFAGFTERASSYVSVTEVSGY
A0JYM8_ARTS2/42-224LGRLA...DGG.......VVHRGSYDVSAMRADADIMVWLHGPKPEALQQAVRDIRR.STLFAGTEIAWSAMGVHREAEF
Y2021_HALSA/32-240LADRE...ALADADE.G...ESGVFSITGQK..ADLLFVHFRESLDELDRIQRAFEQ.TAFAEYTERAHSYVSVVEISGY
D8PHP0_9BACT/31-221VE............EYQGKVLVIAYTTVGIRGDCDLMLWRISYELELFQEMSTKIMA.SGLGKYLYNPYSYLAITKRSIY
G8QM51_AZOSU/74-268IEKHK............DNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRS.TTIGKNADVFETLVGVTKPLNY
I0JS76_HALH3/32-231ISNWE...DTEKSKQ.G...SHALYTIMGQK..ADFMMMILRPTMEELNEIETAFNK.TKLAEFTTPAYSYVSVVELSNY
Y3100_HALMA/40-244LDAYE...AVEDADE.G...QTAVYTVMGHK..ADIMILHLRPTMGDLDAAERHFEQ.TEFAAFTEQEFSYVSVTEASGY
A1SMY6_NOCSJ/40-227FAELE...AAD.......VVVRGVYDVAGLRADAELMIWWHAETSEALQDAYQRLRH.TALGRRLEPVWSQLALHRPAEF
C7NI73_KYTSD/39-223FGGLV...DQG.......VEVRGVYDLAGMRAGADYLIWWHAESNDQLQSAFKAFRR.TELGARSHATWSVSALHRPAEF
B7GML3_ANOFW/35-237VEKWE...NTEAAKE.G...SHAIYTIMGQK..ADIMFMLLRPTMEELHEIETAINK.TKLAEYLVPAYSYVSVVELSNY
D5UN10_TSUPD/36-223FERIQ...QGD.......LIVRGVYNVSGMRADADFMIWWHAEKLEDLQSAYNDFRRSTVLGRASDPVWSSTALHRPAEF
D4GSX4_HALVD/32-241LDAHE...AVEDAEA.G...ASAVFSVLGHK..ADFVVVHFRPTLDDISRAERQFER.TALAAFTEQPTSYVSVTEVSGY
YWFI_BACSU/38-240LEKWG...VAQKEGK.G...SQTLYSIVGQK..ADFMLMILRPTMEELNQIELEFNK.SRLAEFTIPAYSYVSVVELSNY
B1YHR9_EXIS2/43-244LGELA...QVEDQKE.G...SHALYTIIGQK..ADLVLMVLRPTMEEIQDVEVKMQK.LDLYDYLIPTYSYVSVVELGTY
C6CZS1_PAESJ/32-234LKEWS...SIDENKQ.G...STAVYSIVGQK..ADFVFMHLRETLEELNDIETAFNK.TLFAEFTQPAHSYVSVVELSNY
K4J0Y5_BIFAP/33-234ATRLD...AVQSQGQ.G...SHYWCRVNGQK..ADLGLMVLRETLDQLQEVETSLEK.LRLSDYLEPTISYVSVTEVGLY
H6NEC8_9BACL/32-234LRRYQ...DTEDAKQ.G...STAFFSIVGQK..ADFVFMHLRETLDELNELETEFNK.TIFAQVTVPTYSYVSVVELGGY
I3ZHU9_TERRK/71-263IERW..........NKPGEFLTLTYSTVGTRGDVDMCVWSICYSVEEMNRMRSELLA.SPLGGYLETPHSFLSMTKRSQY
C3ATM2_BACMY/35-236IEKWN...KVASSKQ.G...SHAMYTVVGQK..ADIMFMILRPTMEELNEIETELNK.TTLAEYMVPAYSYVSVVELSNY
Q02C59_SOLUE/42-265LAALE...APNQGR......QTALFSMLGHK..GDLMFVHFRRSFEELNQVQLDLAR.LKIGDYLEPATSYLSIVELGIY
B3U4H7_9BACT/61-250VEQWS............GKILVESYLLRGLSDHADLMFRVHARTLSDTQQFLSAFMG.TRLGRHLTSGGLLHGVSKKPTY
Y241_STACT/32-235LDKLA...SVRDDHN.G...DHALYNITGQK..ADILLWVLRPEMQELNSIELALNK.LRIADYLVPTYSYVSIIELSNY
A0RXH1_CENSY/29-210IKNS..............GIRFRSYSTLGLRADADFMFWLAASSADEIQDAVSRLYL.TVFGKYILPTMTYLSCTRTSIY
F6FS66_ISOV2/42-238LWDGQAEADRDPARATGDVVVRGVYDVAGLRADADLMVWVHGPTVESVQGAYRRLRA.SRLGSVLAPEWSVVALHRAAEF
F8D9K2_HALXS/34-241LSAAE...RVDDAEE.G...DSAVFSVLGHK..ADLLILHLRPTLSDIDALERSFEH.TALAEFTERADSYLSVTEVSGY
M4NFE6_9GAMM/24-209FRKYE...DR........VGLRGTYVVQGFQAHTDILFWMFADHFNDIQDLQLEIRR.SSFGRYITTPHAFTGVTKPFEF
Q47NP0_THEFY/34-220LDAAA...EKG.......TATRGVYDVQGFRADADVMFWWIADTPEQLQTIYADFRR.TALGRASTPVWSAIGIHRPAEF
W0RLA9_9BACT/56-280IARLV...SPADG...G...WTAAVQLVGAP..ADLMLIHMRPSLDGLGAAGRAVLT.EPLGDVLRRTYDFLSVTEAGMY
E8SJH0_STAPH/32-235MDRLK...QAQSEGQ.G...DQVLYNVTGQK..ADLLLWVLRPEMKDLTEIENEMNK.LAISDHFIPTYSYVSVVELSNY
F8DZS9_CORRG/32-219LDSYR...DSG.......VTVRGVYDVSGLRPEADIMFWTHGEDLAALQAFYRAFRRETELGKVAQPVRSNAALHRPAEF
A9B544_HERA2/35-220VEEAY............PSIVTYAYSTIGFKLNSDLLLWRKGTSPIAMQEMTSRLLQ.TGIGAYFEQTNLYFGFTRPSNY
C8WXF6_ALIAD/35-233VQGEL...EAQRARL.G...SFGQFVIAGTK..ADLLFLYMRPTIGELNDVKARFEA.TRLADFTERAYSYVSVVELGGY
C7QZX0_JONDD/33-222VGGASVGIETD.......LTVRGWYNISGMRADADLMVWWHGASIEDVQGAYQRLRA.SEFGRCLEPVWSNVGLHRAAEF
Q1IQ94_KORVE/57-277LRPME...ETG.........LTALFSMVGHK..GDLMLIHFRNSFDELNEAELKLAG.TRLYGYLEPVNSYLSVIELGLY
Q4JCN7_SULAC/26-212EARSK.............NDLVALKRFISLRYDGHLLYWVSDFDTSKLNNLRYSLI..SSGEGFLEEKLTLFSYFKPSPY
M1MY31_9CORY/31-219FSRLA...EEGT......VTVRGIYDISGTRAEADFMIWWHAEKFSDIQAAYNAFRRTTVLGQSSEVFWIGNALHRPAEF
X2GJV6_9BACI/32-235LEKLN...EADVAKT.G...AHAFYAIVGQK..ADFMIMTLRETMDELQELEAEFNK.LAIADFTIPTYSYVSVVELSNY
C8XF55_NAKMY/45-226SAELA...EQG.......VSIRGYYDVSGMRADADLMVWWYAPTAEQLQSAARSLRR.TSVGRSLAPFWSAMGLHRPAEF

PF04261

Q9KQ59_VIBCH/5-294VAFSKGFWS.....HF.EM.ASPPELIDFPELGEGETHAPSTDVDVLIHCHATRHDLLFYTLRKGISDIAQDIEIVDETY
EFEN_BACSU/66-405FGFGPGFFEKDGKDRFGLKSKKPKHLAALPAMPNDNLDEKQGGGDICIQVCADDEQVAFHALRNLLNQAVGTCEVRFVNK
Q98KG6_RHILO/13-313AGIGRDLWD.....RLSPG.RRPLELKPFAPIKGAVHSAPSTPGDLLFHIRAERSDMCFEFERILLDRFGPDVNVVDEVT
Q9FBY9_STRCO/10-309TGIGSEAWD.....RLFSG.ARPAGLHPFRELDGPVHRAVATPGDLLFHIRASRLDLCFALATEIMGRLRGAVTPQDEVH
EFEB_ECOLI/61-411LSVGHSLFD....ERFGLAPQMPKKLQKMTRFPNDSLDAALCHGDVLLQICANTQDTVIHALRDIIKHTPDLLSVRWKRE
Q9K1P5_NEIMB/60-410VGVGSSLFD....GRFGLKDKKPIHLQEMRDFSNDKLQKSWCDGDLSLQICAFTPETCQAALRDIIKHTVQTAVIRWSID
Q9ZBW9_STRCO/87-434FGFGHSFFG.....RTGLEEQRPVALDPLPDFSSDHLDKNRSNGDLWVQIGADDALVAFHALRAIQRDAGAAARVRWQMN
Q9CNH6_PASMU/4-293VAFGDRVWK.....QLAGE.NSAKELKPFVTLGKGDASAPATQWDLLIHIQSLRPDVNFSVALAAMNCFGKAIQVEQEIH
Q9RKQ2_STRCO/65-406IGFGPSLFT.....RFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQL
YFEX_ECOLI/5-296VAFGNNTWR.....ALSGG.VGAEELKDFPGYGKG..LAPTTQFDVLIHILSLRHDVNFSVAQAAMEAFGDCIEVKEEIH
Q9K036_NEIMB/5-299IAFGSKAWA.....TFGHT.DEGSEIKPFSEMGNG..LAPSTQHDMSIHIQSFRQNAAYALAQSVLGAFGDSICVASEEH
I6Y4U9_MYCTU/9-305VSIGSDAWD.....RLFAG.PRPTELHPFVELTGPRHTAPATPGDLLFHIRAETMDVCFELAGRILKSMGDAVTVVDEVH
Q2G130_STAA8/64-398FGISKSLMK.....KIGLSSKIPDAFKDLPHFPNDQLIDDYSDGDIMIQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQS
Q5NM63_ZYMMO/7-304MGIGSEAWN.....RLFPDAPRPKELHPFKELKGV.HHAVSTAGDLLFHIRAHRMDICFEMASLIMERIRSAVQVQDEVH

PF07876

Q748N1_GEOSL/2-96-----------------------------------------------------------ITHIVFFK--LTDPSA--PTI
A9CJX0_AGRT5/2-102-----------------------------------------------------------ILHCVFLR--FKAATA--SSE
Q740A8_MYCPA/82-179-----------------------------------------------------------VYRTLLLA--VSPDTA--EDT
Q7S333_NEUCR/57-160-----------------------------------------------------------ITHIVLFK--FKPDAG--ADR
Q98H26_RHILO/2-102-----------------------------------------------------------IRHCVFVR--FRGDVP--ESE
Y4036_STRCO/2-97-----------------------------------------------------------IRHLVLFK--LNDGVG--RDE
Q89RS9_BRADU/5-102-----------------------------------------------------------IRHIVMWR--LRGETP--EER
Q9SYD8_ARATH/116-206-----------------------------------------------------------IGKITLLK--LKENVM--EEA
Q9SYD8_ARATH/5-102-----------------------------------------------------------VEHVVLFK--LNDDDV--DSG
Q8XM37_CLOPE/2-100-----------------------------------------------------------IKHIVMWK--LKDEAE--GNS
Q98BN1_RHILO/2-96-----------------------------------------------------------IRHTVVFT--LKHASH--SLE
Q7MWG5_PORGI/2-100-----------------------------------------------------------IKHIVMFK--LAGFDS--AEA
Q7UFZ5_RHOBA/16-113-----------------------------------------------------------LAHQVFFT--.TKDRS--DET
POP3_ARATH/8-104-----------------------------------------------------------VKHVLLAS--FKDGVS--PEK
Y5258_ARATH/6-100-----------------------------------------------------------FKHLVVVK--FKEDTK--VDE
Q6YTX5_ORYSJ/40-141-----------------------------------------------------------VEHIVLIK--VRPEAA--SSG
Q7N2N7_PHOLL/12-107-----------------------------------------------------------IAHQVLFT--FKDGIS--WDS
Q9SIP1_ARATH/158-254-----------------------------------------------------------VAKLTLLK--LKEDVA--DEA
Q7SEW8_NEUCR/10-117-----------------------------------------------------------IHRMTLFK--IPDETN--QKR
Q7D0A2_AGRT5/2-93-----------------------------------------------------------IRHIVFFT--VPEENR--DAV
Q726I9_DESVH/2-101-----------------------------------------------------------LKHIVWWT--LKDEAE--GAT
Q7URH4_RHOBA/33-129-----------------------------------------------------------LRHVVMFG--FKDASS--EAD
Q97LN9_CLOAB/2-94-----------------------------------------------------------LTHIVFFK--LHDKKD--VGK
Q6LGQ4_PHOPR/2-98-----------------------------------------------------------IRHILLIK--FKDSSP--ASE
Q8KCZ4_CHLTE/2-100-----------------------------------------------------------VKHIVMWR--LCDEAH--GNS
Q7S418_NEUCR/3-107-----------------------------------------------------------IVHVELFE--FKPLAT--QEE
Q8ABC5_BACTN/2-99-----------------------------------------------------------VKHIVLFK--LKDEVP--EAE
Q6LYV0_METMP/2-100-----------------------------------------------------------IKHIVMWK--LKENDK--DND
Q82QQ6_STRAW/2-93-----------------------------------------------------------IYHINRVT--MKATAT--PEQ
Q9F304_STRCO/2-93-----------------------------------------------------------IHHQIRLA--MRPDAP--RDK
Q9SIP1_ARATH/49-144-----------------------------------------------------------IEHIVLFK--TKDDAD--STK
Q8RF81_FUSNN/2-98-----------------------------------------------------------LNHIVMWK--IKEDVE--DKE
Q6YTX5_ORYSJ/154-248-----------------------------------------------------------AVRLSLAK--LKEGVE--AHQ
Q9A628_CAUCR/2-100-----------------------------------------------------------LFHQVFFW--LKNPGD--KAD
B9HX68_POPTR/9-106-----------------------------------------------------------VKHTLLTR--FKDEIT--REQ
B9HX69_POPTR/16-111-----------------------------------------------------------LKHIVFVR--FNDGIT--DEQ
H2VFL6_ZYMMO/42-154-----------------------------------------------------------LQHIVLFR--FKKNVT--EAE
H7C7T4_BRADU/2-94-----------------------------------------------------------IRHIVFFS--AKDEAH--IHQ
Q2YP23_BRUA2/2-92-----------------------------------------------------------IRHIVFFS--VKEGQD--IET
Q8LQD2_ORYSJ/11-106-----------------------------------------------------------VKHILLAR--FKEDVA--PER

PF03992

HMOA_BACSU/1-78----------------------------------------------------------MFVQLRKMT-.VKEGFA..DKV
Q930A7_RHIME/30-107----------------------------------------------------------PVIRIAELE-.IDPAQM..AAY
Q9L164_STRCO/44-120----------------------------------------------------------RLRVVLLVE-.VYDGAQ..QQF
Q930L9_RHIME/3-79----------------------------------------------------------DLTNVAYFT-.AKPGRS..GEL
HDOX_LISMO/1-86----------------------------------------------------------MIIVTNTIK-.VEKGAA..EHV
WH42_STRCO/45-121----------------------------------------------------------RVRVVLMLD-.VHDGMQ..QEF
Q8Y476_LISMO/1-77----------------------------------------------------------MLHIQAKVQ-.VKPDLV..AEF
Q98L66_RHILO/1-81----------------------------------------------------------MCIAMNRFK-.VQNGSE..ADF
Q98HA4_RHILO/1-77----------------------------------------------------------MLLIIGTIR-.LAPDRF..EEA
Q9A6W1_CAUCR/113-186----------------------------------------------------------MYGLIGQML-.AAPGKR..DEL
O33291_MYCTU/2-75----------------------------------------------------------PVVVVATLT-.AKPESV..DTV
Q8YAL6_LISMO/1-77----------------------------------------------------------MLHIEAQIT-.VKKEQT..EAF
Q5LR19_RUEPO/12-92----------------------------------------------------------MREVVIVKS-TPQRGKF..NAF
NECA1_HUMAN/251-326----------------------------------------------------------IMLVQRQMS-.VIEEDL..EEF
Q8XYB2_RALSO/23-99----------------------------------------------------------PVVLVNLFL-.LDKADE..EAF
Q9CLF6_PASMU/1-77----------------------------------------------------------MFAMLVEIN-.IKEGKE..QEF
Q8NLF1_CORGL/2-78----------------------------------------------------------SIVKINAIS-.VPEGAG..EEL
O06569_MYCTU/1-77----------------------------------------------------------MIFIVVKFE-.TKPEWT..ERW
Q8NRX5_CORGL/1-76----------------------------------------------------------MHIVNIRFK-.PKAKYV..DTF
Q9I1R9_PSEAE/4-80----------------------------------------------------------AVRVVALLQ-.AREGRA..AEV
Q9I267_PSEAE/43-119----------------------------------------------------------RASHLVSIR-.ARSGQS..HRL
Q9RTW6_DEIRA/23-100----------------------------------------------------------PVLEIAMLN-.VRPGQT..AEF
Q9RXN8_DEIRA/1-77----------------------------------------------------------MITVANRIF-.VNPERA..AAF
Q9FC02_STRCO/14-92----------------------------------------------------------PVVLIKTYT-.VPSEEA..DYF
Q9K649_BACHD/1-78----------------------------------------------------------MFFQVKTLR-.VEEGHS..DKI
Q92MY2_RHIME/1-77----------------------------------------------------------MVYIIAYLT-.AHAGKG..DEV
HDOX_BACHD/1-78----------------------------------------------------------MVIVTNTSK-.ITKGNG..EKL
Q9RX23_DEIRA/3-80----------------------------------------------------------PVSVHAVLT-.PKPEHL..TEV
Q92N21_RHIME/1-81----------------------------------------------------------MYFAMNRFR-.VAAGQE..EAF
NECA2_HUMAN/285-360----------------------------------------------------------LQLVRQEMA-.VCPEQL..SEF
Q8XW80_RALSO/11-88----------------------------------------------------------MIAMTVSLA-.VVPDSG..EAF
Q9HY51_PSEAE/4-80----------------------------------------------------------PLTLIATIT-.AAPGHA..EAL
Q97V29_SULSO/1-78----------------------------------------------------------MINVGFYYK-.VKRGFE..KDF
Y1783_SYNY3/49-125----------------------------------------------------------PIVVAGNIK-.VKPDKK..EEF
A9CGS9_AGRT5/10-86----------------------------------------------------------AVRLSGFLR-CLSEDDV..ELV
Y2021_HALSA/401-477----------------------------------------------------------FGTMGMFYE-.TKPEHT..AEF
Q8UIT6_AGRT5/6-83----------------------------------------------------------PVVRMAEIE-.IDPTHL..EAY
Q8NRX6_CORGL/1-76----------------------------------------------------------MILINVKFK-.PLPEYV..DTF
Q9ABN2_CAUCR/2-78----------------------------------------------------------TLILAGSIR-.IAPERL..AEL
Q9YCC3_AERPE/2-78----------------------------------------------------------AFAIANYIR-.AETPEA.FDKV
Q8TTU6_METAC/1-76----------------------------------------------------------M.KVVAKNQ-.VKPEKI..QEF
Q9X9W3_STRCO/128-214----------------------------------------------------------IVIVDIEFE-GPDPDRQ..RAW
O54100_STRCO/29-106----------------------------------------------------------MSTAVTEFT-.VAAPAQ..GAF
Q9CFE4_LACLA/2-80----------------------------------------------------------TITVNILYQ-.GEGEKA..HLF
Q92Y06_RHIME/4-80----------------------------------------------------------SIKVVARVM-.ITPGNE..DAF
YQJZ_BACSU/12-86----------------------------------------------------------PYYAVIFSS-.VKSEND..TGY
Q8PEE0_XANCP/7-83----------------------------------------------------------PIVVVARWS-.VPASAR..AIV
A9CLL3_AGRT5/1-78----------------------------------------------------------MIYEIAMLP-.VQKDKI..SEF
Q9HYL5_PSEAE/1-78----------------------------------------------------------MYCIFIKAR-.LRPGCA..EAF
Q7CRR7_AGRT5/5-81----------------------------------------------------------AFVVIAEFR-.VKPDAM..DAF
Q9HHS4_HALSA/1-77----------------------------------------------------------MIVVHATFR-.FDPDAR..DDA
Q9I5L9_PSEAE/2-79----------------------------------------------------------TYHVLVQFD-.VPSDKR..EAF
Q8KL47_RHIEC/8-84----------------------------------------------------------EQHLVVEFK-.TTSQNR..NRV
LSRG_ECOLI/1-77----------------------------------------------------------MHVTLVEIN-.VHEDKV..DEF
Q98HP0_RHILO/1-74----------------------------------------------------------MYGLIGKMR-.ASRGQR..DAV
Q8Y824_LISMO/4-80----------------------------------------------------------GYGLLTAFY-.THPGER..DHL
Q9I6L9_PSEAE/2-78----------------------------------------------------------SASQVIRIR-.ARNGQS..ERL
Q9KLV5_VIBCH/1-77----------------------------------------------------------MIHLLAEIK-.AFPDSA..QQV
Q983R7_RHILO/10-88----------------------------------------------------------VITQINVFT-.VPEGGQ..QAL
NECA3_HUMAN/295-370----------------------------------------------------------ILMAQRQVQ-.VAEEGL..QDF
Q8NMA1_CORGL/2-78----------------------------------------------------------SFVNITALT-.FPAGAE..KEI
Q9RSM4_DEIRA/18-94----------------------------------------------------------MVISHGTLS-.ASAEHA..AHL
Y0793_MYCTU/4-79----------------------------------------------------------PVAVIARFM-.PRPDAR..SAL
Q9JYI1_NEIMB/3-79----------------------------------------------------------NIKIVALVT-.VKPEYT..ETL
Q9A6G2_CAUCR/1-78----------------------------------------------------------MIGVVATLK-.VQPAKA..AEF
Q9I1K5_PSEAE/247-321----------------------------------------------------------PYYAVIFSS-.HRSAVD..DGY
Q97DS8_CLOAB/1-78----------------------------------------------------------MVKVVAKNF-.IKEEKI..EDV
Q9CHY3_LACLA/1-77----------------------------------------------------------MIIVNAKFY-.IKEDKK..SQF
A9CJ79_AGRT5/1-77----------------------------------------------------------MIAVIFEVW-.PAEGEK..QHY
Q98DQ1_RHILO/1-77----------------------------------------------------------MIAVIFEVQ-.PAEGRR..DAY
HMOB_BACSU/65-140----------------------------------------------------------GFAVLNNIA-.VTQEGR..PLF
YCZJ_BACSU/1-78----------------------------------------------------------MVREAAMLH-.IKEGLE..QEF
Q9RSI3_DEIRA/10-86----------------------------------------------------------PVSLVIRRR-.IRPGKE..AEY
Q92VV2_RHIME/1-77----------------------------------------------------------MLIQMVSIN-.VKQGHA..ADF
Q8RDZ4_FUSNN/112-188----------------------------------------------------------TFAVYTVID-.VKPEND..KEF
A9CHT4_AGRT5/1-79----------------------------------------------------------MFIAMNRFR-.VVPGYE..ETF
Q9RKA2_STRCO/1-77----------------------------------------------------------MIFITAKFR-.VLPEHA..DQW
Q9ZBJ4_STRCO/2-77----------------------------------------------------------TYGCIASMK-.TRPGFR..EEV
Q9RX69_DEIRA/1-77----------------------------------------------------------MITVMNRIG-.VKPEFA..AQF
YCNE_BACSU/1-77----------------------------------------------------------MIVLQAYIK-.VKPEKR..EEF
A5FGC9_FLAJ1/1-73----------------------------------------------------------MFVRIVKMS-.FHEEKI..PDF
A9WHE0_CHLAA/1-72----------------------------------------------------------MYGLIGKMR-.ATPGQR..DAL
H7C6P0_BRADU/1-79----------------------------------------------------------MFIAMNRFQ-.VKKGAE..TAF
YGIN_ECOLI/1-87----------------------------------------------------------MLTVIAEIR-.TRPGQHHRQAV
MHUD_MYCTU/3-76----------------------------------------------------------.VVKINAIE-.VPAGAG..PEL
Q2FV13_STAA8/45-118----------------------------------------------------------..CVLNHLY-.INEGQE..ETF
HDOX1_STAA8/3-78----------------------------------------------------------.FMAENRLT-.LTKGTA..KDI
HDOX2_STAA8/1-77----------------------------------------------------------MFMAENRLQ-.LQKGSA..EET
Q2K560_RHIEC/1-80----------------------------------------------------------MYIAMNRFK-.VVTGTE..GDF
Q2YKI2_BRUA2/1-80----------------------------------------------------------MFIAMNRFK-.VRIGSE..TDF
Q2YLT4_BRUA2/1-77----------------------------------------------------------MIAVIFEAW-.VPGEAQ..TEY
Q79ZD9_STRAW/18-90----------------------------------------------------------..RVVLLLD-.LHDGAQ..KQF
Q8CZ78_STRR6/12-86----------------------------------------------------------.LTIHVYYK-.GDGDSA..IKF
X2H731_9GAMM/1-76----------------------------------------------------------MIAVIFEVQ-.IQPDQQ..TRY

PF11695

Q9A5F4_CAUCR/31-168-----------------------------------------------------------LAQVNVGR.LKAP.ID--HPM
F8EE97_RUNSL/6-145-----------------------------------------------------------LAEINIAR.MKGVNIN--DPI
A4XU80_PSEMY/15-152-----------------------------------------------------------LAQLNIAW.MKAS.LE--SPE
G8TAU1_NIAKG/5-143-----------------------------------------------------------LAQINIGK.MLAP.ID--SSV
Q0RPH8_FRAAA/6-148-----------------------------------------------------------LAQVNIAR.VLAP.LD--SPA
Q0RBQ9_FRAAA/10-153-----------------------------------------------------------LAQVNIAR.LRAP.LD--DPI
G0FWI4_AMYMS/6-149-----------------------------------------------------------LAQVNISR.MKAP.LD--DES
E0TC84_PARBH/7-144-----------------------------------------------------------LAQVNIGR.VLGG.PD--APA
Q9XAE9_STRCO/9-147-----------------------------------------------------------LAQVNIAR.LKAP.LD--SPQ
U5W6J8_9ACTO/6-143-----------------------------------------------------------LAQLNVAR.LRAP.LD--SPV
C6WHE5_ACTMD/7-164-----------------------------------------------------------...TTFAI.LKKP.YG--DPE
Q0APS8_MARMM/5-139-----------------------------------------------------------LAQLNIAW.MRGS.ID--DPV
Q163R1_ROSDO/8-148-----------------------------------------------------------LAELNVGR.LAAP.TD--DPR
E4N6J1_KITSK/26-165-----------------------------------------------------------LAQVNIGR.TVAP.LD--SPA
I2EVC9_EMTOG/6-144-----------------------------------------------------------LAQVNISK.LLAP.ID--SPL
G0L103_ZOBGA/6-144-----------------------------------------------------------LSQVNIAR.MLAP.ID--SPV
M4ZXH9_9ACTN/6-146-----------------------------------------------------------LAQLNLGL.LRAP.LD--TDE
D2QP51_SPILD/3-141-----------------------------------------------------------LAQLNISR.MLAPDIN--HPI
A1WRH2_VEREI/5-143-----------------------------------------------------------FAQFNVAW.LKKP.LD--HPD
K0EXQ7_9NOCA/7-138-----------------------------------------------------------LAQANILY.AVDS.LK--SET
U5QGK2_9CYAN/8-146-----------------------------------------------------------LAQFNIGR.MKGS.LD--SPV
S6AKH1_PSERE/7-144-----------------------------------------------------------LAQLNIAV.MQAP.LD--SPA
I0K5K2_9BACT/3-141-----------------------------------------------------------LAQINIGR.LIAP.LD--TPA
D2ATU4_STRRD/6-142-----------------------------------------------------------LAQLNIAH.MRAP.KD--SPE
M4XI80_PSEDE/7-145-----------------------------------------------------------LAQVNIAK.ARAP.LD--QPL
Q027R7_SOLUE/5-143-----------------------------------------------------------LAQVNIGR.ILHP.ID--DPR
A4FAH4_SACEN/6-145-----------------------------------------------------------LAQVNIAL.PVAP.MD--SAE
E2Q5L4_STRC2/8-147-----------------------------------------------------------LAQVNIGR.RKYA.LD--APE
E3J464_FRASU/10-153-----------------------------------------------------------LAQVNIAR.LLEP.LD--SPR
B0T5Z4_CAUSK/7-144-----------------------------------------------------------LAQVNFGR.LRAP.VD--HPM
F4KSW9_HALH1/6-143-----------------------------------------------------------LAQINIAR.LIAP.ID--DPL
K0C7N6_ALCDB/6-143-----------------------------------------------------------IAQLNIAT.LLAP.ID--SPQ
I0HGL4_ACTM4/6-144-----------------------------------------------------------LAQINTAR.LLAP.LE--DPS
Q0BYF9_HYPNA/5-155-----------------------------------------------------------LVHFNCVRPLGAFALD--NPY
C7QH43_CATAD/16-156-----------------------------------------------------------LAQVNIGR.LVAP.LG--DPA
D6X6B2_STRPR/13-151-----------------------------------------------------------LAQVNIGR.LKHP.LD--SPQ
G8SIB6_ACTS5/6-144-----------------------------------------------------------LAQINTAR.LRAP.LA--DPS
B9JB79_AGRRK/2-147-----------------------------------------------------------...YNFGL.HVAP.YE--SPE
B9JTF5_AGRVS/7-155-----------------------------------------------------------LALYNFGL.HVAP.SG--DPA
A9B229_HERA2/6-143-----------------------------------------------------------LAQLNIGT.IKAP.LD--TPL
R4LEJ6_9ACTO/5-162-----------------------------------------------------------.ALYTFG..LIDP.AL--DPD
D7B9L7_NOCDD/15-153-----------------------------------------------------------LAQINVGI.LKAP.LD--DPS
F4AZ85_KROS4/5-144-----------------------------------------------------------LAQVNVAR.MKGVSIN--DPE
V9VXL5_9RHOB/7-167-----------------------------------------------------------LAFMTFSV.LKAP.YG--DPS
C5BJX2_TERTT/5-143-----------------------------------------------------------LAQVNIAK.FRLP.QD--HPV
M9R7J4_9RHOB/3-143-----------------------------------------------------------LAELNIGR.LLAP.TD--DPR
F3ZD85_9ACTO/31-189-----------------------------------------------------------L..YTFGV.LKSP.LA--DPG
A1K291_AZOSB/3-140-----------------------------------------------------------LAELNVAR.LLAP.ID--SPQ
H2JWD5_STRHJ/4-164-----------------------------------------------------------LALYTFGV.LKSP.LA--DPA
S5VG62_STRCU/12-150-----------------------------------------------------------LAQLNVAA.LTHP.LD--DPR
Q2JDS7_FRASC/6-148-----------------------------------------------------------LAQVNIAR.LLAP.PG--SSA
Q15UR5_PSEA6/3-141-----------------------------------------------------------LAQLNIAT.TLYP.ID--APE

PF07682

C7LRC9_DESBD/11-306---------------------------------------------------------.IYVALNMSK--VVNNEE-----
L0DXR4_THIND/8-328---------------------------------------------------------GAALAINQAA--VANDPQ-----
F8I6C7_SULAT/3-301---------------------------------------------------------VPYIAVNKAR--VLNAPS-----
O66762_AQUAE/8-332---------------------------------------------------------GVAVAINKAK--VNNTPR-----
Q6L0W6_PICTO/3-301---------------------------------------------------------KPYVAINIVE--MLNNET-----
F4B4D5_ACIHW/1-294---------------------------------------------------------.......MAE--LKNEPK-----
G0JQP4_9GAMM/4-306---------------------------------------------------------NPIIAINQAK--IFNRPE-----
D0L035_HALNC/5-309---------------------------------------------------------NPIIAINMAK--IANKPD-----
L0DTB9_THIND/25-315---------------------------------------------------------.LYVAINRVL--VENNPN-----
Q972K4_SULTO/3-303---------------------------------------------------------KPYVAINMVE--VRNDPK-----

PF07978

Q7PGV6_ANOGA/173-270----------------------------------------------------------YE..IRSYR--LKPGTM--IEW
Q7SGJ2_NEUCR/232-329----------------------------------------------------------FE..LRSYT--LHPGNL--LEW
Q5LMH4_RUEPO/1-102----------------------------------------------------------MLTCIIRYH--IDPTKR--AQF
Q6W252_RHISN/3-102----------------------------------------------------------YE..IRTYR--LKNGAI--PAY
Q98EJ3_RHILO/1-102----------------------------------------------------------MITCYLKYV--IDPYKL--AEF
Q89P12_BRADU/7-101----------------------------------------------------------VD..LRVYT--IRLRKM--AEF
Q89KU9_BRADU/3-106----------------------------------------------------------YE..MRVYR--CVPGRL--PAL
Q82QD1_STRAW/4-107----------------------------------------------------------YQ..LRVYT--LRSPEA--LVA
NIPS2_MOUSE/182-279----------------------------------------------------------YE..LRSYQ--LRPGTM--IEW
Q98DQ0_RHILO/2-103----------------------------------------------------------TITCFIRYE--IDPFGK--AAF
Q98IN9_RHILO/48-151----------------------------------------------------------YE..LRIYD--CLPGRL--PAL
Q89JD9_BRADU/9-109----------------------------------------------------------SVTVFIRYQ--LDPFKR--AQF
Q5M949_RAT/37-136----------------------------------------------------------YE..FRTYS--LKPSKT--NAF
Q7VX89_BORPE/3-102----------------------------------------------------------IE..ERDYR--IKPGKA--GLF
Q983U2_RHILO/146-257----------------------------------------------------------VV..IRIHH--LRSGAE--TEF
NIPS1_MOUSE/185-282----------------------------------------------------------YE..LRTYK--LKPGTM--IEW
Q88JP3_PSEPK/3-104----------------------------------------------------------YE..LRTYT--LDPLKM--ADW
Q6C7U3_YARLI/393-490----------------------------------------------------------FE..LRTYD--LKPGKL--MEW
Q5M949_RAT/146-245----------------------------------------------------------YE..LATFQ--MKPGGP--ALW
Q89P26_BRADU/3-96----------------------------------------------------------YE..IATLT--VKLGTA--AKA
Q89P26_BRADU/107-202----------------------------------------------------------YE..IRTYR--LKHGGV--PPT
Q983U2_RHILO/19-118----------------------------------------------------------VE..LRQYT--LNPGQR--ETL
A9CLJ4_AGRT5/3-102----------------------------------------------------------VE..ERIYR--IRGGKM--QEY
NPS3A_PONAB/37-136----------------------------------------------------------YE..FRSYY--LKPSKM--NEF
A9CJ80_AGRT5/1-102----------------------------------------------------------MLTCFIRYE--IDPFKV--DAF
YMQ1_CAEEL/427-524----------------------------------------------------------YD..LRSYV--LQPGTM--IDW
Q63UF8_BURPS/3-102----------------------------------------------------------YE..IRTYR--VKTGAV--LAY
Q6N5T9_RHOPA/71-174----------------------------------------------------------YE..SRVYR--CVPGKL--PAI
Q7UP06_RHOBA/160-263----------------------------------------------------------YE..LRLYE--SANERL--GDL
A6VZH8_MARMS/5-99----------------------------------------------------------....YVRYV--IDPKKV--REF
F1QWR0_DANRE/62-160----------------------------------------------------------YE..FRTYY--IQPHLN--AAF
F6W3L2_XENTR/18-115----------------------------------------------------------YE..FRTYT--VKPAMM--SDF
Q0P468_DANRE/179-276----------------------------------------------------------YE..LRSYQ--LLPGTM--IEW
Q2YLT3_BRUA2/5-100----------------------------------------------------------....VITYD--IDPNRQ--ELF
S6AQW2_PSERE/106-203----------------------------------------------------------YE..LRVYD--LVPAGL--APT

PF07237

B5GYT2_STRC2/1-95----------------------------------------------------------MYLVVYLHR--VPRSRE--EVF
Q28SF7_JANSC/2-97----------------------------------------------------------TYVDGFILP--VKTARK--DDY
B9J727_AGRRK/3-103----------------------------------------------------------.YVDGFILA--VPKDKI--EAY
Q8PBE1_XANCP/2-103----------------------------------------------------------SYIDGFVLA--VPTANK--EKF
D2R596_PIRSD/2-117----------------------------------------------------------TYFDCFLAP--VPRDNR--AAY
J7QVW7_METSZ/2-102----------------------------------------------------------SYVDGFVIP--VPAENK--EAY
Q0C3F1_HYPNA/123-216----------------------------------------------------------.YIDGTVIP--VPADKR--GAY
Q1D7D3_MYXXD/125-223----------------------------------------------------------.YVDGSLVP--VPVGNK--EAY
V5S991_9RHIZ/2-103----------------------------------------------------------TYVDGFVLA--VPAANK--QAY
G8ATI6_AZOBR/2-107----------------------------------------------------------AYIDGFVIA--VPTANK--QAF
A6X0L9_OCHA4/2-103----------------------------------------------------------AYIEGFVVA--VPKANK--ELY
K0CB81_ALCDB/2-104----------------------------------------------------------NYVDGFLLP--LPKEDL--DAY
K9SFX5_9CYAN/2-103----------------------------------------------------------HYIDGCVLA--VPIGNK--DIY
Q0ANC9_MARMM/2-101----------------------------------------------------------AYVQGYVAA--VPDENR--DAF
Q82XJ8_NITEU/2-114----------------------------------------------------------TYVDGFVLP--VPEGKI--DAY
X4ZS72_9BORD/3-104----------------------------------------------------------EYVDGYVLA--IPSDKL--ETY
E3F379_KETVY/2-102----------------------------------------------------------TYYSGTLIA--VPTASK--EIY
B2FL05_STRMK/2-104----------------------------------------------------------AYVDAYVLP--CPQDKV--AAY
Q89NE4_BRADU/4-102----------------------------------------------------------.YVDGFVLA--VPKDKI--EAY
Q2NCG7_ERYLH/1-101----------------------------------------------------------MYIQGFLVP--VLSGKK--DAY
F6IFW1_9SPHN/2-103----------------------------------------------------------TYVEGFVIA--VPIANK--ASF
A4YT03_BRASO/13-113----------------------------------------------------------MYIAGFVIP--VPAEKL--EAY
B8EQ30_METSB/3-103----------------------------------------------------------.YVDGFVLA--VPKEKI--EDY
G2IQJ1_9SPHN/7-107----------------------------------------------------------MYVAGLVIP--VPEARM--DAY
B8IJU9_METNO/2-103----------------------------------------------------------TYVDGFVIA--VPKDRI--EDY
C7RAK3_KANKD/4-105----------------------------------------------------------.YIDGYVLP--VPKDKL--DEY
I3U9U4_ADVKW/2-103----------------------------------------------------------KYVDGFVAA--VPTANR--EAY
A1W852_ACISJ/5-103----------------------------------------------------------SYIDGFVLA--VPTANK--ETF
A9FY32_SORC5/2-103----------------------------------------------------------SYVDGFVVP--VPAGKK--QAY
W0AJL6_9SPHN/125-224----------------------------------------------------------.YADGYLVP--VPEGKK--EAY
I4B2R6_TURPD/2-101----------------------------------------------------------SYIDGFVIP--VPLAKK--DAY
I0HMS9_RUBGI/2-107----------------------------------------------------------SYVDGFVIA--VPTANK--QQF
Q89LX7_BRADU/1-101----------------------------------------------------------MYIAGFVIP--VPEDKM--EAY
M4S0F5_9SPHN/3-103----------------------------------------------------------.YVDGYVLA--VPVEKI--DEY
S6AFX9_PSERE/2-103----------------------------------------------------------TYVDGFVVP--VPTANC--EAY
D7A8V6_STAND/2-103----------------------------------------------------------SYVDGFVLA--VPTAKK--DDY
Q21G53_SACD2/2-103----------------------------------------------------------TYIDGFVAA--VPTANK--DKY
C7R6A1_KANKD/1-102----------------------------------------------------------MYVDGFVAA--VPVANR--QAY
B2JM74_BURP8/2-103----------------------------------------------------------NYVDGFVLA--VKAENR--DLY
E1V408_HALED/2-103----------------------------------------------------------TYVDGFVAA--VPTANR--EKY
Q92NA2_RHIME/2-103----------------------------------------------------------AYVDGFLVA--VPTANI--EAY
C5CJX4_VARPS/4-105----------------------------------------------------------.YVDGFIVP--IPSNNI--EAY
F5XY16_RAMTT/2-117----------------------------------------------------------SYIDCFLAP--VPSANR--SEY
A1B4H4_PARDP/2-102----------------------------------------------------------TYYSGFLLP--VPTANK--QKY
A7HVY2_PARL1/2-102----------------------------------------------------------SYVEGFLVA--VPAANK--ELY
I3TII5_TISMK/5-105----------------------------------------------------------.YVDGFVAA--VPTTAR--EAF
Q09CK7_STIAD/2-103----------------------------------------------------------KYVEGFVAA--VPAANK--EMY
D0J6R4_COMT2/2-106----------------------------------------------------------SYIDGFVIA--VPTANK--QKF
B6ITX3_RHOCS/21-122----------------------------------------------------------TYVDGFVLA--VPRAKL--DAY
Q0C3F1_HYPNA/2-102----------------------------------------------------------TYVSGFLLA--VPTANK--DAY
G8R5I7_OWEHD/3-96----------------------------------------------------------NYIDGFMLP--IPRKHL--HEY
N0B831_9RHIZ/2-103----------------------------------------------------------AYVDEFVVA--VPEKSI--ADY
A9C096_DELAS/2-104----------------------------------------------------------HYIDGFVLP--VPRANL--QAY
B2ID24_BEII9/3-104----------------------------------------------------------NYVEGFVAA--VPAANK--EAY
Q0K872_CUPNH/2-103----------------------------------------------------------SYIDGFVLA--VPQATR--ETY
F7QJ30_9BRAD/2-105----------------------------------------------------------QYVDGFVLP--VPKKNL--KAY
G2IQA6_9SPHN/2-100----------------------------------------------------------TYVDGFLCP--VKPGRK--ADY
B3PD68_CELJU/3-105----------------------------------------------------------HYVDGFLLP--IAPEKL--TEY
A9IUP3_BORPD/4-105----------------------------------------------------------QYVDGFLLA--IPKDKL--DTY
E6WPA7_PSEUU/2-104----------------------------------------------------------AYVDGFVLP--VPKDRI--DDY
Q984U4_RHILO/2-103----------------------------------------------------------NYIAGFVAA--VPAASK--EAY
B4RHI4_PHEZH/3-103----------------------------------------------------------.YVDGFVLA--VPKANL--EAY
B2ID24_BEII9/126-226----------------------------------------------------------.YTDGFVLA--VPSVNK--EAY
Q15TI8_PSEA6/2-104----------------------------------------------------------SYIDGFVVA--VPSANK--EEY
F8J4V4_HYPSM/2-103----------------------------------------------------------SYVDGFVVP--VPFERL--KDY
Q12MS1_SHEDO/2-103----------------------------------------------------------SYMDGFVAA--VPTANK--DKY
G8MEM7_9BURK/3-106----------------------------------------------------------HYVDGFVVP--VPIDKI--DAY
R9VVL6_9ENTR/2-103----------------------------------------------------------KYVDGFVVA--VPADQK--EAY
D0LSP9_HALO1/2-102----------------------------------------------------------SYVDGFIIP--VPRENK--EAY
E8RPL4_ASTEC/2-103----------------------------------------------------------SYVDGFLIP--VPKENR--AAY
Q7VWQ1_BORPE/3-103----------------------------------------------------------QYVDGFLLS--VPNDKL--DTY
C7NJF5_KYTSD/19-131----------------------------------------------------------...DVTMVP--VAVNQR--EAY
A9WHX6_CHLAA/3-114----------------------------------------------------------.YFDFYLVP--VPIENK--TAY
W0AJL6_9SPHN/2-103----------------------------------------------------------TYVEGFVAA--VPAANK--QAY
B1ZRB2_OPITP/3-106----------------------------------------------------------KYVDGFVLP--VPKKNL--AAY
K9UEC3_9CHRO/2-102----------------------------------------------------------TYVDGFVIA--VPTANR--AAY
Q984U4_RHILO/125-217----------------------------------------------------------.YIDGSLVP--VPIANK--AAY
D4Z3X9_SPHJU/2-103----------------------------------------------------------SYMDGFVIP--VPKGNK--ERY
G4RAE0_PELHB/3-101----------------------------------------------------------.YIEGFVAA--VPTANK--EVY
K9RSJ8_SYNP3/2-117----------------------------------------------------------TYIDFYLVP--VPCENK--SAY
A8AJZ2_CITK8/2-103----------------------------------------------------------KYVDGFVVA--VPAENK--EAY
A7HVY2_PARL1/124-224----------------------------------------------------------.HIDGYVLA--VPKANK--EAY
E0TG43_PARBH/2-101----------------------------------------------------------TYYDFAVTA--VPAANR--EAY
A5V8A2_SPHWW/3-103----------------------------------------------------------.YVDGFIVA--VAKDKL--DDY
W6RB51_9RHIZ/2-103----------------------------------------------------------SYVDGFVVA--VPQKNM--EAY
E1WZE7_BACMS/3-105----------------------------------------------------------NYVDGFIAP--VPKKNL--DAY
E3HXD2_ACHXA/3-103----------------------------------------------------------KYVDGFLLP--VPKANL--ETY
E3F379_KETVY/124-225----------------------------------------------------------.YIQGFVLA--VPASNK--IAY
Q3J6F6_RHOS4/3-101----------------------------------------------------------.YVDGFVCA--VPVENR--QKY
C6XML8_HIRBI/2-102----------------------------------------------------------TYVTGFLLP--VPKKNK--DRY
D2S2U1_HALTV/4-110----------------------------------------------------------.YVDGFVLP--VPNDKL--DSY
B8IGF6_METNO/2-102----------------------------------------------------------AYVEGFALA--VPHANR--QTY
B6JDI6_OLICO/2-105----------------------------------------------------------QYVDGFIVP--VPKKNL--TAY
Q6MH99_BDEBA/3-105----------------------------------------------------------KYVDGFVLT--VPKKNM--AQY
Q1GX81_SPHAL/125-226----------------------------------------------------------.YVDGFVAP--VPDANK--DRY
Q1GX81_SPHAL/2-103----------------------------------------------------------TYVEGFVVA--VPTANK--DAY
F5Y4J2_RAMTT/2-105----------------------------------------------------------NYIDGFVAA--VPTANR--QLY
Q98HZ3_RHILO/2-103----------------------------------------------------------SYVDGFVLA--VPKAKL--DDY
E8RPL3_ASTEC/12-111----------------------------------------------------------TYVDGFVCP--VKAENR--DAY
M4NEX2_9GAMM/2-102----------------------------------------------------------SYVDGFVIA--VPDANR--EQF
U4KCB2_9VIBR/2-103----------------------------------------------------------SYVDGFAAA--VPQENK--QKY
M4VN50_9DELT/3-103----------------------------------------------------------KYVDGFVIK--VKKKNM--PAY
B8GIK1_METPE/2-107----------------------------------------------------------KYVDGFVLV--VPDEKL--ADY
Q11C17_CHESB/2-101----------------------------------------------------------AYVDGFIIP--LPNDRV--DDY
D3SAH4_THISK/2-95----------------------------------------------------------NYVDGYVIP--IPRDRI--EDY
K4KKH1_SIMAS/2-104----------------------------------------------------------SYVDGYVLA--VPLKNK--TQY
Q1D7D3_MYXXD/2-103----------------------------------------------------------AYIDGFVIA--VPSANK--EAY
W0JAW7_9BACT/3-105----------------------------------------------------------HYVDGFVIP--VPKKNI--AAY
H5WRE5_9BURK/2-103----------------------------------------------------------NYVDGFVTP--VPVANR--QAY
D9QND0_BRESC/3-101----------------------------------------------------------.YVSGFLTP--VKAQDK--DRY
E3I2U0_RHOVT/2-102----------------------------------------------------------TYVEGFLLA--VPASKK--DAY
B0T2P9_CAUSK/2-103----------------------------------------------------------SYVDGFVIA--VPKAKI--EDY
A7HS11_PARL1/2-103----------------------------------------------------------AYVDGFVLP--VPKKNL--DAY
A1U2N5_MARAV/2-103----------------------------------------------------------SYIDGFVAA--VPTANK--EKY
A2SLW6_METPP/28-129----------------------------------------------------------NYVDGFVLA--VPTAQR--EAY

PF05336

E8N7B3_MICTS/3-106----------------------------------------------------------RFASVIGVS--..PENR--EEY
G8NW33_GRAMM/3-106----------------------------------------------------------RYAQVIQLR--..AEDE--AEY
R6A9X3_9BACT/17-125----------------------------------------------------------RFCQTLDLK--NEPELI--AAY
Q2G5L0_NOVAD/2-105----------------------------------------------------------REVFMLDLA--.DEALA--AAY
E3J5G6_FRASU/3-105----------------------------------------------------------RYCFLLTVR--..PELL--DEY
RHAM_CLOB8/3-103----------------------------------------------------------QKAFKMKLF--..EGKE--EEY
F3Y8K3_MELPT/17-117----------------------------------------------------------KKAIRMKLY--..PECK--EVY
D1BAI9_SANKS/1-101----------------------------------------------------------.MCFVSQVD--..PARL--DEY
R6EFZ5_9FIRM/3-103----------------------------------------------------------KYAWRGKIV--..PGMQ--EEY
E8V1U4_TERSS/3-109----------------------------------------------------------RYCFVLDLR--PDPVLI--AEY
Q8A1J5_BACTN/18-126----------------------------------------------------------RYCQTLSLK--NNPILI--EEY
G8UKT9_TANFA/3-106----------------------------------------------------------RYGSIIGVR--..PEKL--EEY
R7BFW5_9FIRM/6-107----------------------------------------------------------KYAWTWKVK--..PECL--DEY
C6VV82_DYAFD/7-106----------------------------------------------------------.KAFRMQLK--..PGFE--AEY
X2H2T6_9GAMM/3-103----------------------------------------------------------RKATIMQVH--..PDKH--AEY
X6NJ28_RETFI/26-133----------------------------------------------------------RYGSIIGLK--..PEKE--QYY
RHAM_ROSDO/4-104----------------------------------------------------------RYVFRMRLN--..PGKQ--AEY
R6NFT0_9BACE/3-109----------------------------------------------------------RYCQTLDLY--DDKELI--EAY
C6Y2X4_PEDHD/3-103----------------------------------------------------------KIAFKMKLL--..PGVK--AEY
M9R5B0_9RHOB/4-104----------------------------------------------------------RYVFRMCLN--..DGMA--DEY
D8MRW2_ERWBE/3-103----------------------------------------------------------RKAFVMQVH--..PDKH--QEY
S6C4A1_9ACTN/4-102----------------------------------------------------------..TFKMKLY--..PGME--EEY
R7J4V8_9PORP/3-106----------------------------------------------------------RVGSIIEVR--..PEKL--EEY
L0G2V5_ECHVK/4-110----------------------------------------------------------RYTMALDLK--DDPTLI--AEY
R6YJI9_9BACE/3-109----------------------------------------------------------RFCQTMDLY--DDPELI--AAY
D7CRS7_TRURR/5-108----------------------------------------------------------RVGFVLKVK--..SELL--EQY
M4WU28_PSEDE/4-110----------------------------------------------------------RHCLALDLA--DDPQLI--AQY
E8WVL5_ACISM/3-109----------------------------------------------------------RFCLALDLR--PDPLLQ--EQY
R5F8H2_9CLOT/21-121----------------------------------------------------------RKGFKMFLN--..PGMA--EEY
Q017X5_OSTTA/20-125----------------------------------------------------------TYAQTIELR--..ADGV--EEY
V2XST4_MONRO/8-118----------------------------------------------------------RICQIIKLK--..PAAE--AEY
RHAM_BURXL/3-103----------------------------------------------------------TIAFRMVLN--..PGMR--EEY
D3FCI7_CONWI/3-103----------------------------------------------------------RVCFTFEIH--..PGTE--AEY
F5YG46_TREAZ/3-104----------------------------------------------------------RFVWKARLL--..PGKR--EEY
X5DE39_9BACT/3-103----------------------------------------------------------RIAFKMYLN--..EGQK--EEY
C7MF49_BRAFD/3-102----------------------------------------------------------RIALHTRIA--..EGRE--ADY
A6KWX7_BACV8/17-125----------------------------------------------------------RYCQTMDLK--DDPELI--AKY
G2R0M2_THITE/36-147----------------------------------------------------------RFAQIVKLK--..PEFV--DKY
R5CS86_9BACT/17-125----------------------------------------------------------RYCQTMRLK--DDAELI--RKY
R5GT53_9BACT/20-128----------------------------------------------------------RYCQTLDLR--DEPALI--AEY
U5VPP9_9ACTO/2-101----------------------------------------------------------RYCFHLQVR--..EDRI--AEY
D1AQR2_SEBTE/6-106----------------------------------------------------------RFGSVSKVK--..PEKL--EYY
F0RIC4_CELLC/5-113----------------------------------------------------------RYCYSCDLK--NDSKLI--EEY
H1YCQ6_9SPHI/3-103----------------------------------------------------------RRAFKMKLF--..PGYT--EEY
RHAM_RHISN/3-103----------------------------------------------------------KYAFRMRLN--..PGMA--EEY
M3CIR2_SPHMS/7-117----------------------------------------------------------RIAQIVRLK--..RESL--QAY
H6MRG6_GORPV/6-114----------------------------------------------------------RVCLVMRLR--..PDRI--DDY
R6W2E5_9BACT/17-125----------------------------------------------------------RFVQTMQLK--DDSELM--KEY
H1W373_COLHI/35-146----------------------------------------------------------RIGQIVKLK--..PEFV--DKY
B7FV54_PHATC/57-181----------------------------------------------------------RYGAAIRLH--..PEAY--RRY
R6RUK4_9BACE/17-125----------------------------------------------------------RYCQTMDLK--DNPELI--AEY
G0FMG2_AMYMS/3-105----------------------------------------------------------RYCFCLQVK--..PDRK--AEY
C6XPT9_HIRBI/4-112----------------------------------------------------------RVCLALDLV--DDQELI--SAY
RHAM_FLAJ1/6-106----------------------------------------------------------RNAFTMKVK--..SGFE--TEY
RHAM_DINSH/3-103----------------------------------------------------------KIAFKMMLN--..PGCR--EEY
E8V2R3_TERSS/3-104----------------------------------------------------------RVAFQLCIK--..EGCE--QAY
Q8A896_BACTN/19-127----------------------------------------------------------RYCQTLDLR--DSPELI--AEY
G8MFN0_9BURK/3-103----------------------------------------------------------TVAFRMTLK--..PGMR--EEY
Q7CW72_AGRT5/3-108----------------------------------------------------------RMGMVIGVK--..PEMI--AEY
L8GD23_PSED2/77-185----------------------------------------------------------RIAQIVKLK--..PEFV--EQY
M2SXV3_COCH5/9-120----------------------------------------------------------RIAQWLYLK--..PEAI--DEY
T2KM13_9FLAO/3-103----------------------------------------------------------RLAFKMKLN--..KGQK--QAY
F2RHJ8_STRVP/6-108----------------------------------------------------------RVCFLLKVR--..AGRV--EEY
N1PM30_MYCP1/6-116----------------------------------------------------------RVAQIVRIK--..RESI--SAY
Q9HK61_THEAC/2-100----------------------------------------------------------RYAFHLRLK--..EGSE--EEY
A4AQM8_MARSH/3-108----------------------------------------------------------RHCLALDLK--NDIELI--SAY
C4Z7U2_EUBE2/3-103----------------------------------------------------------RKAFKMYLK--..AGCA--DEY
C6XTA6_PEDHD/3-103----------------------------------------------------------RIAFKMTLL--..EGHV--DEY
W0F136_9SPHI/3-111----------------------------------------------------------RFCLTLDLK--NDPELI--KTY
Q5LC58_BACFN/3-109----------------------------------------------------------RYCQTLELY--NDSELI--RAY
I0IAI8_PHYMF/3-105----------------------------------------------------------RHCFTLQVR--..PDRL--DDY
J0WX79_AURDE/7-117----------------------------------------------------------RIAQVIKLR--..PEHL--EEY
R6LCZ2_9BACE/19-127----------------------------------------------------------RICRTLELR--DDPQLI--AEY
R6SDC5_9BACE/16-124----------------------------------------------------------RYCQTLDLK--NDPELI--RTY
R6ARE3_9BACT/15-123----------------------------------------------------------RYVQWLELE--SDEEAI--REY
W0HYB7_9ENTR/6-109----------------------------------------------------------RFGGVIKVK--..PEKY--AYY
B2JWP2_BURP8/2-109----------------------------------------------------------RYCLALDLK--DDPILI--ARY
RHAM_VEREI/5-105----------------------------------------------------------KVAFRMFLI--..PGCA--AEY
R7JMG1_9PORP/19-127----------------------------------------------------------RYCQMLDLK--NDPQLI--AEY
W0EWF3_9SPHI/3-103----------------------------------------------------------RLAFKMKLF--..KGLE--SEY
G2PEQ1_STRVO/2-106----------------------------------------------------------RVALHSVLK--..EGQE--SGY
I2ETX1_EMTOG/3-109----------------------------------------------------------RYTLALDLV--DDPQLI--AEY
S0DRY9_GIBF5/8-120----------------------------------------------------------RFAQIIKLK--..PQHI--EKY
W5VZF1_9PSEU/4-102----------------------------------------------------------TIALHTRLK--..PGCE--AEY
F0SAK4_PEDSD/3-109----------------------------------------------------------KYCLALDLV--DDPPLI--KEY
RHAM_ENTFA/3-103----------------------------------------------------------KKAFCMQVY--..PDQH--AEY
C1D3L6_DEIDV/10-112----------------------------------------------------------RVCFLLQVR--..PDRL--TEY
D3AYF8_POLPA/5-111----------------------------------------------------------.FAQALDLK--NDAELI--EEY
Q63M67_BURPS/2-109----------------------------------------------------------RYCLALDLK--DDPDAI--ARY
G3B870_CANTC/9-119----------------------------------------------------------RICQIVKLK--..PEYL--EEY
G8TJY9_NIAKG/2-108----------------------------------------------------------RYCLALDLV--DDAAMI--ADY
A9WV51_RENSM/8-106----------------------------------------------------------RIALHTKLQ--..PGKE--LAY
F8ENG6_RUNSL/3-109----------------------------------------------------------RYCLALDLK--DDPTLI--AEY
G0FVD6_AMYMS/4-107----------------------------------------------------------RYGMLIRLR--..PERR--EEY
C7Q375_CATAD/3-106----------------------------------------------------------RIAQVARLL--..PELR--EQY
C6CYW6_PAESJ/6-107----------------------------------------------------------KFAWTWKIK--..EEML--EEY
C7PCA4_CHIPD/3-109----------------------------------------------------------RYCLALDLV--NDPVLI--AEY
T0N5S5_9EURY/2-100----------------------------------------------------------RYAFHLTIR--..NGME--DEY
Q0C0B4_HYPNA/3-108----------------------------------------------------------RKAMMIRLN--..PEKM--EEY
G8TRD5_NIAKG/34-141----------------------------------------------------------RYGMITGVK--..PEKL--DYY
B5HUQ0_9ACTO/3-106----------------------------------------------------------RIAQTIRLR--..PEHR--EEY
C9SC44_VERA1/35-148----------------------------------------------------------RIAQIVKLK--..PEFL--EEY
U5HAV4_USTV1/5-115----------------------------------------------------------RVCQIIRIK--..PDRL--DEY
C1E6C4_MICSR/5-111----------------------------------------------------------.YAQTICLK--NDPRGI--EEY
S0ART8_FERAC/2-99----------------------------------------------------------RYFFKLSIN--..PADK--ELY
D8J110_HERSS/4-109----------------------------------------------------------..VLALDLK--DDAELI--AQY
H1XZT2_9SPHI/4-110----------------------------------------------------------QYCLALDLV--DDVTLI--AAY
F1A024_DICPU/9-113----------------------------------------------------------.FAQALDLK--NDKELI--DEY
A0M226_GRAFK/6-114----------------------------------------------------------RLCYSCDLK--DDPQLI--EKY
H1YA87_9SPHI/12-120----------------------------------------------------------RYCKTMELR--NDPALI--EAY
A1WK61_VEREI/3-108----------------------------------------------------------RHGAVIGIR--..AEML--EEY
F0S6E2_PEDSD/2-101----------------------------------------------------------KIAFKMKLK--..EGFK--EEY
D8MW19_ERWBE/6-112----------------------------------------------------------RYCQALDLA--DDPQLI--AEY
J4GG69_FIBRA/8-118----------------------------------------------------------RICQIIKLK--..PEAE--AEY
RHAM_TOLAT/3-103----------------------------------------------------------RKAFLMSVK--..PEAH--AEY
R5RHB4_9FIRM/4-102----------------------------------------------------------..GFKMKLY--..PGQE--AEY
R7CUY6_9BACE/4-107----------------------------------------------------------RYGSVIKVA--..PGRL--EEY
F4GKH0_SPICD/4-103----------------------------------------------------------RAAFIMKLK--..PGCE--AEY
M2QQB6_CERS8/8-118----------------------------------------------------------RFCQIIKLK--..PGAE--ETY
R4LU20_9ACTO/8-112----------------------------------------------------------RHAFVVGVR--..PEHR--ERY
RHAM_AGRVS/6-106----------------------------------------------------------KYAFKMQLH--..PGME--AEY
A1RAY8_ARTAT/2-103----------------------------------------------------------RVCFRSSVQ--..PELM--AEY
A0K063_ARTS2/2-106----------------------------------------------------------RVCFRSSVQ--..PGLI--DEY
G8TPW3_NIAKG/3-103----------------------------------------------------------RVAIKMNLF--..KGQE--AEY
Q15XN8_PSEA6/5-113----------------------------------------------------------RYCLALDLI--DDPALI--EQY
G2TP17_BACCO/3-103----------------------------------------------------------RKASVMFVH--..KDQY--EEY
D9QN17_BRESC/8-108----------------------------------------------------------TIAFRMNMN--..PGQA--EEY
H8KVT5_SOLCM/4-109----------------------------------------------------------RHCFALDLK--PDAELI--AEY
G3JAD5_CORMM/9-118----------------------------------------------------------RFGQVIRLR--..KDCV--EQY
F0LZS0_VIBFN/7-107----------------------------------------------------------RLAFVMQLK--..PGFE--AQY
E8RLZ9_ASTEC/5-104----------------------------------------------------------.HAFKMQLK--..PGFE--AEY
R6U745_9FIRM/3-103----------------------------------------------------------RKAFRMKLF--..DGMA--EEY
E0RYP0_BUTPB/3-103----------------------------------------------------------RKGFKMKLY--..PGME--KEY
W0A8U2_9SPHN/5-114----------------------------------------------------------RRCFAVDLH--GDPERI--ARY
F0RTW9_SPHGB/2-102----------------------------------------------------------RKAFVMQLK--..KGCE--AEY
V5XRE7_ENTMU/3-103----------------------------------------------------------KKAVKMKLY--..PGYE--AEY
W0JTK6_9EURY/7-109----------------------------------------------------------RTVYLQRID--..PDYS--EEY
F4C6L3_SPHS2/2-101----------------------------------------------------------KIAFKMKLM--..PGFQ--EEY
R5MDS1_9BACE/17-125----------------------------------------------------------RYCQTMDLK--DNPKLI--KEY
Q92VL4_RHIME/3-108----------------------------------------------------------RMGMVIGLE--..PSKI--AEY
D5EY64_PRER2/19-127----------------------------------------------------------RYCQTMDLK--NDPELI--AKY
E8NDA4_MICTS/4-105----------------------------------------------------------RVCFELRVR--..PELI--DEY
E6SPU6_BACT6/19-127----------------------------------------------------------RYCRTLDLR--DNPALI--AEY
C6WNL3_ACTMD/3-105----------------------------------------------------------RICFLLRVR--..PDRL--AEY
R7NTA6_9BACE/19-127----------------------------------------------------------RYCQMLNLK--DDPALI--AEY
Q826A8_STRAW/2-103----------------------------------------------------------RIALHTKVR--..ADRV--AAY
M1VWH7_CLAP2/35-145----------------------------------------------------------RFGQVIKLK--..KGCV--EEY
C7PNE2_CHIPD/2-102----------------------------------------------------------KIAFKMQLK--..PGCM--EEY
A0QQ10_MYCS2/3-105----------------------------------------------------------RVCFVLQLR--..PERM--DEY
S8E4Q7_FOMPI/8-118----------------------------------------------------------RVCQIIKLR--..PEAE--AEY
F4KPV2_HALH1/6-106----------------------------------------------------------EIAFVMYLK--..PGNE--AEY
E6WCQ8_PANSA/3-103----------------------------------------------------------RRAFVMQVH--..ADCH--DEY
D7CBT4_STRBB/3-105----------------------------------------------------------RVATVIRLR--..PEKE--QEY
R5V6F4_9BACE/15-123----------------------------------------------------------RYCQALDLK--NNPELI--AEY
F8EFY7_RUNSL/5-113----------------------------------------------------------RTCLALDLK--DNDELI--AQY
D2UB54_XANAP/3-111----------------------------------------------------------RHCYLLDLH--DDPTLI--AEY
R6AY66_9BACT/3-104----------------------------------------------------------RFAFKMYLK--..KGCE--KEY
B9TP76_RICCO/180-279----------------------------------------------------------.RAFIMRLK--..PGHV--DEY
A6L884_PARD8/3-111----------------------------------------------------------RYCQTLDLK--EDEQLI--KEY
E1VAZ6_HALED/5-103----------------------------------------------------------..ALRMTLH--..PGQE--AEY
H5X507_9PSEU/6-107----------------------------------------------------------RVCFLLRVK--..PDRM--AEY
G8TKN8_NIAKG/3-111----------------------------------------------------------RYTLALDLK--EDPALI--SEY
E4RWF7_LEAB4/3-103----------------------------------------------------------RQAFKMFLK--..PGCE--AEY
R5P2W9_9PORP/3-109----------------------------------------------------------RFCQTLHLK--EDLELI--RQY
H2ISM0_RAHAC/3-103----------------------------------------------------------RKSFVMQVN--..ANAH--DEY
C6XWC2_PEDHD/4-110----------------------------------------------------------RYCLTLDLI--ADEGLI--AEY
D2AYI7_STRRD/2-103----------------------------------------------------------RVALHTRIR--..PGKE--SEY
R7B568_9ACTN/14-112----------------------------------------------------------..GFKMKLL--..PGFA--AEY
D4LLT3_9FIRM/2-100----------------------------------------------------------.....IKVK--..PEKL--AEY
R5IF69_9FIRM/3-101----------------------------------------------------------RYAWKATVL--..PGKL--EEY
F8EDF5_RUNSL/27-127----------------------------------------------------------KLAFLMKLK--..PGFE--DEY
F4BQP6_CARS1/3-103----------------------------------------------------------KKGFKMKIY--..PDKQ--KEY
Q9RJV5_STRCO/9-112----------------------------------------------------------RVASVIRLR--..PEHA--ERY
F4L4I5_HALH1/3-109----------------------------------------------------------RFCLALDLV--DDPALI--AEY
F4PHW1_DICFS/4-111----------------------------------------------------------SYASALDLK--DDKVLI--EEY
K7ARV7_9ALTE/6-114----------------------------------------------------------QYCLILTLR--DDAELI--RQY
A6W650_KINRD/4-107----------------------------------------------------------RACFLLHLR--..PELV--AEY
R7LE58_9BACT/21-129----------------------------------------------------------RYCQTLDLR--DNPELI--EAY
F4H154_CELFA/3-103----------------------------------------------------------RVCFVSRVR--..PDRL--DEY
B0T1B6_CAUSK/4-110----------------------------------------------------------..VLLLDIH--DDPDAI--RDY
G0GFQ6_SPITZ/3-103----------------------------------------------------------RHAFVMQLK--..PGCE--EEY
Q1J3P3_DEIGD/12-114----------------------------------------------------------RVCFLLQVR--..PDRL--AEY
RHAM_BACSU/3-103----------------------------------------------------------RKASIMFVH--..QDKY--EEY
I6Z2E3_MELRP/3-103----------------------------------------------------------TFAFKMKLK--..PGFK--EEY
R6LHQ9_9BACE/3-103----------------------------------------------------------REAFKMFLK--..SGYE--KEY
D8PU32_SCHCM/8-118----------------------------------------------------------RICQIIKLK--..DEAL--EEY
D8IVV1_HERSS/3-103----------------------------------------------------------QIAFTMQLR--..PGCA--EQY
FUCM_XANCP/5-113----------------------------------------------------------RLCYVLDLH--DDAALI--AQY
B9KXQ9_THERP/5-109----------------------------------------------------------..GLTLCLR--DDPDAI--AAY
A4RYA8_OSTLU/7-113----------------------------------------------------------TFAQTIELE--S.EDAI--EAY
RHAM_BURP8/3-103----------------------------------------------------------TIAFRMVLN--..RGMR--DEY
RHAM_LISMO/3-103----------------------------------------------------------RVASIMYLY--..PGNK--EEY
R5XB53_9FIRM/3-102----------------------------------------------------------.KGFTMKLY--..EGQE--VEY
F4C913_SPHS2/3-109----------------------------------------------------------TYALALDLK--EDDHLI--KEY
G8QUN9_SPHPG/4-104----------------------------------------------------------RLAFVMHVK--..PGFE--EEY
G2YVL3_BOTF4/62-172----------------------------------------------------------RIAQIVKIK--..PECV--ELY
RHAM_CLOPH/3-103----------------------------------------------------------RKAFKMQLF--..EGQA--KEY
C1N719_MICPC/4-111----------------------------------------------------------HYAQTICLR--DGAGVV--DEY
E8RTW3_ASTEC/4-112----------------------------------------------------------RFCFALDLH--DDADLI--ARY
Q7CTD6_AGRT5/3-108----------------------------------------------------------RMGFCLNLR--..PGTV--EEY
I4F5E5_MODMB/3-101----------------------------------------------------------RVCFTLQVR--..PDRL--AEY
D1ARY4_SEBTE/3-103----------------------------------------------------------RKALKMKVY--..SQYH--GEY
A9WGG2_CHLAA/3-106----------------------------------------------------------RVGFTLKVK--..PELI--EEY
F5XNH4_MICPN/3-114----------------------------------------------------------RICELIHVR--..PEAI--AEY
RHAM_LEPCP/5-105----------------------------------------------------------KIAFRMFLN--..PGCE--AEY
RHAM_LACPL/3-103----------------------------------------------------------RLGQVMYLH--..KDAY--EEY
D2Q2I3_KRIFD/3-102----------------------------------------------------------RLALHSRLI--..AGTE--QSY
M2MAG9_BAUCO/7-117----------------------------------------------------------RIGQIVRLK--..RESL--QAY
A3HRM9_9BACT/4-104----------------------------------------------------------TLAFRMRLI--..PGFE--EEY
RHAM_MANSM/3-103----------------------------------------------------------RKGFVMQVN--..PDCH--AEY
I2EVY4_EMTOG/3-103----------------------------------------------------------RLGFKMKLH--..AGQA--EEY
L0FZ10_ECHVK/4-104----------------------------------------------------------QIAFKMKLL--..PGYE--AEY
F9XB02_MYCGM/6-116----------------------------------------------------------RIGQIIRLK--..PECL--QAY
Q5KCR2_CRYNJ/19-129----------------------------------------------------------RICQIVKVK--..PERL--DEY
D2QR00_SPILD/3-103----------------------------------------------------------EVAFTMKLK--..PGVE--AEY
R4X772_TAPDE/13-123----------------------------------------------------------RLAQIIRVK--..PEHI--AEY
K6YYZ3_9ALTE/4-112----------------------------------------------------------THCLTLELN--DDDELI--ALY
R5A8F9_9CLOT/2-102----------------------------------------------------------RKGFKMKLF--..QGQE--EEY
F8Q6Q2_SERL3/8-118----------------------------------------------------------RICQIIKLK--..PEYV--KEY
Q1GLV0_RUEST/3-108----------------------------------------------------------RMGMVIGIK--..PERL--DEY
D3F8C9_CONWI/3-101----------------------------------------------------------.VGNVYRVR--..AGLA--DEY
I3UF06_ADVKW/5-111----------------------------------------------------------RYCLALDLV--DDPEKI--QTY
C1DMX3_AZOVD/1-96----------------------------------------------------------.....MSLD--..PGRA--EEY
RHAM_RHILO/4-104----------------------------------------------------------KYAFKMKLK--..PGMK--AEY
C7MA53_BRAFD/20-118----------------------------------------------------------RCCFLLHVR--..PEKL--TEY
W0AGC7_9SPHN/4-103----------------------------------------------------------.HAFKMQLK--..PGVV--EEY
D7BV13_STRBB/3-105----------------------------------------------------------RVCFLLKVR--..QDRL--EEY
C4R5P5_PICPG/10-120----------------------------------------------------------RICQVVKLK--..PEFY--DEY
B8N6B4_ASPFN/5-114----------------------------------------------------------RIAQIVHLK--..PSAL--AAY
R5PSD2_9BACT/21-129----------------------------------------------------------RYCQCLELR--DNQELI--AKY
RHAM_OPITP/3-103----------------------------------------------------------RKAFVMSVN--..AGCE--AEY
V6JFG7_STRNV/3-106----------------------------------------------------------RIAQVIRAR--..PEKL--DEY
I0KE28_9BACT/2-108----------------------------------------------------------RHCLALDLK--NDPDLI--AEY
I3ZKM1_TERRK/3-103----------------------------------------------------------RVCFTLKLR--..ESTL--PEY
D5BBC0_ZUNPS/5-111----------------------------------------------------------RLCYACDLI--NDAGLI--EEY
D1BY74_XYLCX/3-102----------------------------------------------------------RVMFQFRVA--..PDRL--AEY
RHAM_OCEIH/3-103----------------------------------------------------------RKGFIMTVY--..PDKH--DEY
J9RIB0_9ACTO/6-114----------------------------------------------------------RVCFVLHLR--..PERV--EDY
R6WAC2_9BACT/17-125----------------------------------------------------------RYVQILELK--DDPESL--ASY
A8G9F9_SERP5/10-116----------------------------------------------------------RFCQALDLV--DSPALI--EEY
G0J5Y4_CYCMS/28-127----------------------------------------------------------.VAFTMKLL--..PGNE--EEY
C7YLU2_NECH7/7-118----------------------------------------------------------RFAQIVKLK--..PQHL--AEY
U5RUK3_9CLOT/3-103----------------------------------------------------------RKVCKMKLY--..KNCY--DEY
C5CZB7_VARPS/2-109----------------------------------------------------------RHCLALDLK--DDPALI--AEY
R5BLL2_9FIRM/265-367----------------------------------------------------------.FASVIKLR--..PEKA--EYY
R5B7U2_9BACE/23-126----------------------------------------------------------.....LTLR--PDSKLI--AAY
A3I2P4_9BACT/3-110----------------------------------------------------------KFCFTLDLI--DDPEMI--KEY
F6FU80_ISOV2/2-98----------------------------------------------------------...FQFRVR--..PDRL--DEY
R6Y9M4_9PORP/17-125----------------------------------------------------------RYCQTLDLK--DDPELI--SEY
R5UEH6_9FIRM/3-103----------------------------------------------------------RKGFKMKLY--..PDMA--EEY
Q5YUK3_NOCFA/7-108----------------------------------------------------------RVCFLLSLR--..PDRI--EDY
R5T0T1_9CLOT/5-103----------------------------------------------------------..SFKMHLY--..EGMA--EEY
E8V6H3_TERSS/3-109----------------------------------------------------------RYCLACDLK--DEPALI--TEY
Q7AJX0_BACHD/6-107----------------------------------------------------------KFAWTWTVK--..ESCL--EEY
W0LD07_SERFO/3-103----------------------------------------------------------RKAFVMQVN--..PDAH--AEY
D5ET23_PRER2/3-104----------------------------------------------------------RFAFKMQLK--..PGCE--KEY
T5AGB0_OPHSC/41-152----------------------------------------------------------RFGHVIRLR--..PERV--AEY
B6QAY9_PENMQ/10-121----------------------------------------------------------RVGQWIYLR--..PECI--EEY
R5FKH4_9ACTN/13-112----------------------------------------------------------.HGFKMKLY--..PGFA--EEY
S3CGR6_GLAL2/40-151----------------------------------------------------------RIAQIVKLK--..PEYV--EEY
E9QYL7_ASPFU/6-125----------------------------------------------------------RIAQIVHLK--..PSAV--EAY
D2PT68_KRIFD/3-105----------------------------------------------------------RYCFCLQVK--..PDRL--DEY
RHAM_BACSK/3-103----------------------------------------------------------RKATVMKVY--..KDKY--DDY
R6YNW1_9BACT/15-123----------------------------------------------------------RYVQRLDLK--SDEEAI--QLY
Y3871_DICDI/8-118----------------------------------------------------------SYAQALDLV--NDKELI--EEY
A1RB67_ARTAT/4-103----------------------------------------------------------SIALHTRLK--..PGTE--EAY
A5FI86_FLAJ1/3-109----------------------------------------------------------KYCLALDLN--NHPDLI--AEY
H2JUV0_STRHJ/2-103----------------------------------------------------------RVALHTKVR--..ADRI--EEY
E4RRT9_LEAB4/3-109----------------------------------------------------------RFALVLDLI--DDPQLI--KEY
RHAM_OCHA4/5-105----------------------------------------------------------RYAFRMKLN--..PGME--AEY
D3VH42_XENNA/3-116----------------------------------------------------------RFGFSIEVV--N.DAAL--EMY
L8X683_THACA/10-129----------------------------------------------------------RFCQVVALK--..TEAL--EEY
W0F1J4_9SPHI/6-112----------------------------------------------------------RYCLALDLK--NDPELI--AEY
D2QDE5_SPILD/2-108----------------------------------------------------------RYCFALDLI--DDPTQI--AEY
A0RPU5_CAMFF/263-366----------------------------------------------------------KFASVIKIR--..KDKI--DTY
RHAM_RHIEC/5-105----------------------------------------------------------KHAFKMQLN--..PGME--AEY
W0HUK9_9ENTR/3-103----------------------------------------------------------RKAFVMQLN--..PEAH--QEY
R9VMZ1_9ENTR/3-103----------------------------------------------------------RKAFVMQVN--..PDAH--EEY
I2B3V9_SHIBC/8-108----------------------------------------------------------RKAFVMQVN--..PGAH--QEY
RHAM_PECAS/3-103----------------------------------------------------------RKAFVMSVF--..PDSH--DEY
A4FGN1_SACEN/3-102----------------------------------------------------------RIALHTRLE--..PGRE--ADY
G0R4U7_ICHMG/11-113----------------------------------------------------------....TLDLK--DDQNLI--QLY
Q0S9A0_RHOSR/3-104----------------------------------------------------------KYCFTLQLR--..PDRI--DEY
Q0U0I1_PHANO/10-124----------------------------------------------------------RIGQWLYLN--..PARI--DEY
G9MQ27_HYPVG/10-118----------------------------------------------------------.FAQTVKLK--..KDRV--EEY
R5YL30_9BACE/19-127----------------------------------------------------------RYCQTLNLK--ENPELI--AEY
G0J6H2_CYCMS/3-109----------------------------------------------------------RYCLALDLK--DDPEII--EKY
G0AEI2_COLFT/99-206----------------------------------------------------------RYCLVLDLK--DDPSLI--GRY
RHAM_AGRT5/6-106----------------------------------------------------------KHAFRMKLF--..AGKE--VEY
Q0PB25_CAMJE/3-104----------------------------------------------------------RYGQIIKIK--..KEKI--EEY
RHAM_LACS1/4-107----------------------------------------------------------RLGQIMHVN--..PNYY--DEY
A7RJ94_NEMVE/13-125----------------------------------------------------------RLGSVIKLK--..PGMY--ERY
H2YJ08_CIOSA/7-118----------------------------------------------------------RYGSVIKLN--..ADKV--AEY
A3I067_9BACT/3-104----------------------------------------------------------.....CDLK--NEEEAI--QAY
R6D3Z6_9BACE/3-103----------------------------------------------------------REAFKMYLK--..PGCE--AEY
Q986Z5_RHILO/3-108----------------------------------------------------------RMGMVLGLK--..PEKV--EEY
Q21TQ6_ALBFT/2-109----------------------------------------------------------RYALALDLV--DDAQRI--FDY
H2J1A2_RAHAC/4-110----------------------------------------------------------RYCQALDLA--DDPALI--EEY
Q3XZK3_ENTFC/3-103----------------------------------------------------------KKAFCMKVY--..PEKQ--EEY
C5AGH1_BURGB/2-109----------------------------------------------------------RQCLALDLK--DDPESI--ARY
I3ZIT1_TERRK/3-109----------------------------------------------------------RYCLALDLH--PDPSLM--EEY
C9YZZ6_STRSW/2-102----------------------------------------------------------RVALHTKVR--..ADRV--EEY
RHAM_ACICJ/3-103----------------------------------------------------------QIAFRMQLD--..PAQA--AEY
Q01TX0_SOLUE/3-104----------------------------------------------------------RYAFKLRIK--..PEAV--EEY
W0J174_9BACT/3-103----------------------------------------------------------RKAFVMSVH--..PGQE--AEY
RHAM_JANSC/3-103----------------------------------------------------------KYAFKMQLT--..PGCL--AEY
I0HD26_ACTM4/3-105----------------------------------------------------------RVCFTLQVD--..PAKL--DAY
R6CWI8_9BACE/3-109----------------------------------------------------------RYCQTLELY--NDPELI--AGY
R5IKI3_9PORP/15-123----------------------------------------------------------RYCQTLDLK--NEPKLI--AEY
C5C310_BEUC1/3-105----------------------------------------------------------RICFTLQVR--..PDRL--AEY

PF13826

Q5B835_EMENI/129-253--------------------------------------------------------LIVFHLGARCN----------HPL
Q7NL77_GLOVI/17-135--------------------------------------------------------FVVFLIGMRIN----------QFW
C0ZHQ2_BREBN/17-134--------------------------------------------------------FVVFIIGMRIN----------RML
B1XXV3_LEPCP/17-135--------------------------------------------------------FVVFIIGMRIN----------RLL
D3EAC5_GEOS4/17-135--------------------------------------------------------FVVFVIGFRIN----------KWW
Q65NQ4_BACLD/18-134--------------------------------------------------------VVVFVIGMRVN----------KWH
D0L3R6_GORB4/18-133--------------------------------------------------------TALFLIGMRVT----------KPW
A8FJ75_BACP2/18-135--------------------------------------------------------IVVFIIGMRIN----------KRW
Q0SFP1_RHOSR/17-134--------------------------------------------------------LVVFLIGMTVN----------RPW
B2IYY5_NOSP7/17-135--------------------------------------------------------FIVFLIGMRVN----------KLF
Q8ELJ8_OCEIH/18-135--------------------------------------------------------IVVFIIGMRIN----------KYI
Q9K5Y3_BACHD/18-135--------------------------------------------------------VVVFIIGMRVN----------KRW
Q82JR6_STRAW/18-140--------------------------------------------------------VVVLLIGMRIN----------HLW
C8X6B7_NAKMY/17-134--------------------------------------------------------LVVFHIGMTIN----------RWH
C9Z558_STRSW/19-141--------------------------------------------------------VVVLLIGTRIN----------HFW
D7B5B0_NOCDD/17-134--------------------------------------------------------LVVFHIGATFN----------HWW
D2SAG2_GEOOG/17-134--------------------------------------------------------LTVFLIGMRIN----------RPW
D2Q510_KRIFD/15-133--------------------------------------------------------LVVFLIGMRVN----------KLR
C6XKE2_HIRBI/17-135--------------------------------------------------------FVVFLTGMRIN----------KWW
D2RPK7_HALTV/35-154--------------------------------------------------------IVVFHIGMRIN----------ALW
A1R2W1_ARTAT/19-136--------------------------------------------------------VTVFLIGMRAN----------RWW
Q5WGK6_BACSK/15-132--------------------------------------------------------VVIFIVGMKIQ----------QWW
B1YGH8_EXIS2/12-125--------------------------------------------------------IVVFIIGLRIN----------RLR
A6R852_AJECN/119-243--------------------------------------------------------LVVFLIGAKSS----------HPL
D5UWZ5_TSUPD/14-139--------------------------------------------------------LVVFLLGMRPR----------RAW
Q2TWA6_ASPOR/121-245--------------------------------------------------------IVVFHLGTRSN----------HPL
B6QJL8_PENMQ/116-242--------------------------------------------------------VVVLFLGFKSN----------HPL
Q0CTD2_ASPTN/81-205--------------------------------------------------------IVVFHLGARSN----------HPF
Q2GR33_CHAGB/122-248--------------------------------------------------------VVVLHLGARFN----------HPL
C7YU85_NECH7/113-235--------------------------------------------------------VVVFNLGVQSN----------HPL
B8MRW9_TALSN/40-166--------------------------------------------------------IVVLLLGFKSN----------RPL
Q7S613_NEUCR/120-245--------------------------------------------------------IVVFHLGVSYN----------HPL
Q01W86_SOLUE/18-128--------------------------------------------------------LVVIYLGMRVN----------ALT
A5G2Z4_ACICJ/18-128--------------------------------------------------------LTVVYLGMKVT----------KIR
B1LSK9_METRJ/27-140--------------------------------------------------------LVVIYLGMKVR----------TLA
B0U9U6_METS4/19-131--------------------------------------------------------LVVMYLGMHVR----------ALF
B8EMQ3_METSB/15-128--------------------------------------------------------LVVMMLGMRAR----------TLR
C5AWG2_METEA/27-137--------------------------------------------------------LVVVYLGFRVG----------RMR
F2F0V8_SOLSS/20-135--------------------------------------------------------.VVFIIGMRIN----------HLL
G7XTL7_ASPKW/119-243--------------------------------------------------------IVVFHLGARNH----------HPL
Q4WAZ2_ASPFU/113-235--------------------------------------------------------VVVFHLGIQYN----------HPL

PF13816

Q0C7P1_ASPTN/36-346VKSMSCQDQ...........SRVT.ETFRFLDGDDCK.....NAIIHVCYWEDARSYEEDLSRLRPM----------DIY
C0ZVD3_RHOE4/61-360VAGFDLPDG...........PAHH.DLTHHVDNQGYE.....NLIV.VGYWKDVSSQHRWSTSAPVA----------SWW
L2FQ62_COLGN/47-355ITSNSATPE..SR.......PGFH.EVAAVTDNRGFY.....NLAV.FAYWPSKSAYQEWSTTSGFH----------DWW
M7SDY7_EUTLA/46-400FTTPRPDQQSSNSPPAPIPTPAFS.ELASVTDNRGFF.....NLAV.LAYWPSRAAYDGWAAASGFD----------AWW
F9G6T4_FUSOF/15-335IKDA.SVPV................ERL....EQNNI.....PSRVWMAYWTSPQSFKSWWESDSTK----------SFW
E9EGK8_METAQ/37-344LDESS.AFK...........PQAF.ESFGVINGDDTQ.....DAKVWACYWDNEARGKEGLHRLNLP----------SIY
G9MZH7_HYPVG/2-314LTFPGEDGEESLN.......PEFS.EWAAVTDHKGFY.....NITA.LAYWKSEEVYQKWTTKSGFK----------SWW
C7ZI82_NECH7/15-335IKVA.ALHV................EEF....EQNDL.....PSKIWMSYWRSPQSFKSWWTSDDTL----------SFW
S3DKC9_GLAL2/17-348LSQS.AGRV................DHLR..TEDHGFKSIGQPSATFIAYWLRSEDYEALKTTSAWR----------EFW
A5V4Y9_SPHWW/44-337RATL...DA...........DVRHVDLARYVDEAGYD.....TLVL.QPYWTDPEAFRRWEARADVA----------ALL
Q5B890_EMENI/326-643FTTN.VPII................EHLE...QDDPT.....PTRLWLTYWPSRAVFETWWNSGPVS----------SFW
U1HNF8_ENDPU/45-351INC.SLD.R..LR.......PSFW.ELASVTDNSGAY.....NIAV.IAYWPNKMLHSEWAASSNFQ----------QWW
T0K4N5_COLGC/37-343LDED..EDP...........PLAK.EQFNYLDGDDLP.....GASIWVCYWNDEARGKRSLQRLSLP----------SIH
B2WMJ9_PYRTR/7-318VRDAPESLR...........PSFW.EVTSVVDKKGAY.....NVAV.VAYWPSTNLHRDWQEKSGFN----------VWW
R8BIH2_TOGMI/17-327INKR..AHF................DRIIVP.GKDGL.....NAHIWLSYW.WPETYADWWNSTSVA----------TFW
G3XZK7_ASPNA/17-337FASAAS...................DSLCAHTETLHQHHTSPTSIIHLTYW.STTNYETWLKSPKVS----------AFF
R8BET2_TOGMI/15-336LKAA.AVFV................EDL....INDDTERDLGLSRVWISYWKSPEAFQTWWNCPETK----------QFW
C7ZFH7_NECH7/16-326ISGQ..AHL................DRITVP.GNDGF.....ATQIWLSYW.WPDSHTGWWSKPAVK----------DFW
Q6FBU3_ACIAD/44-342VQSFSLDNG...........PQNH.DITHHTDNQGYE.....NYIV.VGYWRDPGAYCRWFRSTEVS----------HWW
S0DLH6_GIBF5/58-358IHTKSG..............PHHH.IRSSFTDSSGYR.....NIAF.TLYWKDVASYREWEAALPPD----------WWY
Q4WIY1_ASPFU/14-338IAEGP.STA...........PASI.EQFQVLDGDDVP.....NSTVWVCYWNEASKYEDSIRRLSLV----------NIH
K2SG27_MACPH/15-335LDRA.AAHV................ETL....EQNEPTPPVGASRVWMSYWKCPEDYQRWWSSLEVS----------DFW
I1S1Z5_GIBZE/37-347IQG...DTD...........PLAH.ETFTVIDGCDTQ.....ETTIWVCYWNDKTAYEKSLDRLSLK----------SIY
T0KQZ3_COLGC/16-328IDGK..AHL................DRIVYPTKNKPF.....GTQIWLSYW.HPETFAEWWASRSVQ----------DFW
M2V8J7_COCH5/50-359VEQGSEMSK...........PKYW.EAAAVIDNRGFR.....NQVV.IPYWQTKADFDKWRSDSGFD----------TWW
C5FDU1_ARTOC/82-390MKN.PSDAT..AQ.......PSFR.ELVSVTDPNGSY.....NIAV.IAYWPCRESYERWSVASTFT----------DWW
K9GEU7_PEND2/14-335ISGH.AAHI................DTLL...QDGCATPNTGKTYVWLTYWKSVADYQKWWTREDVS----------QFW
C7Z148_NECH7/37-347LKG...HHG...........PSAF.ESFTVIDGSDVE.....ETSIWVSYWLEESKYKLSIEKLSLP----------SIY
G9P8B6_HYPAI/42-386ARQGAGSLA...........PILW.EKMYVEAGYDLP.....DTEIYICYWTDKDVAEAATRSLNLR----------QLY
A7IFL4_XANP2/40-340LQTSFGTDG...........PVAH.EIMRMHDETGAV.....NAIL.VAYWLDATAHARWERNSPFM----------AWF
E6WMT6_PANSA/44-342VRSFSLDNG...........PGNH.DVTFHTDNQGFG.....NFIV.VGYWRDPAAYCRWLHQPAIT----------GWW
A1R5Y5_ARTAT/55-350WELCANEDG...........PMSR.EHAVHTDEQGFD.....NQVI.IAYWDDVDAYGRWFKKHRDA----------LIG
M7TNP5_BOTF1/17-355LSSS.ANRV................DHLQ..DESHGLPRHSPKSTTFIAYWLSCSSYQSFQASSLVQ----------EFW
D8MJY1_ERWBE/44-340TDRFSSADG...........PGHW.DIASCKDQAGFY.....NLMA.IAYWSSAEQFESWKENSLFN----------IWW
A1CFW9_ASPCL/36-355ITADP.SIA...........ASSV.EQFEVLDGDDTP.....GSTVWACYWDDAAKYEASLQRLNLV----------APF
N1QD40_MYCFI/15-330LSQSPAKHV................ETL....ESDDINKDRGSSRVWMSYWFSPPQYESWWQSPNVA----------DFW
M3B660_SPHMS/50-394VANSPESSR...........PKYW.EAAAVTDNRGFQ.....NEVV.IPYWQNKADYDRWRLDSGFA----------KWW
C9STN6_VERA1/46-354I..DLSSPR..SR.......PGFH.EVAAVTDNQGHF.....NIAV.LLYWKSKANYDEWLATSGFG----------RWW
C0SHU3_PARBP/2-309FKD.SPSAE..KK.......PSFW.ELASVTDTNGAY.....NIAV.IAYWPNKESYTEWGAAIGFQ----------NWW
F8J9L9_HYPSM/46-346VASFKEQNG...........PARY.DLVRFIDAQGYF.....NAIA.VGYWLDTDTFHKWNESPAIA----------NWW
B8NMG3_ASPFN/17-331ITGA.NCHL................DQVT...QDGIVSPGIGKTRIWIATWKSIADFEAWWESDSVI----------KFW
N4VS79_COLOR/45-355TTSKAVAAE..SR.......PQFS.EWASVTDNKGYY.....NIAH.LAYWPSKAAYEQWSVDSGFA----------SWW
B8NPL1_ASPFN/37-350LATDQ.DNA...........PAAV.ERFRVIDGDDTP.....DSLVFACYWDTESKYENGIKGLNLT----------QLY
C9SXX8_VERA1/37-348LEA...GHG...........PAVF.EAFAMIDGAEAT.....DTSVWVCYWQDADKYDAALQALALP----------ALF
I1RQY0_GIBZE/15-329IDSA.AIHV................EHL....EQNDV.....PSKIWMSYWESPQKFKQWWEKDDTV----------YFW
F9X370_MYCGM/46-354VEAPLDKSR...........PRYW.EAATVTDNRGYF.....NETA.IAYWQTKSDYEQWSTESGFK----------SWW
F9WY10_MYCGM/41-342LD....ESK...........APAI.DTFRVTNGFDVK.....GSRVWVAYWTNEEDFKSALKLLDLA----------RIW
K2RZK8_MACPH/39-345L...S.DVH...........PEAH.ETFTVLEGDDEV.....GSEIWVCYFVDAAAYENSVRKLSLS----------QIQ
Q0U2P3_PHANO/37-344LVQ...DDG...........PATH.ESFTVIEDDSTK.....DVAVWVCYWNDLEKHKSSMEKLSLS----------SIH
N4V6I5_COLOR/37-346ANTVR.DDR...........PLAI.ETFNHIMGDDAP.....GANVWVAYWNSEENGKNSLRQLALA----------QIH
C5G803_AJEDR/45-352INN.PTAAG..KK.......PSFW.ELASVTDNRGAY.....NIAV.LAYWPDKGSYTEWATTSGFQ----------TWW
G9MHE5_HYPVG/42-380IRQGAGELA...........PVLW.EKTYVEAGYDVP.....DTEIYILYWTDKDVAKAANKSLNLQ----------QLH
Q0CF39_ASPTN/15-333IQEA.SVPV................EVM....EHDDFELEDCRSKVWMGYWKTPEDYRAWWCSPKVA----------AFW
H6BUX5_EXODN/41-346LNHP..ASA...........AESI.EVFRVILGNDLP.....ASKVWIAHWTRREVFSAMLEKLNLP----------HMW
C6WDR0_ACTMD/40-337LELAAGESG...........PALV.ERVSDDDSE..........MA.VCYWPDPEAHRAWWASGPVR----------DWW
N1S900_FUSC4/37-346VSS...DTG...........PEAY.ETFAVIDGCDVQ.....ESTIWVCYWSDKTKYEKGLNDHSLN----------SIY
D4AMZ1_ARTBC/45-352VKS.PTDTE..VR.......PSFW.ELASVTDANGSY.....NIAI.LAYWQSQETYESWNKVSNFR----------SWW
C5CKL2_VARPS/44-346AAGFALPDG...........PGHH.DFAHHVDAAGCD.....NMVA.IAYWNDPAAHARWCTAPEVD----------AWW
D8J0A9_HERSS/44-342VSSFALPDG...........PGNH.DMSYHLDNQGYG.....NFIV.VGYWRDAGRYCRWMRSPDVA----------GWW
N1Q9B6_MYCFI/42-344LN.S..NST...........PPII.DTFRVTHGFDLV.....DSRVWVAYWTSKEGYHAALAQLKLT----------DLW

PF03795

E8VI80_BACST/6-82---------------------------------------------------------MLTMRTEKFN----------QEH
A0A022NQM5_PSEAI/1-116---------------------------------------------------------MKYLCLIYFD----------EAK
Q98EG6_RHILO/1-116---------------------------------------------------------MKYVCLVYGE----------EKD
Q9AB44_CAUCR/10-125---------------------------------------------------------MQYALLLYEN----------EAV
A0A022NRR0_PSEAI/1-123---------------------------------------------------------MRFMVIVKAT----------QAS
Q98I36_RHILO/1-116---------------------------------------------------------MRFMMLMIPG----------GYA
Q98DP4_RHILO/1-116---------------------------------------------------------MRYMLMINND----------ESA
Q98HH2_RHILO/1-118---------------------------------------------------------MLYAILCYAS----------EDV
Q98H82_RHILO/1-116---------------------------------------------------------MFYAILAYHM----------EDA
Q984U5_RHILO/1-115---------------------------------------------------------MRYACLIYYH----------PQT
F7UNU3_SYNYG/2-86---------------------------------------------------------AKYVLWGTYC----------DNV
Q983T6_RHILO/165-255---------------------------------------------------------VFHCRLIPPR----------PDF
Q9RVF8_DEIRA/6-88---------------------------------------------------------TLWVVHSTYL----------KTG
F0KED5_CLOAE/1-82---------------------------------------------------------MFILLLKYIK----------PV.
D6EF87_STRLI/1-82---------------------------------------------------------MFVLELSYTA----------PL.
Q98H68_RHILO/7-87---------------------------------------------------------MFVVALNYKV----------PL.
Q16CW5_ROSDO/1-86---------------------------------------------------------MLVALIAHDK----------PGA
Q9AJZ7_STRCO/1-88---------------------------------------------------------MEFLCYHRDR----------PAS
Q45075_BURCE/1-92---------------------------------------------------------MLFLIYRKDR----------PGS
Q98EI5_RHILO/1-89---------------------------------------------------------MLFAFVCKDK----------PGS
B8GXF8_CAUCN/2-87---------------------------------------------------------ALFAILCKDK----------PGA
Q0K0V2_CUPNH/1-88---------------------------------------------------------MPYLIETVDK----------PNH
A0A037VEJ0_HAEIF/1-95---------------------------------------------------------MYYVIFAQDI----------PNT
A0A016XA68_VIBCL/1-95---------------------------------------------------------MWYVIFAQDV----------ENS
A0A009E788_ECOLX/1-95---------------------------------------------------------MLYVIYAQDK----------ADS
A0A022NMR8_PSEAI/1-95---------------------------------------------------------MLYAIIARDI----------PAS

PF02426

F4CSZ3_PSEUX/1-89---------------------------------------------------------MLFHVRMDVA----------IPR
C7QDL9_CATAD/1-93---------------------------------------------------------MEYLVTMTTH----------VPE
Q7WWV8_CUPNH/1-90---------------------------------------------------------MLYCVQMDVK----------IPD
H6RKG3_BLASD/1-91---------------------------------------------------------MEFLTEVLLT----------VPP
D7CBD2_STRBB/1-90---------------------------------------------------------MLFAVHMTVN----------LPP
CATC_ACIAD/1-90---------------------------------------------------------MLFQVRMDVH----------LPV
A0QTP0_MYCS2/1-90---------------------------------------------------------MHFHVRMDVR----------LPH
C7QDL9_CATAD/107-197---------------------------------------------------------.EYLVTFHVR----------VPE
O07243_MYCTU/1-93---------------------------------------------------------MEFLVTMTTR----------VPD
B2HNZ0_MYCMM/1-93---------------------------------------------------------MEFLVSMTIE----------VPR
G8ML29_9BURK/1-90---------------------------------------------------------MLYLVRMDVH----------LPH
S5UNN6_STRCU/3-92---------------------------------------------------------.EYLVELTTT----------VPA
H2JTH6_STRHJ/3-92---------------------------------------------------------.EFLVELTTT----------VPE
G2J3C0_PSEUL/4-93---------------------------------------------------------MLFHVRMEVN----------LPP
D3F6M4_CONWI/1-88---------------------------------------------------------MEFLVDVRVS----------LPP
H2FYU2_OCESG/1-90---------------------------------------------------------MLFKVEMKVN----------IPH
R4SVN0_AMYOR/1-90---------------------------------------------------------MLYHVRMDVR----------LPP
H6RX66_BLASD/1-89---------------------------------------------------------MEFLVRSENR----------LPA
B1VQ91_STRGG/37-126---------------------------------------------------------MEFLVNIHIT----------WPE
M1NRR9_9CORY/1-90---------------------------------------------------------MLFLARMDVH----------FPE
B4EMK5_BURCJ/1-90---------------------------------------------------------MLFHVEMTVR----------LPA
F2JV84_MARM1/1-90---------------------------------------------------------MLFKVEMTVN----------IPK
Q5YTX0_NOCFA/1-90---------------------------------------------------------MLFHVRMDVR----------IPH
L0IVL4_MYCSM/1-90---------------------------------------------------------MIFAVTMDVD----------LPS
O07243_MYCTU/108-199---------------------------------------------------------.EFLIATTIM----------VPP
F6A976_PSEF1/1-90---------------------------------------------------------MLFHVRMTVK----------LPT
B2HNZ0_MYCMM/108-199---------------------------------------------------------.EFLITTTLT----------VPS
Q0SE60_RHOSR/3-91---------------------------------------------------------.LFHVRMDVA----------IPR
Q0K0V3_CUPNH/1-90---------------------------------------------------------MLFMAEMTVK----------IPA
Q82MX8_STRAW/120-209---------------------------------------------------------.EFLVEITTT----------IPE
S5TF72_9CORY/1-89---------------------------------------------------------MFYMVQMFVN----------RPE
M4XFM6_PSEDE/1-90---------------------------------------------------------MLFHVKMTVK----------LPV
F4CMA9_PSEUX/1-90---------------------------------------------------------MLFHVTMDVA----------IPR
B2UBI3_RALPJ/1-90---------------------------------------------------------MLFHVRMDVR----------LPA
A4FHX7_SACEN/1-90---------------------------------------------------------MLFHVRMDVH----------LPH
H6L7V8_SAPGL/7-88---------------------------------------------------------LEFEVPAEMQ----------...
G2P2X2_STRVO/1-89---------------------------------------------------------MDFLVRIDTS----------DAY
X5DVA1_9CORY/3-91---------------------------------------------------------.LFLVRMDVS----------IPY
B1WUL0_CYAA5/8-98---------------------------------------------------------MLYLLDFQVE----------YGP
D4Z421_SPHJU/1-90---------------------------------------------------------MLFKVEMDVN----------VPL
A9BYG6_DELAS/1-90---------------------------------------------------------MLYLVRMDVK----------IPH
D8IP00_HERSS/1-90---------------------------------------------------------MLFMVQMQVN----------IPA
Q73Y30_MYCPA/110-202---------------------------------------------------------.EFLQAITIR----------VPA
D2SB83_GEOOG/4-92---------------------------------------------------------.LYAVRMDVA----------LPP
E1W0V2_ARTAR/1-90---------------------------------------------------------MLFLARMDVV----------FPD
W0PJH0_9BURK/1-90---------------------------------------------------------MLFMVEMTVN----------IPH
F4CK66_PSEUX/1-90---------------------------------------------------------MLFHVKMDVA----------VPR
Q13YI1_BURXL/1-90---------------------------------------------------------MLFHVEMTVN----------LPV
A9IEP3_BORPD/1-90---------------------------------------------------------MLFMVQMQVN----------LPV
A9IEC2_BORPD/1-90---------------------------------------------------------MLYLVHMIVD----------IPS
K0IEU1_NITGG/8-95---------------------------------------------------------MLYLVIDAVK----------LEF
B9JQ22_AGRRK/1-90---------------------------------------------------------MLFYVEMTVE----------LPY
A6VZS3_MARMS/1-90---------------------------------------------------------MLFKVEMTVN----------IPK
G8RL90_MYCRN/1-90---------------------------------------------------------MLFHVRMDVH----------LPA
B8IBD4_METNO/1-90---------------------------------------------------------MLYCVEMDVA----------IPH
Q1LE87_RALME/1-90---------------------------------------------------------MLFMVEMTVR----------IPQ
G7ZC79_AZOL4/19-108---------------------------------------------------------MLFHVTMTVR----------LPA
H5X6M8_9PSEU/1-90---------------------------------------------------------MLFHVRMDVA----------IPH
R7Y1A3_9ACTO/1-90---------------------------------------------------------MLFHARMDVR----------IPL
A0QZJ3_MYCS2/4-90---------------------------------------------------------.EYLVRIDVE----------RPA
Q8NN13_CORGL/1-90---------------------------------------------------------MLFLARMDVV----------FPD
W8T9C2_EUBAC/1-86---------------------------------------------------------MLFLVKTKVK----------EKY
Q1LDN7_RALME/1-90---------------------------------------------------------MLFLVRMDVQ----------IPH
K9ZDB7_ANACC/1-91---------------------------------------------------------MLYHLDFHVE----------YPD
W0L7T9_SERFO/1-90---------------------------------------------------------MLFHVRMDVN----------LPA
H5WYU9_9PSEU/14-101---------------------------------------------------------.EFLVRADNN----------LPP
A1TU43_ACIAC/1-90---------------------------------------------------------MLFMAEMTVR----------IPS
D0L556_GORB4/1-90---------------------------------------------------------MLFHVRMDVN----------IPN
B2JPE7_BURP8/1-90---------------------------------------------------------MLFHVKMVVK----------LPP
A8I5Y7_AZOC5/1-90---------------------------------------------------------MLFHVEMQVN----------IPH
Q73Y30_MYCPA/1-93---------------------------------------------------------MEFLVAATTQ----------VPD
A4XFH7_NOVAD/1-90---------------------------------------------------------MLFQVEMTVD----------IPL
A6T9N4_KLEP7/1-90---------------------------------------------------------MLFKVEMTVN----------IPP
A5V4X7_SPHWW/1-90---------------------------------------------------------MLFQVHMHVN----------VPT
A0JW94_ARTS2/1-90---------------------------------------------------------MLYLVRMDVN----------IPP
I2B8Q1_SHIBC/1-90---------------------------------------------------------MLFKVDMTVN----------IPL
F4CJL4_PSEUX/1-89---------------------------------------------------------MEFLVRAENR----------LPV
B1LT49_METRJ/1-90---------------------------------------------------------MLYMVHMQVN----------IPA
M4S3X1_9SPHN/1-90---------------------------------------------------------MLFHVRMDVN----------IPH
A1SEX5_NOCSJ/1-90---------------------------------------------------------MLYHVRMDVR----------LPH
A1B186_PARDP/1-90---------------------------------------------------------MLYHVFMDVK----------IPR

PF09448

O51799_CUPNE/2-113-------------------------------------------IRLLYLLVKPA--------GMSDE----------TFR
Q7WWV7_CUPNH/2-112-------------------------------------------IRMLYLLVKPE--------GMTDE----------AFR

PF07110

Q98J67_RHILO/10-91-----------------------------------------------------T--------PADPA----------AFE
YTH4_RHOER/10-90-----------------------------------------------------H--------PADPA----------AFD
Q89V09_BRADU/21-102-----------------------------------------------------T--------PKDAA----------AFD
B8Y4U8_9NOCA/10-91-----------------------------------------------------Q--------PTDTE----------AFD
Q9KGB0_BACHD/16-96-----------------------------------------------------Q--------PEDKQ----------AFD
E2M9K4_PSEUB/10-93-----------------------------------------------------Y--------EEGAR----------FDH
Q2N8F2_ERYLH/12-112-----------------------------------------------------P--------SLSRD----------EFQ
D0J371_COMT2/26-114-----------------------------------------------------P--------ALRPE----------EFA
I8IBK1_ASPO3/43-139-----------------------------------------------------P--------DWARE----------EFW
C9S7C3_VERA1/40-151-----------------------------------------------------P--------DFTRQ----------EFW
Q0UAA8_PHANO/20-125-----------------------------------------------------R--------SLTRA----------QFY
B6QRR3_PENMQ/18-114-----------------------------------------------------E--------GTTPE----------EFY
C9SY64_VERA1/65-158-----------------------------------------------------Q--------GITQE----------QFN
B8MSU2_TALSN/18-112-----------------------------------------------------P--------SLTVE----------EFH
A5VH99_SPHWW/138-221-----------------------------------------------------R--------DMTPE----------EFQ
A5V521_SPHWW/98-177-----------------------------------------------------A--------ELTHD----------AFR
B9K152_AGRVS/13-109-----------------------------------------------------L--------GQTLA----------EQR
B2W3U7_PYRTR/13-127-----------------------------------------------------P--------DLSPE----------EFQ
Q0U4N6_PHANO/13-123-----------------------------------------------------P--------ETSPE----------EFK
B2WDV2_PYRTR/13-120-----------------------------------------------------H--------ALSSE----------EFR
Q0U5I6_PHANO/13-111-----------------------------------------------------P--------TLSPT----------DFQ
A2QB94_ASPNC/13-115-----------------------------------------------------P--------ETSPS----------TFK
A2QVN7_ASPNC/13-122-----------------------------------------------------P--------GLSLS----------TFR
B8MPG2_TALSN/43-154-----------------------------------------------------S--------GLTLE----------EFK
Q2UT25_ASPOR/23-122-----------------------------------------------------E--------GLTPD----------QYR
C9Z9Q5_STRSW/12-103-----------------------------------------------------P--------GMTHL----------AFV
A2R8B5_ASPNC/14-111-----------------------------------------------------A--------GMTKD----------EFF
A5VH99_SPHWW/12-106-----------------------------------------------------P--------TLSRP----------EFF
Q396J2_BURS3/130-221-----------------------------------------------------P--------RLTHE----------AWL
A6GBX1_9DELT/12-106-----------------------------------------------------P--------ALSVA----------EFR
C9Z9Q5_STRSW/139-234-----------------------------------------------------Q--------GVSLD----------NFT
B5HPI7_9ACTO/138-233-----------------------------------------------------E--------GLLPA----------DVT
A8L3R3_FRASN/10-95-----------------------------------------------------R--------GCAPD----------DFV
A5V7F6_SPHWW/12-99-----------------------------------------------------A--------GIARG----------ELI
A5V7F6_SPHWW/139-229-----------------------------------------------------A--------DMSRE----------AFV
A4XEJ1_NOVAD/13-101-----------------------------------------------------E--------GMSKA----------DFI
C7Z3Q5_NECH7/37-130-----------------------------------------------------D--------SIDYD----------TFF
Q140F8_BURXL/125-207-----------------------------------------------------P--------GMEPS----------AFR
C8ND54_9GAMM/12-105-----------------------------------------------------D--------GLSDA----------EFR
C2M2M0_CAPGI/12-107-----------------------------------------------------A--------SLTKE----------EFI
Q93AB2_YERPE/18-98-----------------------------------------------------K--------GQSFE----------DFV
B8MF02_TALSN/21-117-----------------------------------------------------P--------GLTEE----------ELC
C8VQ65_EMENI/29-132-----------------------------------------------------Q--------GMSEE----------AYR
C5FQT1_ARTOC/22-118-----------------------------------------------------G--------GMDEE----------AYR
Q2GSS6_CHAGB/53-131-----------------------------------------------------E--------GIDLA----------EYR
B8NJL1_ASPFN/19-113-----------------------------------------------------P--------GLTEE----------ELH
C8VTL3_EMENI/15-109-----------------------------------------------------P--------GLDES----------SLH
Q0UIY9_PHANO/18-106-----------------------------------------------------P--------GMDED----------AYH
A2QH37_ASPNC/566-663-----------------------------------------------------P--------GMPED----------EYH
B6QDA9_PENMQ/20-117-----------------------------------------------------P--------HLTHE----------EFM
A2QDU1_ASPNC/19-117-----------------------------------------------------E--------GISWK----------DFH
B0YAX3_ASPFC/21-118-----------------------------------------------------P--------NVSEE----------EFY
B2WLL6_PYRTR/30-124-----------------------------------------------------D--------GMSDA----------DFI
Q4P1P8_USTMA/29-132-----------------------------------------------------D--------DISDQ----------KFS
C7Z0I7_NECH7/17-115-----------------------------------------------------E--------GVSQE----------EFS
Q9F3V8_9PSEU/12-93-----------------------------------------------------E--------GIDRD----------EAL

PF07045

Q0C383_HYPNA/2-97-----------------------------------------------------AAYMIVFA.RVKDR----------QRF
Q98DD6_RHILO/3-95-----------------------------------------------------KGYWIARV.DVRDA----------EGY
A8LJW3_DINSH/3-95-----------------------------------------------------KGYIVASI.RSNDM----------ETI
Q1GHA0_RUEST/2-94-----------------------------------------------------PALWIAHV.TVTDA----------DAY
A1B208_PARDP/2-94-----------------------------------------------------SVFILAQL.KFTDI----------ERY
A0R1N9_MYCS2/3-94-----------------------------------------------------KGYVIITE.DIKDP----------AGM
B2U9C2_RALPJ/3-96-----------------------------------------------------AGYILAYV.DVTDP----------VQY
Q1LPI6_RALME/3-96-----------------------------------------------------AGYIIAYV.DVTDP----------QQY
Q0RXH4_RHOSR/2-95-----------------------------------------------------TAIVVARI.RVTDA----------DKY
Q129N1_POLSJ/11-101-----------------------------------------------------PGYLVVEF.QVTDP----------VGW
B2JPM5_BURP8/3-96-----------------------------------------------------KGYWVTSYRKTNDA----------AAL
Q21DJ6_SACD2/2-95-----------------------------------------------------TAYAIGLL.TIHND----------NWL
A1B8D1_PARDP/3-95-----------------------------------------------------KAYWIGHV.TVDDP----------AAY
Q0C268_HYPNA/2-95-----------------------------------------------------TVYALAQL.KIEDR----------AVY
A1K1N9_AZOSB/2-94-----------------------------------------------------KGYWIVRV.DVADS----------ERF
Q65SN3_MANSM/24-117-----------------------------------------------------PAYYVAEF.QPTDR----------EGI
Q0RQX9_FRAAA/2-95-----------------------------------------------------TAYWISVYKEIVDE----------SKV
Q3J0R2_RHOS4/3-95-----------------------------------------------------TALWIANV.EVTDA----------EAY
Q1GHQ7_RUEST/2-96-----------------------------------------------------TAYIIGQL.QIQSR----------DWM
Q5NR08_ZYMMO/2-95-----------------------------------------------------SAYVISDT.NPKDP----------DAW
A8L5T2_FRASN/12-105-----------------------------------------------------KGYVILTE.AIKDP----------EGM
Q742V7_MYCPA/6-97-----------------------------------------------------KGYAILTE.AIKDP----------EGM
Q165U6_ROSDO/2-94-----------------------------------------------------GALWIAHV.KVTDE----------EAY
A4XTJ7_PSEMY/2-95-----------------------------------------------------TAYAVAIVRETQFG----------PEI
A5V7J9_SPHWW/2-96-----------------------------------------------------SAYWIARA.RMRDM----------EGQ
Q5YTA0_NOCFA/2-95-----------------------------------------------------TVYVIAQL.KFTDR----------AAY
Q128E5_POLSJ/3-96-----------------------------------------------------SAYIIANV.TVTNP----------EQY
Q65QR7_MANSM/19-113-----------------------------------------------------TAYVVFIRDEMKDQ----------AAY
Q2VZK5_MAGSA/2-96-----------------------------------------------------SAYLIVDT.QLDDP----------ELY
Q7VAI4_PROMA/7-101-----------------------------------------------------KGYWISTS.TVINQ----------ALF
Q28P24_JANSC/6-100-----------------------------------------------------PVYMIVML.EIDDM----------PTF
B2JHP1_BURP8/2-95-----------------------------------------------------STFAVAHLHEVKMG----------MEI
Q984S8_RHILO/2-95-----------------------------------------------------PAYIISDV.TICDQ----------EAF
Q89JB1_BRADU/14-107-----------------------------------------------------PAYVISEV.EVRDQ----------AMM
A1AZL7_PARDP/2-94-----------------------------------------------------TALWIAHV.NVTDP----------EAY
A8LL19_DINSH/2-94-----------------------------------------------------SAFWIAHV.HVTDA----------DRY
A8KZG9_FRASN/2-95-----------------------------------------------------SAYVIVGV.DVLDE----------EAS
Q11KJ1_CHESB/3-95-----------------------------------------------------KGYWIAHV.DVRDP----------ERY
Q6NCX9_RHOPA/3-96-----------------------------------------------------KGYWVGRI.DVHDL----------DGY
Q1GFX6_RUEST/3-95-----------------------------------------------------KGYWVAHV.DIDDM----------ERY
A1TLS8_ACIAC/3-96-----------------------------------------------------SAYIIASV.TVTNP----------EQY
Q46KM6_PROMT/7-101-----------------------------------------------------KGYWISTA.KIINQ----------ELF
Q127Z9_POLSJ/2-95-----------------------------------------------------SAYLIADT.HITNP----------QIY
Q5FU37_GLUOX/2-95-----------------------------------------------------PAYAVFIREKLTDP----------AEF
Q98JP1_RHILO/45-139-----------------------------------------------------TAYVIADI.KMKDP----------KWV
Q98CT4_RHILO/9-101-----------------------------------------------------KGYWMVML.TVTDA----------EGY
A5V7D8_SPHWW/2-97-----------------------------------------------------AAYIVGKL.NVANW----------DWY
A4XXX9_PSEMY/17-110-----------------------------------------------------KAYWIAHV.DVTDP----------ARY
A1BAV2_PARDP/2-95-----------------------------------------------------ASYAVAHLHHVEIG----------PDI
Q28QV7_JANSC/3-95-----------------------------------------------------QAYWIAHV.TVTDD----------AAY
Q28KV2_JANSC/2-96-----------------------------------------------------TAYCLFQNLDITDM----------DKM
A6WA35_KINRD/13-106-----------------------------------------------------PAYSITEVLQVLDP----------AGA
Q89BY8_BRADU/66-159-----------------------------------------------------PAYFIVQN.TIKDE----------AQY
Q11E97_CHESB/2-98-----------------------------------------------------PVYWIGRA.NVVDE----------EPM
Q6F9F1_ACIAD/2-94-----------------------------------------------------TAYWIAHV.TIHDM----------QQY
Q16DN6_ROSDO/3-95-----------------------------------------------------KGYIIGNI.SLRDA----------DAY
A9BN41_DELAS/3-96-----------------------------------------------------SGYIIASV.TVTKP----------EQY
A4X3R6_SALTO/2-95-----------------------------------------------------AALLIGNVGTLGDP----------EAM
Q0C4G1_HYPNA/2-95-----------------------------------------------------AAYIILIREKLRDE----------EAM
Q2KDF1_RHIEC/3-95-----------------------------------------------------KAYWIARV.DVRDA----------ERY
Q1D8Q3_MYXXD/2-95-----------------------------------------------------PAYVLVEV.SVHDA----------QTY