Sequence alignment for CL0032

PF13826

Q5B835_EMENI/129-253--------------------------------------------------------------------------------
Q7NL77_GLOVI/17-135--------------------------------------------------------------------------------
C0ZHQ2_BREBN/17-134--------------------------------------------------------------------------------
B1XXV3_LEPCP/17-135--------------------------------------------------------------------------------
D3EAC5_GEOS4/17-135--------------------------------------------------------------------------------
Q65NQ4_BACLD/18-134--------------------------------------------------------------------------------
D0L3R6_GORB4/18-133--------------------------------------------------------------------------------
A8FJ75_BACP2/18-135--------------------------------------------------------------------------------
Q0SFP1_RHOJR/17-134--------------------------------------------------------------------------------
B2IYY5_NOSP7/17-135--------------------------------------------------------------------------------
Q8ELJ8_OCEIH/18-135--------------------------------------------------------------------------------
Q9K5Y3_BACHD/18-135--------------------------------------------------------------------------------
Q82JR6_STRAW/18-140--------------------------------------------------------------------------------
C8X6B7_NAKMY/17-134--------------------------------------------------------------------------------
C9Z558_STRSW/19-141--------------------------------------------------------------------------------
D7B5B0_NOCDD/17-134--------------------------------------------------------------------------------
D2SAG2_GEOOG/17-134--------------------------------------------------------------------------------
D2Q510_KRIFD/15-133--------------------------------------------------------------------------------
C6XKE2_HIRBI/17-135--------------------------------------------------------------------------------
D2RPK7_HALTV/35-154--------------------------------------------------------------------------------
A1R2W1_ARTAT/19-136--------------------------------------------------------------------------------
Q5WGK6_BACSK/15-132--------------------------------------------------------------------------------
B1YGH8_EXIS2/12-125--------------------------------------------------------------------------------
A6R852_AJECN/119-243--------------------------------------------------------------------------------
D5UWZ5_TSUPD/14-139--------------------------------------------------------------------------------
Q2TWA6_ASPOR/121-245--------------------------------------------------------------------------------
B6QJL8_TALMQ/116-242--------------------------------------------------------------------------------
Q0CTD2_ASPTN/81-205--------------------------------------------------------------------------------
Q2GR33_CHAGB/122-248--------------------------------------------------------------------------------
C7YU85_NECH7/113-235--------------------------------------------------------------------------------
B8MRW9_TALSN/40-166--------------------------------------------------------------------------------
Q7S613_NEUCR/120-245--------------------------------------------------------------------------------
Q01W86_SOLUE/18-128--------------------------------------------------------------------------------
A5G2Z4_ACICJ/18-128--------------------------------------------------------------------------------
B1LSK9_METRJ/27-140--------------------------------------------------------------------------------
B0U9U6_METS4/19-131--------------------------------------------------------------------------------
B8EMQ3_METSB/15-128--------------------------------------------------------------------------------
C5AWG2_METEA/27-137--------------------------------------------------------------------------------
F2F0V8_SOLSS/20-135--------------------------------------------------------------------------------
G7XTL7_ASPKW/119-243--------------------------------------------------------------------------------
FMAE_ASPFU/113-235--------------------------------------------------------------------------------

PF13816

Q0C7P1_ASPTN/36-346AYIGIQQHDDSAA............GQDAFRTAADVVREFVKSMSCQDQ...........SRVT.ETFRFLDGDDCK...
C0ZVD3_RHOE4/61-360GYLGVQFRGEDQ.................RSAALQSMRDIVAGFDLPDG...........PAHH.DLTHHVDNQGYE...
L2FQ62_COLGN/47-355AVIGAQYEPNMK.........HD.......GSALRTMSEFITSNSATPE..SR.......PGFH.EVAAVTDNRGFY...
M7SDY7_EUTLA/46-400AMIGVQYASKAD.........ADSDSNSDTGAGISKLSSFFTTPRPDQQSSNSPPAPIPTPAFS.ELASVTDNRGFF...
F9G6T4_FUSOF/15-335AIFGCQYHADTP..............STDKLELIEKFDNLIKDA.SVPV................ERL....EQNNI...
E9EGK8_METAQ/37-344AYIGIQPLGAPKA...............AVDKAVKDIQSWLDESS.AFK...........PQAF.ESFGVINGDDTQ...
G9MZH7_HYPVG/2-314AVIGAQFPSKTG.........KE.......EVAISKVNSFLTFPGEDGEESLN.......PEFS.EWAAVTDHKGFY...
C7ZI82_NECH7/15-335SLFGCQYQAESP..............STAKLDLINKFEDLIKVA.ALHV................EEF....EQNDL...
S3DKC9_GLAL2/17-348GLFGIQYTTLTP................EKTKAISTLYTILSQS.AGRV................DHLR..TEDHGFKSI
A5V4Y9_SPHWW/44-337ASYGVQGRESGD.................VAAALAHVRALRATL...DA...........DVRHVDLARYVDEAGYD...
Q5B890_EMENI/326-643AVFGIQRLEANN.................ANLLIDAFNAVFTTN.VPII................EHLE...QDDPT...
U1HNF8_ENDPU/45-351AIMGAQFSSASD.........DD.......GSAISKLMGHINC.SLD.R..LR.......PSFW.ELASVTDNSGAY...
T0K4N5_COLGC/37-343AYIGVQPHSSDND................IEQVNAAVQAWLDED..EDP...........PLAK.EQFNYLDGDDLP...
B2WMJ9_PYRTR/7-318AIMGAQHACTIG.........AD.......SAGISTIKEFVRDAPESLR...........PSFW.EVTSVVDKKGAY...
R8BIH2_TOGMI/17-327AIFGVQYQGEKP..............TGRQADFISMLGNLINKR..AHF................DRIIVP.GKDGL...
G3XZK7_ASPNA/17-337..TGTQPHTPPT....................LTTELSSLFASAAS...................DSLCAHTETLHQHHT
R8BET2_TOGMI/15-336TTFGAQYHGNTP..............SESKAALIAEFDTALKAA.AVFV................EDL....INDDTERD
C7ZFH7_NECH7/16-326GIYGIQYQGQSP..............SGRQLDLIQKFDELISGQ..AHL................DRITVP.GNDGF...
Q6FBU3_ACIAD/44-342AYFGVQFKSEQK..................AIALKAMQHIVQSFSLDNG...........PQNH.DITHHTDNQGYE...
S0DLH6_GIBF5/58-358..LGVQHLPSTD.................PADAIDTIRQAIHTKSG..............PHHH.IRSSFTDSSGYR...
Q4WIY1_ASPFU/14-338AYIGVQQRGAQTD.EG........LLAESVDAAVNSIQRWIAEGP.STA...........PASI.EQFQVLDGDDVP...
K2SG27_MACPH/15-335SLFGCQYHSPQP..............DAKKTALIQNFDRLLDRA.AAHV................ETL....EQNEPTPP
I1S1Z5_GIBZE/37-347AYIGVQKHSDTPE............AEDARDKSIAIIQSWIQG...DTD...........PLAH.ETFTVIDGCDTQ...
T0KQZ3_COLGC/16-328GIFGVQYAGDEP..............AGRQLDLIQSFDALIDGK..AHL................DRIVYPTKNKPF...
M2V8J7_COCH5/50-359AIIGVQHEDSTN.........LQ.......GPAYQKLVSFVEQGSEMSK...........PKYW.EAAAVIDNRGFR...
C5FDU1_ARTOC/82-390AIIGAQYSSAAE.........ND.......GVAMSKVLEFMKN.PSDAT..AQ.......PSFR.ELVSVTDPNGSY...
K9GEU7_PEND2/14-335AVFGIQYPAGNP..............TDSQKALTGEFDGLISGH.AAHI................DTLL...QDGCATPN
C7Z148_NECH7/37-347AYIGIQKHSNDQA............TSDAQKEATSAIQAWLKG...HHG...........PSAF.ESFTVIDGSDVE...
G9P8B6_HYPAI/42-386TYIGIQPRHEENPAKGIHTELHAHVTSAVQRKVGAMIEDWARQGAGSLA...........PILW.EKMYVEAGYDLP...
A7IFL4_XANP2/40-340AYFGLQGQDLAW...................DEQKAFFDRLQTSFGTDG...........PVAH.EIMRMHDETGAV...
E6WMT6_PANSA/44-342AYLGVQFREEQR..................AAAITAMQHIVRSFSLDNG...........PGNH.DVTFHTDNQGFG...
A1R5Y5_ARTAT/55-350AFLGVQSRAPLS..................HEAKVASAGMWELCANEDG...........PMSR.EHAVHTDEQGFD...
M7TNP5_BOTF1/17-355GIFGVQHEEFTP................EKAVFVSTLYKLLSSS.ANRV................DHLQ..DESHGLPRH
D8MJY1_ERWBE/44-340AYFGIQARTCLD.....................ISALDEITDRFSSADG...........PGHW.DIASCKDQAGFY...
A1CFW9_ASPCL/36-355AYIGVQDRESCAN........GQPIHNKAYQDAVEAIQTWITADP.SIA...........ASSV.EQFEVLDGDDTP...
N1QD40_PSEFD/15-330AIFGCQYHDEEP..............DASKSALIARFQSLLSQSPAKHV................ETL....ESDDINKD
M3B660_SPHMS/50-394AIIGVQHETPID.........PQ.......GTDYQKLVDFVANSPESSR...........PKYW.EAAAVTDNRGFQ...
C9STN6_VERA1/46-354AVVGAQYPSASR.........ND.......GNAIKAVSSFI..DLSSPR..SR.......PGFH.EVAAVTDNQGHF...
F8J9L9_HYPSM/46-346SYFGVQVEGEEK.................KDQALAALQNIVASFKEQNG...........PARY.DLVRFIDAQGYF...
B8NMG3_ASPFN/17-331TLFGVQQPDDVQ..............SPATENLIRTFSHLITGA.NCHL................DQVT...QDGIVSPG
N4VS79_COLOR/45-355AVIGAQYESIDK.........AD.......GGAVAQLTQFTTSKAVAAE..SR.......PQFS.EWASVTDNKGYY...
B8NPL1_ASPFN/37-350TYIGVQRHHGLDI...............GLTKCLAAIERWLATDQ.DNA...........PAAV.ERFRVIDGDDTP...
C9SXX8_VERA1/37-348AYIGVQRHAADEP............CLRADAQIASAIRAWLEA...GHG...........PAVF.EAFAMIDGAEAT...
I1RQY0_GIBZE/15-329SVFGCQYHAEAP..............SVEKTELICRFDKLIDSA.AIHV................EHL....EQNDV...
F9X370_ZYMTI/46-354AIIGVQRGGSID..............LRPHSAGFKEIVSFVEAPLDKSR...........PRYW.EAATVTDNRGYF...
F9WY10_ZYMTI/41-342.YVGIQSRGNGSA...............AQSKAESIVQALLD....ESK...........APAI.DTFRVTNGFDVK...
K2RZK8_MACPH/39-345.YVGVQKHISNAT............TDAAATKAKNLLLEWL...S.DVH...........PEAH.ETFTVLEGDDEV...
Q0U2P3_PHANO/37-344AYIGVQQHIDDNE............AANSAAQAIQQVKKWLVQ...DDG...........PATH.ESFTVIEDDSTK...
N4V6I5_COLOR/37-346AYIGVQSHSGDSV..............EATETIRKSIENWANTVR.DDR...........PLAI.ETFNHIMGDDAP...
C5G803_AJEDR/45-352AVVGAQYSTPTD.........ED.......GLAMSTVSGFINN.PTAAG..KK.......PSFW.ELASVTDNRGAY...
G9MHE5_HYPVG/42-380SYIGIQPRHEEIPVRGSHTELNAHVSSAAQRTAATKIEEWIRQGAGELA...........PVLW.EKTYVEAGYDVP...
Q0CF39_ASPTN/15-333AVFGCQYHGLQP..............NASKSALASEFNDLIQEA.SVPV................EVM....EHDDFELE
H6BUX5_EXODN/41-346.YLGVQCHAGDMN...............SLANVERIINEFLNHP..ASA...........AESI.EVFRVILGNDLP...
C6WDR0_ACTMD/40-337ARFGVQTDDS....................AAGVKAIARVLELAAGESG...........PALV.ERVSDDDSE......
N1S900_FUSC4/37-346AYIGVQSHSDTQD............FDIARNKATEIIQAWVSS...DTG...........PEAY.ETFAVIDGCDVQ...
D4AMZ1_ARTBC/45-352AIIGAQYASAAG.........ND.......GAAISKILEFVKS.PTDTE..VR.......PSFW.ELASVTDANGSY...
D8J0A9_HERSS/44-342AYLGIQFKEEKR..................AQALQAMRHIVSSFALPDG...........PGNH.DMSYHLDNQGYG...
N1Q9B6_PSEFD/42-344.YVGAQCHRGNTA...............ARERAEKVIEDILN.S..NST...........PPII.DTFRVTHGFDLV...

PF07876

Q748N1_GEOSL/2-96--------------------------------------------------------------------------------
A9CJX0_AGRFC/2-102--------------------------------------------------------------------------------
Q740A8_MYCPA/82-179--------------------------------------------------------------------------------
Q7S333_NEUCR/57-160--------------------------------------------------------------------------------
Q98H26_RHILO/2-102--------------------------------------------------------------------------------
Y4036_STRCO/2-97--------------------------------------------------------------------------------
Q89RS9_BRADU/5-102--------------------------------------------------------------------------------
DABB1_ARATH/116-206--------------------------------------------------------------------------------
DABB1_ARATH/5-102--------------------------------------------------------------------------------
Q8XM37_CLOPE/2-100--------------------------------------------------------------------------------
Q98BN1_RHILO/2-96--------------------------------------------------------------------------------
Q7MWG5_PORGI/2-100--------------------------------------------------------------------------------
Q7UFZ5_RHOBA/16-113--------------------------------------------------------------------------------
POP3_ARATH/8-104--------------------------------------------------------------------------------
Y5258_ARATH/6-100--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/40-141--------------------------------------------------------------------------------
Q7N2N7_PHOLL/12-107--------------------------------------------------------------------------------
UP3_ARATH/158-254--------------------------------------------------------------------------------
Q7SEW8_NEUCR/10-117--------------------------------------------------------------------------------
Q7D0A2_AGRFC/2-93--------------------------------------------------------------------------------
Q726I9_DESVH/2-101--------------------------------------------------------------------------------
Q7URH4_RHOBA/33-129--------------------------------------------------------------------------------
Q97LN9_CLOAB/2-94--------------------------------------------------------------------------------
Q6LGQ4_PHOPR/2-98--------------------------------------------------------------------------------
Q8KCZ4_CHLTE/2-100--------------------------------------------------------------------------------
Q7S418_NEUCR/3-107--------------------------------------------------------------------------------
Q8ABC5_BACTN/2-99--------------------------------------------------------------------------------
Q6LYV0_METMP/2-100--------------------------------------------------------------------------------
Q82QQ6_STRAW/2-93--------------------------------------------------------------------------------
Q9F304_STRCO/2-93--------------------------------------------------------------------------------
UP3_ARATH/49-144--------------------------------------------------------------------------------
Q8RF81_FUSNN/2-98--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/154-248--------------------------------------------------------------------------------
Q9A628_CAUCR/2-100--------------------------------------------------------------------------------
B9HX68_POPTR/9-106--------------------------------------------------------------------------------
B9HX69_POPTR/16-111--------------------------------------------------------------------------------
H2VFL6_ZYMMO/42-154--------------------------------------------------------------------------------
H7C7T4_BRADU/2-94--------------------------------------------------------------------------------
Q2YP23_BRUA2/2-92--------------------------------------------------------------------------------
Q8LQD2_ORYSJ/11-106--------------------------------------------------------------------------------

PF03992

HMOA_BACSU/1-78--------------------------------------------------------------------------------
Q930A7_RHIME/30-107--------------------------------------------------------------------------------
Q9L164_STRCO/44-120--------------------------------------------------------------------------------
Q930L9_RHIME/3-79--------------------------------------------------------------------------------
HDOX_LISMO/1-86--------------------------------------------------------------------------------
WH42_STRCO/45-121--------------------------------------------------------------------------------
Q8Y476_LISMO/1-77--------------------------------------------------------------------------------
Q98L66_RHILO/1-81--------------------------------------------------------------------------------
Q98HA4_RHILO/1-77--------------------------------------------------------------------------------
Q9A6W1_CAUCR/113-186--------------------------------------------------------------------------------
O33291_MYCTU/2-75--------------------------------------------------------------------------------
Q8YAL6_LISMO/1-77--------------------------------------------------------------------------------
Q5LR19_RUEPO/12-92--------------------------------------------------------------------------------
NECA1_HUMAN/251-326--------------------------------------------------------------------------------
Q8XYB2_RALSO/23-99--------------------------------------------------------------------------------
Q9CLF6_PASMU/1-77--------------------------------------------------------------------------------
Q8NLF1_CORGL/2-78--------------------------------------------------------------------------------
O06569_MYCTU/1-77--------------------------------------------------------------------------------
Q8NRX5_CORGL/1-76--------------------------------------------------------------------------------
Q9I1R9_PSEAE/4-80--------------------------------------------------------------------------------
Q9I267_PSEAE/43-119--------------------------------------------------------------------------------
Q9RTW6_DEIRA/23-100--------------------------------------------------------------------------------
Q9RXN8_DEIRA/1-77--------------------------------------------------------------------------------
Q9FC02_STRCO/14-92--------------------------------------------------------------------------------
Q9K649_BACHD/1-78--------------------------------------------------------------------------------
Q92MY2_RHIME/1-77--------------------------------------------------------------------------------
HDOX_BACHD/1-78--------------------------------------------------------------------------------
Q9RX23_DEIRA/3-80--------------------------------------------------------------------------------
Q92N21_RHIME/1-81--------------------------------------------------------------------------------
NECA2_HUMAN/285-360--------------------------------------------------------------------------------
Q8XW80_RALSO/11-88--------------------------------------------------------------------------------
Q9HY51_PSEAE/4-80--------------------------------------------------------------------------------
Q97V29_SULSO/1-78--------------------------------------------------------------------------------
Y1783_SYNY3/49-125--------------------------------------------------------------------------------
A9CGS9_AGRFC/10-86--------------------------------------------------------------------------------
Y2021_HALSA/401-477--------------------------------------------------------------------------------
Q8UIT6_AGRFC/6-83--------------------------------------------------------------------------------
Q8NRX6_CORGL/1-76--------------------------------------------------------------------------------
Q9ABN2_CAUCR/2-78--------------------------------------------------------------------------------
Q9YCC3_AERPE/2-78--------------------------------------------------------------------------------
Q8TTU6_METAC/1-76--------------------------------------------------------------------------------
Q9X9W3_STRCO/128-214--------------------------------------------------------------------------------
O54100_STRCO/29-106--------------------------------------------------------------------------------
Q9CFE4_LACLA/2-80--------------------------------------------------------------------------------
Q92Y06_RHIME/4-80--------------------------------------------------------------------------------
YQJZ_BACSU/12-86--------------------------------------------------------------------------------
Q8PEE0_XANCP/7-83--------------------------------------------------------------------------------
A9CLL3_AGRFC/1-78--------------------------------------------------------------------------------
Q9HYL5_PSEAE/1-78--------------------------------------------------------------------------------
Q7CRR7_AGRFC/5-81--------------------------------------------------------------------------------
Q9HHS4_HALSA/1-77--------------------------------------------------------------------------------
Q9I5L9_PSEAE/2-79--------------------------------------------------------------------------------
Q8KL47_RHIEC/8-84--------------------------------------------------------------------------------
LSRG_ECOLI/1-77--------------------------------------------------------------------------------
Q98HP0_RHILO/1-74--------------------------------------------------------------------------------
Q8Y824_LISMO/4-80--------------------------------------------------------------------------------
Q9I6L9_PSEAE/2-78--------------------------------------------------------------------------------
Q9KLV5_VIBCH/1-77--------------------------------------------------------------------------------
Q983R7_RHILO/10-88--------------------------------------------------------------------------------
NECA3_HUMAN/295-370--------------------------------------------------------------------------------
Q8NMA1_CORGL/2-78--------------------------------------------------------------------------------
Q9RSM4_DEIRA/18-94--------------------------------------------------------------------------------
Y0793_MYCTU/4-79--------------------------------------------------------------------------------
Q9JYI1_NEIMB/3-79--------------------------------------------------------------------------------
Q9A6G2_CAUCR/1-78--------------------------------------------------------------------------------
Q9I1K5_PSEAE/247-321--------------------------------------------------------------------------------
Q97DS8_CLOAB/1-78--------------------------------------------------------------------------------
Q9CHY3_LACLA/1-77--------------------------------------------------------------------------------
A9CJ79_AGRFC/1-77--------------------------------------------------------------------------------
Q98DQ1_RHILO/1-77--------------------------------------------------------------------------------
HMOB_BACSU/65-140--------------------------------------------------------------------------------
YCZJ_BACSU/1-78--------------------------------------------------------------------------------
Q9RSI3_DEIRA/10-86--------------------------------------------------------------------------------
Q92VV2_RHIME/1-77--------------------------------------------------------------------------------
Q8RDZ4_FUSNN/112-188--------------------------------------------------------------------------------
A9CHT4_AGRFC/1-79--------------------------------------------------------------------------------
Q9RKA2_STRCO/1-77--------------------------------------------------------------------------------
Q9ZBJ4_STRCO/2-77--------------------------------------------------------------------------------
Q9RX69_DEIRA/1-77--------------------------------------------------------------------------------
YCNE_BACSU/1-77--------------------------------------------------------------------------------
A5FGC9_FLAJ1/1-73--------------------------------------------------------------------------------
A9WHE0_CHLAA/1-72--------------------------------------------------------------------------------
H7C6P0_BRADU/1-79--------------------------------------------------------------------------------
YGIN_ECOLI/1-87--------------------------------------------------------------------------------
MHUD_MYCTU/3-76--------------------------------------------------------------------------------
Q2FV13_STAA8/45-118--------------------------------------------------------------------------------
HDOX1_STAA8/3-78--------------------------------------------------------------------------------
HDOX2_STAA8/1-77--------------------------------------------------------------------------------
Q2K560_RHIEC/1-80--------------------------------------------------------------------------------
Q2YKI2_BRUA2/1-80--------------------------------------------------------------------------------
Q2YLT4_BRUA2/1-77--------------------------------------------------------------------------------
Q79ZD9_STRAW/18-90--------------------------------------------------------------------------------
Q8CZ78_STRR6/12-86--------------------------------------------------------------------------------
X2H731_9GAMM/1-76--------------------------------------------------------------------------------

PF16291

Q5WAX8_BACSK/3-90--------------------------------------------------------------------------------
G8S1E6_ACTS5/2-84--------------------------------------------------------------------------------
D4ZEB5_SHEVD/2-88--------------------------------------------------------------------------------
D5DXX8_BACMQ/2-88--------------------------------------------------------------------------------
Q089G9_SHEFN/2-83--------------------------------------------------------------------------------
U5L684_9BACI/2-91--------------------------------------------------------------------------------
Q65N75_BACLD/114-202--------------------------------------------------------------------------------
YDBC_BACSU/2-92--------------------------------------------------------------------------------
Q81QN5_BACAN/2-87--------------------------------------------------------------------------------
B5I8G4_9ACTN/2-86--------------------------------------------------------------------------------
F8JVN5_STREN/2-86--------------------------------------------------------------------------------
V4IUD6_9ACTN/2-86--------------------------------------------------------------------------------

PF11695

Q9A5F4_CAUCR/31-168--------------------------------------------------------------------------------
F8EE97_RUNSL/6-145--------------------------------------------------------------------------------
A4XU80_PSEMY/15-152--------------------------------------------------------------------------------
G8TAU1_NIAKG/5-143--------------------------------------------------------------------------------
Q0RPH8_FRAAA/6-148--------------------------------------------------------------------------------
Q0RBQ9_FRAAA/10-153--------------------------------------------------------------------------------
G0FWI4_AMYMS/6-149--------------------------------------------------------------------------------
E0TC84_PARBH/7-144--------------------------------------------------------------------------------
Q9XAE9_STRCO/9-147--------------------------------------------------------------------------------
U5W6J8_9ACTN/6-143--------------------------------------------------------------------------------
C6WHE5_ACTMD/7-164--------------------------------------------------------------------------------
Q0APS8_MARMM/5-139--------------------------------------------------------------------------------
Q163R1_ROSDO/8-148--------------------------------------------------------------------------------
E4N6J1_KITSK/26-165--------------------------------------------------------------------------------
I2EVC9_EMTOG/6-144--------------------------------------------------------------------------------
G0L103_ZOBGA/6-144--------------------------------------------------------------------------------
M4ZXH9_9ACTN/6-146--------------------------------------------------------------------------------
D2QP51_SPILD/3-141--------------------------------------------------------------------------------
A1WRH2_VEREI/5-143--------------------------------------------------------------------------------
K0EXQ7_9NOCA/7-138--------------------------------------------------------------------------------
U5QGK2_9CYAN/8-146--------------------------------------------------------------------------------
S6AKH1_PSERE/7-144--------------------------------------------------------------------------------
I0K5K2_9BACT/3-141--------------------------------------------------------------------------------
D2ATU4_STRRD/6-142--------------------------------------------------------------------------------
M4XI80_PSEDE/7-145--------------------------------------------------------------------------------
Q027R7_SOLUE/5-143--------------------------------------------------------------------------------
A4FAH4_SACEN/6-145--------------------------------------------------------------------------------
E2Q5L4_STRC2/8-147--------------------------------------------------------------------------------
E3J464_FRASU/10-153--------------------------------------------------------------------------------
B0T5Z4_CAUSK/7-144--------------------------------------------------------------------------------
F4KSW9_HALH1/6-143--------------------------------------------------------------------------------
K0C7N6_ALCDB/6-143--------------------------------------------------------------------------------
I0HGL4_ACTM4/6-144--------------------------------------------------------------------------------
Q0BYF9_HYPNA/5-155--------------------------------------------------------------------------------
C7QH43_CATAD/16-156--------------------------------------------------------------------------------
D6X6B2_STRPR/13-151--------------------------------------------------------------------------------
G8SIB6_ACTS5/6-144--------------------------------------------------------------------------------
B9JB79_AGRRK/2-147--------------------------------------------------------------------------------
B9JTF5_AGRVS/7-155--------------------------------------------------------------------------------
A9B229_HERA2/6-143--------------------------------------------------------------------------------
R4LEJ6_9ACTN/5-162--------------------------------------------------------------------------------
D7B9L7_NOCDD/15-153--------------------------------------------------------------------------------
F4AZ85_DOKS4/5-144--------------------------------------------------------------------------------
V9VXL5_9RHOB/7-167--------------------------------------------------------------------------------
C5BJX2_TERTT/5-143--------------------------------------------------------------------------------
M9R7J4_9RHOB/3-143--------------------------------------------------------------------------------
F3ZD85_9ACTN/31-189--------------------------------------------------------------------------------
A1K291_AZOSB/3-140--------------------------------------------------------------------------------
H2JWD5_STRHJ/4-164--------------------------------------------------------------------------------
S5VG62_STRC3/12-150--------------------------------------------------------------------------------
Q2JDS7_FRASC/6-148--------------------------------------------------------------------------------
Q15UR5_PSEA6/3-141--------------------------------------------------------------------------------

PF07682

C7LRC9_DESBD/11-306--------------------------------------------------------------------------------
L0DXR4_THIND/8-328--------------------------------------------------------------------------------
F8I6C7_SULAT/3-301--------------------------------------------------------------------------------
O66762_AQUAE/8-332--------------------------------------------------------------------------------
Q6L0W6_PICTO/3-301--------------------------------------------------------------------------------
F4B4D5_ACIHW/1-294--------------------------------------------------------------------------------
D0L035_HALNC/5-309--------------------------------------------------------------------------------
L0DTB9_THIND/25-315--------------------------------------------------------------------------------
Q972K4_SULTO/3-303--------------------------------------------------------------------------------

PF07978

Q7PGV6_ANOGA/173-270--------------------------------------------------------------------------------
Q7SGJ2_NEUCR/232-329--------------------------------------------------------------------------------
Q5LMH4_RUEPO/1-102--------------------------------------------------------------------------------
Q6W252_SINFN/3-102--------------------------------------------------------------------------------
Q98EJ3_RHILO/1-102--------------------------------------------------------------------------------
Q89P12_BRADU/7-101--------------------------------------------------------------------------------
Q89KU9_BRADU/3-106--------------------------------------------------------------------------------
Q82QD1_STRAW/4-107--------------------------------------------------------------------------------
NIPS2_MOUSE/182-279--------------------------------------------------------------------------------
Q98DQ0_RHILO/2-103--------------------------------------------------------------------------------
Q98IN9_RHILO/48-151--------------------------------------------------------------------------------
Q89JD9_BRADU/9-109--------------------------------------------------------------------------------
Q5M949_RAT/37-136--------------------------------------------------------------------------------
Q7VX89_BORPE/3-102--------------------------------------------------------------------------------
Q983U2_RHILO/146-257--------------------------------------------------------------------------------
NIPS1_MOUSE/185-282--------------------------------------------------------------------------------
Q88JP3_PSEPK/3-104--------------------------------------------------------------------------------
Q6C7U3_YARLI/393-490--------------------------------------------------------------------------------
Q5M949_RAT/146-245--------------------------------------------------------------------------------
Q89P26_BRADU/3-96--------------------------------------------------------------------------------
Q89P26_BRADU/107-202--------------------------------------------------------------------------------
Q983U2_RHILO/19-118--------------------------------------------------------------------------------
A9CLJ4_AGRFC/3-102--------------------------------------------------------------------------------
NPS3A_PONAB/37-136--------------------------------------------------------------------------------
A9CJ80_AGRFC/1-102--------------------------------------------------------------------------------
YMQ1_CAEEL/427-524--------------------------------------------------------------------------------
Q63UF8_BURPS/3-102--------------------------------------------------------------------------------
Q6N5T9_RHOPA/71-174--------------------------------------------------------------------------------
Q7UP06_RHOBA/160-263--------------------------------------------------------------------------------
A6VZH8_MARMS/5-99--------------------------------------------------------------------------------
F1QWR0_DANRE/62-160--------------------------------------------------------------------------------
F6W3L2_XENTR/18-115--------------------------------------------------------------------------------
Q2YLT3_BRUA2/5-100--------------------------------------------------------------------------------
S6AQW2_PSERE/106-203--------------------------------------------------------------------------------

PF08803

A8EUX1_ARCB4/4-99--------------------------------------------------------------------------------
E3JD16_FRASU/8-97--------------------------------------------------------------------------------
F4PWG8_DICFS/4-99--------------------------------------------------------------------------------
Q5LVU2_RUEPO/6-101--------------------------------------------------------------------------------
Q8FSM8_COREF/4-99--------------------------------------------------------------------------------
Q6BHZ0_DEBHA/4-99--------------------------------------------------------------------------------
Q7CPL0_SALTY/5-100--------------------------------------------------------------------------------
Q6LHD1_PHOPR/17-112--------------------------------------------------------------------------------
M1NIW1_9CORY/4-99--------------------------------------------------------------------------------
C1D9W2_LARHH/6-103--------------------------------------------------------------------------------
Q02D50_SOLUE/2-98--------------------------------------------------------------------------------
YDHR_ECOLI/4-99--------------------------------------------------------------------------------
Q7CGF9_YERPE/4-99--------------------------------------------------------------------------------
A8FDT9_BACP2/4-99--------------------------------------------------------------------------------
H2FWK5_OCESG/4-99--------------------------------------------------------------------------------
S5SR49_9CORY/4-99--------------------------------------------------------------------------------
C4ZIG6_THASP/4-99--------------------------------------------------------------------------------
A5WCX6_PSYWF/4-99--------------------------------------------------------------------------------
Q24N18_DESHY/3-98--------------------------------------------------------------------------------
F2F1L1_SOLSS/4-99--------------------------------------------------------------------------------
Q87FS2_VIBPA/4-99--------------------------------------------------------------------------------
B7VH82_VIBTL/3-98--------------------------------------------------------------------------------
A1K9H6_AZOSB/5-100--------------------------------------------------------------------------------
I2B924_SHIBC/5-100--------------------------------------------------------------------------------
E1Z2Y0_CHLVA/4-104--------------------------------------------------------------------------------
K9U1S6_9CYAN/4-104--------------------------------------------------------------------------------
B2IYQ3_NOSP7/78-174--------------------------------------------------------------------------------
A0KFG2_AERHH/4-100--------------------------------------------------------------------------------
Q6ZE60_SYNY3/5-101--------------------------------------------------------------------------------
D2VKN0_NAEGR/3-98--------------------------------------------------------------------------------
Q3IK82_PSEHT/4-99--------------------------------------------------------------------------------

PF07237

B5GYT2_STRC2/1-95--------------------------------------------------------------------------------
Q28SF7_JANSC/2-97--------------------------------------------------------------------------------
B9J727_AGRRK/3-103--------------------------------------------------------------------------------
Q8PBE1_XANCP/2-103--------------------------------------------------------------------------------
D2R596_PIRSD/2-117--------------------------------------------------------------------------------
J7QVW7_METSZ/2-102--------------------------------------------------------------------------------
Q0C3F1_HYPNA/123-216--------------------------------------------------------------------------------
Q1D7D3_MYXXD/125-223--------------------------------------------------------------------------------
V5S991_9RHIZ/2-103--------------------------------------------------------------------------------
G8ATI6_AZOBR/2-107--------------------------------------------------------------------------------
A6X0L9_OCHA4/2-103--------------------------------------------------------------------------------
K0CB81_ALCDB/2-104--------------------------------------------------------------------------------
K9SFX5_9CYAN/2-103--------------------------------------------------------------------------------
Q0ANC9_MARMM/2-101--------------------------------------------------------------------------------
Q82XJ8_NITEU/2-114--------------------------------------------------------------------------------
E3F379_KETVY/2-102--------------------------------------------------------------------------------
B2FL05_STRMK/2-104--------------------------------------------------------------------------------
Q89NE4_BRADU/4-102--------------------------------------------------------------------------------
Q2NCG7_ERYLH/1-101--------------------------------------------------------------------------------
F6IFW1_9SPHN/2-103--------------------------------------------------------------------------------
A4YT03_BRASO/13-113--------------------------------------------------------------------------------
B8EQ30_METSB/3-103--------------------------------------------------------------------------------
G2IQJ1_9SPHN/7-107--------------------------------------------------------------------------------
B8IJU9_METNO/2-103--------------------------------------------------------------------------------
I3U9U4_ADVKW/2-103--------------------------------------------------------------------------------
A1W852_ACISJ/5-103--------------------------------------------------------------------------------
A9FY32_SORC5/2-103--------------------------------------------------------------------------------
W0AJL6_9SPHN/125-224--------------------------------------------------------------------------------
I4B2R6_TURPD/2-101--------------------------------------------------------------------------------
I0HMS9_RUBGI/2-107--------------------------------------------------------------------------------
Q89LX7_BRADU/1-101--------------------------------------------------------------------------------
M4S0F5_9SPHN/3-103--------------------------------------------------------------------------------
S6AFX9_PSERE/2-103--------------------------------------------------------------------------------
D7A8V6_STAND/2-103--------------------------------------------------------------------------------
Q21G53_SACD2/2-103--------------------------------------------------------------------------------
B2JM74_PARP8/2-103--------------------------------------------------------------------------------
E1V408_HALED/2-103--------------------------------------------------------------------------------
Q92NA2_RHIME/2-103--------------------------------------------------------------------------------
F5XY16_RAMTT/2-117--------------------------------------------------------------------------------
A1B4H4_PARDP/2-102--------------------------------------------------------------------------------
A7HVY2_PARL1/2-102--------------------------------------------------------------------------------
I3TII5_TISMK/5-105--------------------------------------------------------------------------------
Q09CK7_STIAD/2-103--------------------------------------------------------------------------------
D0J6R4_COMT2/2-106--------------------------------------------------------------------------------
B6ITX3_RHOCS/21-122--------------------------------------------------------------------------------
Q0C3F1_HYPNA/2-102--------------------------------------------------------------------------------
G8R5I7_OWEHD/3-96--------------------------------------------------------------------------------
N0B831_9RHIZ/2-103--------------------------------------------------------------------------------
A9C096_DELAS/2-104--------------------------------------------------------------------------------
B2ID24_BEII9/3-104--------------------------------------------------------------------------------
Q0K872_CUPNH/2-103--------------------------------------------------------------------------------
F7QJ30_9BRAD/2-105--------------------------------------------------------------------------------
G2IQA6_9SPHN/2-100--------------------------------------------------------------------------------
B3PD68_CELJU/3-105--------------------------------------------------------------------------------
A9IUP3_BORPD/4-105--------------------------------------------------------------------------------
E6WPA7_PSEUU/2-104--------------------------------------------------------------------------------
Q984U4_RHILO/2-103--------------------------------------------------------------------------------
B4RHI4_PHEZH/3-103--------------------------------------------------------------------------------
B2ID24_BEII9/126-226--------------------------------------------------------------------------------
Q15TI8_PSEA6/2-104--------------------------------------------------------------------------------
F8J4V4_HYPSM/2-103--------------------------------------------------------------------------------
Q12MS1_SHEDO/2-103--------------------------------------------------------------------------------
G8MEM7_9BURK/3-106--------------------------------------------------------------------------------
D0LSP9_HALO1/2-102--------------------------------------------------------------------------------
E8RPL4_ASTEC/2-103--------------------------------------------------------------------------------
Q7VWQ1_BORPE/3-103--------------------------------------------------------------------------------
C7NJF5_KYTSD/19-131--------------------------------------------------------------------------------
A9WHX6_CHLAA/3-114--------------------------------------------------------------------------------
W0AJL6_9SPHN/2-103--------------------------------------------------------------------------------
B1ZRB2_OPITP/3-106--------------------------------------------------------------------------------
K9UEC3_9CYAN/2-102--------------------------------------------------------------------------------
Q984U4_RHILO/125-217--------------------------------------------------------------------------------
D4Z3X9_SPHJU/2-103--------------------------------------------------------------------------------
G4RAE0_PELHB/3-101--------------------------------------------------------------------------------
K9RSJ8_SYNP3/2-117--------------------------------------------------------------------------------
A8AJZ2_CITK8/2-103--------------------------------------------------------------------------------
A7HVY2_PARL1/124-224--------------------------------------------------------------------------------
E0TG43_PARBH/2-101--------------------------------------------------------------------------------
A5V8A2_SPHWW/3-103--------------------------------------------------------------------------------
E1WZE7_HALMS/3-105--------------------------------------------------------------------------------
E3F379_KETVY/124-225--------------------------------------------------------------------------------
Q3J6F6_RHOS4/3-101--------------------------------------------------------------------------------
C6XML8_HIRBI/2-102--------------------------------------------------------------------------------
D2S2U1_HALTV/4-110--------------------------------------------------------------------------------
B8IGF6_METNO/2-102--------------------------------------------------------------------------------
B6JDI6_OLICO/2-105--------------------------------------------------------------------------------
Q6MH99_BDEBA/3-105--------------------------------------------------------------------------------
Q1GX81_SPHAL/125-226--------------------------------------------------------------------------------
Q1GX81_SPHAL/2-103--------------------------------------------------------------------------------
F5Y4J2_RAMTT/2-105--------------------------------------------------------------------------------
Q98HZ3_RHILO/2-103--------------------------------------------------------------------------------
E8RPL3_ASTEC/12-111--------------------------------------------------------------------------------
M4NEX2_9GAMM/2-102--------------------------------------------------------------------------------
U4KCB2_9VIBR/2-103--------------------------------------------------------------------------------
M4VN50_9DELT/3-103--------------------------------------------------------------------------------
B8GIK1_METPE/2-107--------------------------------------------------------------------------------
Q11C17_CHESB/2-101--------------------------------------------------------------------------------
D3SAH4_THISK/2-95--------------------------------------------------------------------------------
K4KKH1_SIMAS/2-104--------------------------------------------------------------------------------
Q1D7D3_MYXXD/2-103--------------------------------------------------------------------------------
W0JAW7_9BACT/3-105--------------------------------------------------------------------------------
H5WRE5_9BURK/2-103--------------------------------------------------------------------------------
D9QND0_BRESC/3-101--------------------------------------------------------------------------------
E3I2U0_RHOVT/2-102--------------------------------------------------------------------------------
B0T2P9_CAUSK/2-103--------------------------------------------------------------------------------
A7HS11_PARL1/2-103--------------------------------------------------------------------------------
A1U2N5_MARHV/2-103--------------------------------------------------------------------------------
A2SLW6_METPP/28-129--------------------------------------------------------------------------------

PF05336

Q5KCR2_CRYNJ/37-147--------------------------------------------------------------------------------
E8N7B3_MICTS/3-106--------------------------------------------------------------------------------
G8NW33_GRAMM/3-106--------------------------------------------------------------------------------
R6A9X3_9BACT/17-125--------------------------------------------------------------------------------
Q2G5L0_NOVAD/2-105--------------------------------------------------------------------------------
E3J5G6_FRASU/3-105--------------------------------------------------------------------------------
RHAM_CLOB8/3-103--------------------------------------------------------------------------------
F3Y8K3_MELPT/17-117--------------------------------------------------------------------------------
D1BAI9_SANKS/1-101--------------------------------------------------------------------------------
R6EFZ5_9FIRM/3-103--------------------------------------------------------------------------------
E8V1U4_TERSS/3-109--------------------------------------------------------------------------------
Q8A1J5_BACTN/18-126--------------------------------------------------------------------------------
G8UKT9_TANFA/3-106--------------------------------------------------------------------------------
R7BFW5_9FIRM/6-107--------------------------------------------------------------------------------
C6VV82_DYAFD/7-106--------------------------------------------------------------------------------
X2H2T6_9GAMM/3-103--------------------------------------------------------------------------------
X6NJ28_RETFI/26-133--------------------------------------------------------------------------------
RHAM_ROSDO/4-104--------------------------------------------------------------------------------
R6NFT0_9BACE/3-109--------------------------------------------------------------------------------
C6Y2X4_PEDHD/3-103--------------------------------------------------------------------------------
M9R5B0_9RHOB/4-104--------------------------------------------------------------------------------
D8MRW2_ERWBE/3-103--------------------------------------------------------------------------------
S6C4A1_9ACTN/4-102--------------------------------------------------------------------------------
R7J4V8_9PORP/3-106--------------------------------------------------------------------------------
L0G2V5_ECHVK/4-110--------------------------------------------------------------------------------
R6YJI9_9BACE/3-109--------------------------------------------------------------------------------
D7CRS7_TRURR/5-108--------------------------------------------------------------------------------
M4WU28_PSEDE/4-110--------------------------------------------------------------------------------
E8WVL5_GRATM/3-109--------------------------------------------------------------------------------
R5F8H2_9CLOT/21-121--------------------------------------------------------------------------------
Q017X5_OSTTA/20-125--------------------------------------------------------------------------------
V2XST4_MONRO/8-118--------------------------------------------------------------------------------
RHAM_BURXL/3-103--------------------------------------------------------------------------------
D3FCI7_CONWI/3-103--------------------------------------------------------------------------------
F5YG46_TREAZ/3-104--------------------------------------------------------------------------------
X5DE39_9BACT/3-103--------------------------------------------------------------------------------
C7MF49_BRAFD/3-102--------------------------------------------------------------------------------
A6KWX7_BACV8/17-125--------------------------------------------------------------------------------
G2R0M2_THITE/36-147--------------------------------------------------------------------------------
R5CS86_9BACT/17-125--------------------------------------------------------------------------------
R5GT53_9BACT/20-128--------------------------------------------------------------------------------
U5VPP9_9ACTN/2-101--------------------------------------------------------------------------------
D1AQR2_SEBTE/6-106--------------------------------------------------------------------------------
F0RIC4_CELLC/5-113--------------------------------------------------------------------------------
H1YCQ6_9SPHI/3-103--------------------------------------------------------------------------------
RHAM_SINFN/3-103--------------------------------------------------------------------------------
M3CIR2_SPHMS/7-117--------------------------------------------------------------------------------
H6MRG6_GORPV/6-114--------------------------------------------------------------------------------
R6W2E5_9BACT/17-125--------------------------------------------------------------------------------
H1W373_COLHI/35-146--------------------------------------------------------------------------------
B7FV54_PHATC/57-181--------------------------------------------------------------------------------
R6RUK4_9BACE/17-125--------------------------------------------------------------------------------
G0FMG2_AMYMS/3-105--------------------------------------------------------------------------------
C6XPT9_HIRBI/4-112--------------------------------------------------------------------------------
RHAM_FLAJ1/6-106--------------------------------------------------------------------------------
RHAM_DINSH/3-103--------------------------------------------------------------------------------
E8V2R3_TERSS/3-104--------------------------------------------------------------------------------
Q8A896_BACTN/19-127--------------------------------------------------------------------------------
G8MFN0_9BURK/3-103--------------------------------------------------------------------------------
Q7CW72_AGRFC/3-108--------------------------------------------------------------------------------
L8GD23_PSED2/77-185--------------------------------------------------------------------------------
M2SXV3_COCH5/9-120--------------------------------------------------------------------------------
T2KM13_9FLAO/3-103--------------------------------------------------------------------------------
F2RHJ8_STRVP/6-108--------------------------------------------------------------------------------
N1PM30_DOTSN/6-116--------------------------------------------------------------------------------
Q9HK61_THEAC/2-100--------------------------------------------------------------------------------
A4AQM8_MARSH/3-108--------------------------------------------------------------------------------
C4Z7U2_EUBE2/3-103--------------------------------------------------------------------------------
C6XTA6_PEDHD/3-103--------------------------------------------------------------------------------
W0F136_9BACT/3-111--------------------------------------------------------------------------------
Q5LC58_BACFN/3-109--------------------------------------------------------------------------------
I0IAI8_PHYMF/3-105--------------------------------------------------------------------------------
J0WX79_AURST/7-117--------------------------------------------------------------------------------
R6LCZ2_9BACE/19-127--------------------------------------------------------------------------------
R6SDC5_9BACE/16-124--------------------------------------------------------------------------------
R6ARE3_9BACT/15-123--------------------------------------------------------------------------------
W0HYB7_9GAMM/6-109--------------------------------------------------------------------------------
B2JWP2_PARP8/2-109--------------------------------------------------------------------------------
RHAM_VEREI/5-105--------------------------------------------------------------------------------
R7JMG1_9PORP/19-127--------------------------------------------------------------------------------
W0EWF3_9BACT/3-103--------------------------------------------------------------------------------
G2PEQ1_STRVO/2-106--------------------------------------------------------------------------------
I2ETX1_EMTOG/3-109--------------------------------------------------------------------------------
S0DRY9_GIBF5/8-120--------------------------------------------------------------------------------
W5VZF1_9PSEU/4-102--------------------------------------------------------------------------------
F0SAK4_PSESL/3-109--------------------------------------------------------------------------------
RHAM_ENTFA/3-103--------------------------------------------------------------------------------
C1D3L6_DEIDV/10-112--------------------------------------------------------------------------------
D3AYF8_POLPA/5-111--------------------------------------------------------------------------------
Q63M67_BURPS/2-109--------------------------------------------------------------------------------
G3B870_CANTC/9-119--------------------------------------------------------------------------------
G8TJY9_NIAKG/2-108--------------------------------------------------------------------------------
A9WV51_RENSM/8-106--------------------------------------------------------------------------------
F8ENG6_RUNSL/3-109--------------------------------------------------------------------------------
G0FVD6_AMYMS/4-107--------------------------------------------------------------------------------
C7Q375_CATAD/3-106--------------------------------------------------------------------------------
C6CYW6_PAESJ/6-107--------------------------------------------------------------------------------
C7PCA4_CHIPD/3-109--------------------------------------------------------------------------------
T0N5S5_9EURY/2-100--------------------------------------------------------------------------------
Q0C0B4_HYPNA/3-108--------------------------------------------------------------------------------
G8TRD5_NIAKG/34-141--------------------------------------------------------------------------------
B5HUQ0_9ACTN/3-106--------------------------------------------------------------------------------
C9SC44_VERA1/35-148--------------------------------------------------------------------------------
U5HAV4_USTV1/5-115--------------------------------------------------------------------------------
C1E6C4_MICCC/5-111--------------------------------------------------------------------------------
D8J110_HERSS/4-109--------------------------------------------------------------------------------
H1XZT2_9SPHI/4-110--------------------------------------------------------------------------------
F1A024_DICPU/9-113--------------------------------------------------------------------------------
A0M226_GRAFK/6-114--------------------------------------------------------------------------------
H1YA87_9SPHI/12-120--------------------------------------------------------------------------------
A1WK61_VEREI/3-108--------------------------------------------------------------------------------
F0S6E2_PSESL/2-101--------------------------------------------------------------------------------
D8MW19_ERWBE/6-112--------------------------------------------------------------------------------
RHAM_TOLAT/3-103--------------------------------------------------------------------------------
R5RHB4_9FIRM/4-102--------------------------------------------------------------------------------
R7CUY6_9BACE/4-107--------------------------------------------------------------------------------
F4GKH0_SPHCD/4-103--------------------------------------------------------------------------------
M2QQB6_CERS8/8-118--------------------------------------------------------------------------------
R4LU20_9ACTN/8-112--------------------------------------------------------------------------------
RHAM_AGRVS/6-106--------------------------------------------------------------------------------
A1RAY8_ARTAT/2-103--------------------------------------------------------------------------------
A0K063_ARTS2/2-106--------------------------------------------------------------------------------
G8TPW3_NIAKG/3-103--------------------------------------------------------------------------------
Q15XN8_PSEA6/5-113--------------------------------------------------------------------------------
G2TP17_BACCO/3-103--------------------------------------------------------------------------------
D9QN17_BRESC/8-108--------------------------------------------------------------------------------
H8KVT5_SOLCM/4-109--------------------------------------------------------------------------------
G3JAD5_CORMM/9-118--------------------------------------------------------------------------------
F0LZS0_VIBFN/7-107--------------------------------------------------------------------------------
E8RLZ9_ASTEC/5-104--------------------------------------------------------------------------------
R6U745_9FIRM/3-103--------------------------------------------------------------------------------
E0RYP0_BUTPB/3-103--------------------------------------------------------------------------------
W0A8U2_9SPHN/5-114--------------------------------------------------------------------------------
F0RTW9_SPHGB/2-102--------------------------------------------------------------------------------
V5XRE7_ENTMU/3-103--------------------------------------------------------------------------------
W0JTK6_9EURY/7-109--------------------------------------------------------------------------------
F4C6L3_SPHS2/2-101--------------------------------------------------------------------------------
R5MDS1_9BACE/17-125--------------------------------------------------------------------------------
Q92VL4_RHIME/3-108--------------------------------------------------------------------------------
D5EY64_PRER2/19-127--------------------------------------------------------------------------------
E8NDA4_MICTS/4-105--------------------------------------------------------------------------------
E6SPU6_BACT6/19-127--------------------------------------------------------------------------------
C6WNL3_ACTMD/3-105--------------------------------------------------------------------------------
R7NTA6_9BACE/19-127--------------------------------------------------------------------------------
Q826A8_STRAW/2-103--------------------------------------------------------------------------------
M1VWH7_CLAP2/35-145--------------------------------------------------------------------------------
C7PNE2_CHIPD/2-102--------------------------------------------------------------------------------
A0QQ10_MYCS2/3-105--------------------------------------------------------------------------------
S8E4Q7_FOMPI/8-118--------------------------------------------------------------------------------
F4KPV2_HALH1/6-106--------------------------------------------------------------------------------
E6WCQ8_PANSA/3-103--------------------------------------------------------------------------------
D7CBT4_STRBB/3-105--------------------------------------------------------------------------------
R5V6F4_9BACE/15-123--------------------------------------------------------------------------------
F8EFY7_RUNSL/5-113--------------------------------------------------------------------------------
D2UB54_XANAP/3-111--------------------------------------------------------------------------------
R6AY66_9BACT/3-104--------------------------------------------------------------------------------
B9TP76_RICCO/180-279--------------------------------------------------------------------------------
A6L884_PARD8/3-111--------------------------------------------------------------------------------
E1VAZ6_HALED/5-103--------------------------------------------------------------------------------
H5X507_9PSEU/6-107--------------------------------------------------------------------------------
G8TKN8_NIAKG/3-111--------------------------------------------------------------------------------
E4RWF7_LEAB4/3-103--------------------------------------------------------------------------------
R5P2W9_9BACT/3-109--------------------------------------------------------------------------------
H2ISM0_RAHAC/3-103--------------------------------------------------------------------------------
C6XWC2_PEDHD/4-110--------------------------------------------------------------------------------
D2AYI7_STRRD/2-103--------------------------------------------------------------------------------
R7B568_9ACTN/14-112--------------------------------------------------------------------------------
D4LLT3_9FIRM/2-100--------------------------------------------------------------------------------
R5IF69_9FIRM/3-101--------------------------------------------------------------------------------
F8EDF5_RUNSL/27-127--------------------------------------------------------------------------------
Q9RJV5_STRCO/9-112--------------------------------------------------------------------------------
F4L4I5_HALH1/3-109--------------------------------------------------------------------------------
F4PHW1_DICFS/4-111--------------------------------------------------------------------------------
K7ARV7_9ALTE/6-114--------------------------------------------------------------------------------
A6W650_KINRD/4-107--------------------------------------------------------------------------------
R7LE58_9BACT/21-129--------------------------------------------------------------------------------
F4H154_CELFA/3-103--------------------------------------------------------------------------------
B0T1B6_CAUSK/4-110--------------------------------------------------------------------------------
G0GFQ6_SPITZ/3-103--------------------------------------------------------------------------------
Q1J3P3_DEIGD/12-114--------------------------------------------------------------------------------
RHAM_BACSU/3-103--------------------------------------------------------------------------------
I6Z2E3_MELRP/3-103--------------------------------------------------------------------------------
R6LHQ9_9BACE/3-103--------------------------------------------------------------------------------
D8PU32_SCHCM/8-118--------------------------------------------------------------------------------
D8IVV1_HERSS/3-103--------------------------------------------------------------------------------
FUCM_XANCP/5-113--------------------------------------------------------------------------------
B9KXQ9_THERP/5-109--------------------------------------------------------------------------------
A4RYA8_OSTLU/7-113--------------------------------------------------------------------------------
RHAM_PARP8/3-103--------------------------------------------------------------------------------
RHAM_LISMO/3-103--------------------------------------------------------------------------------
R5XB53_9FIRM/3-102--------------------------------------------------------------------------------
F4C913_SPHS2/3-109--------------------------------------------------------------------------------
G8QUN9_SPHPG/4-104--------------------------------------------------------------------------------
G2YVL3_BOTF4/62-172--------------------------------------------------------------------------------
RHAM_CLOPH/3-103--------------------------------------------------------------------------------
C1N719_MICPC/4-111--------------------------------------------------------------------------------
E8RTW3_ASTEC/4-112--------------------------------------------------------------------------------
Q7CTD6_AGRFC/3-108--------------------------------------------------------------------------------
I4F5E5_9ACTN/3-101--------------------------------------------------------------------------------
D1ARY4_SEBTE/3-103--------------------------------------------------------------------------------
A9WGG2_CHLAA/3-106--------------------------------------------------------------------------------
F5XNH4_MICPN/3-114--------------------------------------------------------------------------------
RHAM_LEPCP/5-105--------------------------------------------------------------------------------
RHAM_LACPL/3-103--------------------------------------------------------------------------------
D2Q2I3_KRIFD/3-102--------------------------------------------------------------------------------
M2MAG9_BAUCO/7-117--------------------------------------------------------------------------------
A3HRM9_9BACT/4-104--------------------------------------------------------------------------------
RHAM_MANSM/3-103--------------------------------------------------------------------------------
I2EVY4_EMTOG/3-103--------------------------------------------------------------------------------
L0FZ10_ECHVK/4-104--------------------------------------------------------------------------------
F9XB02_ZYMTI/6-116--------------------------------------------------------------------------------
D2QR00_SPILD/3-103--------------------------------------------------------------------------------
R4X772_TAPDE/13-123--------------------------------------------------------------------------------
K6YYZ3_9ALTE/4-112--------------------------------------------------------------------------------
R5A8F9_9CLOT/2-102--------------------------------------------------------------------------------
F8Q6Q2_SERL3/8-118--------------------------------------------------------------------------------
Q1GLV0_RUEST/3-108--------------------------------------------------------------------------------
D3F8C9_CONWI/3-101--------------------------------------------------------------------------------
I3UF06_ADVKW/5-111--------------------------------------------------------------------------------
C1DMX3_AZOVD/1-96--------------------------------------------------------------------------------
RHAM_RHILO/4-104--------------------------------------------------------------------------------
C7MA53_BRAFD/20-118--------------------------------------------------------------------------------
W0AGC7_9SPHN/4-103--------------------------------------------------------------------------------
D7BV13_STRBB/3-105--------------------------------------------------------------------------------
C4R5P5_KOMPG/10-120--------------------------------------------------------------------------------
B8N6B4_ASPFN/5-114--------------------------------------------------------------------------------
R5PSD2_9BACT/21-129--------------------------------------------------------------------------------
RHAM_OPITP/3-103--------------------------------------------------------------------------------
V6JFG7_STRNV/3-106--------------------------------------------------------------------------------
I0KE28_9BACT/2-108--------------------------------------------------------------------------------
I3ZKM1_TERRK/3-103--------------------------------------------------------------------------------
D5BBC0_ZUNPS/5-111--------------------------------------------------------------------------------
D1BY74_XYLCX/3-102--------------------------------------------------------------------------------
RHAM_OCEIH/3-103--------------------------------------------------------------------------------
J9RIB0_9ACTN/6-114--------------------------------------------------------------------------------
R6WAC2_9BACT/17-125--------------------------------------------------------------------------------
A8G9F9_SERP5/10-116--------------------------------------------------------------------------------
G0J5Y4_CYCMS/28-127--------------------------------------------------------------------------------
C7YLU2_NECH7/7-118--------------------------------------------------------------------------------
U5RUK3_9CLOT/3-103--------------------------------------------------------------------------------
R5BLL2_9FIRM/265-367--------------------------------------------------------------------------------
R5B7U2_9BACE/23-126--------------------------------------------------------------------------------
A3I2P4_9BACT/3-110--------------------------------------------------------------------------------
F6FU80_ISOV2/2-98--------------------------------------------------------------------------------
R6Y9M4_9PORP/17-125--------------------------------------------------------------------------------
R5UEH6_9FIRM/3-103--------------------------------------------------------------------------------
Q5YUK3_NOCFA/7-108--------------------------------------------------------------------------------
R5T0T1_9CLOT/5-103--------------------------------------------------------------------------------
E8V6H3_TERSS/3-109--------------------------------------------------------------------------------
Q7AJX0_BACHD/6-107--------------------------------------------------------------------------------
W0LD07_9GAMM/3-103--------------------------------------------------------------------------------
D5ET23_PRER2/3-104--------------------------------------------------------------------------------
T5AGB0_OPHSC/41-152--------------------------------------------------------------------------------
B6QAY9_TALMQ/10-121--------------------------------------------------------------------------------
R5FKH4_9ACTN/13-112--------------------------------------------------------------------------------
S3CGR6_GLAL2/40-151--------------------------------------------------------------------------------
E9QYL7_ASPFU/6-125--------------------------------------------------------------------------------
D2PT68_KRIFD/3-105--------------------------------------------------------------------------------
RHAM_BACSK/3-103--------------------------------------------------------------------------------
R6YNW1_9BACT/15-123--------------------------------------------------------------------------------
Y3871_DICDI/8-118--------------------------------------------------------------------------------
A1RB67_ARTAT/4-103--------------------------------------------------------------------------------
A5FI86_FLAJ1/3-109--------------------------------------------------------------------------------
H2JUV0_STRHJ/2-103--------------------------------------------------------------------------------
E4RRT9_LEAB4/3-109--------------------------------------------------------------------------------
RHAM_OCHA4/5-105--------------------------------------------------------------------------------
D3VH42_XENNA/3-116--------------------------------------------------------------------------------
L8X683_THACA/10-129--------------------------------------------------------------------------------
W0F1J4_9BACT/6-112--------------------------------------------------------------------------------
D2QDE5_SPILD/2-108--------------------------------------------------------------------------------
A0RPU5_CAMFF/263-366--------------------------------------------------------------------------------
RHAM_RHIEC/5-105--------------------------------------------------------------------------------
W0HUK9_9GAMM/3-103--------------------------------------------------------------------------------
I2B3V9_SHIBC/8-108--------------------------------------------------------------------------------
RHAM_PECAS/3-103--------------------------------------------------------------------------------
A4FGN1_SACEN/3-102--------------------------------------------------------------------------------
G0R4U7_ICHMG/11-113--------------------------------------------------------------------------------
Q0S9A0_RHOJR/3-104--------------------------------------------------------------------------------
Q0U0I1_PHANO/10-124--------------------------------------------------------------------------------
G9MQ27_HYPVG/10-118--------------------------------------------------------------------------------
R5YL30_9BACE/19-127--------------------------------------------------------------------------------
G0J6H2_CYCMS/3-109--------------------------------------------------------------------------------
G0AEI2_COLFT/99-206--------------------------------------------------------------------------------
RHAM_AGRFC/6-106--------------------------------------------------------------------------------
Q0PB25_CAMJE/3-104--------------------------------------------------------------------------------
RHAM_LACS1/4-107--------------------------------------------------------------------------------
A7RJ94_NEMVE/13-125--------------------------------------------------------------------------------
H2YJ08_CIOSA/7-118--------------------------------------------------------------------------------
A3I067_9BACT/3-104--------------------------------------------------------------------------------
R6D3Z6_9BACE/3-103--------------------------------------------------------------------------------
Q986Z5_RHILO/3-108--------------------------------------------------------------------------------
Q21TQ6_RHOFT/2-109--------------------------------------------------------------------------------
H2J1A2_RAHAC/4-110--------------------------------------------------------------------------------
Q3XZK3_ENTFC/3-103--------------------------------------------------------------------------------
C5AGH1_BURGB/2-109--------------------------------------------------------------------------------
I3ZIT1_TERRK/3-109--------------------------------------------------------------------------------
C9YZZ6_STRSW/2-102--------------------------------------------------------------------------------
RHAM_ACICJ/3-103--------------------------------------------------------------------------------
Q01TX0_SOLUE/3-104--------------------------------------------------------------------------------
W0J174_9BACT/3-103--------------------------------------------------------------------------------
RHAM_JANSC/3-103--------------------------------------------------------------------------------
I0HD26_ACTM4/3-105--------------------------------------------------------------------------------
R6CWI8_9BACE/3-109--------------------------------------------------------------------------------
R5IKI3_9PORP/15-123--------------------------------------------------------------------------------
C5C310_BEUC1/3-105--------------------------------------------------------------------------------

PF11639

Q2S9J0_HAHCH/1-104--------------------------------------------------------------------------------
O54144_STRCO/1-104--------------------------------------------------------------------------------

PF07110

Q98J67_RHILO/10-91--------------------------------------------------------------------------------
YTH4_RHOER/10-90--------------------------------------------------------------------------------
Q89V09_BRADU/21-102--------------------------------------------------------------------------------
B8Y4U8_9NOCA/10-91--------------------------------------------------------------------------------
Q9KGB0_BACHD/16-96--------------------------------------------------------------------------------
Q884M0_PSESM/10-93--------------------------------------------------------------------------------
Q2N8F2_ERYLH/12-112--------------------------------------------------------------------------------
D0J371_COMT2/26-114--------------------------------------------------------------------------------
Q2UH77_ASPOR/43-139--------------------------------------------------------------------------------
C9S7C3_VERA1/40-151--------------------------------------------------------------------------------
Q0UAA8_PHANO/20-125--------------------------------------------------------------------------------
B6QRR3_TALMQ/18-114--------------------------------------------------------------------------------
C9SY64_VERA1/65-158--------------------------------------------------------------------------------
B8MSU2_TALSN/18-112--------------------------------------------------------------------------------
A5VH99_SPHWW/138-221--------------------------------------------------------------------------------
A5V521_SPHWW/98-177--------------------------------------------------------------------------------
B9K152_AGRVS/13-109--------------------------------------------------------------------------------
B2W3U7_PYRTR/13-127--------------------------------------------------------------------------------
Q0U4N6_PHANO/13-123--------------------------------------------------------------------------------
B2WDV2_PYRTR/13-120--------------------------------------------------------------------------------
Q0U5I6_PHANO/13-111--------------------------------------------------------------------------------
A2QB94_ASPNC/13-115--------------------------------------------------------------------------------
A2QVN7_ASPNC/13-122--------------------------------------------------------------------------------
B8MPG2_TALSN/43-154--------------------------------------------------------------------------------
Q2UT25_ASPOR/23-122--------------------------------------------------------------------------------
C9Z9Q5_STRSW/12-103--------------------------------------------------------------------------------
A2R8B5_ASPNC/14-111--------------------------------------------------------------------------------
A5VH99_SPHWW/12-106--------------------------------------------------------------------------------
Q396J2_BURL3/130-221--------------------------------------------------------------------------------
A6GBX1_9DELT/12-106--------------------------------------------------------------------------------
C9Z9Q5_STRSW/139-234--------------------------------------------------------------------------------
B5HPI7_9ACTN/138-233--------------------------------------------------------------------------------
A8L3R3_FRASN/10-95--------------------------------------------------------------------------------
A5V7F6_SPHWW/12-99--------------------------------------------------------------------------------
A5V7F6_SPHWW/139-229--------------------------------------------------------------------------------
A4XEJ1_NOVAD/13-101--------------------------------------------------------------------------------
C7Z3Q5_NECH7/37-130--------------------------------------------------------------------------------
Q140F8_BURXL/125-207--------------------------------------------------------------------------------
C8ND54_9GAMM/12-105--------------------------------------------------------------------------------
C2M2M0_CAPGI/12-107--------------------------------------------------------------------------------
Q93AB2_YERPE/18-98--------------------------------------------------------------------------------
B8MF02_TALSN/21-117--------------------------------------------------------------------------------
MDPH_EMENI/29-132--------------------------------------------------------------------------------
C5FQT1_ARTOC/22-118--------------------------------------------------------------------------------
Q2GSS6_CHAGB/53-131--------------------------------------------------------------------------------
B8NJL1_ASPFN/19-113--------------------------------------------------------------------------------
C8VTL3_EMENI/15-109--------------------------------------------------------------------------------
Q0UIY9_PHANO/18-106--------------------------------------------------------------------------------
A2QH37_ASPNC/566-663--------------------------------------------------------------------------------
B6QDA9_TALMQ/20-117--------------------------------------------------------------------------------
A2QDU1_ASPNC/19-117--------------------------------------------------------------------------------
Q4WAY9_ASPFU/21-118--------------------------------------------------------------------------------
B2WLL6_PYRTR/30-124--------------------------------------------------------------------------------
A0A0D1CGX8_USTMA/29-132--------------------------------------------------------------------------------
C7Z0I7_NECH7/17-115--------------------------------------------------------------------------------
Q9F3V8_9PSEU/12-93--------------------------------------------------------------------------------

PF09448

Q7WWV7_CUPNH/1-109--------------------------------------------------------------------------------
I3UFX9_ADVKW/1-111--------------------------------------------------------------------------------
C5BCG5_EDWI9/1-234--------------------------------------------------------------------------------

PF07045

Q0C383_HYPNA/2-97--------------------------------------------------------------------------------
Q98DD6_RHILO/3-95--------------------------------------------------------------------------------
A8LJW3_DINSH/3-95--------------------------------------------------------------------------------
Q1GHA0_RUEST/2-94--------------------------------------------------------------------------------
A1B208_PARDP/2-94--------------------------------------------------------------------------------
A0R1N9_MYCS2/3-94--------------------------------------------------------------------------------
B2U9C2_RALPJ/3-96--------------------------------------------------------------------------------
Q1LPI6_CUPMC/3-96--------------------------------------------------------------------------------
Q0RXH4_RHOJR/2-95--------------------------------------------------------------------------------
Q129N1_POLSJ/11-101--------------------------------------------------------------------------------
B2JPM5_PARP8/3-96--------------------------------------------------------------------------------
Q21DJ6_SACD2/2-95--------------------------------------------------------------------------------
A1B8D1_PARDP/3-95--------------------------------------------------------------------------------
Q0C268_HYPNA/2-95--------------------------------------------------------------------------------
A1K1N9_AZOSB/2-94--------------------------------------------------------------------------------
Q65SN3_MANSM/24-117--------------------------------------------------------------------------------
Q0RQX9_FRAAA/2-95--------------------------------------------------------------------------------
Q3J0R2_RHOS4/3-95--------------------------------------------------------------------------------
Q1GHQ7_RUEST/2-96--------------------------------------------------------------------------------
Q5NR08_ZYMMO/2-95--------------------------------------------------------------------------------
A8L5T2_FRASN/12-105--------------------------------------------------------------------------------
Q742V7_MYCPA/6-97--------------------------------------------------------------------------------
Q165U6_ROSDO/2-94--------------------------------------------------------------------------------
A4XTJ7_PSEMY/2-95--------------------------------------------------------------------------------
A5V7J9_SPHWW/2-96--------------------------------------------------------------------------------
Q5YTA0_NOCFA/2-95--------------------------------------------------------------------------------
Q128E5_POLSJ/3-96--------------------------------------------------------------------------------
Q65QR7_MANSM/19-113--------------------------------------------------------------------------------
Q2VZK5_MAGSA/2-96--------------------------------------------------------------------------------
Q7VAI4_PROMA/7-101--------------------------------------------------------------------------------
Q28P24_JANSC/6-100--------------------------------------------------------------------------------
B2JHP1_PARP8/2-95--------------------------------------------------------------------------------
Q984S8_RHILO/2-95--------------------------------------------------------------------------------
Q89JB1_BRADU/14-107--------------------------------------------------------------------------------
A1AZL7_PARDP/2-94--------------------------------------------------------------------------------
A8LL19_DINSH/2-94--------------------------------------------------------------------------------
A8KZG9_FRASN/2-95--------------------------------------------------------------------------------
Q11KJ1_CHESB/3-95--------------------------------------------------------------------------------
Q6NCX9_RHOPA/3-96--------------------------------------------------------------------------------
Q1GFX6_RUEST/3-95--------------------------------------------------------------------------------
A1TLS8_ACIAC/3-96--------------------------------------------------------------------------------
Q46KM6_PROMT/7-101--------------------------------------------------------------------------------
Q127Z9_POLSJ/2-95--------------------------------------------------------------------------------
Q5FU37_GLUOX/2-95--------------------------------------------------------------------------------
Q98JP1_RHILO/45-139--------------------------------------------------------------------------------
Q98CT4_RHILO/9-101--------------------------------------------------------------------------------
A5V7D8_SPHWW/2-97--------------------------------------------------------------------------------
A4XXX9_PSEMY/17-110--------------------------------------------------------------------------------
A1BAV2_PARDP/2-95--------------------------------------------------------------------------------
Q28QV7_JANSC/3-95--------------------------------------------------------------------------------
Q28KV2_JANSC/2-96--------------------------------------------------------------------------------
A6WA35_KINRD/13-106--------------------------------------------------------------------------------
Q89BY8_BRADU/66-159--------------------------------------------------------------------------------
Q11E97_CHESB/2-98--------------------------------------------------------------------------------
Q6F9F1_ACIAD/2-94--------------------------------------------------------------------------------
Q16DN6_ROSDO/3-95--------------------------------------------------------------------------------
A9BN41_DELAS/3-96--------------------------------------------------------------------------------
A4X3R6_SALTO/2-95--------------------------------------------------------------------------------
Q0C4G1_HYPNA/2-95--------------------------------------------------------------------------------
Q2KDF1_RHIEC/3-95--------------------------------------------------------------------------------
Q1D8Q3_MYXXD/2-95--------------------------------------------------------------------------------
Q47EX6_DECAR/3-96--------------------------------------------------------------------------------
A7IC73_XANP2/114-206--------------------------------------------------------------------------------
Q15VR2_PSEA6/29-121--------------------------------------------------------------------------------
A6VY75_MARMS/2-96--------------------------------------------------------------------------------
Q28SX7_JANSC/3-95--------------------------------------------------------------------------------
A7HSS3_PARL1/2-95--------------------------------------------------------------------------------
Q87W43_PSESM/6-100--------------------------------------------------------------------------------
Q89X32_BRADU/22-115--------------------------------------------------------------------------------
A5FY88_ACICJ/3-95--------------------------------------------------------------------------------
Q28UH1_JANSC/27-121--------------------------------------------------------------------------------
A0QZT5_MYCS2/2-95--------------------------------------------------------------------------------
A1B124_PARDP/3-95--------------------------------------------------------------------------------
Q98G06_RHILO/23-116--------------------------------------------------------------------------------
Q215U7_RHOPB/2-95--------------------------------------------------------------------------------
A7IC73_XANP2/3-95--------------------------------------------------------------------------------
B2HIJ1_MYCMM/2-95--------------------------------------------------------------------------------
B4EJY9_BURCJ/2-95--------------------------------------------------------------------------------
H7C7V4_BRADU/3-95--------------------------------------------------------------------------------
Q2YQU8_BRUA2/3-95--------------------------------------------------------------------------------
Q4FP83_PELUB/2-95--------------------------------------------------------------------------------
Q63KP2_BURPS/3-94--------------------------------------------------------------------------------
Q7VW78_BORPE/2-94--------------------------------------------------------------------------------
Q882F9_PSESM/2-94--------------------------------------------------------------------------------

PF04486

R4LLP7_9ACTN/1-119--------------------------------------------------------------------------------
G2PCT7_STRVO/148-259--------------------------------------------------------------------------------
D5UC49_CELFN/1-110--------------------------------------------------------------------------------
D2AY36_STRRD/1-119--------------------------------------------------------------------------------
R4LAU9_9ACTN/2-117--------------------------------------------------------------------------------
WH42_STRCO/160-272--------------------------------------------------------------------------------
Q79ZD9_STRAW/136-248--------------------------------------------------------------------------------
E4NJ49_KITSK/148-260--------------------------------------------------------------------------------
D2AY76_STRRD/1-119--------------------------------------------------------------------------------
G0FY92_AMYMS/1-119--------------------------------------------------------------------------------
S5UX09_STRC3/133-245--------------------------------------------------------------------------------
C7Q5R3_CATAD/144-255--------------------------------------------------------------------------------
C7N0C8_SACVD/1-119--------------------------------------------------------------------------------

PF04673

E2PW02_STRC2/7-110--------------------------------------------------------------------------------
D2S3T2_GEOOG/2-104--------------------------------------------------------------------------------
G2NAB9_STREK/2-105--------------------------------------------------------------------------------
A8L2X4_FRASN/16-119--------------------------------------------------------------------------------
G2NGK3_STREK/2-105--------------------------------------------------------------------------------
I4EQF5_9ACTN/2-104--------------------------------------------------------------------------------
Q79ZD3_STRAW/2-105--------------------------------------------------------------------------------
A4X6Z4_SALTO/2-106--------------------------------------------------------------------------------
D9SZ16_MICAI/3-104--------------------------------------------------------------------------------
E3IZH8_FRASU/3-106--------------------------------------------------------------------------------
Q47QL4_THEFY/2-106--------------------------------------------------------------------------------
G2PCT1_STRVO/4-107--------------------------------------------------------------------------------
Q79ZE6_STRAW/119-220--------------------------------------------------------------------------------
R4LMZ7_9ACTN/2-104--------------------------------------------------------------------------------
W5W942_9PSEU/3-104--------------------------------------------------------------------------------
F4F9S6_VERMA/2-104--------------------------------------------------------------------------------
Q2J929_FRASC/24-127--------------------------------------------------------------------------------
A4X7V4_SALTO/2-104--------------------------------------------------------------------------------
D2S3R9_GEOOG/48-148--------------------------------------------------------------------------------
A4X7V2_SALTO/2-104--------------------------------------------------------------------------------
K0K773_SACES/2-106--------------------------------------------------------------------------------
E4NJ55_KITSK/2-105--------------------------------------------------------------------------------
C7Q5R9_CATAD/2-105--------------------------------------------------------------------------------
C9Z709_STRSW/2-105--------------------------------------------------------------------------------
D9SXY7_MICAI/2-104--------------------------------------------------------------------------------
C7QAF1_CATAD/2-106--------------------------------------------------------------------------------
F8B670_FRADG/33-136--------------------------------------------------------------------------------
D5UC58_CELFN/3-106--------------------------------------------------------------------------------
W5W942_9PSEU/116-220--------------------------------------------------------------------------------
YHB2_STRCO/2-106--------------------------------------------------------------------------------
D9SZ16_MICAI/114-218--------------------------------------------------------------------------------
Q79ZE6_STRAW/2-108--------------------------------------------------------------------------------
F8B4Y4_FRADG/2-104--------------------------------------------------------------------------------
H2JYH9_STRHJ/2-105--------------------------------------------------------------------------------
K0EZY9_9NOCA/3-105--------------------------------------------------------------------------------
C7N0C9_SACVD/2-104--------------------------------------------------------------------------------
F8B0H7_FRADG/2-104--------------------------------------------------------------------------------
F4FBR0_VERMA/3-105--------------------------------------------------------------------------------
D2S3R9_GEOOG/159-264--------------------------------------------------------------------------------
Q9XCV6_STRVP/2-106--------------------------------------------------------------------------------
D2AY42_STRRD/2-104--------------------------------------------------------------------------------

PF03927

Q0PAA5_CAMJE/4-75--------------------------------------------------------------------------------
A6Q707_SULNB/2-77--------------------------------------------------------------------------------
E6X0J9_NITSE/1-76--------------------------------------------------------------------------------
Q6LTW0_PHOPR/6-81--------------------------------------------------------------------------------
C5B7B8_EDWI9/6-82--------------------------------------------------------------------------------
C0QTT2_PERMH/1-76--------------------------------------------------------------------------------
C4K982_THASP/1-77--------------------------------------------------------------------------------
F7YR78_VIBA7/6-81--------------------------------------------------------------------------------
S6CGZ1_9GAMM/4-79--------------------------------------------------------------------------------
Q9CKL9_PASMU/13-89--------------------------------------------------------------------------------
E6WCW8_PANSA/7-83--------------------------------------------------------------------------------
H7C6L0_BRADU/34-109--------------------------------------------------------------------------------
V5SFH9_9RHIZ/10-84--------------------------------------------------------------------------------
Q9I4G2_PSEAE/5-80--------------------------------------------------------------------------------
D4ZL47_SHEVD/11-86--------------------------------------------------------------------------------
A4XWL9_PSEMY/5-79--------------------------------------------------------------------------------
H2FWI7_OCESG/6-81--------------------------------------------------------------------------------
Q080B9_SHEFN/5-79--------------------------------------------------------------------------------
F2NPP1_MARHT/1-76--------------------------------------------------------------------------------
Q1LFZ4_CUPMC/19-94--------------------------------------------------------------------------------
Q2W3T0_MAGSA/19-94--------------------------------------------------------------------------------
G8PIR3_PSEUV/16-91--------------------------------------------------------------------------------
F8AE25_THEID/3-76--------------------------------------------------------------------------------
Q7VPJ8_HAEDU/10-86--------------------------------------------------------------------------------
Q6D5Z1_PECAS/5-81--------------------------------------------------------------------------------
B0URQ2_HISS2/14-89--------------------------------------------------------------------------------
A0RQ30_CAMFF/1-74--------------------------------------------------------------------------------
Q487G3_COLP3/11-86--------------------------------------------------------------------------------
E6WPJ5_PSEUU/9-82--------------------------------------------------------------------------------
B2V814_SULSY/6-77--------------------------------------------------------------------------------
E1SPK5_FERBD/5-80--------------------------------------------------------------------------------
A1S9X8_SHEAM/5-80--------------------------------------------------------------------------------
G8AUD4_AZOBR/16-89--------------------------------------------------------------------------------
NAPD_HAEIN/14-90--------------------------------------------------------------------------------
Q21AR5_RHOPB/30-104--------------------------------------------------------------------------------
A1K384_AZOSB/7-82--------------------------------------------------------------------------------
A7I3Z3_CAMHC/1-75--------------------------------------------------------------------------------
Q7VJT0_HELHP/1-77--------------------------------------------------------------------------------
Q79HQ5_WOLSU/1-76--------------------------------------------------------------------------------
E8RJB8_DESPD/3-76--------------------------------------------------------------------------------
Q5E3J5_VIBF1/10-85--------------------------------------------------------------------------------
F6AJN2_PSEF1/5-79--------------------------------------------------------------------------------
M9X453_MANHA/11-87--------------------------------------------------------------------------------
Q87GW7_VIBPA/6-81--------------------------------------------------------------------------------
B6IR09_RHOCS/9-83--------------------------------------------------------------------------------
G7Z2F9_AZOL4/7-81--------------------------------------------------------------------------------
A3QDT7_SHELP/7-80--------------------------------------------------------------------------------
A9I7M2_BORPD/2-76--------------------------------------------------------------------------------
C9R7H4_AGGAD/15-91--------------------------------------------------------------------------------
G7ZD38_AZOL4/15-89--------------------------------------------------------------------------------
E7A9K1_HELFC/1-76--------------------------------------------------------------------------------
A1BB87_PARDP/30-103--------------------------------------------------------------------------------
E4U743_OCEP5/2-76--------------------------------------------------------------------------------
A8GHJ5_SERP5/6-82--------------------------------------------------------------------------------
D6E6X0_9ACTN/3-75--------------------------------------------------------------------------------
I2B9N7_SHIBC/5-81--------------------------------------------------------------------------------
S6CE21_9ACTN/6-80--------------------------------------------------------------------------------
A3QHX3_SHELP/5-80--------------------------------------------------------------------------------
M1PB12_DESSD/3-76--------------------------------------------------------------------------------
Q13I16_BURXL/18-93--------------------------------------------------------------------------------
A0KIM0_AERHH/5-80--------------------------------------------------------------------------------
A1SWQ1_PSYIN/6-81--------------------------------------------------------------------------------
A6Q5Z8_NITSB/2-76--------------------------------------------------------------------------------
C5ZXD4_9HELI/11-84--------------------------------------------------------------------------------
V6F139_9PROT/20-94--------------------------------------------------------------------------------
G8QFB1_DECSP/1-76--------------------------------------------------------------------------------
E1SPK8_FERBD/5-79--------------------------------------------------------------------------------
F8E847_FLESM/4-77--------------------------------------------------------------------------------
Q92Z35_RHIME/8-82--------------------------------------------------------------------------------
M4U4Q1_9GAMM/6-81--------------------------------------------------------------------------------
A4Z0A0_BRASO/31-105--------------------------------------------------------------------------------
C7N4I2_SLAHD/2-77--------------------------------------------------------------------------------
Q5P545_AROAE/99-172--------------------------------------------------------------------------------
Q47A86_DECAR/4-79--------------------------------------------------------------------------------
V9VYJ2_9RHOB/5-78--------------------------------------------------------------------------------
C8WHW5_EGGLE/3-75--------------------------------------------------------------------------------
E1SPL2_FERBD/5-80--------------------------------------------------------------------------------
Q32I07_SHIDS/5-81--------------------------------------------------------------------------------
Q2SGV8_HAHCH/5-80--------------------------------------------------------------------------------
D7A7N1_STAND/6-78--------------------------------------------------------------------------------
Q12P45_SHEDO/5-78--------------------------------------------------------------------------------
R5ED13_9BURK/4-77--------------------------------------------------------------------------------
F8KQ14_HELBC/1-77--------------------------------------------------------------------------------
H5WUJ8_9BURK/2-77--------------------------------------------------------------------------------
Q3IV44_RHOS4/6-80--------------------------------------------------------------------------------
D1B0Z4_SULD5/1-76--------------------------------------------------------------------------------
F4H9V5_GALAU/13-88--------------------------------------------------------------------------------
Q7WXC4_CUPNH/19-94--------------------------------------------------------------------------------
S6AI66_9PROT/1-76--------------------------------------------------------------------------------
G8B0E5_AZOBR/4-78--------------------------------------------------------------------------------
A1KCK3_AZOSB/2-77--------------------------------------------------------------------------------
Q0WCM9_YERPE/6-81--------------------------------------------------------------------------------
R5QDQ6_9BURK/4-76--------------------------------------------------------------------------------
Q8EIJ0_SHEON/5-80--------------------------------------------------------------------------------
A4VJ12_PSEU5/21-93--------------------------------------------------------------------------------
L0F5T8_DESDL/3-76--------------------------------------------------------------------------------
D0J758_COMT2/1-75--------------------------------------------------------------------------------
I7H569_9HELI/1-77--------------------------------------------------------------------------------
Q9KLR5_VIBCH/18-93--------------------------------------------------------------------------------
R7C3D0_9BURK/5-78--------------------------------------------------------------------------------
Q21PN2_SACD2/11-86--------------------------------------------------------------------------------
K4KH51_SIMAS/8-79--------------------------------------------------------------------------------
C1D9G2_LARHH/1-73--------------------------------------------------------------------------------
F7UYF5_EEGSY/3-75--------------------------------------------------------------------------------
A9CGL4_AGRFC/8-82--------------------------------------------------------------------------------
C7RM77_ACCPU/1-76--------------------------------------------------------------------------------
B0UD65_METS4/21-95--------------------------------------------------------------------------------
B1Y6A7_LEPCP/2-77--------------------------------------------------------------------------------
B2UBL6_RALPJ/21-96--------------------------------------------------------------------------------
M4R765_BIBTR/2-75--------------------------------------------------------------------------------
B3E654_GEOLS/3-76--------------------------------------------------------------------------------
H0Q103_9RHOO/2-77--------------------------------------------------------------------------------
A8LLZ0_DINSH/2-76--------------------------------------------------------------------------------
B8F7K3_HAEPS/16-92--------------------------------------------------------------------------------

PF01037

GRP_ZYMMO/71-144--------------------------------------------------------------------------------
ZRP_ZYMMO/68-141--------------------------------------------------------------------------------
Q92MD2_RHIME/86-156--------------------------------------------------------------------------------
Q7D0A6_AGRFC/69-139--------------------------------------------------------------------------------
Q8XUT3_RALSO/72-151--------------------------------------------------------------------------------
Q6FBR8_ACIAD/74-148--------------------------------------------------------------------------------
Q5UYW6_HALMA/69-139--------------------------------------------------------------------------------
O28651_ARCFU/68-142--------------------------------------------------------------------------------
Q97KE2_CLOAB/74-146--------------------------------------------------------------------------------
Q6LFY1_PHOPR/75-149--------------------------------------------------------------------------------
Q9KKN4_VIBCH/69-143--------------------------------------------------------------------------------
Q88Q35_PSEPK/72-143--------------------------------------------------------------------------------
LRPB_BACSU/69-136--------------------------------------------------------------------------------
Q8ELF6_OCEIH/69-140--------------------------------------------------------------------------------
Q7P0K6_CHRVO/67-134--------------------------------------------------------------------------------
Q5LQ65_RUEPO/71-144--------------------------------------------------------------------------------
Q6NDU4_RHOPA/81-154--------------------------------------------------------------------------------
Q8XS36_RALSO/102-176--------------------------------------------------------------------------------
Q6N2H6_RHOPA/71-144--------------------------------------------------------------------------------
Q9RT71_DEIRA/109-183--------------------------------------------------------------------------------
Q87GT1_VIBPA/66-140--------------------------------------------------------------------------------
Q6LY54_METMP/67-138--------------------------------------------------------------------------------
Q6L2L7_PICTO/21-92--------------------------------------------------------------------------------
Q5V2Q8_HALMA/69-143--------------------------------------------------------------------------------
Q9HQ13_HALSA/69-140--------------------------------------------------------------------------------
Q8E9E7_SHEON/75-150--------------------------------------------------------------------------------
A9CFY0_AGRFC/67-137--------------------------------------------------------------------------------
Q63VD1_BURPS/71-145--------------------------------------------------------------------------------
Q8XQA9_RALSO/69-143--------------------------------------------------------------------------------
Q6A8E6_PROAC/82-152--------------------------------------------------------------------------------
Q9L101_STRCO/68-139--------------------------------------------------------------------------------
Q5YPF7_NOCFA/74-144--------------------------------------------------------------------------------
Q98D73_RHILO/70-144--------------------------------------------------------------------------------
Q98F66_RHILO/68-135--------------------------------------------------------------------------------
Q9A2I8_CAUCR/74-148--------------------------------------------------------------------------------
Q9AAL7_CAUCR/79-153--------------------------------------------------------------------------------
Q5LQ72_RUEPO/75-142--------------------------------------------------------------------------------
A9CFA2_AGRFC/70-143--------------------------------------------------------------------------------
Q5ZSK0_LEGPH/69-144--------------------------------------------------------------------------------
Q98PB1_RHILO/72-146--------------------------------------------------------------------------------
Q92LN5_RHIME/67-137--------------------------------------------------------------------------------
Q92U21_RHIME/82-152--------------------------------------------------------------------------------
Q88GR4_PSEPK/67-141--------------------------------------------------------------------------------
Q5LX17_RUEPO/69-143--------------------------------------------------------------------------------
Q8KCK3_CHLTE/71-142--------------------------------------------------------------------------------
Q9I287_PSEAE/71-145--------------------------------------------------------------------------------
Q9A5B5_CAUCR/107-181--------------------------------------------------------------------------------
Q5YR66_NOCFA/67-141--------------------------------------------------------------------------------
Q8NMC1_CORGL/75-149--------------------------------------------------------------------------------
Q82QC2_STRAW/71-138--------------------------------------------------------------------------------
Q898A1_CLOTE/78-150--------------------------------------------------------------------------------
Q88H33_PSEPK/67-137--------------------------------------------------------------------------------
Q88DP7_PSEPK/70-145--------------------------------------------------------------------------------
Q9KYP0_STRCO/82-153--------------------------------------------------------------------------------
Q9EX07_STRCO/69-139--------------------------------------------------------------------------------
Q74NJ3_NANEQ/8-78--------------------------------------------------------------------------------
Q5UXF0_HALMA/63-134--------------------------------------------------------------------------------
LYSM_SULTO/67-138--------------------------------------------------------------------------------
Q7VRX6_BORPE/85-159--------------------------------------------------------------------------------
HOSA_SULTO/388-459--------------------------------------------------------------------------------
Q6L0M6_PICTO/71-145--------------------------------------------------------------------------------
Q7NXB3_CHRVO/75-142--------------------------------------------------------------------------------
Q8XJU9_CLOPE/76-148--------------------------------------------------------------------------------
Q82JE5_STRAW/69-138--------------------------------------------------------------------------------
Y4TD_SINFN/84-158--------------------------------------------------------------------------------
Q9K0L9_NEIMB/99-172--------------------------------------------------------------------------------
Q87PU4_VIBPA/76-146--------------------------------------------------------------------------------
Q5Z126_NOCFA/77-147--------------------------------------------------------------------------------
Q89LX8_BRADU/73-146--------------------------------------------------------------------------------
Q5LQW1_RUEPO/67-141--------------------------------------------------------------------------------
Q65N91_BACLD/69-136--------------------------------------------------------------------------------
Q92XD8_RHIME/73-147--------------------------------------------------------------------------------
Q8FLW4_COREF/255-325--------------------------------------------------------------------------------
Q5LTP6_RUEPO/68-142--------------------------------------------------------------------------------
Q8XVM9_RALSO/69-143--------------------------------------------------------------------------------
Q98KG1_RHILO/93-160--------------------------------------------------------------------------------
Q8A556_BACTN/73-147--------------------------------------------------------------------------------
Q7NU65_CHRVO/74-148--------------------------------------------------------------------------------
Q5NMJ8_ZYMMO/67-141--------------------------------------------------------------------------------
Q7VRX9_BORPE/76-153--------------------------------------------------------------------------------
Q6FCQ3_ACIAD/67-137--------------------------------------------------------------------------------
Q6A5I2_PROAC/64-135--------------------------------------------------------------------------------
Q8ZT22_PYRAE/67-153--------------------------------------------------------------------------------
Q9KFQ5_BACHD/69-136--------------------------------------------------------------------------------
Q63M55_BURPS/72-146--------------------------------------------------------------------------------
Q9RKY4_STRCO/86-156--------------------------------------------------------------------------------
Q89QF0_BRADU/95-169--------------------------------------------------------------------------------
Q7NH56_GLOVI/75-142--------------------------------------------------------------------------------
Q5WIR4_BACSK/69-136--------------------------------------------------------------------------------
Q82AJ9_STRAW/6-77--------------------------------------------------------------------------------
Q7VV34_BORPE/67-140--------------------------------------------------------------------------------
Q63K02_BURPS/70-144--------------------------------------------------------------------------------
Q9K6T5_BACHD/69-140--------------------------------------------------------------------------------
O29671_ARCFU/66-134--------------------------------------------------------------------------------
Q6AF01_LEIXX/80-150--------------------------------------------------------------------------------
Q98JQ8_RHILO/76-143--------------------------------------------------------------------------------
Q9XAG4_STRCO/72-142--------------------------------------------------------------------------------
Q92PN1_RHIME/74-147--------------------------------------------------------------------------------
O86743_STRCO/86-156--------------------------------------------------------------------------------
Q7VXK7_BORPE/69-143--------------------------------------------------------------------------------
Q9RK86_STRCO/67-136--------------------------------------------------------------------------------
Q9RXV6_DEIRA/89-157--------------------------------------------------------------------------------
O29606_ARCFU/6-76--------------------------------------------------------------------------------
Q6ANT7_DESPS/69-143--------------------------------------------------------------------------------
REG1_PYRFU/70-146--------------------------------------------------------------------------------
Q98K63_RHILO/72-146--------------------------------------------------------------------------------
Q9HLH1_THEAC/98-168--------------------------------------------------------------------------------
O29117_ARCFU/70-140--------------------------------------------------------------------------------
Q983I9_RHILO/78-152--------------------------------------------------------------------------------
Q972L7_SULTO/67-140--------------------------------------------------------------------------------
Q5V2P2_HALMA/69-140--------------------------------------------------------------------------------
Q87GV1_VIBPA/67-140--------------------------------------------------------------------------------
Q8XX00_RALSO/74-141--------------------------------------------------------------------------------
Q987B0_RHILO/72-146--------------------------------------------------------------------------------
Q9A3N3_CAUCR/116-190--------------------------------------------------------------------------------
Q7NT80_CHRVO/75-149--------------------------------------------------------------------------------
Q5LKR4_RUEPO/67-141--------------------------------------------------------------------------------
P71888_MYCTU/70-141--------------------------------------------------------------------------------
Q5LTI9_RUEPO/68-142--------------------------------------------------------------------------------
Q88E71_PSEPK/78-152--------------------------------------------------------------------------------
Q82M14_STRAW/244-315--------------------------------------------------------------------------------
Q5LX25_RUEPO/67-137--------------------------------------------------------------------------------
Q981V1_RHILO/75-149--------------------------------------------------------------------------------
Q97J19_CLOAB/69-136--------------------------------------------------------------------------------
Q89XH4_BRADU/78-152--------------------------------------------------------------------------------
Q984M5_RHILO/74-148--------------------------------------------------------------------------------
Q9HQ33_HALSA/67-138--------------------------------------------------------------------------------
Q93IX1_STRCO/72-139--------------------------------------------------------------------------------
Q975B9_SULTO/71-141--------------------------------------------------------------------------------
Q745M6_MYCPA/252-323--------------------------------------------------------------------------------
Q5LNM4_RUEPO/70-143--------------------------------------------------------------------------------
Q93IX5_STRCO/73-147--------------------------------------------------------------------------------
Q92MD5_RHIME/70-144--------------------------------------------------------------------------------
Q9RS40_DEIRA/9-80--------------------------------------------------------------------------------
Q5KVS2_GEOKA/71-145--------------------------------------------------------------------------------
Q5LUB6_RUEPO/69-143--------------------------------------------------------------------------------
BKDR_PSEAE/70-144--------------------------------------------------------------------------------
Q8ZX24_PYRAE/6-77--------------------------------------------------------------------------------
Q8XFM7_RALSO/75-142--------------------------------------------------------------------------------
REG8_PYRFU/69-139--------------------------------------------------------------------------------
Q5UZ96_HALMA/68-138--------------------------------------------------------------------------------
Q5QV65_IDILO/67-141--------------------------------------------------------------------------------
Q5LRE1_RUEPO/71-145--------------------------------------------------------------------------------
Q6D0Y1_PECAS/70-144--------------------------------------------------------------------------------
Q98N03_RHILO/69-143--------------------------------------------------------------------------------
Q880K0_PSESM/71-145--------------------------------------------------------------------------------
Q8ZWW2_PYRAE/87-153--------------------------------------------------------------------------------
Q986N0_RHILO/91-161--------------------------------------------------------------------------------
Q9HV24_PSEAE/67-134--------------------------------------------------------------------------------
Q6LS33_PHOPR/66-136--------------------------------------------------------------------------------
Q9A4E7_CAUCR/94-165--------------------------------------------------------------------------------
Q89D55_BRADU/68-142--------------------------------------------------------------------------------
Q6AIZ2_DESPS/68-140--------------------------------------------------------------------------------
Q5LTP5_RUEPO/70-144--------------------------------------------------------------------------------
Q88AX2_PSESM/73-147--------------------------------------------------------------------------------
Q8A637_BACTN/72-143--------------------------------------------------------------------------------
A9CJY9_AGRFC/67-141--------------------------------------------------------------------------------
Q826R1_STRAW/74-145--------------------------------------------------------------------------------
Q9KGA0_BACHD/67-134--------------------------------------------------------------------------------
Q8G6L1_BIFLO/70-140--------------------------------------------------------------------------------
Q6AQ93_DESPS/16-87--------------------------------------------------------------------------------
Q81G47_BACCR/69-136--------------------------------------------------------------------------------
Q5NRK7_ZYMMO/74-148--------------------------------------------------------------------------------
Q6FAP4_ACIAD/69-144--------------------------------------------------------------------------------
Q7VUI7_BORPE/70-140--------------------------------------------------------------------------------
AZLB_BACSU/71-145--------------------------------------------------------------------------------
O28824_ARCFU/64-138--------------------------------------------------------------------------------
Q6NCU7_RHOPA/67-141--------------------------------------------------------------------------------
Q5LMF1_RUEPO/70-144--------------------------------------------------------------------------------
Q5WDD1_BACSK/69-140--------------------------------------------------------------------------------
Q9XA32_STRCO/57-128--------------------------------------------------------------------------------
Q9A3M5_CAUCR/129-203--------------------------------------------------------------------------------
Q6L1Y9_PICTO/97-167--------------------------------------------------------------------------------
Q6W0Z0_SINFN/69-143--------------------------------------------------------------------------------
Q87WM3_PSESM/56-130--------------------------------------------------------------------------------
Q5NNH9_ZYMMO/73-147--------------------------------------------------------------------------------
PTR1_METJA/68-139--------------------------------------------------------------------------------
Q92NU2_RHIME/68-141--------------------------------------------------------------------------------
LRP_RHIME/73-147--------------------------------------------------------------------------------
Q8XU40_RALSO/70-144--------------------------------------------------------------------------------
Q65G37_BACLD/68-136--------------------------------------------------------------------------------
Y224_HAEIN/85-159--------------------------------------------------------------------------------
Q65E48_BACLD/78-149--------------------------------------------------------------------------------
Q6W241_SINFN/68-142--------------------------------------------------------------------------------
O28868_ARCFU/6-77--------------------------------------------------------------------------------
Q63I71_BURPS/69-143--------------------------------------------------------------------------------
O27261_METTH/78-148--------------------------------------------------------------------------------
Q5LWR4_RUEPO/91-158--------------------------------------------------------------------------------
Q9K655_BACHD/67-134--------------------------------------------------------------------------------
Q980N2_SULSO/6-77--------------------------------------------------------------------------------
Q5P347_AROAE/71-145--------------------------------------------------------------------------------
Q8NTP9_CORGL/72-146--------------------------------------------------------------------------------
Q5YZ22_NOCFA/6-77--------------------------------------------------------------------------------
Q92S84_RHIME/6-77--------------------------------------------------------------------------------
Q5LVX6_RUEPO/69-143--------------------------------------------------------------------------------
Q6FCJ8_ACIAD/71-145--------------------------------------------------------------------------------
Q9HVR3_PSEAE/69-143--------------------------------------------------------------------------------
Q5LXH4_RUEPO/67-141--------------------------------------------------------------------------------
Q8Y353_RALSO/69-136--------------------------------------------------------------------------------
A9CG60_AGRFC/77-149--------------------------------------------------------------------------------
A9IKA3_BORPD/73-141--------------------------------------------------------------------------------
B2FLQ0_STRMK/74-148--------------------------------------------------------------------------------
C1A292_RHOE4/70-138--------------------------------------------------------------------------------
D5AV63_RHOCB/70-137--------------------------------------------------------------------------------
F2Z5Y7_SULAC/76-144--------------------------------------------------------------------------------
G4RMH4_THETK/397-468--------------------------------------------------------------------------------
YBAO_ECOLI/68-142--------------------------------------------------------------------------------
REG7_PYRFU/69-138--------------------------------------------------------------------------------
Q0K0V9_CUPNH/87-161--------------------------------------------------------------------------------
Q1DFS8_MYXXD/69-140--------------------------------------------------------------------------------
Q2K1K4_RHIEC/70-143--------------------------------------------------------------------------------
Q2YIU7_BRUA2/70-144--------------------------------------------------------------------------------
Q2YL25_BRUA2/72-139--------------------------------------------------------------------------------
Q2YQJ2_BRUA2/71-144--------------------------------------------------------------------------------
Q5JGT9_THEKO/6-76--------------------------------------------------------------------------------
Q5L7H5_BACFN/70-142--------------------------------------------------------------------------------
Q5LDE0_BACFN/71-144--------------------------------------------------------------------------------
Q5SK07_THET8/6-76--------------------------------------------------------------------------------
Q5ZVF4_LEGPH/88-161--------------------------------------------------------------------------------
Q63LV0_BURPS/69-143--------------------------------------------------------------------------------
Q63PU3_BURPS/81-154--------------------------------------------------------------------------------
Q63WP2_BURPS/72-146--------------------------------------------------------------------------------
Q79Z48_STRAW/82-148--------------------------------------------------------------------------------
Q7LX67_SULSO/76-145--------------------------------------------------------------------------------
Q7VSF7_BORPE/69-142--------------------------------------------------------------------------------
Q7VUR8_BORPE/71-143--------------------------------------------------------------------------------
Q7VUU2_BORPE/68-141--------------------------------------------------------------------------------
Q7VVL9_BORPE/71-144--------------------------------------------------------------------------------
Q81UN4_BACAN/77-147--------------------------------------------------------------------------------
Q88EQ3_PSEPK/70-143--------------------------------------------------------------------------------
Q88NA5_PSEPK/72-143--------------------------------------------------------------------------------
Q88QV0_PSEPK/75-144--------------------------------------------------------------------------------
Q8PE26_XANCP/73-147--------------------------------------------------------------------------------
REG6_PYRFU/71-140--------------------------------------------------------------------------------
Q8ZKW5_SALTY/74-143--------------------------------------------------------------------------------
Q98A93_RHILO/76-149--------------------------------------------------------------------------------
Q9HKJ0_THEAC/68-141--------------------------------------------------------------------------------
A0A089UKH2_9ENTR/78-152--------------------------------------------------------------------------------

PF08734

Q1IPM3_KORVE/4-93--------------------------------------------------------------------------------
G2MLB5_9ARCH/4-91--------------------------------------------------------------------------------
H1XQS5_9BACT/4-95--------------------------------------------------------------------------------
D7BJC3_MEISD/4-95--------------------------------------------------------------------------------
G8MII4_9BURK/4-93--------------------------------------------------------------------------------
L0AFR4_NATGS/4-92--------------------------------------------------------------------------------
F4F772_VERMA/4-95--------------------------------------------------------------------------------
Q5SI26_THET8/4-92--------------------------------------------------------------------------------
H6R075_NOCCG/4-95--------------------------------------------------------------------------------
G2NSS9_STRVO/4-93--------------------------------------------------------------------------------
I4F214_9ACTN/4-95--------------------------------------------------------------------------------
I4ETI0_9ACTN/4-94--------------------------------------------------------------------------------
Q01ZT0_SOLUE/4-95--------------------------------------------------------------------------------
Q98IV7_RHILO/5-93--------------------------------------------------------------------------------
A2SGQ7_METPP/4-92--------------------------------------------------------------------------------
D1CC79_THET1/4-92--------------------------------------------------------------------------------
D3SXC2_NATMM/4-91--------------------------------------------------------------------------------
Q89Y28_BRADU/4-93--------------------------------------------------------------------------------
B5YHM6_THEYD/4-93--------------------------------------------------------------------------------
G2MJ21_9ARCH/4-92--------------------------------------------------------------------------------
C3MFG8_SINFN/4-93--------------------------------------------------------------------------------
H2K980_STRHJ/4-95--------------------------------------------------------------------------------
A0JTG1_ARTS2/4-95--------------------------------------------------------------------------------
K9T082_9CYAN/4-90--------------------------------------------------------------------------------
B0ULW4_METS4/4-93--------------------------------------------------------------------------------
Q1LFX7_CUPMC/4-93--------------------------------------------------------------------------------
G2MHS5_9ARCH/4-89--------------------------------------------------------------------------------
Q98IC6_RHILO/51-140--------------------------------------------------------------------------------
A4FIK6_SACEN/4-95--------------------------------------------------------------------------------
L0JX86_9EURY/6-91--------------------------------------------------------------------------------
L0AEV4_NATGS/14-96--------------------------------------------------------------------------------
Q4FMK6_PELUB/4-97--------------------------------------------------------------------------------
Q2LVQ6_SYNAS/4-92--------------------------------------------------------------------------------
I4CDN7_DESTA/4-94--------------------------------------------------------------------------------
X5DZ33_9BACT/4-95--------------------------------------------------------------------------------
D7EBR9_METEZ/4-92--------------------------------------------------------------------------------
V9XI29_9NOCA/4-95--------------------------------------------------------------------------------
D3RYX8_FERPA/4-93--------------------------------------------------------------------------------
J7QAT7_METSZ/2-93--------------------------------------------------------------------------------
Q2FRI7_METHJ/4-93--------------------------------------------------------------------------------
D3DGX8_HYDTT/4-92--------------------------------------------------------------------------------
B1XZW1_LEPCP/4-93--------------------------------------------------------------------------------
A4X3V5_SALTO/4-95--------------------------------------------------------------------------------
Q01T30_SOLUE/4-95--------------------------------------------------------------------------------
C0ZSA3_RHOE4/6-97--------------------------------------------------------------------------------
D2SAQ8_GEOOG/4-95--------------------------------------------------------------------------------
Q89ER8_BRADU/100-191--------------------------------------------------------------------------------
D1C9V9_SPHTD/4-93--------------------------------------------------------------------------------
D3DFQ5_HYDTT/4-95--------------------------------------------------------------------------------
D0MJ54_RHOM4/7-93--------------------------------------------------------------------------------
Q12DD7_POLSJ/4-92--------------------------------------------------------------------------------
Q11IB3_CHESB/4-93--------------------------------------------------------------------------------
B2JGN9_PARP8/4-93--------------------------------------------------------------------------------
B5H974_STRPR/4-93--------------------------------------------------------------------------------
A4X7F1_SALTO/10-101--------------------------------------------------------------------------------
Q98KS8_RHILO/15-104--------------------------------------------------------------------------------
Q0K0J1_CUPNH/4-93--------------------------------------------------------------------------------
Q8ZW09_PYRAE/15-104--------------------------------------------------------------------------------
D3FAH0_CONWI/4-91--------------------------------------------------------------------------------
Q0SDZ3_RHOJR/4-95--------------------------------------------------------------------------------
M1XRC1_NATM8/4-94--------------------------------------------------------------------------------
N0B760_9RHIZ/4-93--------------------------------------------------------------------------------
F6EH65_HOYSD/4-95--------------------------------------------------------------------------------
Q4J9X1_SULAC/7-96--------------------------------------------------------------------------------
H0PTW2_9RHOO/4-93--------------------------------------------------------------------------------
D5C2W6_NITHN/4-95--------------------------------------------------------------------------------
D7BTX3_STRBB/4-93--------------------------------------------------------------------------------
A7HGK0_ANADF/2-93--------------------------------------------------------------------------------
B9L4A5_THERP/4-92--------------------------------------------------------------------------------
A7HIY5_ANADF/4-94--------------------------------------------------------------------------------
B8EJ72_METSB/4-93--------------------------------------------------------------------------------
B2UD21_RALPJ/4-93--------------------------------------------------------------------------------
D2AZB3_STRRD/4-95--------------------------------------------------------------------------------
A4FIW4_SACEN/4-95--------------------------------------------------------------------------------
F7XLV3_METZD/4-92--------------------------------------------------------------------------------
Q0KC50_CUPNH/4-94--------------------------------------------------------------------------------
I0AG43_IGNAJ/4-91--------------------------------------------------------------------------------
A1VQZ0_POLNA/4-93--------------------------------------------------------------------------------
D1C1Y9_SPHTD/4-93--------------------------------------------------------------------------------
C1E8T0_MICCC/67-156--------------------------------------------------------------------------------
Q89DC6_BRADU/4-94--------------------------------------------------------------------------------
B3DWF2_METI4/4-94--------------------------------------------------------------------------------
V9VRN4_9RHOB/4-93--------------------------------------------------------------------------------

PF14026

G8TFB1_NIAKG/4-80--------------------------------------------------------------------------------
V9XCZ8_9NOCA/94-168--------------------------------------------------------------------------------
G8TMA0_NIAKG/4-78--------------------------------------------------------------------------------
D5WQX0_KYRT2/4-77--------------------------------------------------------------------------------
A4AS08_MARSH/36-112--------------------------------------------------------------------------------
B9L383_THERP/96-171--------------------------------------------------------------------------------
D0LJ18_HALO1/4-78--------------------------------------------------------------------------------
J7Q501_METSZ/4-80--------------------------------------------------------------------------------
B1ZTA8_OPITP/14-93--------------------------------------------------------------------------------
B3DUX5_METI4/4-80--------------------------------------------------------------------------------
E6S7R8_INTC7/4-79--------------------------------------------------------------------------------
A1SCD8_NOCSJ/4-80--------------------------------------------------------------------------------
F8GI72_NITSI/4-79--------------------------------------------------------------------------------
Q2W7Z8_MAGSA/7-86--------------------------------------------------------------------------------
G4SUJ6_META2/4-79--------------------------------------------------------------------------------
B2GI79_KOCRD/102-174--------------------------------------------------------------------------------
N0B124_9BACI/99-174--------------------------------------------------------------------------------
C0Q912_DESAH/7-77--------------------------------------------------------------------------------
K9U3B1_9CYAN/97-168--------------------------------------------------------------------------------
H8KMQ1_SOLCM/4-80--------------------------------------------------------------------------------
K0I223_9BURK/7-83--------------------------------------------------------------------------------
C7LNZ1_DESBD/4-80--------------------------------------------------------------------------------
B1ZTA7_OPITP/125-201--------------------------------------------------------------------------------
M1XLI3_NATM8/7-89--------------------------------------------------------------------------------
L0JZM3_9EURY/9-90--------------------------------------------------------------------------------
Q9R6V4_SYNE7/96-169--------------------------------------------------------------------------------
D5WPK0_KYRT2/4-79--------------------------------------------------------------------------------
W0EYH3_9BACT/4-80--------------------------------------------------------------------------------
C1D3G4_DEIDV/4-83--------------------------------------------------------------------------------
E9SX14_RHOHA/100-174--------------------------------------------------------------------------------
D2B7E5_STRRD/4-78--------------------------------------------------------------------------------
A1T6F0_MYCVP/4-80--------------------------------------------------------------------------------
B2JMD2_PARP8/4-76--------------------------------------------------------------------------------
G8TM99_NIAKG/40-116--------------------------------------------------------------------------------
C8XC84_NAKMY/4-80--------------------------------------------------------------------------------
B1ZTA7_OPITP/32-108--------------------------------------------------------------------------------
Q2Y7K8_NITMU/4-79--------------------------------------------------------------------------------
G8QK01_DECSP/7-86--------------------------------------------------------------------------------
W0RUX2_9BACT/4-80--------------------------------------------------------------------------------
C8W032_DESAS/4-80--------------------------------------------------------------------------------
Q9FCE4_STRCO/4-78--------------------------------------------------------------------------------
A4AS09_MARSH/4-79--------------------------------------------------------------------------------
H8GQA4_METAL/4-80--------------------------------------------------------------------------------
E4N716_KITSK/4-78--------------------------------------------------------------------------------
B5HGI0_STRPR/16-90--------------------------------------------------------------------------------
B9LRJ4_HALLT/7-81--------------------------------------------------------------------------------
E6S8K4_INTC7/4-75--------------------------------------------------------------------------------
D5MIC9_9BACT/4-80--------------------------------------------------------------------------------
F4CTJ9_PSEUX/4-80--------------------------------------------------------------------------------
H8KL20_SOLCM/1-78--------------------------------------------------------------------------------
G0A3V8_METMM/4-80--------------------------------------------------------------------------------
A1SPZ6_NOCSJ/4-80--------------------------------------------------------------------------------
E1Z7P5_CHLVA/8-85--------------------------------------------------------------------------------
G8SC67_ACTS5/4-77--------------------------------------------------------------------------------
G2PJG4_MURRD/4-79--------------------------------------------------------------------------------
I5B561_9DELT/7-76--------------------------------------------------------------------------------
H8KL19_SOLCM/44-120--------------------------------------------------------------------------------
I0H3H8_ACTM4/4-79--------------------------------------------------------------------------------
A5G7G2_GEOUR/4-80--------------------------------------------------------------------------------
H6RKM4_BLASD/4-75--------------------------------------------------------------------------------
Q128D6_POLSJ/4-81--------------------------------------------------------------------------------
D4Z3M1_SPHJU/4-79--------------------------------------------------------------------------------
F3Z1Q3_DESAF/4-80--------------------------------------------------------------------------------
C1D006_DEIDV/14-91--------------------------------------------------------------------------------
C7PZ36_CATAD/4-78--------------------------------------------------------------------------------
D8J9F0_HALJB/7-85--------------------------------------------------------------------------------
A0LXR5_GRAFK/4-78--------------------------------------------------------------------------------
E8SGS7_STAPH/95-169--------------------------------------------------------------------------------
Q98DV8_RHILO/22-99--------------------------------------------------------------------------------
A4CHT0_ROBBH/4-80--------------------------------------------------------------------------------
D1AAM0_THECD/104-177--------------------------------------------------------------------------------
Q3A3V9_PELCD/4-80--------------------------------------------------------------------------------
D2RT68_HALTV/13-94--------------------------------------------------------------------------------
E3HDW6_ILYPC/4-79--------------------------------------------------------------------------------
F4CQ97_PSEUX/100-174--------------------------------------------------------------------------------
W0RDJ0_9BACT/6-81--------------------------------------------------------------------------------
G0A3D0_METMM/4-80--------------------------------------------------------------------------------
S6AIV6_PSERE/4-79--------------------------------------------------------------------------------
D1C6P6_SPHTD/4-81--------------------------------------------------------------------------------
Q6MKP0_BDEBA/4-80--------------------------------------------------------------------------------
A3HXX5_9BACT/4-79--------------------------------------------------------------------------------
G8RLG3_MYCRN/4-79--------------------------------------------------------------------------------
X5DGI2_9BACT/4-79--------------------------------------------------------------------------------
C9ZH24_STRSW/4-78--------------------------------------------------------------------------------
F5XJ89_MICPN/4-81--------------------------------------------------------------------------------
D2PQB5_KRIFD/4-81--------------------------------------------------------------------------------
H8KL19_SOLCM/135-211--------------------------------------------------------------------------------
U5QNI6_9CYAN/4-78--------------------------------------------------------------------------------
C3KQB2_SINFN/4-81--------------------------------------------------------------------------------
A8ZZK0_DESOH/7-77--------------------------------------------------------------------------------
C7PBS7_CHIPD/4-80--------------------------------------------------------------------------------
Q12D40_POLSJ/4-81--------------------------------------------------------------------------------
M4X076_PSEDE/4-80--------------------------------------------------------------------------------
Q2K8M1_RHIEC/4-78--------------------------------------------------------------------------------
K9ZYX6_DEIPD/4-81--------------------------------------------------------------------------------
D5BYJ1_NITHN/4-83--------------------------------------------------------------------------------

PF06778

I4F0Z5_9ACTN/39-227-------------------------------------------------------------R.GPAADEVTALFEE....
R7XV22_9ACTN/34-222-------------------------------------------------------------R.DTEASEVEALFAS....
C4LIZ4_CORK4/53-242-------------------------------------------------------------R.DTVAQEMRDFIAS....
Y2262_NATPD/35-246-------------------------------------------------------------R.ERALETGTDYLQAHVDL
B0RBL8_CLAMS/288-476-------------------------------------------------------------V.PGAVDELDGIVHI....
Q9YFL1_AERPE/32-211-------------------------------------------------------------V.SEAAESSDATVSR....
C8XF55_NAKMY/41-229-------------------------------------------------------------V.DKATTELVELSAE....
B1YHR9_EXIS2/43-247-------------------------------------------------------------R.TKMVQEFQAFLGELAQV
D8PHP0_9BACT/32-224-------------------------------------------------------------R.TRGKQEFLRAVEE....
B9LRB6_HALLT/33-243-------------------------------------------------------------R.KRAIEEGKAFLKHRELV
F9VP99_SULTO/26-215-------------------------------------------------------------R.KQILSRLNEVEKE....
X5E9F8_9CORY/35-224-------------------------------------------------------------R.AAVAADLESFLAS....
C8WXF6_ALIAD/32-236-------------------------------------------------------------A.AAVLRDFGAFVQGELEA
F6FS66_ISOV2/43-241-------------------------------------------------------------R.AEIVAEAEAALWDG...
F0SNH9_RUBBR/44-269-------------------------------------------------------------R.SRGVDAVCELLDE....
A9B544_HERA2/35-223-------------------------------------------------------------R.EDLREQFAQVVEE....
C7Q1S6_CATAD/54-242-------------------------------------------------------------R.ADLAAEVETLLET....
R4VWV7_9EURY/33-244-------------------------------------------------------------R.DRAIAEGREYLEDAVAV
D1AC74_THECD/42-228-------------------------------------------------------------...EAAGEVEELLAQ....
K0IKJ2_NITGG/40-226-------------------------------------------------------------K.EEAAKEFASLVDV....
D2PNW4_KRIFD/46-234-------------------------------------------------------------R.EELTAELTDLVGK....
M1MY31_9CORY/32-222-------------------------------------------------------------R.SEIITEAREFFSR....
E8SJH0_STAPH/33-238-------------------------------------------------------------R.ADMIAEFHRLMDRLKQA
U3GV86_9CORY/37-227-------------------------------------------------------------R.QEAIEEARSFFQQ....
A4YEP6_METS5/20-208-------------------------------------------------------------R.AKILGLVKEVEEQ....
D5UN10_TSUPD/37-226-------------------------------------------------------------R.AAAAAEAEAFFER....
F5XEW4_MICPN/38-220-------------------------------------------------------------A.WSAVNEA..........
Y2021_HALSA/33-243-------------------------------------------------------------R.TAALDDAASFLADREAL
D7AZW8_NOCDD/38-226-------------------------------------------------------------R.AAAADELATLLDK....
C0ZJF7_BREBN/35-239-------------------------------------------------------------R.KEALDELNALIRTWEAN
E3H4V1_ROTDC/65-253-------------------------------------------------------------S.AEAIAEFEQLIEE....
Q8FPI6_COREF/58-248-------------------------------------------------------------R.TAVIEQAREFFTN....
A0RXH1_CENSY/28-213-------------------------------------------------------------K.EESAREVENII......
F8D9K2_HALXS/35-246-------------------------------------------------------------R.ERAIDEGIEFLSAAERV
Y1714_THET8/37-238-------------------------------------------------------------R.EDAWEELKGLVREWREL
C4KZ59_EXISA/43-247-------------------------------------------------------------R.EQMIEEFTAFLASLEEV
E1VXL5_GLUAR/41-229-------------------------------------------------------------S.EAAAAEFDALIEQ....
YWFI_BACSU/39-243-------------------------------------------------------------R.QSIIHEFTGLLEKWGVA
O69830_STRCO/45-233-------------------------------------------------------------R.AGYADEVQELFDQ....
D4GSX4_HALVD/33-244-------------------------------------------------------------R.RRAIEEGVAYLDAHEAV
C5CB90_MICLC/40-228-------------------------------------------------------------A.KKAAKEFDEAVAR....
D9SZQ2_MICAI/35-223-------------------------------------------------------------R.ENVVDEVESLFTE....
X2GJV6_9BACI/33-238-------------------------------------------------------------R.QAAVEEFIAYLEKLNEA
Q4JVC0_CORJK/34-223-------------------------------------------------------------R.AEAAADFQAFIDS....
L0JIJ1_NATP1/35-246-------------------------------------------------------------R.ERAIEEGIDYLEASEAV
M4NFE6_9GAMM/25-212-------------------------------------------------------------R.IAAIKEVVDIFRK....
M1XN90_NATM8/35-246-------------------------------------------------------------R.ESALGEGVEYLRSHVDL
S6D874_9EURY/35-247-------------------------------------------------------------R.ERAITEGETFFADAIGV
X4ZQL5_9BACL/33-239-------------------------------------------------------------R.AVALDELNAFIEEWSGV
B9E8M3_MACCJ/33-238-------------------------------------------------------------R.TAMVEEFKAFINTLEDN
C7NI73_KYTSD/37-226-------------------------------------------------------------RIEEIATEAEAFFGG....
E3E6Q2_PAEPS/26-229-------------------------------------------------------------R.AGALDELQEFMKEWSVT
S0EWF5_CHTCT/28-220-------------------------------------------------------------R.EKDKADFTCAVEE....
E6TY42_BACCJ/33-236-------------------------------------------------------------R.ETIMAEFFSLLEKWNNT
D3F509_CONWI/27-212-------------------------------------------------------------R.AAAAEEAQAALDA....
D2B5C2_STRRD/37-225-------------------------------------------------------------R.EGMADEVDDLLAQ....
L0AIF2_NATGS/35-246-------------------------------------------------------------R.ERALEDGAAFLADCESV
T0MX07_9EURY/26-214-------------------------------------------------------------R.NGVIERINSTFMD....
D6Y396_THEBD/39-227-------------------------------------------------------------R.GGIADEVEELLAQ....
Y3912_BACSK/33-238-------------------------------------------------------------R.EQMLNEFEALVSKWEGT
A0LUP2_ACIC1/32-220-------------------------------------------------------------R.SHVSAEVENLLAE....
A6W8D4_KINRD/45-233-------------------------------------------------------------R.TDLTREVQDLLDE....
L0A3P4_DEIPD/65-259-------------------------------------------------------------Q.AELKQEFTAAVEGWL.D
Q5YTA7_NOCFA/32-221-------------------------------------------------------------R.EAAIKEAKAFFDG....
Q9RUB0_DEIRA/84-279-------------------------------------------------------------R.EEIKAEFQAAVEDWVND
Q1IQ94_KORVE/58-280-------------------------------------------------------------R.LGVIKDAEQTLRPME..
F8DZS9_CORRG/33-222-------------------------------------------------------------R.QAIAEQFQDFLDS....
B3U4H7_9BACT/59-253-------------------------------------------------------------R.VISVAEVKGLVEQ....
D1BQU3_VEIPT/33-233-------------------------------------------------------------K.VAARNELKAFLADLEAK
F8I7Y0_SULAT/33-236-------------------------------------------------------------R.QEAIQELAREIEKYRSV
G8QM51_DECSP/75-271-------------------------------------------------------------R.KGAAEEVKKLIEK....
E6SGY0_THEM7/78-285-------------------------------------------------------------R.AAIAREAADFLRQVAEA
E8NBZ8_MICTS/26-212-------------------------------------------------------------...SEATELADLTAL....
C3PGT0_CORA7/32-222-------------------------------------------------------------R.EEIVAQAQKFFSE....
E4NLI1_HALBP/33-245-------------------------------------------------------------R.NRAVGEGVEYLRTHEAV
D3EHI6_GEOS4/33-238-------------------------------------------------------------R.AFALDELNAFLAEWDAV
R5BEF5_9FIRM/52-252-------------------------------------------------------------Q.IKALAEFKAFIAELEAG
S5T2Z6_9CORY/40-229-------------------------------------------------------------R.DALTAEARDFFAA....
B1VE13_CORU7/33-222-------------------------------------------------------------R.AAVAEDFQKFLDS....
A9A1Z8_NITMS/29-215-------------------------------------------------------------K.EESAKEVENIL......
Q47NP0_THEFY/35-223-------------------------------------------------------------R.AAAGDELTGLLDA....
W0K1G0_9EURY/33-243-------------------------------------------------------------R.EAALEEAESFLEDREAL
D6Y1B9_BACIE/33-236-------------------------------------------------------------R.ENILSEFHSHLEKWDAV
A0JYM8_ARTS2/39-227-------------------------------------------------------------S.GDAAADFEALLGR....
Y3825_BACHD/33-238-------------------------------------------------------------R.QQIINEFLDLMEKWNDT
D1CGR6_THET1/37-238-------------------------------------------------------------R.SRLLEELLGFLGECASV
Q97WP2_SULSO/28-216-------------------------------------------------------------R.RSAINEIESVESQ....
C7MH02_BRAFD/50-239-------------------------------------------------------------I.TAALGDVTALIES....
F2NQ02_MARHT/64-256-------------------------------------------------------------K.ERAKAEFAEVVERW...
I3ZHU9_TERRK/72-266-------------------------------------------------------------K.AAMKAAFIEVIERW...
C7QZX0_JONDD/34-225-------------------------------------------------------------R.RALIDDA..........
G2MME7_9ARCH/33-243-------------------------------------------------------------R.DRAVSEGVEYLSSHEAV
Y3023_OCEIH/33-238-------------------------------------------------------------R.QAAIDEFQQLISKWEAV
V5XBV5_MYCNE/32-220-------------------------------------------------------------R.SAVIDETATFLKQ....
I0JS76_HALH3/33-234-------------------------------------------------------------R.EQAIHEFQQMISNWEDT
E6SBC9_INTC7/39-227-------------------------------------------------------------R.ESLSDELESFLVT....
G2TIY8_BACCO/33-239-------------------------------------------------------------R.DATVKEFRQFLQQLDAI
Y241_STACT/33-238-------------------------------------------------------------R.IQIVQEFHDFLDKLASV
T0LXR6_9EURY/29-217-------------------------------------------------------------R.DAVVEALNVTFRE....
Q2JDC9_FRASC/33-221-------------------------------------------------------------R.TPLIDEATALLDG....
Y3416_GEOKA/33-237-------------------------------------------------------------R.EAAISEFLALVDQWETT
C6WBD6_ACTMD/34-222-------------------------------------------------------------R.AAAATEAQEYIDG....
Y3100_HALMA/35-247-------------------------------------------------------------R.DRALSEGIGFLDAYEAV
B9L446_THERP/57-243-------------------------------------------------------------V.EPAVEEFVQLLER....
C6CZS1_PAESJ/33-237-------------------------------------------------------------R.SQALDELQSFLKEWSSI
W0RLA9_9BACT/54-283-------------------------------------------------------------R.RAAGEAMRGAIARLVSP
D7GH54_PROFC/31-216-------------------------------------------------------------G.EQALEQLQAV.......
Q6NGV6_CORDI/33-223-------------------------------------------------------------R.AEIVAQAQSFFDG....
Y1094_HALWD/33-243-------------------------------------------------------------R.EAAVGDGVEYLRKHESI
K4J0Y5_BIFAP/34-237-------------------------------------------------------------R.RECLDEFKALATRLDAV
D8J8S2_HALJB/35-244-------------------------------------------------------------R.EAAIEEGIAYLEDHAAV
Q4JCN7_SULAC/26-215-------------------------------------------------------------R.RNILNRIEELEAR....
L0ICT5_HALRX/35-246-------------------------------------------------------------R.ERALADGVAYLEAAEAV
B7GML3_ANOFW/36-240-------------------------------------------------------------R.QEAIQEFFTLVEKWENT
D7WCD0_9CORY/39-229-------------------------------------------------------------R.SEIIAEAQRFFSG....
W5XTF0_9CORY/32-222-------------------------------------------------------------R.ADVISEAQQFFNA....
D5UHH5_CELFN/40-226-------------------------------------------------------------R.AEVAADALRAV......
Y235_STAEQ/33-238-------------------------------------------------------------R.EAMITELETFVKDKAVA
D5WXV8_KYRT2/33-237-------------------------------------------------------------R.RRMRDAFLDLVAQWDEI
H6NEC8_9BACL/33-237-------------------------------------------------------------R.GRAEDELYGLLRRYQDT
F4CMZ7_PSEUX/32-221-------------------------------------------------------------R.GAVASQATEFVEA....
L0DE33_SINAD/60-286-------------------------------------------------------------R.REGVEALKKVLDP....
Q02C59_SOLUE/43-268-------------------------------------------------------------R.AAIAGEASTALAALEA.
W0JP72_9EURY/35-246-------------------------------------------------------------R.QQAIEEGIEYLSACERL
C1F2S0_ACIC5/37-265-------------------------------------------------------------R.QRMVAEAQAFLGPLEAG
Q73W63_MYCPA/32-221-------------------------------------------------------------R.DEVVDDASRFFKQ....
Y2113_LISMO/33-240-------------------------------------------------------------Q.ELMLNELSHFLSDMEIT
Q0SJX2_RHOJR/32-220-------------------------------------------------------------R.DEVVDDAHTYLDR....
H5WWJ5_9PSEU/32-220-------------------------------------------------------------R.GQAAAETAEYLDA....
L0EGN4_THECK/33-237-------------------------------------------------------------R.EQAAGELRRMMEEWASV
D6Z8U5_SEGRD/33-222-------------------------------------------------------------R.EKIGAEALEFFEE....
A1SMY6_NOCSJ/41-230-------------------------------------------------------------R.AAEGAEVEQLFAE....

PF04261

Q9KQ59_VIBCH/5-294QTAILPEAGPFALYTLLKVRQNHAHVL..QALKALPALVEE.........................I.NQNQPGAELTVS
EFEN_BACSU/66-405QAGITTAHQTYVYFAALDVTAKDKSD.IITLFRNWTSLTQMLTSGKKMSAEQR..NQYLPPQDTGESADLS..PSNLTVT
Q98KG6_RHILO/13-313AQSVDAPLSQSAIFLVVTVAGEQPA......LAKVCSVLGELD...................DLVKTVGFRDLGGRLSCI
Q9FBY9_STRCO/10-309PQMVLSPLTSAAIFLVVTIDSGG.....EDTVRDLLSDVASLERA.....................VGFRAQPDGRLSCV
EFEB_ECOLI/61-411QAGILTPQQAAMMLVAFDVLASDKADL.ERLFRLLTQRFAFLTQGGAAPETP...NPRLPPLDSGILGGYIAP.DNLTIT
Q9K1P5_NEIMB/60-410QAGIVTPQQAFSIMCAFDVTAQSAKQL.ENLFRTLTARIEFLTQGGEYQDGD....DKLPPAGSGILGKAFN.PDGLTVT
Q9ZBW9_STRCO/87-434QPGITTPMQARGHLVAFDLAAGAGRKEAAALLRRWSDTARRLMAGEPA...........GSRDTDVA.RDAG.PSSLTVT
Q9CNH6_PASMU/4-293QSGVLLEHCKAAIYLEANITD.................LTVIPEASRQ............FCDKLAQLQQTYPDARLGAV
Q9RKQ2_STRCO/65-406QAGIATPVQDRLHFAAFDVTT.EDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEAL.GLKP.SRLTLT
YFEX_ECOLI/5-296QSGILPEHCRAAIWIEANVK................GEVDALRAASKT............FADKLATFEAKFPDAHLGAV
Q9K036_NEIMB/5-299QSAIIPDHAQAGIFIEADFAA...............NRLNDIKAACRA...........S.LDALTALKARFPDDILGLT
I6Y4U9_MYCTU/9-305.QPILAPLTPAAIFLVATIGADGEATV.HDALSKISGLVRA..........................IGFRDPTKHLSVV
Q2G130_STAA8/64-398QPGITTPTQKTCNFVALDLKSKDRDAI.KAMFKKWTVMADRMMDGDTVGKPSN..NPLMPPVDTGESIGL.G.ASKLTIT
Q5NM63_ZYMMO/7-304.QAIVTPITPAAIFLVVTLKEGK..EA.EDNIRSFCPDLSALRRT......................VSLRDRDARLTCV

PF03795

YJPA_BACSU/6-82--------------------------------------------------------------------------------
Q9I3Z5_PSEAE/1-116--------------------------------------------------------------------------------
Q98EG6_RHILO/1-116--------------------------------------------------------------------------------
Q9AB44_CAUCR/10-125--------------------------------------------------------------------------------
Q9I3Z0_PSEAE/1-123--------------------------------------------------------------------------------
Q98I36_RHILO/1-116--------------------------------------------------------------------------------
Q98DP4_RHILO/1-116--------------------------------------------------------------------------------
Q98HH2_RHILO/1-118--------------------------------------------------------------------------------
Q98H82_RHILO/1-116--------------------------------------------------------------------------------
Q984U5_RHILO/1-115--------------------------------------------------------------------------------
P73587_SYNY3/2-86--------------------------------------------------------------------------------
Q983T6_RHILO/165-255--------------------------------------------------------------------------------
Q9RVF8_DEIRA/6-88--------------------------------------------------------------------------------
Q97TR0_CLOAB/1-82--------------------------------------------------------------------------------
Q9X7N1_STRCO/1-82--------------------------------------------------------------------------------
Q98H68_RHILO/7-87--------------------------------------------------------------------------------
Q16CW5_ROSDO/1-86--------------------------------------------------------------------------------
Q9AJZ7_STRCO/1-88--------------------------------------------------------------------------------
Q45075_BURCE/1-92--------------------------------------------------------------------------------
Q98EI5_RHILO/1-89--------------------------------------------------------------------------------
Q9AC00_CAUCR/2-87--------------------------------------------------------------------------------
Q0K0V2_CUPNH/1-88--------------------------------------------------------------------------------
Y828_HAEIN/1-95--------------------------------------------------------------------------------
Q9KRE0_VIBCH/1-95--------------------------------------------------------------------------------
YCII_ECOLI/1-95--------------------------------------------------------------------------------
Q9HZ38_PSEAE/1-95--------------------------------------------------------------------------------

PF02426

F4CSZ3_PSEUX/1-89--------------------------------------------------------------------------------
C7QDL9_CATAD/1-93--------------------------------------------------------------------------------
Q7WWV8_CUPNH/1-90--------------------------------------------------------------------------------
H6RKG3_BLASD/1-91--------------------------------------------------------------------------------
D7CBD2_STRBB/1-90--------------------------------------------------------------------------------
CATC_ACIAD/1-90--------------------------------------------------------------------------------
A0QTP0_MYCS2/1-90--------------------------------------------------------------------------------
C7QDL9_CATAD/107-197--------------------------------------------------------------------------------
O07243_MYCTU/1-93--------------------------------------------------------------------------------
B2HNZ0_MYCMM/1-93--------------------------------------------------------------------------------
G8ML29_9BURK/1-90--------------------------------------------------------------------------------
S5UNN6_STRC3/3-92--------------------------------------------------------------------------------
H2JTH6_STRHJ/3-92--------------------------------------------------------------------------------
G2J3C0_PSEUL/4-93--------------------------------------------------------------------------------
D3F6M4_CONWI/1-88--------------------------------------------------------------------------------
H2FYU2_OCESG/1-90--------------------------------------------------------------------------------
R4SVN0_AMYOR/1-90--------------------------------------------------------------------------------
H6RX66_BLASD/1-89--------------------------------------------------------------------------------
B1VQ91_STRGG/37-126--------------------------------------------------------------------------------
M1NRR9_9CORY/1-90--------------------------------------------------------------------------------
B4EMK5_BURCJ/1-90--------------------------------------------------------------------------------
F2JV84_MARM1/1-90--------------------------------------------------------------------------------
Q5YTX0_NOCFA/1-90--------------------------------------------------------------------------------
L0IVL4_9MYCO/1-90--------------------------------------------------------------------------------
O07243_MYCTU/108-199--------------------------------------------------------------------------------
F6A976_PSEF1/1-90--------------------------------------------------------------------------------
B2HNZ0_MYCMM/108-199--------------------------------------------------------------------------------
Q0SE60_RHOJR/3-91--------------------------------------------------------------------------------
Q0K0V3_CUPNH/1-90--------------------------------------------------------------------------------
Q82MX8_STRAW/120-209--------------------------------------------------------------------------------
S5TF72_9CORY/1-89--------------------------------------------------------------------------------
M4XFM6_PSEDE/1-90--------------------------------------------------------------------------------
F4CMA9_PSEUX/1-90--------------------------------------------------------------------------------
B2UBI3_RALPJ/1-90--------------------------------------------------------------------------------
A4FHX7_SACEN/1-90--------------------------------------------------------------------------------
H6L7V8_SAPGL/7-88--------------------------------------------------------------------------------
G2P2X2_STRVO/1-89--------------------------------------------------------------------------------
X5DVA1_9CORY/3-91--------------------------------------------------------------------------------
B1WUL0_CYAA5/8-98--------------------------------------------------------------------------------
D4Z421_SPHJU/1-90--------------------------------------------------------------------------------
A9BYG6_DELAS/1-90--------------------------------------------------------------------------------
D8IP00_HERSS/1-90--------------------------------------------------------------------------------
Q73Y30_MYCPA/110-202--------------------------------------------------------------------------------
D2SB83_GEOOG/4-92--------------------------------------------------------------------------------
E1W0V2_GLUAR/1-90--------------------------------------------------------------------------------
W0PJH0_9BURK/1-90--------------------------------------------------------------------------------
F4CK66_PSEUX/1-90--------------------------------------------------------------------------------
Q13YI1_BURXL/1-90--------------------------------------------------------------------------------
A9IEP3_BORPD/1-90--------------------------------------------------------------------------------
A9IEC2_BORPD/1-90--------------------------------------------------------------------------------
K0IEU1_NITGG/8-95--------------------------------------------------------------------------------
B9JQ22_AGRRK/1-90--------------------------------------------------------------------------------
A6VZS3_MARMS/1-90--------------------------------------------------------------------------------
G8RL90_MYCRN/1-90--------------------------------------------------------------------------------
B8IBD4_METNO/1-90--------------------------------------------------------------------------------
Q1LE87_CUPMC/1-90--------------------------------------------------------------------------------
G7ZC79_AZOL4/19-108--------------------------------------------------------------------------------
H5X6M8_9PSEU/1-90--------------------------------------------------------------------------------
R7Y1A3_9ACTN/1-90--------------------------------------------------------------------------------
A0QZJ3_MYCS2/4-90--------------------------------------------------------------------------------
Q8NN13_CORGL/1-90--------------------------------------------------------------------------------
W8T9C2_EUBAC/1-86--------------------------------------------------------------------------------
Q1LDN7_CUPMC/1-90--------------------------------------------------------------------------------
K9ZDB7_ANACC/1-91--------------------------------------------------------------------------------
W0L7T9_9GAMM/1-90--------------------------------------------------------------------------------
H5WYU9_9PSEU/14-101--------------------------------------------------------------------------------
A1TU43_ACIAC/1-90--------------------------------------------------------------------------------
D0L556_GORB4/1-90--------------------------------------------------------------------------------
B2JPE7_PARP8/1-90--------------------------------------------------------------------------------
A8I5Y7_AZOC5/1-90--------------------------------------------------------------------------------
Q73Y30_MYCPA/1-93--------------------------------------------------------------------------------
A4XFH7_NOVAD/1-90--------------------------------------------------------------------------------
A6T9N4_KLEP7/1-90--------------------------------------------------------------------------------
A5V4X7_SPHWW/1-90--------------------------------------------------------------------------------
A0JW94_ARTS2/1-90--------------------------------------------------------------------------------
I2B8Q1_SHIBC/1-90--------------------------------------------------------------------------------
F4CJL4_PSEUX/1-89--------------------------------------------------------------------------------
B1LT49_METRJ/1-90--------------------------------------------------------------------------------
M4S3X1_9SPHN/1-90--------------------------------------------------------------------------------
A1SEX5_NOCSJ/1-90--------------------------------------------------------------------------------
A1B186_PARDP/1-90--------------------------------------------------------------------------------

PF13826

Q5B835_EMENI/129-253----------------LIVFHLGARCNHPLGLL...-------APGYKELGDWAEKMYES.LR-V-----------NP..
Q7NL77_GLOVI/17-135----------------FVVFLIGMRINQFWAL....-------.GKWVPTLRAMGPMLRR.LY-R-----------NP..
C0ZHQ2_BREBN/17-134----------------FVVFIIGMRINRMLAV....-------.HKWMPVANAMGGMMRE.LY-Q-----------HP..
B1XXV3_LEPCP/17-135----------------FVVFIIGMRINRLLAV....-------.HKWLPVAQAMGPMVKH.LM-A-----------HK..
D3EAC5_GEOS4/17-135----------------FVVFVIGFRINKWWAV....-------.HKWLPVMNAMTPMLQE.LY-R-----------NK..
Q65NQ4_BACLD/18-134----------------VVVFVIGMRVNKWHAV....-------.HKWWPVFTAMPPMIKE.LY-Q-----------NK..
D0L3R6_GORB4/18-133----------------TALFLIGMRVTKPWRV....-------.RAWTYVFFAMPRMLRH.LT-R-----------YR..
A8FJ75_BACP2/18-135----------------IVVFIIGMRINKRWAV....-------.HQWMPVFMAMPGMIKE.LY-T-----------HQ..
Q0SFP1_RHOJR/17-134----------------LVVFLIGMTVNRPWRP....-------.DLWLPTFLAMPRMLRE.LS-E-----------DP..
B2IYY5_NOSP7/17-135----------------FIVFLIGMRVNKLFAF....-------.SKWVPTARAMSPMLQS.LN-Q-----------NP..
Q8ELJ8_OCEIH/18-135----------------IVVFIIGMRINKYIAI....-------.HKWLPVFLAMPRMIKE.LY-T-----------QK..
Q9K5Y3_BACHD/18-135----------------VVVFIIGMRVNKRWAL....-------.GKWLPVFMAMPGMLKE.LH-E-----------NK..
Q82JR6_STRAW/18-140----------------VVVLLIGMRINHLWAV....-------.HQWLPVFLAMPRMLRE.LT-R-----------DR..
C8X6B7_NAKMY/17-134----------------LVVFHIGMTINRWHRP....-------.DLWWPTFAAMPGMLAE.LA-K-----------DP..
C9Z558_STRSW/19-141----------------VVVLLIGTRINHFWAV....-------.HHWMPVLTAMPRMLRE.LR-K-----------DP..
D7B5B0_NOCDD/17-134----------------LVVFHIGATFNHWWRP....-------.DLWFTVESAMRRMLRE.LS-E-----------DP..
D2SAG2_GEOOG/17-134----------------LTVFLIGMRINRPWRL....-------.DAWLPVFLAMPRMLRE.LA-A-----------DP..
D2Q510_KRIFD/15-133----------------LVVFLIGMRVNKLRAW....-------.RQWLPVAKAMGPMLRE.LS-A-----------DP..
C6XKE2_HIRBI/17-135----------------FVVFLTGMRINKWWKV....-------.WKWLPVFIAMPRMCRE.LA-R-----------RP..
D2RPK7_HALTV/35-154----------------IVVFHIGMRINALWKI....-------.QLWLPILLFGPRMVRE.LR-A-----------DP..
A1R2W1_ARTAT/19-136----------------VTVFLIGMRANRWWKM....-------.GRVAKVASAMPTMMQH.LA-T-----------HP..
Q5WGK6_BACSK/15-132----------------VVIFIVGMKIQQWWNI....-------.KAWGPVFSAMPPMLKE.LS-S-----------KK..
B1YGH8_EXIS2/12-125----------------IVVFIIGLRINRLRSV....-------.RKWWPAVQAMTPMIEE.CY-E-----------.Q..
A6R852_AJECN/119-243----------------LVVFLIGAKSSHPLGAF...-------DPVFLKLADYFSKMVRE.LR-E-----------TA..
D5UWZ5_TSUPD/14-139----------------LVVFLLGMRPRRAWRL....-------.GQAFFVSRAMFRMQAE.LE-R-----------DRAA
Q2TWA6_ASPOR/121-245----------------IVVFHLGTRSNHPLGLL...-------APGFSELNRQVIAMNRE.MN-S-----------DP..
B6QJL8_TALMQ/116-242----------------VVVLFLGFKSNHPLRMLAPG-------FKETASHFMAMLKSLDN.PK-G-----------RE..
Q0CTD2_ASPTN/81-205----------------IVVFHLGARSNHPFGPL...-------APGMRDLSRRAIAMNKA.MA-A-----------DP..
Q2GR33_CHAGB/122-248----------------VVVLHLGARFNHPLGAL...-------APGSKEVGEKFMACHREVLN-R-----------AK..
C7YU85_NECH7/113-235----------------VVVFNLGVQSNHPLGVA...-------APHFDKVGDYFRTLHNN.LT-A-----------RR..
B8MRW9_TALSN/40-166----------------IVVLLLGFKSNRPLRMLSSG-------FKETSDHFMAMLQSFDS.PE-G-----------RE..
Q7S613_NEUCR/120-245----------------IVVFHLGVSYNHPLGPA...-------SPGAYELFTHFMNMSKA.IN-E-----------KK..
Q01W86_SOLUE/18-128----------------LVVIYLGMRVNALTGV....-------.KT...LLGFGPKISAA.VD-A-----------HP..
A5G2Z4_ACICJ/18-128----------------LTVVYLGMKVTKIRGV....-------.A....TLLGLGRPLRA.LG-Q-----------NR..
B1LSK9_METRJ/27-140----------------LVVIYLGMKVRTLAGV....-------.K....TLLGFGPRIDR.VG-A-----------AR..
B0U9U6_METS4/19-131----------------LVVMYLGMHVRALFGL....-------.KT....LLGLGPAIEK.AG-L-----------GR..
B8EMQ3_METSB/15-128----------------LVVMMLGMRARTLRAF....-------.RR....LAGFGRKIEA.AS-G-----------AR..
C5AWG2_METEA/27-137----------------LVVVYLGFRVGRMRGL....-------.KA....LLGIGRGLAQ.MQ-R-----------ER..
F2F0V8_SOLSS/20-135----------------.VVFIIGMRINHLLKF....-------.WKWVPVFNAMGPMVKE.LY-Q-----------NP..
G7XTL7_ASPKW/119-243----------------IVVFHLGARNHHPLGMF...-------APGMKELGDSAEKMQRD.MR-A-----------NP..
FMAE_ASPFU/113-235----------------VVVFHLGIQYNHPLGVF...-------APHMREISNRFLAMQQDILR-R-----------KD..

PF13816

Q0C7P1_ASPTN/36-346..NAIIHVCYWEDARSYEEDLSRLRPMDIYTRVQRA.....PGIGIWCERFTTPISRLET-NY-S-----------GIDY
C0ZVD3_RHOE4/61-360..NLIV.VGYWKDVSSQHRWSTSAPVASWWESEDRLS....DGLGFFREIVAPRAEQFET-LY-A-----------FQDD
L2FQ62_COLGN/47-355..NLAV.FAYWPSKSAYQEWSTTSGFHDWWSNLT..S....DDNGWFLEVFYPTIDRLET-VF-S-----------.TQL
M7SDY7_EUTLA/46-400..NLAV.LAYWPSRAAYDGWAAASGFDAWWAALSPEEGTDGRQRGWFREVFFPTMDRLET-VF-T-----------DREV
F9G6T4_FUSOF/15-335..PSRVWMAYWTSPQSFKSWWESDSTKSFWGSLPDD.......AGFWRESICLPATRSMH-.E-S-----------TGKD
E9EGK8_METAQ/37-344..DAKVWACYWDNEARGKEGLHRLNLPSIYSTLPSSE...RSAIGLWSESFSTSVSRLET-NY-T-----------GLDY
G9MZH7_HYPVG/2-314..NITA.LAYWKSEEVYQKWTTKSGFKSWWESLDAQE....QENGWFLEIFFPTMDRIET-VF-S-----------SGEI
C7ZI82_NECH7/15-335..PSKIWMSYWRSPQSFKSWWTSDDTLSFWNSLPDD.......AGFWRETFSLPATRAMY-.E-S-----------NAEQ
S3DKC9_GLAL2/17-348GQPSATFIAYWLRSEDYEALKTTSAWREFWDDLTDD.......AGVWREVMTVPKSRFMH-.A-S-----------SMNV
A5V4Y9_SPHWW/44-337..TLVL.QPYWTDPEAFRRWEARADVAALLAAET........GLGHFREILTPTVERLET-LY-S-----------TEDE
Q5B890_EMENI/326-643..PTRLWLTYWPSRAVFETWWNSGPVSSFWSSLPDD.......AGVYREIMTVPPGRTQH-GT-N-----------ATER
U1HNF8_ENDPU/45-351..NIAV.IAYWPNKMLHSEWAASSNFQQWWDELNAED....ERHGWFLEVFFPTIERFET-VF-S-----------DNEI
T0K4N5_COLGC/37-343..GASIWVCYWNDEARGKRSLQRLSLPSIHSSLPENV...RKNVGVWTESFLTPISRLET-NY-S-----------GLDY
B2WMJ9_PYRTR/7-318..NVAV.VAYWPSTNLHRDWQEKSGFNVWWQSSDREK....DGYGWFQEVLSPTVDRFET-VF-S-----------NSEH
R8BIH2_TOGMI/17-327..NAHIWLSYW.WPETYADWWNSTSVATFWKDLPDD.......AGIWREILTVSVGRTQN-.A-C-----------TKEL
G3XZK7_ASPNA/17-337SPTSIIHLTYW.STTNYETWLKSPKVSAFFASLPSNQ..NDEASGIYHETLTIQPSRIQG-.A-T-----------NHPV
R8BET2_TOGMI/15-336LGLSRVWISYWKSPEAFQTWWNCPETKQFWAALPED.......AGFWRESLRFSNKRFVT-.E-M-----------SQDI
C7ZFH7_NECH7/16-326..ATQIWLSYW.WPDSHTGWWSKPAVKDFWDNLPED.......AGMWREVLTVSPSRVQN-.A-C-----------TAEL
Q6FBU3_ACIAD/44-342..NYIV.VGYWRDPGAYCRWFRSTEVSHWWDSDERLN....DGIGYFREIVIPRADQFET-LY-A-----------FKED
S0DLH6_GIBF5/58-358..NIAF.TLYWKDVASYREWEAALPPDWWYRGLCAAS.....DIGVFRELYTVPITDTET-TF-A-----------LPNP
Q4WIY1_ASPFU/14-338..NSTVWVCYWNEASKYEDSIRRLSLVNIHQQLSASH...RESVGLWCERFASHLSRVET-NY-S-----------GLDY
K2SG27_MACPH/15-335VGASRVWMSYWKCPEDYQRWWSSLEVSDFWNSLPDD.......AGFWREKLSLPHSRVMF-.E-S-----------NKNT
I1S1Z5_GIBZE/37-347..ETTIWVCYWNDKTAYEKSLDRLSLKSIYSRLPNPG...RASVGIWREAFVTEYPRLET-NY-S-----------GLEY
T0KQZ3_COLGC/16-328..GTQIWLSYW.HPETFAEWWASRSVQDFWNSLPED.......AGVWRETLTVDVGRTQN-.A-C-----------TADL
M2V8J7_COCH5/50-359..NQVV.IPYWQTKADFDKWRSDSGFDTWWANLRAQP.....EQGWFVEIFFPTLDRFET-VF-S-----------DNVV
C5FDU1_ARTOC/82-390..NIAV.IAYWPCRESYERWSVASTFTDWWEGLVVED....EHHGWFLEVFSPTIDRFET-II-S-----------GNEV
K9GEU7_PEND2/14-335TGKTYVWLTYWKSVADYQKWWTREDVSQFWADLPLD.......AGIWREVMTPSPRRSQY-.A-S-----------SRVE
C7Z148_NECH7/37-347..ETSIWVSYWLEESKYKLSIEKLSLPSIYSSLSTPG...RASIGIWREAFTTEVPRLET-NY-S-----------GLDY
G9P8B6_HYPAI/42-386..DTEIYICYWTDKDVAEAATRSLNLRQLYSSLFPSE...QEVIALWRESLSVPKTRIET-VY-S-----------GNDY
A7IFL4_XANP2/40-340..NAIL.VAYWLDATAHARWERNSPFMAWFRDPARLE....GTRGVWRETMHVPYDRHET-IY-S-----------TPSY
E6WMT6_PANSA/44-342..NFIV.VGYWRDPAAYCRWLHQPAITGWWSSDDRLR....DGLGYFREIIAPRAEQFET-LY-A-----------FKEA
A1R5Y5_ARTAT/55-350..NQVI.IAYWDDVDAYGRWFKKHRDALIGAGLEP......SDYGRWIEAVTPEARGFET-LY-S-----------SNTF
M7TNP5_BOTF1/17-355SPKSTTFIAYWLSCSSYQSFQASSLVQEFWNSLPPD.......AGVWREVMTVPKSRFMF-.A-S-----------SQPV
D8MJY1_ERWBE/44-340..NLMA.IAYWSSAEQFESWKENSLFNIWWNSPEREN....GEYGLFLEVVSPQPESFET-IF-S-----------DRGS
A1CFW9_ASPCL/36-355..GSTVWACYWDDAAKYEASLQRLNLVAPFEQLDSTN...RQSIGLWCERFTTRLSRLET-NY-S-----------GSDY
N1QD40_PSEFD/15-330RGSSRVWMSYWFSPPQYESWWQSPNVADFWRNLPNA.......AGFWRERFQFTSKNSMF-.E-S-----------NHAR
M3B660_SPHMS/50-394..NEVV.IPYWQNKADYDRWRLDSGFAKWWADLQVTP.....DRGWFLEVFLPSMDRFET-VF-S-----------DNAV
C9STN6_VERA1/46-354..NIAV.LLYWKSKANYDEWLATSGFGRWWDELTPGT....DQHGWFLEVFYPTIDRFET-VI-T-----------.TEV
F8J9L9_HYPSM/46-346..NAIA.VGYWLDTDTFHKWNESPAIANWWASDKRLT....EGVGYFREILRPRMEQFET-IF-T-----------HKHG
B8NMG3_ASPFN/17-331IGKTRIWIATWKSIADFEAWWESDSVIKFWSSLPPD.......AGMWREFVKVPYGRSQY-.K-A-----------TQNR
N4VS79_COLOR/45-355..NIAH.LAYWPSKAAYEQWSVDSGFASWWEKLDPEA....ERHGWFLEVFFPTVDRFET-VF-S-----------NNEV
B8NPL1_ASPFN/37-350..DSLVFACYWDTESKYENGIKGLNLTQLYQKLDKSI...QPTVGLWCERFVSHVSRLET-NY-S-----------GTDY
C9SXX8_VERA1/37-348..DTSVWVCYWQDADKYDAALQALALPALFSRLETRD...RESIGLWRECFATALPRLET-NY-S-----------GLDY
I1RQY0_GIBZE/15-329..PSKIWMSYWESPQKFKQWWEKDDTVYFWASLPDD.......AGFWRETFSLPATRAMY-.E-G-----------TGKD
F9X370_ZYMTI/46-354..NETA.IAYWQTKSDYEQWSTESGFKSWWASLQPEM.....ESGWFLEVLLPSIDRFET-VF-S-----------DNNE
F9WY10_ZYMTI/41-342..GSRVWVAYWTNEEDFKSALKLLDLARIWESL.GDD...KHDVGIWREDFAAPKERLET-NY-A-----------RLDH
K2RZK8_MACPH/39-345..GSEIWVCYFVDAAAYENSVRKLSLSQIQASL.TPD...GATIGLWCERFSTAVSRLET-NY-S-----------GLDY
Q0U2P3_PHANO/37-344..DVAVWVCYWNDLEKHKSSMEKLSLSSIHSSLSSPS......IGLWRETFTSSVSRLET-NY-S-----------GLDY
N4V6I5_COLOR/37-346..GANVWVAYWNSEENGKNSLRQLALAQIHSELPVAQ...RKVTGLWVESFATPVSRLET-NY-S-----------GLDY
C5G803_AJEDR/45-352..NIAV.LAYWPDKGSYTEWATTSGFQTWWDTLDPET....QRHGWFLEVFSPTIDRFET-VF-S-----------DNEV
G9MHE5_HYPVG/42-380..DTEIYILYWTDKDVAKAANKSLNLQQLHKTLSPSD...QEIVGVWRESFTVPKLRFET-VY-S-----------GNDY
Q0CF39_ASPTN/15-333DCRSKVWMGYWKTPEDYRAWWCSPKVAAFWSKLPDN.......AGFWRESLRFAHSRVLF-.E-T-----------NQKA
H6BUX5_EXODN/41-346..ASKVWIAHWTRREVFSAMLEKLNLPHMWQEL.GSA...RKGIGLWRESFVTPRKRLQT-NY-S-----------RLEY
C6WDR0_ACTMD/40-337....MA.VCYWPDPEAHRAWWASGPVRDWWASLPVDG.....PIGHWHETSVTPVEQFET-LY-S-----------....
N1S900_FUSC4/37-346..ESTIWVCYWSDKTKYEKGLNDHSLNSIYAQLPETG...RASVGIWREAFITEFPRLET-NY-S-----------GLDY
D4AMZ1_ARTBC/45-352..NIAI.LAYWQSQETYESWNKVSNFRSWWEGLDTEN....QQHGWFLEVFSPTTDRFET-VA-S-----------DEKV
D8J0A9_HERSS/44-342..NFIV.VGYWRDAGRYCRWMRSPDVAGWWDSDARLA....DGLGYFREVFSPRAEQFET-LY-A-----------FKED
N1Q9B6_PSEFD/42-344..DSRVWVAYWTSKEGYHAALAQLKLTDLWTGL.GQD...KADVGLWIEHFAAPVERLET-NY-A-----------RLDH

PF07876

Q748N1_GEOSL/2-96-------------------ITHIVFFK--LTDPSA--PTIA..A-------T.....R----E-K-------L---ESM.
A9CJX0_AGRFC/2-102-------------------ILHCVFLR--FKAATA--SSEK..H-------AV....F----E-A-------I---AAL.
Q740A8_MYCPA/82-179-------------------VYRTLLLA--VSPDTA--EDTV..A-------RF....E----A-D-------L---RLM.
Q7S333_NEUCR/57-160-------------------ITHIVLFK--FKPDAG--ADRI..K-------TI....S----N-R-------F---LGLK
Q98H26_RHILO/2-102-------------------IRHCVFVR--FRGDVP--ESER..A-------AI....H----A-D-------L---EAL.
Y4036_STRCO/2-97-------------------IRHLVLFK--LNDGVG--RDEPRVL-------AG....V----E-A-------F---RAL.
Q89RS9_BRADU/5-102-------------------IRHIVMWR--LRGETP--EERSAAR-------AK...VK----T-L-------F---EGL.
DABB1_ARATH/116-206-------------------IGKITLLK--LKENVM--EEAK...-------......L----E-I-------M---EVM.
DABB1_ARATH/5-102-------------------VEHVVLFK--LNDDDV--DSGK.IN-------SM....V----N-G-------I---NEL.
Q8XM37_CLOPE/2-100-------------------IKHIVMWK--LKDEAE--GNSK..A-------ENAKIIK----N-S-------L---EDL.
Q98BN1_RHILO/2-96-------------------IRHTVVFT--LKHASH--SLEE..K-------RF....L----V-D-------A---KKI.
Q7MWG5_PORGI/2-100-------------------IKHIVMFK--LAGFDS--AEAK..T-------KHLHRIK----D-A-------L---EAL.
Q7UFZ5_RHOBA/16-113-------------------LAHQVFFT--.TKDRS--DETI..N-------AL....L----D-D-------C---QTY.
POP3_ARATH/8-104-------------------VKHVLLAS--FKDGVS--PEKI..E-------EL....I----K-G-------Y---ANL.
Y5258_ARATH/6-100-------------------FKHLVVVK--FKEDTK--VDEI...-------......L----K-G-------L---ENL.
Q6YTX5_ORYSJ/40-141-------------------VEHIVLIK--VRPEAA--SSGA.AA-------AM....V----S-S-------L---QAL.
Q7N2N7_PHOLL/12-107-------------------IAHQVLFT--FKDGIS--WDSE..K-------AI....L----A-E-------K---VTLN
UP3_ARATH/158-254-------------------VAKLTLLK--LKEDVA--DEAK..S-------EI....T----G-V-------I---KGL.
Q7SEW8_NEUCR/10-117-------------------IHRMTLFK--IPDETN--QKRL..L-------DAYHVVA----E-E-------Q---KKLA
Q7D0A2_AGRFC/2-93-------------------IRHIVFFT--VPEENR--DAVR...-------.......----K-G-------L---SGL.
Q726I9_DESVH/2-101-------------------LKHIVWWT--LKDEAE--GATG..A-------ENGRKML----E-M-------L---RGL.
Q7URH4_RHOBA/33-129-------------------LRHVVMFG--FKDASS--EADV..Q-------KV....V----D-A-------F---RNL.
Q97LN9_CLOAB/2-94-------------------LTHIVFFK--LHDKKD--VGKV...-------......K----Q-I-------L---ESI.
Q6LGQ4_PHOPR/2-98-------------------IRHILLIK--FKDSSP--ASEI..N-------KL....K----G-L-------F---ESM.
Q8KCZ4_CHLTE/2-100-------------------VKHIVMWR--LCDEAH--GNSA..Q-------VNARLMK----E-K-------L---EAL.
Q7S418_NEUCR/3-107-------------------IVHVELFE--FKPLAT--QEEV..Q-------QV....C----D-K-------M---MSLK
Q8ABC5_BACTN/2-99-------------------VKHIVLFK--LKDEVP--EAEK..L-------VVMNKFK----E-A-------I---EAL.
Q6LYV0_METMP/2-100-------------------IKHIVMWK--LKENDK--DNDK..F-------ENAKTIK----N-K-------L---ESL.
Q82QQ6_STRAW/2-93-------------------IYHINRVT--MKATAT--PEQI..E-------GV....L----E-S-------W---RNQ.
Q9F304_STRCO/2-93-------------------IHHQIRLA--MRPDAP--RDKV..E-------EA....L----E-M-------L---RRM.
UP3_ARATH/49-144-------------------IEHIVLFK--TKDDAD--STKI..T-------SM....I----N-N-------L---NAL.
Q8RF81_FUSNN/2-98-------------------LNHIVMWK--IKEDVE--DKEK..V-------KLG..IK----N-G-------L---EGL.
Q6YTX5_ORYSJ/154-248-------------------AVRLSLAK--LKEGVE--AHQL..A-------EK....L----A-A-------A---TAA.
Q9A628_CAUCR/2-100-------------------LFHQVFFW--LKNPGD--KADR..D-------KL....I----A-G-------L---KAL.
B9HX68_POPTR/9-106-------------------VKHTLLTR--FKDEIT--REQI..D-------NY....I----N-D-------Y---TNL.
B9HX69_POPTR/16-111-------------------LKHIVFVR--FNDGIT--DEQI..E-------KF....I----K-D-------Y---AHV.
H2VFL6_ZYMMO/42-154-------------------LQHIVLFR--FKKNVT--EAER..R-------EV....T----K-Q-------F---LELA
H7C7T4_BRADU/2-94-------------------IRHIVFFS--AKDEAH--IHQI...-------......I----E-G-------L---SLL.
Q2YP23_BRUA2/2-92-------------------IRHIVFFS--VKEGQD--IETV...-------......R----K-G-------L---EQL.
Q8LQD2_ORYSJ/11-106-------------------VKHILLAR--FKEDVA--PERL..D-------QL....I----R-G-------Y---AGL.

PF03992

HMOA_BACSU/1-78------------------MFVQLRKMT-.VKEGFA..DKVI--E-------R.----F----S-A-------.---.E..
Q930A7_RHIME/30-107------------------PVIRIAELE-.IDPAQM..AAYS--A-------A.----V----K-E-------E---ME..
Q9L164_STRCO/44-120------------------RLRVVLLVE-.VYDGAQ..QQFL--E-------T.----Y----E-N-------L---RS..
Q930L9_RHIME/3-79------------------DLTNVAYFT-.AKPGRS..GELG--D-------E.----L----L-Q-------L---VT..
HDOX_LISMO/1-86------------------MIIVTNTIK-.VEKGAA..EHVI--R-------Q.----F----T-G-------A---NGDG
WH42_STRCO/45-121------------------RVRVVLMLD-.VHDGMQ..QEFL--D-------A.----Y----E-R-------I---RD..
Q8Y476_LISMO/1-77------------------MLHIQAKVQ-.VKPDLV..AEFL--V-------E.----V----N-L-------V---IQ..
Q98L66_RHILO/1-81------------------MCIAMNRFK-.VQNGSE..ADFE--A-------V.----W----K-N-------R---DS..
Q98HA4_RHILO/1-77------------------MLLIIGTIR-.LAPDRF..EEAR--P-------V.----M----E-R-------M---VS..
Q9A6W1_CAUCR/113-186------------------MYGLIGQML-.AAPGKR..DELL--A-------I.----L----A-E-------G---TA..
O33291_MYCTU/2-75------------------PVVVVATLT-.AKPESV..DTVR--D-------I.----L----T-R-------A---VD..
Q8YAL6_LISMO/1-77------------------MLHIEAQIT-.VKKEQT..EAFL--Q-------A.----A----K-E-------V---IA..
Q5LR19_RUEPO/12-92------------------MREVVIVKS-TPQRGKF..NAFA--E-------L.----V----G-K-------L---VS..
NECA1_HUMAN/251-326------------------IMLVQRQMS-.VIEEDL..EEFQ--L-------A.----L----K-H-------Y---VE..
Q8XYB2_RALSO/23-99------------------PVVLVNLFL-.LDKADE..EAFL--R-------V.----W----Q-D-------D---AN..
Q9CLF6_PASMU/1-77------------------MFAMLVEIN-.IKEGKE..QEFL--E-------V.----F----A-R-------N---HI..
Q8NLF1_CORGL/2-78------------------SIVKINAIS-.VPEGAG..EELE--K-------R.----F----A-A-------R---QN..
O06569_MYCTU/1-77------------------MIFIVVKFE-.TKPEWT..ERWP--D-------L.----V----A-S-------F---TA..
Q8NRX5_CORGL/1-76------------------MHIVNIRFK-.PKAKYV..DTFR--Y-------T.----V----D-K-------F---TE..
Q9I1R9_PSEAE/4-80------------------AVRVVALLQ-.AREGRA..AEVE--R-------L.----L----L-A-------C---VQ..
Q9I267_PSEAE/43-119------------------RASHLVSIR-.ARSGQS..HRLG--L-------R.----L----Q-E-------L---AQ..
Q9RTW6_DEIRA/23-100------------------PVLEIAMLN-.VRPGQT..AEFE--A-------A.----F----A-Q-------A---GR..
Q9RXN8_DEIRA/1-77------------------MITVANRIF-.VNPERA..AAFE--E-------R.----F----R-R-------R---PR..
Q9FC02_STRCO/14-92------------------PVVLIKTYT-.VPSEEA..DYFT--E-------A.----Y----Q-E-------N---AR..
Q9K649_BACHD/1-78------------------MFFQVKTLR-.VEEGHS..DKIV--E-------K.----F----A-S-------K---....
Q92MY2_RHIME/1-77------------------MVYIIAYLT-.AHAGKG..DEVV--A-------L.----T----T-P-------L---IE..
HDOX_BACHD/1-78------------------MVIVTNTSK-.ITKGNG..EKLI--E-------R.----F----N-K-------V---GK..
Q9RX23_DEIRA/3-80------------------PVSVHAVLT-.PKPEHL..TEVE--A-------E.----L----R-T-------M---AR..
Q92N21_RHIME/1-81------------------MYFAMNRFR-.VAAGQE..EAFE--A-------V.----W----K-A-------R---DS..
NECA2_HUMAN/285-360------------------LQLVRQEMA-.VCPEQL..SEFL--D-------S.----L----R-Q-------Y---LR..
Q8XW80_RALSO/11-88------------------MIAMTVSLA-.VVPDSG..EAFE--R-------V.----F----A-V-------Q---AA..
Q9HY51_PSEAE/4-80------------------PLTLIATIT-.AAPGHA..EALE--R-------E.----L----R-A-------L---VA..
Q97V29_SULSO/1-78------------------MINVGFYYK-.VKRGFE..KDFE--N-------K.----F----K-E-------V---LS..
Y1783_SYNY3/49-125------------------PIVVAGNIK-.VKPDKK..EEFI--A-------L.----S----Q-T-------F---IE..
A9CGS9_AGRFC/10-86------------------AVRLSGFLR-CLSEDDV..ELVR--Q-------H.----L----P-D-------H---IR..
Y2021_HALSA/401-477------------------FGTMGMFYE-.TKPEHT..AEFV--E-------K.----F----D-T-------V---AG..
Q8UIT6_AGRFC/6-83------------------PVVRMAEIE-.IDPTHL..EAYR--R-------L.----L----A-E-------E---IE..
Q8NRX6_CORGL/1-76------------------MILINVKFK-.PLPEYV..DTFR--E-------Q.----V----A-E-------F---TE..
Q9ABN2_CAUCR/2-78------------------TLILAGSIR-.IAPERL..AELR--P-------H.----L----A-A-------Q---VE..
Q9YCC3_AERPE/2-78------------------AFAIANYIR-.AETPEA.FDKVI--E-------A.----F----T-G-------R---AG..
Q8TTU6_METAC/1-76------------------M.KVVAKNQ-.VKPEKI..QEFM--D-------L.----C----K-K-------L---VE..
Q9X9W3_STRCO/128-214------------------IVIVDIEFE-GPDPDRQ..RAWV--D-------A.----V----F-E-------A---LE..
O54100_STRCO/29-106------------------MSTAVTEFT-.VAAPAQ..GAFE--N-------N.----C----T-A-------S---MR..
Q9CFE4_LACLA/2-80------------------TITVNILYQ-.GEGEKA..HLFA--D-------EM----V----S-S-------G---LV..
Q92Y06_RHIME/4-80------------------SIKVVARVM-.ITPGNE..DAFE--T-------Y.----A----A-E-------L---SV..
YQJZ_BACSU/12-86------------------PYYAVIFSS-.VKSEND..TGYG--E-------T.----A----E-R-------M---VS..
Q8PEE0_XANCP/7-83------------------PIVVVARWS-.VPASAR..AIVL--A-------L.----L----P-E-------L---QR..
A9CLL3_AGRFC/1-78------------------MIYEIAMLP-.VQKDKI..SEFR--Q-------A.----F----G-D-------V---VP..
Q9HYL5_PSEAE/1-78------------------MYCIFIKAR-.LRPGCA..EAFI--D-------A.----I----Q-V-------N---AA..
Q7CRR7_AGRFC/5-81------------------AFVVIAEFR-.VKPDAM..DAFL--D-------A.----A----R-D-------D---AK..
Q9HHS4_HALSA/1-77------------------MIVVHATFR-.FDPDAR..DDAL--E-------L.----I----A-D-------L---VE..
Q9I5L9_PSEAE/2-79------------------TYHVLVQFD-.VPSDKR..EAFA--A-------AG----L----F-D-------A---NG..
Q8KL47_RHIEC/8-84------------------EQHLVVEFK-.TTSQNR..NRVK--E-------L.----L----Q-E-------F---IG..
LSRG_ECOLI/1-77------------------MHVTLVEIN-.VHEDKV..DEFI--E-------V.----F----R-Q-------N---HL..
Q98HP0_RHILO/1-74------------------MYGLIGKMR-.ASRGQR..DAVM--D-------L.----L----R-A-------S---TG..
Q8Y824_LISMO/4-80------------------GYGLLTAFY-.THPGER..DHLV--K-------I.----L----L-E-------A---AE..
Q9I6L9_PSEAE/2-78------------------SASQVIRIR-.ARNGQS..ERLG--L-------R.----L----Q-Q-------L---VE..
Q9KLV5_VIBCH/1-77------------------MIHLLAEIK-.AFPDSA..QQVQ--A-------L.----L----E-A-------L---LE..
Q983R7_RHILO/10-88------------------VITQINVFT-.VPEGGQ..QALI--D-------L.----L----R-E-------A---AM..
NECA3_HUMAN/295-370------------------ILMAQRQVQ-.VAEEGL..QDFH--R-------A.----L----R-C-------Y---VD..
Q8NMA1_CORGL/2-78------------------SFVNITALT-.FPAGAE..KEIE--Q-------R.----F----A-A-------R---KK..
Q9RSM4_DEIRA/18-94------------------MVISHGTLS-.ASAEHA..AHLR--Q-------L.----L----V-H-------I---AQ..
Y0793_MYCTU/4-79------------------PVAVIARFM-.PRPDAR..SALR--A-------L.----L----D-A-------M---IT..
Q9JYI1_NEIMB/3-79------------------NIKIVALVT-.VKPEYT..ETLA--A-------Q.----F----K-E-------L---VK..
Q9A6G2_CAUCR/1-78------------------MIGVVATLK-.VQPAKA..AEFE--K-------V.----F----L-D-------L---AA..
Q9I1K5_PSEAE/247-321------------------PYYAVIFSS-.HRSAVD..DGYA--E-------A.----A----E-R-------M---LE..
Q97DS8_CLOAB/1-78------------------MVKVVAKNF-.IKEEKI..EDVL--K-------V.----A----K-E-------L---VE..
Q9CHY3_LACLA/1-77------------------MIIVNAKFY-.IKEDKK..SQFL--K-------E.----I----E-G-------L---IS..
A9CJ79_AGRFC/1-77------------------MIAVIFEVW-.PAEGEK..QHYL--D-------I.----A----A-G-------L---RA..
Q98DQ1_RHILO/1-77------------------MIAVIFEVQ-.PAEGRR..DAYL--A-------I.----A----A-N-------L---RP..
HMOB_BACSU/65-140------------------GFAVLNNIA-.VTQEGR..PLFE--N-------R.----F----K-N-------R---AG..
YCZJ_BACSU/1-78------------------MVREAAMLH-.IKEGLE..QEFE--D-------A.----F----R-Q-------A---AP..
Q9RSI3_DEIRA/10-86------------------PVSLVIRRR-.IRPGKE..AEYE--A-------L.----L----S-E-------A---IA..
Q92VV2_RHIME/1-77------------------MLIQMVSIN-.VKQGHA..ADFL--E-------A.----F----R-I-------N---YE..
Q8RDZ4_FUSNN/112-188------------------TFAVYTVID-.VKPEND..KEFA--E-------I.----I----K-N-------I---VE..
A9CHT4_AGRFC/1-79------------------MFIAMNRFR-.VVPGYE..ETFE--S-------I.----W----R-E-------R---KS..
Q9RKA2_STRCO/1-77------------------MIFITAKFR-.VLPEHA..DQWP--Q-------V.----V----E-D-------F---TR..
Q9ZBJ4_STRCO/2-77------------------TYGCIASMK-.TRPGFR..EEVV--S-------L.----L----L-S-------A---AD..
Q9RX69_DEIRA/1-77------------------MITVMNRIG-.VKPEFA..AQFE--E-------S.----F----R-N-------R---AG..
YCNE_BACSU/1-77------------------MIVLQAYIK-.VKPEKR..EEFL--S-------E.----A----Q-S-------L---VQ..
A5FGC9_FLAJ1/1-73------------------MFVRIVKMS-.FHEEKI..PDFL--E-------N.----F----E-S-------V---KD..
A9WHE0_CHLAA/1-72------------------MYGLIGKMR-.ATPGQR..DALI--A-------I.----L----V-E-------G---AS..
H7C6P0_BRADU/1-79------------------MFIAMNRFQ-.VKKGAE..TAFE--T-------V.----W----A-T-------R---ES..
YGIN_ECOLI/1-87------------------MLTVIAEIR-.TRPGQHHRQAVL--D-------Q.----F----A-K-------I---VP..
MHUD_MYCTU/3-76------------------.VVKINAIE-.VPAGAG..PELE--K-------R.----F----A-H-------R---AH..
Q2FV13_STAA8/45-118------------------..CVLNHLY-.INEGQE..ETFE--Q-------K.----F----L-R-------R---NK..
HDOX1_STAA8/3-78------------------.FMAENRLT-.LTKGTA..KDII--E-------R.----F----Y-T-------R---HG..
HDOX2_STAA8/1-77------------------MFMAENRLQ-.LQKGSA..EETI--E-------R.----F----Y-N-------R---QG..
Q2K560_RHIEC/1-80------------------MYIAMNRFK-.VVTGTE..GDFE--T-------V.----W----R-N-------R---DS..
Q2YKI2_BRUA2/1-80------------------MFIAMNRFK-.VRIGSE..TDFE--T-------V.----W----K-N-------R---DS..
Q2YLT4_BRUA2/1-77------------------MIAVIFEAW-.VPGEAQ..TEYL--D-------L.----A----A-E-------L---RP..
Q79ZD9_STRAW/18-90------------------..RVVLLLD-.LHDGAQ..KQFL--E-------A.----Y----E-Q-------L---RN..
Q8CZ78_STRR6/12-86------------------.LTIHVYYK-.GDGDSA..IKFA--R-------EM----L----D-S-------G---LV..
X2H731_9GAMM/1-76------------------MIAVIFEVQ-.IQPDQQ..TRYL--T-------L.----A----E-E-------L---RP..

PF16291

Q5WAX8_BACSK/3-90-------------------I.KHITCK--VKKEKK--DVFS--N-------G-----Q----A-K-------W---GY--
G8S1E6_ACTS5/2-84-------------------LLKVIVCE--VTD..V--AGFA--A-------A-----Q----A-G-------W---SA--
D4ZEB5_SHEVD/2-88-------------------IAKYIRCD--VTSQMR--PEFS--K-------G-----Q----G-L-------W---QE--
D5DXX8_BACMQ/2-88-------------------LTKIVKCS--IPTDKK--ASFS--Y-------T-----Q----Q-H-------W---AA--
Q089G9_SHEFN/2-83-------------------......CE--VDDGKQ--EAFS--Q-------S-----Q----S-A-------W---SQ--
U5L684_9BACI/2-91-------------------LVKYIRCG--VDSASR--EEFS--L-------A-----Q----M-G-------W---EP--
Q65N75_BACLD/114-202-------------------L.KLIRCK--SAEQKL--QAFS--E-------A-----Q----A-K-------W---AP--
YDBC_BACSU/2-92-------------------LIKKMICE--VDAANA--EAFA--K-------A-----Q----S-Q-------W---EA--
Q81QN5_BACAN/2-87-------------------LLKTIYCK--VEEEKK--ELFS--M-------A-----Q----E-K-------W---RD--
B5I8G4_9ACTN/2-86-------------------LVKWIRCT--VVD..R--RGFE--R-------G-----Q----R-K-------W---AG--
F8JVN5_STREN/2-86-------------------LVKWIRCR--VTD..R--TGFE--R-------G-----Q----R-E-------W---AA--
V4IUD6_9ACTN/2-86-------------------LVKWTRCT--VKD..R--RGFE--R-------G-----Q----R-K-------W---AG--

PF11695

Q9A5F4_CAUCR/31-168-------------------LAQVNVGR.LKAP.ID--HPM.----------------I---.K-D-------F---ADNL
F8EE97_RUNSL/6-145-------------------LAEINIAR.MKGVNIN--DPI.----------------M---.K-E-------F---VDNL
A4XU80_PSEMY/15-152-------------------LAQLNIAW.MKAS.LE--SPE.----------------M---.A-D-------F---VANL
G8TAU1_NIAKG/5-143-------------------LAQINIGK.MLAP.ID--SSV.----------------M---.A-E-------F---VANL
Q0RPH8_FRAAA/6-148-------------------LAQVNIAR.VLAP.LD--SPA.----------------P---.D-D-------I---LAGL
Q0RBQ9_FRAAA/10-153-------------------LAQVNIAR.LRAP.LD--DPI.----------------L---.A-D-------F---VAAL
G0FWI4_AMYMS/6-149-------------------LAQVNISR.MKAP.LD--DES.----------------F---.R-D-------F---VGAL
E0TC84_PARBH/7-144-------------------LAQVNIGR.VLGG.PD--APA.----------------M---.Q-D-------F---YRNL
Q9XAE9_STRCO/9-147-------------------LAQVNIAR.LKAP.LD--SPQ.----------------L---.K-D-------F---VDAL
U5W6J8_9ACTN/6-143-------------------LAQLNVAR.LRAP.LD--SPV.----------------L---.A-D-------F---VALL
C6WHE5_ACTMD/7-164-------------------...TTFAI.LKKP.YG--DPE.----------------V---.Q-E-------F---DDLT
Q0APS8_MARMM/5-139-------------------LAQLNIAW.MRGS.ID--DPV.----------------M---.A-D-------F---VGAI
Q163R1_ROSDO/8-148-------------------LAELNVGR.LAAP.TD--DPR.----------------V---.A-E-------F---MENL
E4N6J1_KITSK/26-165-------------------LAQVNIGR.TVAP.LD--SPA.----------------L---.A-G-------F---VAQL
I2EVC9_EMTOG/6-144-------------------LAQVNISK.LLAP.ID--SPL.----------------L---.A-D-------F---VAQL
G0L103_ZOBGA/6-144-------------------LSQVNIAR.MLAP.ID--SPV.----------------M---.A-D-------F---VKDL
M4ZXH9_9ACTN/6-146-------------------LAQLNLGL.LRAP.LD--TDE.----------------M---.A-E-------F---RAAL
D2QP51_SPILD/3-141-------------------LAQLNISR.MLAPDIN--HPI.----------------M---.A-D-------F---VAQL
A1WRH2_VEREI/5-143-------------------FAQFNVAW.LKKP.LD--HPD.----------------I---.A-D-------F---KNGI
K0EXQ7_9NOCA/7-138-------------------LAQANILY.AVDS.LK--SET.----------------L---.A-D-------F---HELA
U5QGK2_9CYAN/8-146-------------------LAQFNIGR.MKGS.LD--SPV.----------------M---.A-D-------F---VARL
S6AKH1_PSERE/7-144-------------------LAQLNIAV.MQAP.LD--SPA.----------------M---.A-D-------F---VANL
I0K5K2_9BACT/3-141-------------------LAQINIGR.LIAP.LD--TPA.----------------L---.A-D-------F---VAGL
D2ATU4_STRRD/6-142-------------------LAQLNIAH.MRAP.KD--SPE.----------------L---.A-D-------F---VAAL
M4XI80_PSEDE/7-145-------------------LAQVNIAK.ARAP.LD--QPL.----------------M---.K-G-------F---VDQL
Q027R7_SOLUE/5-143-------------------LAQVNIGR.ILHP.ID--DPR.----------------M---.S-G-------F---VNQL
A4FAH4_SACEN/6-145-------------------LAQVNIAL.PVAP.MD--SAE.----------------L---.A-G-------F---VAAL
E2Q5L4_STRC2/8-147-------------------LAQVNIGR.RKYA.LD--APE.----------------M---.K-D-------F---TDNL
E3J464_FRASU/10-153-------------------LAQVNIAR.LLEP.LD--SPR.----------------L---.A-G-------F---VAEL
B0T5Z4_CAUSK/7-144-------------------LAQVNFGR.LRAP.VD--HPM.----------------I---.K-D-------F---VDNL
F4KSW9_HALH1/6-143-------------------LAQINIAR.LIAP.ID--DPL.----------------I---.A-D-------F---VRQL
K0C7N6_ALCDB/6-143-------------------IAQLNIAT.LLAP.ID--SPQ.----------------L---.S-D-------F---IANL
I0HGL4_ACTM4/6-144-------------------LAQINTAR.LLAP.LE--DPS.----------------M---.A-E-------F---VAGL
Q0BYF9_HYPNA/5-155-------------------LVHFNCVRPLGAFALD--NPY.----------------V---.M-T-------F---LSVL
C7QH43_CATAD/16-156-------------------LAQVNIGR.LVAP.LG--DPA.----------------I---.E-D-------F---TKNL
D6X6B2_STRPR/13-151-------------------LAQVNIGR.LKHP.LD--SPQ.----------------L---.K-D-------F---VDNL
G8SIB6_ACTS5/6-144-------------------LAQINTAR.LRAP.LA--DPS.----------------M---.A-E-------F---VAGL
B9JB79_AGRRK/2-147-------------------...YNFGL.HVAP.YE--SPE.----------------V---.E-G-------F---RLRE
B9JTF5_AGRVS/7-155-------------------LALYNFGL.HVAP.SG--DPA.----------------I---.Q-G-------F---VDRE
A9B229_HERA2/6-143-------------------LAQLNIGT.IKAP.LD--TPL.----------------M---.A-D-------F---TNNL
R4LEJ6_9ACTN/5-162-------------------.ALYTFG..LIDP.AL--DPDT----------------M---.A-D-------F---AERG
D7B9L7_NOCDD/15-153-------------------LAQINVGI.LKAP.LD--DPS.----------------M---.A-G-------F---TARI
F4AZ85_DOKS4/5-144-------------------LAQVNVAR.MKGVSIN--DPE.----------------M---.K-D-------F---RDHT
V9VXL5_9RHOB/7-167-------------------LAFMTFSV.LKAP.YG--DPS.----------------V---.Q-E-------F---DDRT
C5BJX2_TERTT/5-143-------------------LAQVNIAK.FRLP.QD--HPV.----------------N---.K-D-------F---VDNL
M9R7J4_9RHOB/3-143-------------------LAELNIGR.LLAP.TD--DPR.----------------V---.K-D-------F---MDNL
F3ZD85_9ACTN/31-189-------------------L..YTFGV.LKSP.LA--DPGP----------------L---TR-A-------L---QDSG
A1K291_AZOSB/3-140-------------------LAELNVAR.LLAP.ID--SPQ.----------------L---.A-G-------F---VNQL
H2JWD5_STRHJ/4-164-------------------LALYTFGV.LKSP.LA--DPAP----------------L---TR-E-------F---YDAG
S5VG62_STRC3/12-150-------------------LAQLNVAA.LTHP.LD--DPR.----------------T---.A-P-------F---VELL
Q2JDS7_FRASC/6-148-------------------LAQVNIAR.LLAP.PG--SSA.----------------L---.T-D-------F---VAGL
Q15UR5_PSEA6/3-141-------------------LAQLNIAT.TLYP.ID--APE.----------------M---.A-D-------F---VNNL

PF07682

C7LRC9_DESBD/11-306-----------------.IYVALNMSK--VVNNEE----------------------S---FD-L-------M---HKVG
L0DXR4_THIND/8-328-----------------GAALAINQAA--VANDPQ----------------------T---FE-K-------M---GHIG
F8I6C7_SULAT/3-301-----------------VPYIAVNKAR--VLNAPS----------------------S---FE-T-------F---TSVG
O66762_AQUAE/8-332-----------------GVAVAINKAK--VNNTPR----------------------F---QE-L-------M---YQVG
Q6L0W6_PICTO/3-301-----------------KPYVAINIVE--MLNNET----------------------T---MN-M-------F---QQVG
F4B4D5_ACIHW/1-294-----------------.......MAE--LKNEPK----------------------T---FE-M-------F---ASVG
D0L035_HALNC/5-309-----------------NPIIAINMAK--IANKPD----------------------S---YE-T-------M---MKVG
L0DTB9_THIND/25-315-----------------.LYVAINRVL--VENNPN----------------------L---MR-M-------M---RQAS
Q972K4_SULTO/3-303-----------------KPYVAINMVE--VRNDPK----------------------T---LE-L-------F---GKVG

PF07978

Q7PGV6_ANOGA/173-270------------------YE..IRSYR--LKPGTM--IEW.----------------G----N-N-------W---ARAI
Q7SGJ2_NEUCR/232-329------------------FE..LRSYT--LHPGNL--LEW.----------------E----T-H-------W---RRGL
Q5LMH4_RUEPO/1-102------------------MLTCIIRYH--IDPTKR--AQF.----------------.----E-R-------Y---ARTW
Q6W252_SINFN/3-102------------------YE..IRTYR--LKNGAI--PAY.----------------L----K-V-------V---EEEG
Q98EJ3_RHILO/1-102------------------MITCYLKYV--IDPYKL--AEF.----------------.----E-E-------Y---GRRW
Q89P12_BRADU/7-101------------------VD..LRVYT--IRLRKM--AEF.----------------I----E-V-------F---DRLA
Q89KU9_BRADU/3-106------------------YE..MRVYR--CVPGRL--PAL.----------------L----K-R-------F---ETAT
Q82QD1_STRAW/4-107------------------YQ..LRVYT--LRSPEA--LVA.----------------Y----E-N-------I---WSQH
NIPS2_MOUSE/182-279------------------YE..LRSYQ--LRPGTM--IEW.----------------G----N-Y-------W---ARAI
Q98DQ0_RHILO/2-103------------------TITCFIRYE--IDPFGK--AAF.----------------.----E-E-------Y---ARNW
Q98IN9_RHILO/48-151------------------YE..LRIYD--CLPGRL--PAL.----------------L----K-R-------F---SDQT
Q89JD9_BRADU/9-109------------------SVTVFIRYQ--LDPFKR--AQF.----------------.----E-E-------Y---SKRW
Q5M949_RAT/37-136------------------YE..FRTYS--LKPSKT--NAF.----------------L----Q-N-------F---QKYV
Q7VX89_BORPE/3-102------------------IE..ERDYR--IKPGKA--GLF.----------------V----A-T-------Y---EAHG
Q983U2_RHILO/146-257------------------VV..IRIHH--LRSGAE--TEF.----------------A----S-R-------F---AAEA
NIPS1_MOUSE/185-282------------------YE..LRTYK--LKPGTM--IEW.----------------G----N-N-------W---ARAI
Q88JP3_PSEPK/3-104------------------YE..LRTYT--LDPLKM--ADW.----------------L----A-L-------Y---QSHA
Q6C7U3_YARLI/393-490------------------FE..LRTYD--LKPGKL--MEW.----------------E----T-S-------W---KRGL
Q5M949_RAT/146-245------------------YE..LATFQ--MKPGGP--ALW.----------------G----D-A-------F---KRAI
Q89P26_BRADU/3-96------------------YE..IATLT--VKLGTA--AKA.----------------V----A-G-------I---GDYV
Q89P26_BRADU/107-202------------------YE..IRTYR--LKHGGV--PPT.----------------I----A-A-------W---EAAM
Q983U2_RHILO/19-118------------------VE..LRQYT--LNPGQR--ETL.----------------I----A-L-------F---DREF
A9CLJ4_AGRFC/3-102------------------VE..ERIYR--IRGGKM--QEY.----------------L----K-L-------V---REEG
NPS3A_PONAB/37-136------------------YE..FRSYY--LKPSKM--NEF.----------------L----E-N-------F---KKNA
A9CJ80_AGRFC/1-102------------------MLTCFIRYE--IDPFKV--DAF.----------------.----E-R-------Y---ARNW
YMQ1_CAEEL/427-524------------------YD..LRSYV--LQPGTM--IDW.----------------A----S-A-------W---AKGI
Q63UF8_BURPS/3-102------------------YE..IRTYR--VKTGAV--LAY.----------------L----K-L-------V---EEEG
Q6N5T9_RHOPA/71-174------------------YE..SRVYR--CVPGKL--PAI.----------------L----K-R-------F---ETIT
Q7UP06_RHOBA/160-263------------------YE..LRLYE--SANERL--GDLK----------------V----E-M-------F---NAGE
A6VZH8_MARMS/5-99------------------....YVRYV--IDPKKV--REF.----------------.----E-E-------Y---AKMW
F1QWR0_DANRE/62-160------------------YE..FRTYY--IQPHLN--AAF.----------------L----K-L-------T---NEKI
F6W3L2_XENTR/18-115------------------YE..FRTYT--VKPAMM--SDF.----------------M----K-L-------T---SENI
Q2YLT3_BRUA2/5-100------------------....VITYD--IDPNRQ--ELF.----------------.----A-Q-------Y---ARNW
S6AQW2_PSERE/106-203------------------YE..LRVYD--LVPAGL--APT.----------------L----K-G-------W---ENAV

PF08803

A8EUX1_ARCB4/4-99-------------------ILQVDFPH--DGI.FG---------------------------E-E-------F---SKAF
E3JD16_FRASU/8-97-------------------.....FGL--TIP..V---------------------------E-S-------Y---NAHA
F4PWG8_DICFS/4-99-------------------ILQFDFEY--PSHLLG---------------------------D-V-------L---VQNA
Q5LVU2_RUEPO/6-101-------------------IWDLHLTY--DGP.LS---------------------------Q-E-------F---LTGT
Q8FSM8_COREF/4-99-------------------LLVFEFPS--TGP.FG---------------------------A-D-------A---ETAY
Q6BHZ0_DEBHA/4-99-------------------VLQVDFKM--NGP.FG---------------------------D-E-------M---AEQF
Q7CPL0_SALTY/5-100-------------------LLQIHFNF--SGP.FG---------------------------E-E-------M---TQQL
Q6LHD1_PHOPR/17-112-------------------LLQVDFEF--NGP.FG---------------------------E-D-------M---AKAF
M1NIW1_9CORY/4-99-------------------LLFFEFPF--TGP.FG---------------------------A-E-------A---ETAY
C1D9W2_LARHH/6-103-------------------LLQIDFDY--AGP.WG---------------------------A-D-------L---AAAA
Q02D50_SOLUE/2-98-------------------ILQINFNL--NVP..A---------------------------A-E-------Y---RTMA
YDHR_ECOLI/4-99-------------------LLQLHFAF--NGP.FG---------------------------D-A-------M---AEQL
Q7CGF9_YERPE/4-99-------------------ILQVDFPY--TGP.WG---------------------------N-E-------M---TKAM
A8FDT9_BACP2/4-99-------------------VLQVDFKM--NGP.FG---------------------------D-E-------L---AKEF
H2FWK5_OCESG/4-99-------------------ILQIDFPF--SGP.FG---------------------------E-E-------M---AQAM
S5SR49_9CORY/4-99-------------------LLVVEFPS--AGP.FG---------------------------A-E-------A---ATAY
C4ZIG6_THASP/4-99-------------------LLQVDFPY--AGP.WG---------------------------E-D-------M---AQAM
A5WCX6_PSYWF/4-99-------------------LLQIDFPY--QGP.FG---------------------------E-A-------F---YEAM
Q24N18_DESHY/3-98-------------------LLQIDFKM--KGP.WG---------------------------K-E-------M---SMAF
F2F1L1_SOLSS/4-99-------------------ILQVDFKM--DGP.FG---------------------------D-E-------M---AVGF
Q87FS2_VIBPA/4-99-------------------LLQVDFEF--HGP.FG---------------------------E-E-------M---SNTL
B7VH82_VIBTL/3-98-------------------LLQVDFEF--SGP.FG---------------------------E-E-------M---SNAL
A1K9H6_AZOSB/5-100-------------------LLQIDFPY--DGP.WG---------------------------E-A-------L---ASAC
I2B924_SHIBC/5-100-------------------ILQIHFTW--SGP.FG---------------------------A-E-------M---AASL
E1Z2Y0_CHLVA/4-104-------------------LLQVDFPF--QGP.FG---------------------------D-A-------T---TEGM
K9U1S6_9CYAN/4-104-------------------IIQIDFKR--DRS.QK---------------------------K-T-------A---SSRT
B2IYQ3_NOSP7/78-174-------------------ILQINFKY--NNS..T---------------------------S-D-------F---RKQM
A0KFG2_AERHH/4-100-------------------LLQIHFNF--PAEMMG---------------------------P-A-------L---TAAA
Q6ZE60_SYNY3/5-101-------------------ILQINVTY--DCS..Q---------------------------A-E-------L---ENVF
D2VKN0_NAEGR/3-98-------------------LLQVHFKF--NGP.FG---------------------------E-E-------M---SEQL
Q3IK82_PSEHT/4-99-------------------LLQVDFDF--AGP.FG---------------------------E-Q-------M---SAAL

PF07237

B5GYT2_STRC2/1-95------------------MYLVVYLHR--VPRSRE--EVFRAVV-------HRA.NEV---FR.R-------H---GAIG
Q28SF7_JANSC/2-97------------------TYVDGFILP--VKTARK--DDYIKAA-------QKM.TAL---YL.A-------H---GAAR
B9J727_AGRRK/3-103------------------.YVDGFILA--VPKDKI--EAYKALA-------HTA.GEV---WM.E-------H---GALS
Q8PBE1_XANCP/2-103------------------SYIDGFVLA--VPTANK--EKFLEHA-------RTG.DAI---CL.E-------H---GALR
D2R596_PIRSD/2-117------------------TYFDCFLAP--VPRDNR--AAYEELA-------RIS.EQV---VL.E-------C---GAIR
J7QVW7_METSZ/2-102------------------SYVDGFVIP--VPAENK--EAYRKMA-------ALA.WPI---FK.E-------F---GALE
Q0C3F1_HYPNA/123-216------------------.YIDGTVIP--VPADKR--GAYTAAS-------HKM.AEL---FQ.E-------F---GAIS
Q1D7D3_MYXXD/125-223------------------.YVDGSLVP--VPVGNK--EAYHVIA-------SRL.AAV---LL.E-------H---GATR
V5S991_9RHIZ/2-103------------------TYVDGFVLA--VPAANK--QAYLEVA-------ARM.API---FK.E-------F---GATR
G8ATI6_AZOBR/2-107------------------AYIDGFVIA--VPTANK--QAFIDHA-------NKV.DVL---FK.E-------L---GATR
A6X0L9_OCHA4/2-103------------------AYIEGFVVA--VPKANK--ELYRKHA-------AEA.AVL---FK.E-------F---GVTR
K0CB81_ALCDB/2-104------------------NYVDGFLLP--LPKEDL--DAYLEMS-------RKA.GEV---WK.E-------Y---GAID
K9SFX5_9CYAN/2-103------------------HYIDGCVLA--VPIGNK--DIYKKYA-------EAV.AIV---FK.E-------Y---GALK
Q0ANC9_MARMM/2-101------------------AYVQGYVAA--VPDENR--DAFIESS-------VVM.CAM---MK.E-------F---GALQ
Q82XJ8_NITEU/2-114------------------TYVDGFVLP--VPEGKI--DAYRQMA-------ESA.GKI---WM.E-------H---GALQ
E3F379_KETVY/2-102------------------TYYSGTLIA--VPTASK--EIYTDYA-------RTS.WPL---FQ.R-------L---GAVR
B2FL05_STRMK/2-104------------------AYVDAYVLP--CPQDKV--AAYRRLA-------RKA.GAV---WK.D-------H---GALQ
Q89NE4_BRADU/4-102------------------.YVDGFVLA--VPKDKI--EAYKALA-------KTA.CAV---WM.E-------H---GALD
Q2NCG7_ERYLH/1-101------------------MYIQGFLVP--VLSGKK--DAYLAMA-------KDA.GEM---FQ.R-------Y---GAIE
F6IFW1_9SPHN/2-103------------------TYVEGFVIA--VPIANK--ASFIAHA-------EEF.DAL---FV.E-------K---GASR
A4YT03_BRASO/13-113------------------MYIAGFVIP--VPAEKL--EAYRRWA-------ERG.ALL---FR.E-------Y---GCIE
B8EQ30_METSB/3-103------------------.YVDGFVLA--VPKEKI--EDYKKAA-------QTA.GAL---WK.E-------Y---GALA
G2IQJ1_9SPHN/7-107------------------MYVAGLVIP--VPEARM--DAYRRWA-------ENS.AQI---FS.R-------Y---GCLE
B8IJU9_METNO/2-103------------------TYVDGFVIA--VPKDRI--EDYKAMA-------RRA.GEL---WK.E-------H---GALA
I3U9U4_ADVKW/2-103------------------KYVDGFVAA--VPTANR--EAYIKHA-------SEA.AEV---FK.E-------L---GALS
A1W852_ACISJ/5-103------------------SYIDGFVLA--VPTANK--ETFRQHA-------SEA.AQI---FK.K-------H---GALE
A9FY32_SORC5/2-103------------------SYVDGFVVP--VPAGKK--QAYRDLA-------EKA.AAV---FK.E-------H---GAIR
W0AJL6_9SPHN/125-224------------------.YADGYLVP--VPEGKK--EAYRAMA-------AKA.AGL---FR.E-------Y---GATR
I4B2R6_TURPD/2-101------------------SYIDGFVIP--VPLAKK--DAYFEMA-------RMA.KAL---YL.E-------C---GALR
I0HMS9_RUBGI/2-107------------------SYVDGFVIA--VPTANK--QQFIDHA-------SRF.DAL---FI.E-------Q---GATR
Q89LX7_BRADU/1-101------------------MYIAGFVIP--VPEDKM--EAYRRWA-------ENG.SAL---FR.E-------Y---GCLE
M4S0F5_9SPHN/3-103------------------.YVDGYVLA--VPVEKI--DEYREMA-------VRA.GEV---WK.E-------H---GAIA
S6AFX9_PSERE/2-103------------------TYVDGFVVP--VPTANC--EAYRKVA-------EMA.AGV---FK.E-------Y---GALS
D7A8V6_STAND/2-103------------------SYVDGFVLA--VPTAKK--DDYRILA-------AKC.API---FI.D-------H---GAQH
Q21G53_SACD2/2-103------------------TYIDGFVAA--VPTANK--DKYIAHS-------KLS.IAV---FK.D-------H---GALK
B2JM74_PARP8/2-103------------------NYVDGFVLA--VKAENR--DLYRRHA-------TTA.AGV---FK.E-------Y---GALK
E1V408_HALED/2-103------------------TYVDGFVAA--VPTANR--EKYLQHV-------RDC.AGV---FK.E-------H---GVLK
Q92NA2_RHIME/2-103------------------AYVDGFLVA--VPTANI--EAYKKLA-------SAA.GAV---WK.E-------H---GALN
F5XY16_RAMTT/2-117------------------SYIDCFLAP--VPSANR--SEYELLA-------KIS.AQV---VK.E-------H---GALR
A1B4H4_PARDP/2-102------------------TYYSGFLLP--VPTANK--QKYIDMA-------QGA.WSM---FK.R-------Y---GALR
A7HVY2_PARL1/2-102------------------SYVEGFLVA--VPAANK--ELYRKHA-------QEA.WSI---FA.E-------F---GMSR
I3TII5_TISMK/5-105------------------.YVDGFVAA--VPTTAR--EAFRAHA-------EAA.AVV---FR.E-------N---GALG
Q09CK7_STIAD/2-103------------------KYVEGFVAA--VPAANK--EMYRQHA-------AEA.APL---FK.E-------F---GATR
D0J6R4_COMT2/2-106------------------SYIDGFVIA--VPTANK--QKFIEHA-------RKL.DPI---FI.E-------L---GAIR
B6ITX3_RHOCS/21-122------------------TYVDGFVLA--VPRAKL--DAYTALA-------RTA.AEV---WK.E-------H---GALA
Q0C3F1_HYPNA/2-102------------------TYVSGFLLA--VPTANK--DAYRKQA-------EEA.WPM---FK.G-------Y---GAVA
G8R5I7_OWEHD/3-96------------------NYIDGFMLP--IPRKHL--HEYKAVA-------EQV.AEI---WK.E-------Y---GALA
N0B831_9RHIZ/2-103------------------AYVDEFVVA--VPEKSI--ADYKKLA-------RKA.GKI---WL.E-------H---GALE
A9C096_DELAS/2-104------------------HYIDGFVLP--VPRANL--QAYREVA-------QAA.GKV---WM.E-------Y---GALQ
B2ID24_BEII9/3-104------------------NYVEGFVAA--VPAANK--EAYRRHI-------QEA.FPL---FK.Q-------F---GATR
Q0K872_CUPNH/2-103------------------SYIDGFVLA--VPQATR--ETYRQVA-------QKA.AAV---FK.E-------H---GALK
F7QJ30_9BRAD/2-105------------------QYVDGFVLP--VPKKNL--KAYTALA-------KLA.CKV---WL.E-------H---GALD
G2IQA6_9SPHN/2-100------------------TYVDGFLCP--VKPGRK--ADYEEMA-------RMA.APL---FL.E-------Y---GALR
B3PD68_CELJU/3-105------------------HYVDGFLLP--IAPEKL--TEYQKMA-------DKA.GAV---WK.D-------H---GAIA
A9IUP3_BORPD/4-105------------------QYVDGFLLA--IPKDKL--DTYQAMA-------STA.GAV---WK.E-------H---GALD
E6WPA7_PSEUU/2-104------------------AYVDGFVLP--VPKDRI--DDYRALA-------EAA.GRI---WL.E-------Y---GALE
Q984U4_RHILO/2-103------------------NYIAGFVAA--VPAASK--EAYRRHV-------TEA.ASV---LK.E-------F---GTTR
B4RHI4_PHEZH/3-103------------------.YVDGFVLA--VPKANL--EAYKEMA-------RLG.AQV---WM.E-------H---GALS
B2ID24_BEII9/126-226------------------.YTDGFVLA--VPSVNK--EAYRAVA-------SKM.AAM---LK.D-------Y---GAIR
Q15TI8_PSEA6/2-104------------------SYIDGFVVA--VPSANK--EEYKAYA-------KQC.IRI---FREE-------Y---GALS
F8J4V4_HYPSM/2-103------------------SYVDGFVVP--VPFERL--KDYRKLS-------KRA.GKV---WR.E-------H---GALA
Q12MS1_SHEDO/2-103------------------SYMDGFVAA--VPTANK--DKYIEHA-------KLT.ALV---FK.D-------H---GALK
G8MEM7_9BURK/3-106------------------HYVDGFVVP--VPIDKI--DAYRAMA-------EAA.GKI---WL.E-------H---GALQ
D0LSP9_HALO1/2-102------------------SYVDGFIIP--VPRENK--EAYRKLA-------AEM.LPM---FR.E-------L---GALQ
E8RPL4_ASTEC/2-103------------------SYVDGFLIP--VPKENR--AAYKKMA-------ETA.AEV---FK.E-------Y---GALQ
Q7VWQ1_BORPE/3-103------------------QYVDGFLLS--VPNDKL--DTYRQMA-------TKA.GAI---WK.E-------H---GALA
C7NJF5_KYTSD/19-131------------------...DVTMVP--VAVNQR--EAYLAFE-------KRM.AEV---YR.D-------H---GATQ
A9WHX6_CHLAA/3-114------------------.YFDFYLVP--VPIENK--TAYEELA-------YIS.AQV---LR.E-------Y---GAVR
W0AJL6_9SPHN/2-103------------------TYVEGFVAA--VPAANK--QAYIKHA-------SDA.APL---FK.A-------F---GVTR
B1ZRB2_OPITP/3-106------------------KYVDGFVLP--VPKKNL--AAYFKMA-------KAA.SKV---WR.D-------H---GALE
K9UEC3_9CYAN/2-102------------------TYVDGFVIA--VPTANR--AAYQKIA-------EDA.AIV---FK.E-------Y---GALK
Q984U4_RHILO/125-217------------------.YIDGSLVP--VPIANK--AAYLAVA-------SKH.AAV---IK.E-------F---GATR
D4Z3X9_SPHJU/2-103------------------SYMDGFVIP--VPKGNK--ERYREVA-------AYA.API---FI.E-------H---GALR
G4RAE0_PELHB/3-101------------------.YIEGFVAA--VPTANK--EVYLKHS-------QEA.AAY---FK.R-------N---GATR
K9RSJ8_SYNP3/2-117------------------TYIDFYLVP--VPCENK--SAYEELA-------RIS.AQV---VK.E-------Y---GALC
A8AJZ2_CITK8/2-103------------------KYVDGFVVA--VPAENK--EAYREMA-------AKA.APL---FK.E-------F---GALR
A7HVY2_PARL1/124-224------------------.HIDGYVLA--VPKANK--EAYREMA-------AKA.APV---FL.D-------H---GATR
E0TG43_PARBH/2-101------------------TYYDFAVTA--VPAANR--EAYVEHA-------KEF.ATI---AA.A-------F---GPLA
A5V8A2_SPHWW/3-103------------------.YVDGFIVA--VAKDKL--DDYTALA-------ERA.RDV---WM.S-------H---GALS
E1WZE7_HALMS/3-105------------------NYVDGFIAP--VPKKNL--DAYKAIS-------EKA.GKI---WM.E-------Y---GAIS
E3F379_KETVY/124-225------------------.YIQGFVLA--VPASNK--IAYIAEA-------ERGWAEM---FS.P-------L---GCLG
Q3J6F6_RHOS4/3-101------------------.YVDGFVCA--VPVENR--QKYIDHA-------LFA.ARK---FK.E-------L---GALQ
C6XML8_HIRBI/2-102------------------TYVTGFLLP--VPKKNK--DRYTELA-------KAS.WPL---FK.E-------Y---GALS
D2S2U1_HALTV/4-110------------------.YVDGFVLP--VPNDKL--DSYREMA-------DEA.GKL---WI.E-------H---GALE
B8IGF6_METNO/2-102------------------AYVEGFALA--VPHANR--QTYEKMA-------VVA.AHV---YK.E-------H---GALS
B6JDI6_OLICO/2-105------------------QYVDGFIVP--VPKKNL--TAYRALA-------RKA.GKI---WR.E-------H---GALD
Q6MH99_BDEBA/3-105------------------KYVDGFVLT--VPKKNM--AQYRKMA-------MQA.SKI---FL.K-------H---GALE
Q1GX81_SPHAL/125-226------------------.YVDGFVAP--VPDANK--DRYRAMA-------KMA.SEI---FI.E-------H---GATR
Q1GX81_SPHAL/2-103------------------TYVEGFVVA--VPTANK--DAYRRHA-------ADA.APL---FR.E-------F---GVTR
F5Y4J2_RAMTT/2-105------------------NYIDGFVAA--VPTANR--QLYLEHV-------RMA.AQV---FK.D-------H---GALQ
Q98HZ3_RHILO/2-103------------------SYVDGFVLA--VPKAKL--DDYKKLA-------NLA.GPI---WM.E-------H---GALA
E8RPL3_ASTEC/12-111------------------TYVDGFVCP--VKAENR--DAYLKSA-------QVT.ATL---FK.E-------L---GALA
M4NEX2_9GAMM/2-102------------------SYVDGFVIA--VPDANR--EQFIAHA-------RHF.DAM---FL.E-------F---GATR
U4KCB2_9VIBR/2-103------------------SYVDGFAAA--VPQENK--QKYIDHA-------LMA.AGL---FK.E-------L---GALS
M4VN50_9DELT/3-103------------------KYVDGFVIK--VKKKNM--PAYKKMA-------KLG.KKI---WL.E-------Y---GALD
B8GIK1_METPE/2-107------------------KYVDGFVLV--VPDEKL--ADYRKMA-------KTG.EKL---WK.K-------Y---GALE
Q11C17_CHESB/2-101------------------AYVDGFIIP--LPNDRV--DDYKRQA-------QLG.EQV---WR.E-------H---GAIG
D3SAH4_THISK/2-95------------------NYVDGYVIP--IPRDRI--EDYRQQA-------DLA.AQI---WR.E-------H---GALE
K4KKH1_SIMAS/2-104------------------SYVDGYVLA--VPLKNK--TQYIELA-------EAS.AAV---FK.D-------H---GAIA
Q1D7D3_MYXXD/2-103------------------AYIDGFVIA--VPSANK--EAYRQAA-------IAA.APL---YK.E-------F---GATR
W0JAW7_9BACT/3-105------------------HYVDGFVIP--VPKKNI--AAYRRMA-------RLG.GKL---WR.E-------H---GALD
H5WRE5_9BURK/2-103------------------NYVDGFVTP--VPVANR--QAYVEHA-------EKV.AAL---FR.E-------H---GALS
D9QND0_BRESC/3-101------------------.YVSGFLTP--VKAQDK--DRYIASA-------AKS.WPV---FQ.K-------Y---GCLE
E3I2U0_RHOVT/2-102------------------TYVEGFLLA--VPASKK--DAYLAMA-------EAA.VPL---FK.E-------F---GATR
B0T2P9_CAUSK/2-103------------------SYVDGFVIA--VPKAKI--EDYKAMA-------KLG.SEV---WM.E-------Y---GAVS
A7HS11_PARL1/2-103------------------AYVDGFVLP--VPKKNL--DAYKRMA-------RKA.GKV---WM.E-------H---GALD
A1U2N5_MARHV/2-103------------------SYIDGFVAA--VPTANK--EKYIKHA-------SDA.AAV---FK.E-------Y---GALK
A2SLW6_METPP/28-129------------------NYVDGFVLA--VPTAQR--EAYTQIA-------QKA.SVV---FK.D-------H---GALS

PF05336

Q5KCR2_CRYNJ/37-147------------------RICQIVKVK--..PERL--DEYK--K.......VH..AEV...WP-E-------V...LGAL
E8N7B3_MICTS/3-106------------------RFASVIGVS--..PENR--EEYE--R.......YH..AAV...WP-G-------V...LEQI
G8NW33_GRAMM/3-106------------------RYAQVIQLR--..AEDE--AEYI--R.......YH..ADV...WP-S-------V...LERI
R6A9X3_9BACT/17-125------------------RFCQTLDLK--NEPELI--AAYK--K.......LHEEGHV...WR-E-------I...LSGI
Q2G5L0_NOVAD/2-105------------------REVFMLDLA--.DEALA--AAYE--D.......WHRPGRV...PA-G-------V...LADI
E3J5G6_FRASU/3-105------------------RYCFLLTVR--..PELL--DEYR--A.......RH..AAV...WP-E-------M...LRAL
RHAM_CLOB8/3-103------------------QKAFKMKLF--..EGKE--EEYK--K.......RH..NEI...WP-D-------L...VKEL
F3Y8K3_MELPT/17-117------------------KKAIRMKLY--..PECK--EVYI--Q.......RH..QQL...WP-E-------M...RQML
D1BAI9_SANKS/1-101------------------.MCFVSQVD--..PARL--DEYR--A.......HH..AAV...WP-E-------M...LEAL
R6EFZ5_9FIRM/3-103------------------KYAWRGKIV--..PGMQ--EEYK--K.......RH..DNI...WP-E-------M...KEVL
E8V1U4_TERSS/3-109------------------RYCFVLDLR--PDPVLI--AEYI--R.......LH..QGV...WP-E-------I...RESI
Q8A1J5_BACTN/18-126------------------RYCQTLSLK--NNPILI--EEYR--K.......IHSEEKA...WP-E-------I...RAGI
G8UKT9_TANFA/3-106------------------RYGSIIGVR--..PEKL--EEYK--K.......LH..AAV...WP-E-------V...LRTI
R7BFW5_9FIRM/6-107------------------KYAWTWKVK--..PECL--DEYV--K.......MH..NNP...WP-E-------I...MEEH
C6VV82_DYAFD/7-106------------------.KAFRMQLK--..PGFE--AEYK--K.......RH..DEI...WP-E-------L...SGLL
X2H2T6_9GAMM/3-103------------------RKATIMQVH--..PDKH--AEYK--K.......RH..DEI...FP-E-------L...VTEL
X6NJ28_RETFI/26-133------------------RYGSIIGLK--..PEKE--QYYR--Q.......LH..SST...WP-K-------V...LERL
RHAM_ROSDO/4-104------------------RYVFRMRLN--..PGKQ--AEYQ--R.......RH..DEI...WP-E-------L...VDLL
R6NFT0_9BACE/3-109------------------RYCQTLDLY--DDKELI--EAYV--A.......EH..AHV...WE-E-------V...KAGI
C6Y2X4_PEDHD/3-103------------------KIAFKMKLL--..PGVK--AEYR--K.......RH..DEI...WP-E-------L...IELL
M9R5B0_9RHOB/4-104------------------RYVFRMCLN--..DGMA--DEYK--R.......RH..DAI...WP-E-------L...VGLL
D8MRW2_ERWBE/3-103------------------RKAFVMQVH--..PDKH--QEYQ--Q.......RH..NPI...WP-E-------L...AKTL
S6C4A1_9ACTN/4-102------------------..TFKMKLY--..PGME--EEYE--R.......RH..NEL...WP-E-------M...IDMI
R7J4V8_9PORP/3-106------------------RVGSIIEVR--..PEKL--EEYK--H.......LH..ANV...WP-G-------V...LEMI
L0G2V5_ECHVK/4-110------------------RYTMALDLK--DDPTLI--AEYE--K.......FH..QAV...WP-E-------I...QKSI
R6YJI9_9BACE/3-109------------------RFCQTMDLY--DDPELI--AAYV--A.......EH..DHV...WE-E-------V...KEGF
D7CRS7_TRURR/5-108------------------RVGFVLKVK--..SELL--EQYK--A.......RH..QNV...WP-E-------M...RAAL
M4WU28_PSEDE/4-110------------------RHCLALDLA--DDPQLI--AQYR--Q.......AH..QRI...WP-E-------V...AANL
E8WVL5_GRATM/3-109------------------RFCLALDLR--PDPLLQ--EQYV--R.......YH..QHV...WP-E-------V...QQSL
R5F8H2_9CLOT/21-121------------------RKGFKMFLN--..PGMA--EEYE--K.......RH..NAL...WP-E-------M...KEMI
Q017X5_OSTTA/20-125------------------TYAQTIELR--..ADGV--EEYV--R.......LH..AAV...WP-E-------V...LSSL
V2XST4_MONRO/8-118------------------RICQIIKLK--..PAAE--AEYR--E.......IH..AAV...WP-G-------V...LAAL
RHAM_BURXL/3-103------------------TIAFRMVLN--..PGMR--EEYE--R.......RH..AQI...WP-E-------L...VDAL
D3FCI7_CONWI/3-103------------------RVCFTFEIH--..PGTE--AEYK--Q.......RH..DEI...WP-E-------L...VEAI
F5YG46_TREAZ/3-104------------------RFVWKARLL--..PGKR--EEYI--R.......RH..DEI...WP-E-------M...TELL
X5DE39_9BACT/3-103------------------RIAFKMYLN--..EGQK--EEYK--K.......RH..AEI...WP-E-------L...KQLL
C7MF49_BRAFD/3-102------------------RIALHTRIA--..EGRE--ADYD--R.......EH..ARI...PD-E-------L...DASL
A6KWX7_BACV8/17-125------------------RYCQTMDLK--DDPELI--AKYR--E.......CHSKEKS...WR-E-------I...REGI
G2R0M2_THITE/36-147------------------RFAQIVKLK--..PEFV--DKYK--E.......VH..AAV...WP-E-------V...LKQI
R5CS86_9BACT/17-125------------------RYCQTMRLK--DDAELI--RKYR--E.......AHDKEHF...WN-E-------I...KQGI
R5GT53_9BACT/20-128------------------RYCQTLDLR--DEPALI--AEYR--R.......LHSEPCI...WQ-E-------I...LDGI
U5VPP9_9ACTN/2-101------------------RYCFHLQVR--..EDRI--AEYV--E.......RH..QAV...WP-E-------M...QSAL
D1AQR2_SEBTE/6-106------------------RFGSVSKVK--..PEKL--EYYK--K.......LH..ANP...WP-Q-------I...NSMI
F0RIC4_CELLC/5-113------------------RYCYSCDLK--NDSKLI--EEYK--A.......YHAKGKA...WP-E-------I...TKSI
H1YCQ6_9SPHI/3-103------------------RRAFKMKLF--..PGYT--EEYK--K.......RH..DEI...WP-E-------L...VALL
RHAM_SINFN/3-103------------------KYAFRMRLN--..PGMA--EEYR--A.......RH..DAI...WP-E-------L...VTLL
M3CIR2_SPHMS/7-117------------------RIAQIVRLK--..RESL--QAYK--E.......CH..DAV...WP-A-------V...LQQI
H6MRG6_GORPV/6-114------------------RVCLVMRLR--..PDRI--DDYL--A.......AH..EHV...WP-E-------M...LDAL
R6W2E5_9BACT/17-125------------------RFVQTMQLK--DDSELM--KEYR--K.......AHDKDHF...WR-E-------I...EEGI
H1W373_COLHI/35-146------------------RIGQIVKLK--..PEFV--DKYK--E.......VH..ANV...WP-D-------V...LKQI
B7FV54_PHATC/57-181------------------RYGAAIRLH--..PEAY--RRYR--D.......LH..DNV...WD-Q-------V...LNRM
R6RUK4_9BACE/17-125------------------RYCQTMDLK--DNPELI--AEYV--K.......RHSEAEA...WP-E-------I...RAGI
G0FMG2_AMYMS/3-105------------------RYCFCLQVK--..PDRK--AEYA--E.......RH..RAV...WP-E-------M...RQAL
C6XPT9_HIRBI/4-112------------------RVCLALDLV--DDQELI--SAYE--K.......WHRVGNV...PV-E-------I...VKSI
RHAM_FLAJ1/6-106------------------RNAFTMKVK--..SGFE--TEYK--I.......RH..DQI...WP-E-------L...TALL
RHAM_DINSH/3-103------------------KIAFKMMLN--..PGCR--EEYI--K.......RH..DAI...WP-E-------L...VDLL
E8V2R3_TERSS/3-104------------------RVAFQLCIK--..EGCE--QAYD--E.......AH..RRV...WP-E-------L...ISEL
Q8A896_BACTN/19-127------------------RYCQTLDLR--DSPELI--AEYR--K.......RHSQAEV...WP-E-------I...LAGI
G8MFN0_9BURK/3-103------------------TVAFRMTLK--..PGMR--EEYE--Q.......RH..REI...WP-E-------L...ADAL
Q7CW72_AGRFC/3-108------------------RMGMVIGVK--..PEMI--AEYK--R.......LH..AAV...WP-E-------V...LALI
L8GD23_PSED2/77-185------------------RIAQIVKLK--..PEFV--EQYK--E.......YH..ANV...WP-E-------V...LKQI
M2SXV3_COCH5/9-120------------------RIAQWLYLK--..PEAI--DEYK--K.......CH..AAV...WP-E-------V...LEQI
T2KM13_9FLAO/3-103------------------RLAFKMKLN--..KGQK--QAYK--E.......RH..DQL...WP-E-------L...KQLL
F2RHJ8_STRVP/6-108------------------RVCFLLKVR--..AGRV--EEYR--A.......RH..EHV...WA-E-------M...LTAL
N1PM30_DOTSN/6-116------------------RVAQIVRIK--..RESI--SAYK--E.......CH..AAV...WP-A-------V...LKQI
Q9HK61_THEAC/2-100------------------RYAFHLRLK--..EGSE--EEYT--R.......RH..KNV...WP-E-------M...LDLL
A4AQM8_MARSH/3-108------------------RHCLALDLK--NDIELI--SAYE--E.......YH..QNV...WP-E-------V...LQSL
C4Z7U2_EUBE2/3-103------------------RKAFKMYLK--..AGCA--DEYE--K.......RH..NEL...WP-E-------M...KAMI
C6XTA6_PEDHD/3-103------------------RIAFKMTLL--..EGHV--DEYK--R.......RH..QEI...WP-E-------I...PALL
W0F136_9BACT/3-111------------------RFCLTLDLK--NDPELI--KTYE--H.......YHSRQAI...WP-E-------V...IEGI
Q5LC58_BACFN/3-109------------------RYCQTLELY--NDSELI--RAYV--E.......EH..QHV...WP-E-------I...KAGI
I0IAI8_PHYMF/3-105------------------RHCFTLQVR--..PDRL--DDYK--A.......AH..ADV...WP-E-------M...LAAL
J0WX79_AURST/7-117------------------RIAQVIKLR--..PEHL--EEYK--K.......IH..EEV...WP-G-------V...LAAL
R6LCZ2_9BACE/19-127------------------RICRTLELR--DDPQLI--AEYR--R.......RHSQGAI...WP-E-------I...PAGI
R6SDC5_9BACE/16-124------------------RYCQTLDLK--NDPELI--RTYQ--I.......YHSESEM...WP-E-------I...LEGF
R6ARE3_9BACT/15-123------------------RYVQWLELE--SDEEAI--REYR--K.......LHSEGVQ...WK-E-------I...RDGI
W0HYB7_9GAMM/6-109------------------RFGGVIKVK--..PEKY--AYYA--K.......LH..ANP...WP-D-------V...NAMI
B2JWP2_PARP8/2-109------------------RYCLALDLK--DDPILI--ARYE--E.......FH..RNV...WP-E-------V...IQHL
RHAM_VEREI/5-105------------------KVAFRMFLI--..PGCA--AEYQ--R.......RH..AAI...WP-E-------L...SALL
R7JMG1_9PORP/19-127------------------RYCQMLDLK--NDPQLI--AEYK--K.......RHSPEYY...WK-E-------I...GEGI
W0EWF3_9BACT/3-103------------------RLAFKMKLF--..KGLE--SEYE--K.......RH..AAI...WP-E-------L...SALL
G2PEQ1_STRVO/2-106------------------RVALHSVLK--..EGQE--SGYE--Q.......VH..ATV...PE-D-------L...LEAL
I2ETX1_EMTOG/3-109------------------RYTLALDLV--DDPQLI--AEYE--A.......YH..KKI...WD-E-------I...AKSI
S0DRY9_GIBF5/8-120------------------RFAQIIKLK--..PQHI--EKYK--Q.......LH..ANV...WP-E-------V...LAQN
W5VZF1_9PSEU/4-102------------------TIALHTRLK--..PGCE--AEYD--R.......VH..ATI...PS-E-------L...DGAL
F0SAK4_PSESL/3-109------------------KYCLALDLV--DDPPLI--KEYT--E.......WH..ARV...WP-E-------V...LESI
RHAM_ENTFA/3-103------------------KKAFCMQVY--..PDQH--AEYQ--R.......RH..EKL...WP-E-------M...RQML
C1D3L6_DEIDV/10-112------------------RVCFLLQVR--..PDRL--TEYK--T.......HH..QAV...WP-D-------M...LQAL
D3AYF8_POLPA/5-111------------------.FAQALDLK--NDAELI--EEYK--K.......YH..KSV...WV-E-------V...KNAL
Q63M67_BURPS/2-109------------------RYCLALDLK--DDPDAI--ARYE--A.......HH..ERI...WP-E-------V...AAYL
G3B870_CANTC/9-119------------------RICQIVKLK--..PEYL--EEYK--E.......CH..KHV...WE-P-------V...AANL
G8TJY9_NIAKG/2-108------------------RYCLALDLV--DDAAMI--ADYE--R.......HH..DEI...WP-E-------I...VQSI
A9WV51_RENSM/8-106------------------RIALHTKLQ--..PGKE--LAYE--Q.......AH..ALI...PG-E-------L...DQLL
F8ENG6_RUNSL/3-109------------------RYCLALDLK--DDPTLI--AEYE--K.......YH..EKI...RP-E-------I...AESI
G0FVD6_AMYMS/4-107------------------RYGMLIRLR--..PERR--EEYL--R.......LH..AAV...WP-A-------V...ERTL
C7Q375_CATAD/3-106------------------RIAQVARLL--..PELR--EQYL--A.......LH..SEV...WP-G-------V...ESTL
C6CYW6_PAESJ/6-107------------------KFAWTWKIK--..EEML--EEYV--A.......MH..LAP...WP-E-------I...MEEH
C7PCA4_CHIPD/3-109------------------RYCLALDLV--NDPVLI--AEYE--A.......YH..REI...WP-E-------I...RKSI
T0N5S5_9EURY/2-100------------------RYAFHLTIR--..NGME--DEYD--R.......RH..AAV...WD-D-------M...KKML
Q0C0B4_HYPNA/3-108------------------RKAMMIRLN--..PEKM--EEYK--R.......LH..ADA...WP-S-------I...LRQI
G8TRD5_NIAKG/34-141------------------RYGMITGVK--..PEKL--DYYK--S.......LH..GKP...WA-T-------V...LAKI
B5HUQ0_9ACTN/3-106------------------RIAQTIRLR--..PEHR--EEYL--R.......LH..SAV...WP-G-------V...EAAL
C9SC44_VERA1/35-148------------------RIAQIVKLK--..PEFL--EEYK--K.......VH..AHV...WP-E-------V...LKQI
U5HAV4_USTV1/5-115------------------RVCQIIRIK--..PDRL--DEYV--H.......LH..ANA...WP-G-------V...LETL
C1E6C4_MICCC/5-111------------------.YAQTICLK--NDPRGI--EEYK--R.......HH..ADC...WP-E-------V...LGAL
D8J110_HERSS/4-109------------------..VLALDLK--DDAELI--AQYE--A.......HH..RRI...WP-E-------I...ARHL
H1XZT2_9SPHI/4-110------------------QYCLALDLV--DDVTLI--AAYE--A.......YH..TQV...WP-E-------I...IRSI
F1A024_DICPU/9-113------------------.FAQALDLK--NDKELI--DEYK--T.......FH..KSV...WP-E-------V...TDAL
A0M226_GRAFK/6-114------------------RLCYSCDLK--DDPQLI--EKYK--E.......YHAAGNA...WP-E-------I...TRSI
H1YA87_9SPHI/12-120------------------RYCKTMELR--NDPALI--EAYK--L.......AHAKGAA...WP-E-------I...TQGM
A1WK61_VEREI/3-108------------------RHGAVIGIR--..AEML--EEYK--A.......LH..AAV...WP-A-------V...LAQI
F0S6E2_PSESL/2-101------------------KIAFKMKLK--..EGFK--EEYI--K.......RH..NLI...WP-E-------L...KELL
D8MW19_ERWBE/6-112------------------RYCQALDLA--DDPQLI--AEYR--Q.......YH..QQI...WP-E-------I...TQHL
RHAM_TOLAT/3-103------------------RKAFLMSVK--..PEAH--AEYK--R.......RH..DEI...WP-E-------L...ADTL
R5RHB4_9FIRM/4-102------------------..GFKMKLY--..PGQE--AEYE--R.......RH..NLL...WP-E-------M...KEMI
R7CUY6_9BACE/4-107------------------RYGSVIKVA--..PGRL--EEYK--R.......LH..AAV...WN-S-------V...KKMI
F4GKH0_SPHCD/4-103------------------RAAFIMKLK--..PGCE--AEYT--R.......RH..NAI...WP-E-------L...KELL
M2QQB6_CERS8/8-118------------------RFCQIIKLK--..PGAE--ETYK--E.......LH..ADA...WP-G-------V...LAAI
R4LU20_9ACTN/8-112------------------RHAFVVGVR--..PEHR--ERYL--D.......LH..RAV...WP-Q-------V...EQTL
RHAM_AGRVS/6-106------------------KYAFKMQLH--..PGME--AEYK--K.......RH..DAI...WP-E-------L...VALL
A1RAY8_ARTAT/2-103------------------RVCFRSSVQ--..PELM--AEYK--Q.......RH..AAV...WP-E-------M...LAAL
A0K063_ARTS2/2-106------------------RVCFRSSVQ--..PGLI--DEYR--R.......RH..AAV...WP-E-------M...LRAL
G8TPW3_NIAKG/3-103------------------RVAIKMNLF--..KGQE--AEYK--K.......RH..DAL...WP-E-------L...KELL
Q15XN8_PSEA6/5-113------------------RYCLALDLI--DDPALI--EQYL--A.......FHTPDKA...WP-Q-------I...TQNM
G2TP17_BACCO/3-103------------------RKASVMFVH--..KDQY--EEYK--R.......RH..DHI...WP-E-------M...SKEL
D9QN17_BRESC/8-108------------------TIAFRMNMN--..PGQA--EEYR--R.......RH..DDI...WP-A-------L...SEAL
H8KVT5_SOLCM/4-109------------------RHCFALDLK--PDAELI--AEYE--K.......YH..TEV...WP-E-------V...LENL
G3JAD5_CORMM/9-118------------------RFGQVIRLR--..KDCV--EQYK--A.......CH..ANA...WP-E-------V...LKQI
F0LZS0_VIBFN/7-107------------------RLAFVMQLK--..PGFE--AQYQ--Q.......RH..DEL...WP-E-------L...AQTL
E8RLZ9_ASTEC/5-104------------------.HAFKMQLK--..PGFE--AEYQ--K.......RH..DEI...WP-E-------L...ADLL
R6U745_9FIRM/3-103------------------RKAFRMKLF--..DGMA--EEYR--R.......RH..NLI...WR-E-------M...VDMI
E0RYP0_BUTPB/3-103------------------RKGFKMKLY--..PGME--KEYE--K.......RH..NEL...WP-E-------M...QQMI
W0A8U2_9SPHN/5-114------------------RRCFAVDLH--GDPERI--ARYR--A.......WHAAGAV...PA-A-------V...SAAI
F0RTW9_SPHGB/2-102------------------RKAFVMQLK--..KGCE--AEYQ--K.......RH..DEI...WP-A-------L...KALL
V5XRE7_ENTMU/3-103------------------KKAVKMKLY--..PGYE--AEYL--K.......RH..HEL...WP-E-------M...RDML
W0JTK6_9EURY/7-109------------------RTVYLQRID--..PDYS--EEYL--R.......AH..DDV...PA-E-------V...TDAM
F4C6L3_SPHS2/2-101------------------KIAFKMKLM--..PGFQ--EEYK--K.......RH..DEI...WP-E-------I...SALL
R5MDS1_9BACE/17-125------------------RYCQTMDLK--DNPKLI--KEYI--R.......CHSKPEA...WP-E-------I...RAGI
Q92VL4_RHIME/3-108------------------RMGMVIGLE--..PSKI--AEYK--R.......LH..AAV...WP-E-------I...LALI
D5EY64_PRER2/19-127------------------RYCQTMDLK--NDPELI--AKYK--E.......AHDRLHA...WP-E-------I...LAGI
E8NDA4_MICTS/4-105------------------RVCFELRVR--..PELI--DEYV--A.......RH..TPV...RA-D-------M...LAEI
E6SPU6_BACT6/19-127------------------RYCRTLDLR--DNPALI--AEYR--R.......RHDQTNI...WP-E-------I...LAGI
C6WNL3_ACTMD/3-105------------------RICFLLRVR--..PDRL--AEYR--E.......RH..RDV...WP-D-------M...RRAL
R7NTA6_9BACE/19-127------------------RYCQMLNLK--DDPALI--AEYR--K.......RHSEEEV...WP-E-------T...LAAI
Q826A8_STRAW/2-103------------------RIALHTKVR--..ADRV--AAYE--A.......AH..REV...PE-E-------L...TAAI
M1VWH7_CLAP2/35-145------------------RFGQVIKLK--..KGCV--EEYK--K.......CH..ANI...WP-E-------V...VKQI
C7PNE2_CHIPD/2-102------------------KIAFKMQLK--..PGCM--EEYR--K.......RH..DAI...WP-E-------L...KALL
A0QQ10_MYCS2/3-105------------------RVCFVLQLR--..PERM--DEYL--T.......AH..EQV...WP-E-------M...LEAL
S8E4Q7_FOMPI/8-118------------------RVCQIIKLR--..PEAE--AEYK--A.......LH..ANA...WP-G-------V...LAAL
F4KPV2_HALH1/6-106------------------EIAFVMYLK--..PGNE--AEYQ--R.......RH..DEI...WP-A-------L...SAAL
E6WCQ8_PANSA/3-103------------------RRAFVMQVH--..ADCH--DEYL--R.......RH..SPI...WP-E-------L...AATL
D7CBT4_STRBB/3-105------------------RVATVIRLR--..PEKE--QEYR--E.......LH..ATV...WP-D-------V...LVAL
R5V6F4_9BACE/15-123------------------RYCQALDLK--NNPELI--AEYR--K.......IHSREEA...WP-E-------I...RAGI
F8EFY7_RUNSL/5-113------------------RTCLALDLK--DNDELI--AQYE--Y.......FHQPEHI...WP-E-------I...PRGI
D2UB54_XANAP/3-111------------------RHCYLLDLH--DDPTLI--AEYE--R.......WHRPDTV...WP-E-------I...VASL
R6AY66_9BACT/3-104------------------RFAFKMYLK--..KGCE--KEYA--K.......RH..AAI...WP-E-------L...KQMI
B9TP76_RICCO/180-279------------------.RAFIMRLK--..PGHV--DEYK--R.......RH..DEI...WP-E-------L...ADLL
A6L884_PARD8/3-111------------------RYCQTLDLK--EDEQLI--KEYC--Y.......WHSPEHI...WP-E-------I...PEGI
E1VAZ6_HALED/5-103------------------..ALRMTLH--..PGQE--AEYR--R.......RH..AAI...WP-E-------L...VTAL
H5X507_9PSEU/6-107------------------RVCFLLRVK--..PDRM--AEYR--R.......RH..AEV...WP-E-------M...LDAL
G8TKN8_NIAKG/3-111------------------RYTLALDLK--EDPALI--SEYE--Y.......WHRAENG...WP-E-------I...KKSI
E4RWF7_LEAB4/3-103------------------RQAFKMFLK--..PGCE--AEYE--K.......RH..NEI...WP-E-------L...RQLL
R5P2W9_9BACT/3-109------------------RFCQTLHLK--EDLELI--RQYT--E.......IH..RQI...WP-E-------I...KAGI
H2ISM0_RAHAC/3-103------------------RKSFVMQVN--..ANAH--DEYQ--R.......RH..SPI...WP-E-------L...AETL
C6XWC2_PEDHD/4-110------------------RYCLTLDLI--ADEGLI--AEYE--E.......MH..RKV...WP-E-------I...IDSI
D2AYI7_STRRD/2-103------------------RVALHTRIR--..PGKE--SEYE--Q.......AH..REV...PP-E-------L...VEAI
R7B568_9ACTN/14-112------------------..GFKMKLL--..PGFA--AEYE--R.......RH..DEL...WP-E-------M...VAML
D4LLT3_9FIRM/2-100------------------.....IKVK--..PEKL--AEYK--K.......WH..ANP...MP-G-------V...NEMI
R5IF69_9FIRM/3-101------------------RYAWKATVL--..PGKL--EEYI--R.......RH..NEI...WP-E-------M...KDVL
F8EDF5_RUNSL/27-127------------------KLAFLMKLK--..PGFE--DEYK--K.......RH..DEI...WP-E-------L...SAAL
Q9RJV5_STRCO/9-112------------------RVASVIRLR--..PEHA--ERYR--E.......LH..RAV...PG-P-------V...LDAL
F4L4I5_HALH1/3-109------------------RFCLALDLV--DDPALI--AEYE--Q.......YH..EKI...WP-E-------I...TASI
F4PHW1_DICFS/4-111------------------SYASALDLK--DDKVLI--EEYK--K.......YH..QNV...WP-E-------V...KNSL
K7ARV7_9ALTE/6-114------------------QYCLILTLR--DDAELI--RQYD--E.......YHQAGNV...WP-E-------V...IKNI
A6W650_KINRD/4-107------------------RACFLLHLR--..PELV--AEYL--E.......VH..REV...WP-E-------V...LEAL
R7LE58_9BACT/21-129------------------RYCQTLDLR--DNPELI--EAYR--K.......LHSPEGV...WP-E-------V...LQGI
F4H154_CELFA/3-103------------------RVCFVSRVR--..PDRL--DEYR--A.......RH..AAV...WP-E-------M...LEAL
B0T1B6_CAUSK/4-110------------------..VLLLDIH--DDPDAI--RDYR--H.......WHRPGGP...PA-A-------V...TRSI
G0GFQ6_SPITZ/3-103------------------RHAFVMQLK--..PGCE--EEYK--R.......RH..DLI...WP-E-------L...KDEL
Q1J3P3_DEIGD/12-114------------------RVCFLLQVR--..PDRL--AEYR--A.......RH..RQV...WP-E-------M...LQAL
RHAM_BACSU/3-103------------------RKASIMFVH--..QDKY--EEYK--Q.......RH..DDI...WP-E-------M...AEAL
I6Z2E3_MELRP/3-103------------------TFAFKMKLK--..PGFK--EEYK--K.......RH..EAI...WP-E-------L...KTLL
R6LHQ9_9BACE/3-103------------------REAFKMFLK--..SGYE--KEYE--R.......RH..AAI...WP-E-------L...KKML
D8PU32_SCHCM/8-118------------------RICQIIKLK--..DEAL--EEYK--A.......IH..ANV...WP-G-------V...LAAL
D8IVV1_HERSS/3-103------------------QIAFTMQLR--..PGCA--EQYR--A.......RH..DAL...WP-E-------L...AVLL
FUCM_XANCP/5-113------------------RLCYVLDLH--DDAALI--AQYE--R.......WHRPSEV...WP-E-------V...VASL
B9KXQ9_THERP/5-109------------------..GLTLCLR--DDPDAI--AAYI--Q.......YH..QAV...WP-Q-------V...CARI
A4RYA8_OSTLU/7-113------------------TFAQTIELE--.SEDAI--EAYD--A.......LH..ARA...WP-E-------I...LESL
RHAM_PARP8/3-103------------------TIAFRMVLN--..RGMR--DEYE--R.......RH..REI...WP-E-------L...VSKL
RHAM_LISMO/3-103------------------RVASIMYLY--..PGNK--EEYK--K.......RH..DEL...WP-E-------M...KEAL
R5XB53_9FIRM/3-102------------------.KGFTMKLY--..EGQE--VEYE--K.......RH..NLL...WP-E-------M...KEMI
F4C913_SPHS2/3-109------------------TYALALDLK--EDDHLI--KEYE--Q.......HH..RAI...WP-E-------I...RESI
G8QUN9_SPHPG/4-104------------------RLAFVMHVK--..PGFE--EEYQ--R.......RH..AAI...WP-E-------L...KKLL
G2YVL3_BOTF4/62-172------------------RIAQIVKIK--..PECV--ELYK--E.......CH..ARV...WP-E-------V...LKQI
RHAM_CLOPH/3-103------------------RKAFKMQLF--..EGQA--KEYE--K.......RH..NEL...WP-E-------M...KEMI
C1N719_MICPC/4-111------------------HYAQTICLR--DGAGVV--DEYK--A.......YH..AEA...WP-E-------V...CDAL
E8RTW3_ASTEC/4-112------------------RFCFALDLH--DDADLI--ARYK--A.......WHAPGQV...PG-P-------I...IRSI
Q7CTD6_AGRFC/3-108------------------RMGFCLNLR--..PGTV--EEYK--R.......LH..ANV...WP-E-------V...LDAI
I4F5E5_9ACTN/3-101------------------RVCFTLQVR--..PDRL--AEYR--E.......RH..AAV...WP-E-------M...LHAL
D1ARY4_SEBTE/3-103------------------RKALKMKVY--..SQYH--GEYK--R.......RH..DEI...WE-S-------L...KNVL
A9WGG2_CHLAA/3-106------------------RVGFTLKVK--..PELI--EEYK--A.......HH..ANV...WP-E-------M...LDAL
F5XNH4_MICPN/3-114------------------RICELIHVR--..PEAI--AEYK--R.......IH..AEV...WP-T-------V...LARL
RHAM_LEPCP/5-105------------------KIAFRMFLN--..PGCE--AEYQ--L.......RH..DRI...WP-E-------L...VALL
RHAM_LACPL/3-103------------------RLGQVMYLH--..KDAY--EEYA--K.......RH..AEL...WP-E-------M...KTAL
D2Q2I3_KRIFD/3-102------------------RLALHSRLI--..AGTE--QSYE--R.......EH..ARV...WP-E-------L...ITVM
M2MAG9_BAUCO/7-117------------------RIGQIVRLK--..RESL--QAYK--D.......CH..AAV...WP-T-------V...LKQI
A3HRM9_9BACT/4-104------------------TLAFRMRLI--..PGFE--EEYE--R.......RH..SEI...WP-E-------L...VALL
RHAM_MANSM/3-103------------------RKGFVMQVN--..PDCH--AEYK--K.......RH..DEI...FP-E-------L...VEEL
I2EVY4_EMTOG/3-103------------------RLGFKMKLH--..AGQA--EEYK--R.......RH..DEL...WP-E-------L...GQVL
L0FZ10_ECHVK/4-104------------------QIAFKMKLL--..PGYE--AEYE--Q.......RH..REI...WP-E-------L...VKLL
F9XB02_ZYMTI/6-116------------------RIGQIIRLK--..PECL--QAYK--D.......CH..AAA...WP-A-------V...LKQI
D2QR00_SPILD/3-103------------------EVAFTMKLK--..PGVE--AEYQ--R.......RH..DEI...WP-E-------L...TQAL
R4X772_TAPDE/13-123------------------RLAQIIRVK--..PEHI--AEYV--R.......IH..NPI...PE-P-------I...ERRI
K6YYZ3_9ALTE/4-112------------------THCLTLELN--DDDELI--ALYE--Q.......YHQPGSV...WP-E-------V...LVSI
R5A8F9_9CLOT/2-102------------------RKGFKMKLF--..QGQE--EEYQ--R.......RH..NEL...WP-E-------M...KEML
F8Q6Q2_SERL3/8-118------------------RICQIIKLK--..PEYV--KEYK--E.......IH..SQV...WP-G-------V...LNAL
Q1GLV0_RUEST/3-108------------------RMGMVIGIK--..PERL--DEYK--R.......LH..AAV...WP-D-------V...LAQI
D3F8C9_CONWI/3-101------------------.VGNVYRVR--..AGLA--DEYA--R.......RH..ATV...WP-E-------I...EALL
I3UF06_ADVKW/5-111------------------RYCLALDLV--DDPEKI--QTYI--A.......LH..RKI...WP-E-------V...KANI
C1DMX3_AZOVD/1-96------------------.....MSLD--..PGRA--EEYR--R.......RH..DAI...WP-E-------L...VDAL
RHAM_RHILO/4-104------------------KYAFKMKLK--..PGMK--AEYK--K.......RH..DEI...WP-S-------L...VSLL
C7MA53_BRAFD/20-118------------------RCCFLLHVR--..PEKL--TEYV--A.......AH..QDV...WQ-E-------M...RTAL
W0AGC7_9SPHN/4-103------------------.HAFKMQLK--..PGVV--EEYR--R.......RH..DEI...WP-E-------L...TELL
D7BV13_STRBB/3-105------------------RVCFLLKVR--..QDRL--EEYR--E.......RH..AAV...WP-E-------M...LDAL
C4R5P5_KOMPG/10-120------------------RICQVVKLK--..PEFY--DEYV--K.......VH..AAV...WP-S-------V...LELL
B8N6B4_ASPFN/5-114------------------RIAQIVHLK--..PSAL--AAYK--E.......CH..ANV...WP-E-------V...LQQI
R5PSD2_9BACT/21-129------------------RYCQCLELR--DNQELI--AKYR--E.......VHDEEHV...WK-E-------V...IEGI
RHAM_OPITP/3-103------------------RKAFVMSVN--..AGCE--AEYE--R.......RH..RPI...WA-E-------L...AQVL
V6JFG7_STRNV/3-106------------------RIAQVIRAR--..PEKL--DEYR--E.......LH..RAV...PE-A-------V...LGRL
I0KE28_9BACT/2-108------------------RHCLALDLK--NDPDLI--AEYE--R.......YH..EAV...WP-D-------I...LQSL
I3ZKM1_TERRK/3-103------------------RVCFTLKLR--..ESTL--PEYI--E.......RH..RNV...WP-E-------M...QDAL
D5BBC0_ZUNPS/5-111------------------RLCYACDLI--NDAGLI--EEYE--T.......YH..QKI...WP-E-------I...EKSI
D1BY74_XYLCX/3-102------------------RVMFQFRVA--..PDRL--AEYA--A.......AH..ARV...WP-E-------M...LDAL
RHAM_OCEIH/3-103------------------RKGFIMTVY--..PDKH--DEYE--K.......RH..NEI...WP-E-------M...VAEL
J9RIB0_9ACTN/6-114------------------RVCFVLHLR--..PERV--EDYL--E.......AH..TEV...WP-E-------M...LDAL
R6WAC2_9BACT/17-125------------------RYVQILELK--DDPESL--ASYR--K.......AHSREDF...WP-E-------I...KQGI
A8G9F9_SERP5/10-116------------------RFCQALDLV--DSPALI--EEYL--A.......YH..QCI...WP-E-------I...ATHL
G0J5Y4_CYCMS/28-127------------------.VAFTMKLL--..PGNE--EEYE--K.......RH..NEI...WP-E-------L...AELL
C7YLU2_NECH7/7-118------------------RFAQIVKLK--..PQHL--AEYK--D.......VH..ARV...WP-D-------V...LAQI
U5RUK3_9CLOT/3-103------------------RKVCKMKLY--..KNCY--DEYK--K.......RH..DEI...WL-E-------M...KEEL
R5BLL2_9FIRM/265-367------------------.FASVIKLR--..PEKA--EYYK--A.......LH..ADP...FA-S-------V...NKMI
R5B7U2_9BACE/23-126------------------.....LTLR--PDSKLI--AAYR--L.......RHAPGNV...WP-E-------I...VAGI
A3I2P4_9BACT/3-110------------------KFCFTLDLI--DDPEMI--KEYE--Q.......YHAAGQA...WP-E-------V...TQHD
F6FU80_ISOV2/2-98------------------...FQFRVR--..PDRL--DEYA--R.......RH..AEV...WP-E-------M...LRAL
R6Y9M4_9PORP/17-125------------------RYCQTLDLK--DDPELI--SEYR--K.......RHTENEA...WP-E-------I...LQGI
R5UEH6_9FIRM/3-103------------------RKGFKMKLY--..PDMA--EEYE--K.......RH..NEL...WP-E-------M...KDMI
Q5YUK3_NOCFA/7-108------------------RVCFLLSLR--..PDRI--EDYL--A.......AH..ATV...WP-E-------M...LAAL
R5T0T1_9CLOT/5-103------------------..SFKMHLY--..EGMA--EEYE--R.......RH..NLL...WP-E-------M...KDMI
E8V6H3_TERSS/3-109------------------RYCLACDLK--DEPALI--TEYI--D.......WH..TKV...WP-E-------V...MESL
Q7AJX0_BACHD/6-107------------------KFAWTWTVK--..ESCL--EEYV--A.......MH..VDP...WP-E-------V...LAEH
W0LD07_9GAMM/3-103------------------RKAFVMQVN--..PDAH--AEYQ--Q.......RH..SPI...WP-E-------L...AQVL
D5ET23_PRER2/3-104------------------RFAFKMQLK--..PGCE--KEYE--R.......RH..AAI...WP-E-------L...VKMI
T5AGB0_OPHSC/41-152------------------RFGHVIRLR--..PERV--AEYK--A.......CH..ARI...WP-E-------V...AKQI
B6QAY9_TALMQ/10-121------------------RVGQWIYLR--..PECI--EEYK--K.......CH..AEV...WP-A-------V...LEQI
R5FKH4_9ACTN/13-112------------------.HGFKMKLY--..PGFA--EEYE--K.......RH..NEL...WP-E-------M...ADMI
S3CGR6_GLAL2/40-151------------------RIAQIVKLK--..PEYV--EEYK--K.......CH..AKV...WP-E-------V...LKQI
E9QYL7_ASPFU/6-125------------------RIAQIVHLK--..PSAV--EAYK--E.......CH..ANV...WP-E-------V...LQQI
D2PT68_KRIFD/3-105------------------RYCFCLQVK--..PDRL--DEYV--E.......RH..RDV...WP-D-------M...RAAL
RHAM_BACSK/3-103------------------RKATVMKVY--..KDKY--DDYK--Q.......RH..DKL...WP-E-------M...AEML
R6YNW1_9BACT/15-123------------------RYVQRLDLK--SDEEAI--QLYR--K.......LHSEECH...WK-E-------I...RDGI
Y3871_DICDI/8-118------------------SYAQALDLV--NDKELI--EEYK--K.......YH..KNV...WK-E-------V...NEAL
A1RB67_ARTAT/4-103------------------SIALHTRLK--..PGTE--EAYA--D.......AH..AHI...PA-E-------L...VTAL
A5FI86_FLAJ1/3-109------------------KYCLALDLN--NHPDLI--AEYI--D.......YH..KNV...WP-E-------I...QKSI
H2JUV0_STRHJ/2-103------------------RVALHTKVR--..ADRI--EEYE--A.......AH..RAV...PK-D-------L...TDAI
E4RRT9_LEAB4/3-109------------------RFALVLDLI--DDPQLI--KEYE--D.......YH..KEI...WP-E-------I...KKSI
RHAM_OCHA4/5-105------------------RYAFRMKLN--..PGME--AEYR--R.......RH..DEI...WP-E-------L...VDLL
D3VH42_XENNA/3-116------------------RFGFSIEVV--.NDAAL--EMYK--E.......MH..KQV...PQ-E-------ISGDKGAL
L8X683_THACA/10-129------------------RFCQVVALK--..TEAL--EEYK--KARGAYTGIH..AAV...WP-A-------V...LETL
W0F1J4_9BACT/6-112------------------RYCLALDLK--NDPELI--AEYE--A.......HH..NAV...WP-E-------I...KKSI
D2QDE5_SPILD/2-108------------------RYCFALDLI--DDPTQI--AEYE--E.......YH..KQI...RP-E-------I...EASI
A0RPU5_CAMFF/263-366------------------KFASVIKIR--..KDKI--DTYK--K.......LH..ENP...LS-G-------V...NKMI
RHAM_RHIEC/5-105------------------KHAFKMQLN--..PGME--AEYR--K.......RH..DEI...WP-E-------L...VDLL
W0HUK9_9GAMM/3-103------------------RKAFVMQLN--..PEAH--QEYE--R.......RH..NPI...WP-E-------L...AQTL
I2B3V9_SHIBC/8-108------------------RKAFVMQVN--..PGAH--QEYQ--R.......RH..SPI...WP-E-------L...EAVL
RHAM_PECAS/3-103------------------RKAFVMSVF--..PDSH--DEYQ--R.......RH..NPI...WP-E-------L...AEVL
A4FGN1_SACEN/3-102------------------RIALHTRLE--..PGRE--ADYE--R.......VH..AVI...PP-E-------L...DAAL
G0R4U7_ICHMG/11-113------------------....TLDLK--DDQNLI--QLYE--E.......HH..KKI...WP-E-------I...TKGI
Q0S9A0_RHOJR/3-104------------------KYCFTLQLR--..PDRI--DEYV--R.......RH..AQV...WP-E-------M...LEAL
Q0U0I1_PHANO/10-124------------------RIGQWLYLN--..PARI--DEYK--K.......CH..AAV...WP-E-------V...LEQI
G9MQ27_HYPVG/10-118------------------.FAQTVKLK--..KDRV--EEYK--A.......CH..AKV...WP-E-------V...LKQI
R5YL30_9BACE/19-127------------------RYCQTLNLK--ENPELI--AEYR--K.......RHLKENA...WP-E-------I...LEGI
G0J6H2_CYCMS/3-109------------------RYCLALDLK--DDPEII--EKYV--E.......HH..KKV...SD-E-------I...ISSI
G0AEI2_COLFT/99-206------------------RYCLVLDLK--DDPSLI--GRYE--T.......LH..RRI...WP-E-------I...AAHL
RHAM_AGRFC/6-106------------------KHAFRMKLF--..AGKE--VEYK--K.......RH..DEI...WP-E-------L...VALL
Q0PB25_CAMJE/3-104------------------RYGQIIKIK--..KEKI--EEYK--E.......LH..TKP...YE-G-------V...CEMI
RHAM_LACS1/4-107------------------RLGQIMHVN--..PNYY--DEYE--K.......RH..SDLPVKFP-E-------M...KKAL
A7RJ94_NEMVE/13-125------------------RLGSVIKLK--..PGMY--ERYK--E.......LH..AAV...WP-K-------V...LQRL
H2YJ08_CIOSA/7-118------------------RYGSVIKLN--..ADKV--AEYK--A.......LH..ASV...WP-A-------V...LARL
A3I067_9BACT/3-104------------------.....CDLK--NEEEAI--QAYV--D.......CH..KAV...AP-E-------I...LESI
R6D3Z6_9BACE/3-103------------------REAFKMYLK--..PGCE--AEYE--K.......RH..AAI...WP-E-------L...KALL
Q986Z5_RHILO/3-108------------------RMGMVLGLK--..PEKV--EEYV--R.......LH..AAV...WP-D-------V...LTMI
Q21TQ6_RHOFT/2-109------------------RYALALDLV--DDAQRI--FDYE--K.......AH..EKI...WP-E-------V...RDHL
H2J1A2_RAHAC/4-110------------------RYCQALDLA--DDPALI--EEYQ--R.......YH..REI...WP-E-------I...TAHL
Q3XZK3_ENTFC/3-103------------------KKAFCMKVY--..PEKQ--EEYK--K.......RH..DEL...WP-E-------M...RTAL
C5AGH1_BURGB/2-109------------------RQCLALDLK--DDPESI--ARYE--A.......HH..QRI...WP-Q-------I...AAHL
I3ZIT1_TERRK/3-109------------------RYCLALDLH--PDPSLM--EEYV--R.......LH..KSV...QP-V-------I...QKSI
C9YZZ6_STRSW/2-102------------------RVALHTKVR--..ADRV--EEYE--A.......AH..REV...PE-E-------L...TTAI
RHAM_ACICJ/3-103------------------QIAFRMQLD--..PAQA--AEYE--R.......RH..DEI...WP-E-------L...VAAL
Q01TX0_SOLUE/3-104------------------RYAFKLRIK--..PEAV--EEYE--I.......EH..KRV...WP-E-------L...LAKL
W0J174_9BACT/3-103------------------RKAFVMSVH--..PGQE--AEYE--R.......RH..SPI...WP-E-------L...AATL
RHAM_JANSC/3-103------------------KYAFKMQLT--..PGCL--AEYR--K.......RH..DEI...WP-E-------L...VDLL
I0HD26_ACTM4/3-105------------------RVCFTLQVD--..PAKL--DAYR--E.......AH..AAV...WP-E-------M...LRAL
R6CWI8_9BACE/3-109------------------RYCQTLELY--NDPELI--AGYI--E.......EH..RHV...WK-E-------I...KDGI
R5IKI3_9PORP/15-123------------------RYCQTLDLK--NEPKLI--AEYR--K.......MHSQGKI...WP-E-------I...PAGI
C5C310_BEUC1/3-105------------------RICFTLQVR--..PDRL--AEYT--E.......RH..AHV...WP-E-------M...LRAL

PF11639

Q2S9J0_HAHCH/1-104----------------METIIHKIRLFDVAQADAF--EFWV--------------QNV------D-------Y---ATCP
O54144_STRCO/1-104----------------MDVIIHRIRLHDGVDPARF--EAWV--------------RDV------D-------Y---ATCP

PF07110

Q98J67_RHILO/10-91-----------------------------TPADPAAFERHYHDI-------HV---PL---AK-Q-------L---PG..
YTH4_RHOER/10-90-----------------------------HPADPAAFDEHYSSK-------HV---PL---VQ-Q-------I---PS..
Q89V09_BRADU/21-102-----------------------------TPKDAAAFDKYYAET-------HI---PL---AK-K-------L---PG..
B8Y4U8_9NOCA/10-91-----------------------------QPTDTEAFDTYYDST-------HV---PL---AN-K-------L---PG..
Q9KGB0_BACHD/16-96-----------------------------QPEDKQAFDEHYFNT-------HA---PL---TR-K-------I---PG..
Q884M0_PSESM/10-93-----------------------------YEEGARFDHDYYRDK-------HL---PL---VQ-E-------L---MG..
Q2N8F2_ERYLH/12-112-----------------------------PSLSRDEFQHYRRET-------HA---PL---VR-A-------A---APHL
D0J371_COMT2/26-114-----------------------------PALRPEEFAQAWRE.-------HS---AL---GR-Q-------C---RN..
Q2UH77_ASPOR/43-139-----------------------------PDWAREEFWTHWQTE-------HA---PK---VA-P-------L---AT.Y
C9S7C3_VERA1/40-151-----------------------------PDFTRQEFWDYWQTQ-------HA---PR---VA-P-------L---AA.H
Q0UAA8_PHANO/20-125-----------------------------RSLTRAQFYTHWEMI-------HA---PK---VL-F-------L---FP..
B6QRR3_TALMQ/18-114-----------------------------EGTTPEEFYHHWYEV-------HG---PK---ML-D-------L---SLRY
C9SY64_VERA1/65-158-----------------------------QGITQEQFNRYWAYN-------HA---EL---AT-P-------F---HLRL
B8MSU2_TALSN/18-112-----------------------------PSLTVEEFHRQWTEV-------HA---QL---LK-H-------W---LE..
A5VH99_SPHWW/138-221-----------------------------RDMTPEEFQVQWADY-------GR---SL---AS-N-------D---AY..
A5V521_SPHWW/98-177-----------------------------AELTHDAFRDRWLHG-------HA---PF---GL-R-------T---SA..
B9K152_AGRVS/13-109-----------------------------LGQTLAEQRAHMKDH-------HG---KL---VL-D-------Y---IA.H
B2W3U7_PYRTR/13-127-----------------------------PDLSPEEFQTYMEGT-------HM---PL---VK-E-------I---FGDQ
Q0U4N6_PHANO/13-123-----------------------------PETSPEEFKRYMEEN-------HI---PL---MR-E-------A---LGIH
B2WDV2_PYRTR/13-120-----------------------------HALSSEEFRDYYEHR-------HI---PL---AY-S-------L---LTQC
Q0U5I6_PHANO/13-111-----------------------------PTLSPTDFQAAYEN.-------HV---PF---LR-D-------T---VGSG
A2QB94_ASPNC/13-115-----------------------------PETSPSTFKSRLEA.-------HI---AL---VK-H-------L---TGPD
A2QVN7_ASPNC/13-122-----------------------------PGLSLSTFRERYEA.-------HI---DL---VR-H-------I---SGED
B8MPG2_TALSN/43-154-----------------------------SGLTLEEFKSYSEQ.-------HG---HL---LK-R-------L---ASDV
Q2UT25_ASPOR/23-122-----------------------------EGLTPDQYRDHYENV-------HI---PL---MK-N-------L---TGDT
C9Z9Q5_STRSW/12-103-----------------------------PGMTHLAFVHHLHHV-------HG---PL---AA-A-------K---PL..
A2R8B5_ASPNC/14-111-----------------------------AGMTKDEFFNYHYQV-------HG---AL---ST-G-------P---SPSE
A5VH99_SPHWW/12-106-----------------------------PTLSRPEFFHYMANV-------HA---PM---AT-S-------L---PA..
Q396J2_BURL3/130-221-----------------------------PRLTHEAWLDVWHGH-------HT---RV---AI-D-------T---QD..
A6GBX1_9DELT/12-106-----------------------------PALSVAEFRDKLNE.-------YG---FV---VK-D-------I---AD..
C9Z9Q5_STRSW/139-234-----------------------------QGVSLDNFTERALGA-------HE---AA---LS-R-------D---EP..
B5HPI7_9ACTN/138-233-----------------------------EGLLPADVTGRWRAA-------HE---EV---IT-E-------G---AP..
A8L3R3_FRASN/10-95-----------------------------RGCAPDDFVPAWRAA-------MG---AA---AA-A-------P---PD..
A5V7F6_SPHWW/12-99-----------------------------AGIARGELIDRYERE-------HA---PL---VS-L-------L---LP..
A5V7F6_SPHWW/139-229-----------------------------ADMSREAFVARYEQG-------HC---AV---AL-D-------V---LK..
A4XEJ1_NOVAD/13-101-----------------------------EGMSKADFIAYYESR-------HR---LI---GE-K-------V---LS..
C7Z3Q5_NECH7/37-130-----------------------------DSIDYDTFFGHWQTV-------HA---DL---AV-A-------T---LA..
Q140F8_BURXL/125-207-----------------------------PGMEPSAFRRHWDD.-------HA---LN---VI-A-------T---QG..
C8ND54_9GAMM/12-105-----------------------------DGLSDAEFRSRWQA.-------HS---EK---VL-G-------F---QA..
C2M2M0_CAPGI/12-107-----------------------------ASLTKEEFIKLWEA.-------HS---QK---VI-K-------Y---KE..
Q93AB2_YERPE/18-98-----------------------------KGQSFEDFVKHWEEV-------HT---AI---TL-K-------L---PG..
B8MF02_TALSN/21-117-----------------------------PGLTEEELCSFQVCQ-------HS---QL---VC-G-------L---MEKY
MDPH_EMENI/29-132-----------------------------QGMSEEAYRKHMIEH-------SA---PL---TK-D-------L---MIKY
C5FQT1_ARTOC/22-118-----------------------------GGMDEEAYRSYMTKV-------HA---PL---VQ-G-------L---MVKH
Q2GSS6_CHAGB/53-131-----------------------------EGIDLAEYRNYMANV-------HA---PL---VA-G-------L---MQKY
B8NJL1_ASPFN/19-113-----------------------------PGLTEEELHHHLCEV-------HA---PK---AS-P-------F---LEKY
C8VTL3_EMENI/15-109-----------------------------PGLDESSLHEYLTNH-------HA---PL---AL-P-------F---LLKY
Q0UIY9_PHANO/18-106-----------------------------PGMDEDAYHKYISET-------HA---GH---LK-H-------L---LVEK
A2QH37_ASPNC/566-663-----------------------------PGMPEDEYHRYLSEH-------HA---VL---VR-N-------H---LVKM
B6QDA9_TALMQ/20-117-----------------------------PHLTHEEFMKWIVDE-------HL---PL---AM-P-------V---FKKH
A2QDU1_ASPNC/19-117-----------------------------EGISWKDFHEYGTRQ-------HA---PK---AA-R-------I---QERH
Q4WAY9_ASPFU/21-118-----------------------------PNVSEEEFYQWVTEQ-------HA---AR---AA-K-------L---HAKN
B2WLL6_PYRTR/30-124-----------------------------DGMSDADFIDYYNNN-------HA---QR---AI-P-------I---LQRH
A0A0D1CGX8_USTMA/29-132-----------------------------DDISDQKFSDYYAQT-------HA---AL---AG-P-------V---LLRH
C7Z0I7_NECH7/17-115-----------------------------EGVSQEEFSRRFAR.-------HG---TL---AG-P-------V---IKKH
Q9F3V8_9PSEU/12-93-----------------------------EGIDRDEALRYWREQ-------HG---PL---AS-K-------V---PG..

PF09448

Q7WWV7_CUPNH/1-109----------------MIRMLYLLVKP--EGMTDEAFRAECLR.-------HY---EM---SH-D-------V---PG--
I3UFX9_ADVKW/1-111----------------MIKSISLLTRK--EGMSHEEFMTHWVEK-------HA---PL---AH-A-------V---PG--
C5BCG5_EDWI9/1-234----------------MITRMGIVSRR--QDLSHEQFLHHWREV-------HA---PI---VC-A-------M---TG--

PF07045

Q0C383_HYPNA/2-97------------------AAYMIVFA.--RVKDRQRFMTEYGAP-------TA---AL---IA-H-------F---GG--
Q98DD6_RHILO/3-95------------------KGYWIARV.--DVRDAEGYK.EYIAA-------SK---LA---FE-R-------F---GA--
A8LJW3_DINSH/3-95------------------KGYIVASI.--RSNDMETIG.RFAAA-------AG---PV---IA-E-------Y---GG--
Q1GHA0_RUEST/2-94------------------PALWIAHV.--TVTDADAYG.KYAEL-------AG---PA---IA-K-------H---GG--
A1B208_PARDP/2-94------------------SVFILAQL.--KFTDIERYR.RYQAA-------FA---EV---FG-K-------F---NG--
A0R1N9_MYCS2/3-94------------------KGYVIITE.--DIKDPAGMA.EYAKA-------AG---PT---MG-.-------.---GA--
B2U9C2_RALPJ/3-96------------------AGYILAYV.--DVTDPVQYE.QYKTL-------ST---KA---MQ-A-------H---GA--
Q1LPI6_CUPMC/3-96------------------AGYIIAYV.--DVTDPQQYE.QYKVL-------ST---KA---MQ-A-------H---GA--
Q0RXH4_RHOJR/2-95------------------TAIVVARI.--RVTDADKYE.SYKPL-------SK---QA---IE-E-------F---GG--
Q129N1_POLSJ/11-101------------------PGYLVVEF.--QVTDPVGWK.TYVDA-------AR---AL---..-P-------T---SG--
B2JPM5_PARP8/3-96------------------KGYWVTSYR--KTNDAAALA.AYAQL-------AL---PA---IT-A-------A---GG--
Q21DJ6_SACD2/2-95------------------TAYAIGLL.--TIHNDNWLE.EYSSK-------IL---PL---IE-K-------H---GG--
A1B8D1_PARDP/3-95------------------KAYWIGHV.--TVDDPAAYD.AYRQA-------NA---AA---FA-K-------Y---GA--
Q0C268_HYPNA/2-95------------------TVYALAQL.--KIEDRAVYQ.RYVDR-------FL---PV---LA-A-------Y---GG--
A1K1N9_AZOSB/2-94------------------KGYWIVRV.--DVADSERFM.NYAQL-------AG---PA---LK-L-------Y---GA--
Q65SN3_MANSM/24-117------------------PAYYVAEF.--QPTDREGIK.AYSAQ-------VE---ST---FK-P-------Y---SG--
Q0RQX9_FRAAA/2-95------------------TAYWISVYK--EIVDESKVA.AYAEL-------AG---PA---LR-A-------A---GG--
Q3J0R2_RHOS4/3-95------------------TALWIANV.--EVTDAEAYG.RYAKG-------AG---PA---IA-A-------H---GG--
Q1GHQ7_RUEST/2-96------------------TAYIIGQL.--QIQSRDWME.EYYAK-------VP---QV---LE-A-------H---GG--
Q5NR08_ZYMMO/2-95------------------SAYVISDT.--NPKDPDAWK.IYIGL-------AA---AA---IK-Q-------Y---GG--
A8L5T2_FRASN/12-105------------------KGYVILTE.--AIKDPEGMA.AYSRL-------SG---PS---VA-A-------A---GA--
Q742V7_MYCPA/6-97------------------KGYAILTE.--AIKDPEGMK.AYAKA-------AG---SA---MS-.-------.---GA--
Q165U6_ROSDO/2-94------------------GALWIAHV.--KVTDEEAYG.KYAAL-------AT---EA---IA-A-------H---GG--
A4XTJ7_PSEMY/2-95------------------TAYAVAIVR--ETQFGPEIR.EYLQR-------ID---AT---LA-P-------F---SG--
A5V7J9_SPHWW/2-96------------------SAYWIARA.--RMRDMEGQD.QYARI-------IG---DI---GQ-R-------F---PY--
Q5YTA0_NOCFA/2-95------------------TVYVIAQL.--KFTDRAAYD.RYQAR-------FM---DV---FT-K-------Y---SG--
Q128E5_POLSJ/3-96------------------SAYIIANV.--TVTNPEQYE.TYKKL-------SS---IA---MQ-V-------H---GA--
Q65QR7_MANSM/19-113------------------TAYVVFIRD--EMKDQAAYD.RYLQL-------GV---PT---LA-P-------F---GG--
Q2VZK5_MAGSA/2-96------------------SAYLIVDT.--QLDDPELYE.EYKHK-------AR---PL---IE-R-------W---GG--
Q7VAI4_PROMA/7-101------------------KGYWISTS.--TVINQALFA.EYVGK-------VG---PW---LK-G-------V---GG--
Q28P24_JANSC/6-100------------------PVYMIVML.--EIDDMPTFFEDYANP-------LQ---AI---HA-R-------H---GV--
B2JHP1_PARP8/2-95------------------STFAVAHLH--EVKMGMEIV.EYLKR-------ID---AT---LA-P-------Y---GG--
Q984S8_RHILO/2-95------------------PAYIISDV.--TICDQEAFQ.TYRSR-------AA---AS---IA-H-------Y---GG--
Q89JB1_BRADU/14-107------------------PAYVISEV.--EVRDQAMME.AYRAL-------AA---QT---IA-Q-------Y---GG--
A1AZL7_PARDP/2-94------------------TALWIAHV.--NVTDPEAYG.EYARL-------AG---PA---IA-A-------H---GG--
A8LL19_DINSH/2-94------------------SAFWIAHV.--HVTDADRYG.EYAKR-------AT---VA---IA-E-------H---GG--
A8KZG9_FRASN/2-95------------------SAYVIVGV.--DVLDEEASL.AYAAV-------AQ---PS---VL-S-------H---GG--
Q11KJ1_CHESB/3-95------------------KGYWIAHV.--DVRDPERYK.DYIAA-------AK---PA---FE-K-------Y---GA--
Q6NCX9_RHOPA/3-96------------------KGYWVGRI.--DVHDLDGYKRDYVAH-------NG---AV---FA-K-------Y---GA--
Q1GFX6_RUEST/3-95------------------KGYWVAHV.--DIDDMERYK.AYIDA-------NA---AP---FR-E-------Y---GA--
A1TLS8_ACIAC/3-96------------------SAYIIASV.--TVTNPEQYE.DYRRL-------ST---QA---MQ-V-------H---GA--
Q46KM6_PROMT/7-101------------------KGYWISTA.--KIINQELFD.EYVEK-------VG---PW---LK-E-------N---GG--
Q127Z9_POLSJ/2-95------------------SAYLIADT.--HITNPQIYD.EYKRQ-------VA---PL---VA-K-------F---GG--
Q5FU37_GLUOX/2-95------------------PAYAVFIRE--KLTDPAEFQ.KYSEV-------VG---ET---FK-G-------F---PA--
Q98JP1_RHILO/45-139------------------TAYVIADI.--KMKDPKWVP.AYAAS-------VH---DI---VH-K-------H---GG--
Q98CT4_RHILO/9-101------------------KGYWMVML.--TVTDAEGYQ.RYREA-------IG---DA---IS-H-------F---GG--
A5V7D8_SPHWW/2-97------------------AAYIVGKL.--NVANWDWYR.EYRKV-------TE---AL---VA-E-------H---GG--
A4XXX9_PSEMY/17-110------------------KAYWIAHV.--DVTDPARYA.EYTSR-------AP---AV---FA-H-------F---GG--
A1BAV2_PARDP/2-95------------------ASYAVAHLH--HVEIGPDIV.AYLEA-------ID---AT---LA-P-------F---AG--
Q28QV7_JANSC/3-95------------------QAYWIAHV.--TVTDDAAYS.KYAAL-------AT---DA---IT-A-------H---GG--
Q28KV2_JANSC/2-96------------------TAYCLFQNL--DITDMDKMQ.EYATT-------VE---PI---TH-A-------F---KG--
A6WA35_KINRD/13-106------------------PAYSITEVL--QVLDPAGAQ.RYAEL-------TP---AT---VE-K-------F---GG--
Q89BY8_BRADU/66-159------------------PAYFIVQN.--TIKDEAQYQ.KYVQA-------VV---PF---IA-S-------F---GG--
Q11E97_CHESB/2-98------------------PVYWIGRA.--NVVDEEPMQ.EYHRL-------TE---LA---LQ-K-------Y---PN--
Q6F9F1_ACIAD/2-94------------------TAYWIAHV.--TIHDMQQYQ.EYMKL-------AP---AA---FQ-K-------Y---GA--
Q16DN6_ROSDO/3-95------------------KGYIIGNI.--SLRDADAYK.PYSLR-------ND---EI---VP-R-------H---GG--
A9BN41_DELAS/3-96------------------SGYIIASV.--TVTKPEQYE.EYRKW-------ST---EA---MR-V-------H---GA--
A4X3R6_SALTO/2-95------------------AALLIGNVG--TLGDPEAMA.EYRAK-------VG---ST---LA-L-------H---GG--
Q0C4G1_HYPNA/2-95------------------AAYIILIRE--KLRDEEAMA.RYAKA-------AG---DA---RG-D-------H---QI--
Q2KDF1_RHIEC/3-95------------------KAYWIARV.--DVRDAERYK.DYVAA-------AK---PA---FE-K-------Y---GA--
Q1D8Q3_MYXXD/2-95------------------PAYVLVEV.--SVHDAQTYE.RYKQL-------AP---PS---LK-A-------Y---GG--
Q47EX6_DECAR/3-96------------------TAYVIGHI.--TVKDAAKWD.EYRSQ-------VP---AT---LA-P-------W---QA--
A7IC73_XANP2/114-206------------------RGYWMAKV.--DVTDPERYK.DYIAA-------NA---EP---FA-E-------Y---GA--
Q15VR2_PSEA6/29-121------------------SAYLIIQA.--TVHDWDKFK.LYTQA-------VP---PL---IK-K-------F---GG--
A6VY75_MARMS/2-96------------------KGYWVAFV.--NVDDKAKYQ.DYLAL-------AP---AA---LQ-K-------Y---GA--
Q28SX7_JANSC/3-95------------------KGYIIGHI.--TVNDPEAYK.EYIER-------DT---PI---LL-S-------H---GA--
A7HSS3_PARL1/2-95------------------TVYALAQF.--TIHDRARYE.AYAAR-------FA---ET---MK-G-------R---KG--
Q87W43_PSESM/6-100------------------SAYLIGKM.--SITDQARYD.NYKRL-------TP---DI---VK-A-------H---GG--
Q89X32_BRADU/22-115------------------TVYAIAQL.--KMTDRAAYD.RYQAR-------FF---DV---FR-K-------Y---SG--
A5FY88_ACICJ/3-95------------------KGYWIASV.--DVRDAEAYA.AYVRE-------NA---VA---FA-K-------Y---GA--
Q28UH1_JANSC/27-121------------------PIYLVASL.--DVTDLTAYFDRYGAP-------VF---PM---LA-A-------A---GA--
A0QZT5_MYCS2/2-95------------------SAYVISDI.--EIVDPAAFE.EYKTL-------SP---PS---VA-K-------Y---GG--
A1B124_PARDP/3-95------------------KAYWIAHV.--TVTDPEPYA.IYAEG-------AS---QA---FR-K-------F---GA--
Q98G06_RHILO/23-116------------------TAYAIAHMR--QVTMGPQIV.EYLHK-------ID---AT---LE-P-------F---GG--
Q215U7_RHOPB/2-95------------------AAYVIFGV.--DVRDPEQYQ.EFISG-------VK---PA---LE-T-------A---GA--
A7IC73_XANP2/3-95------------------KGYWFLNL.--DVVNPVDYI.TYREA-------NA---RY---AA-E-------H---DL--
B2HIJ1_MYCMM/2-95------------------TVYAIAQL.--RFTDRPAYD.RYQAA-------FM---QV---FD-R-------Y---AG--
B4EJY9_BURCJ/2-95------------------TAYAIAHLH--DVDMCDDIV.EYLER-------ID---GT---LA-P-------Y---DG--
H7C7V4_BRADU/3-95------------------KGYWIGRV.--DVNSDEGYK.PYAVA-------NG---AI---FK-K-------W---GG--
Q2YQU8_BRUA2/3-95------------------KAYWIARV.--DVRDPERYK.DYVST-------AK---PA---FE-R-------F---GA--
Q4FP83_PELUB/2-95------------------KAYWIALYK--RIDSQENLK.NYGAK-------VT---GI---IK-S-------Y---GG--
Q63KP2_BURPS/3-94------------------.AYLLGRM.--AISDPSKYA.RYKAL-------TP---DI---IA-R-------Y---GG--
Q7VW78_BORPE/2-94------------------SAYLIADV.--SVTKPAQYE.DYKRL-------ST---LA---MR-A-------Y---DA--
Q882F9_PSESM/2-94------------------KAYWIAHV.--DVTDPQQYS.EYTQR-------AP---AA---FQ-L-------F---GG--

PF04486

R4LLP7_9ACTN/1-119------------------MPYAAISYR--IKPGHDDEIAELFAG-------FR---RV---SS-PVLHDEGGQ---AN--
G2PCT7_STRVO/148-259------------------.VRQALTFT--VNPGSEDSVAKILAD-------YA---SP---EA-RV......D---QT--
D5UC49_CELFN/1-110------------------MQRYALTFR--VKPGSQEKVKQLLAD-------YD---PP---QW-RT......E---DG--
D2AY36_STRRD/1-119------------------MPFAAITYR--VKLGFEDEIAEIFAG-------FQ---RV---NT-PVMRDEEGE---QA--
R4LAU9_9ACTN/2-117------------------.SIAAISYD--IKAGHEEQIAEIFGN-------FR---RT---GS-PVIRDESGA---EV--
WH42_STRCO/160-272------------------VVRHALTFT--VRPGTEAETARLLSE-------YV---SP---DA-HV......D---GS--
Q79ZD9_STRAW/136-248------------------VVRHALTFT--VKPGSEPMVAKILAG-------YS---SP---QA-QV......D---EN--
E4NJ49_KITSK/148-260------------------VVRHALSFT--VKPGSEARAAELLAG-------YR---SP---QA-RV......D---DT--
D2AY76_STRRD/1-119------------------MPFVAITYD--IKGGNEDRVAEVFSN-------FQ---RP---RS-AVVPGADGG---QA--
G0FY92_AMYMS/1-119------------------MPYAAITYD--IKPGFEDEIAGIFAN-------FK---RA---DS-PIMRDESGT---EV--
S5UX09_STRC3/133-245------------------VIRHALTFT--VKPGTEEKVAKILSD-------YA---SP---KA-EV......D---AT--
C7Q5R3_CATAD/144-255------------------.IRHALTFN--VKPGSEQTVADILAG-------YT---SP---AS-QV......D---ET--
C7N0C8_SACVD/1-119------------------MPYAAISYR--VKEGYEDDLARLFSN-------IG---RV---SS-PVLHDESGK---EV--

PF04673

E2PW02_STRC2/7-110-------------------HQALVVAR--MAPGSAEGIARLFAD-------SD...GG---EL-P-------R---LV--
D2S3T2_GEOOG/2-104-------------------HQTMIIAK--MAPTDADKVADIFGR-------YD...AT---SM-P-------H---EI--
G2NAB9_STREK/2-105-------------------HHALIVAR--MAPESAPDIAELFAA-------SD...NT---EL-P-------H---LV--
A8L2X4_FRASN/16-119-------------------QRTLIVAR--MNPEDAGAVADVFAE-------SD...AG---EL-P-------H---LV--
G2NGK3_STREK/2-105-------------------HSSLIVAR--MDGASQHEVARLFGE-------FD...RT---EM-P-------H---LM--
I4EQF5_9ACTN/2-104-------------------HETMIIAK--MDPRDADEVAAVFGR-------SD...AT---SM-P-------H---DI--
Q79ZD3_STRAW/2-105-------------------HQALIVAR--MAPGSAPDIAKVFAE-------SD...SG---EL-P-------H---LV--
A4X6Z4_SALTO/2-106-------------------YSTLIVGR--MQPQWSTEVAELFGA-------FD...DT---EM-P-------H---RM--
D9SZ16_MICAI/3-104-------------------FRNVIVCH--MVPGSEQIVGGVFGH-------YD...QA---TR-P-------Q---DL--
E3IZH8_FRASU/3-106-------------------HRTLIVAR--MNPSDEEAVAQIFGE-------SD...AG---EL-P-------H---LV--
Q47QL4_THEFY/2-106-------------------HSTLIVGR--MRPEDQDDVARLFAA-------FD...AT---EM-P-------H---LM--
G2PCT1_STRVO/4-107-------------------YRTMIVAK--MQRDAAPQVAKIFAE-------SD...RG---EL-P-------K---LI--
Q79ZE6_STRAW/119-220-------------------YSAVIVNT--QRQEHIPEAARLFAE-------SD...AT---DI-P-------Q---KM--
R4LMZ7_9ACTN/2-104-------------------HRTLIVAR--LKDRDPAGIAEAFGK-------SD...GT---EL-P-------H---LV--
W5W942_9PSEU/3-104-------------------YRSVIVAR--IVPGSEDKVAEVFAH-------ND...RT---TR-P-------Q---DF--
F4F9S6_VERMA/2-104-------------------DRTLIVAK--VVPTAENAVAEIFAE-------SD...TT---EL-P-------H---LV--
Q2J929_FRASC/24-127-------------------HRTLIVAR--MNPADAPAIAATFAE-------SD...AG---EL-P-------G---IV--
A4X7V4_SALTO/2-104-------------------SRLLIVNR--IVPGAEGRVAQIFAE-------SD...AT---EL-P-------S---LT--
D2S3R9_GEOOG/48-148-------------------FRNVIVCR--MVPGSEDKVGPVFAY-------YD...RT---TR-P-------Q---DL--
A4X7V2_SALTO/2-104-------------------ERSLIVAK--VDPSAEERIAEIFAE-------SD...AT---EL-P-------R---LA--
K0K773_SACES/2-106-------------------FSTLIVAR--MDPGSSPDVAELFAH-------FD...TT---EM-P-------H---LM--
E4NJ55_KITSK/2-105-------------------HRTLIVAR--MKPGTADHIAGVFAD-------SD...RG---EL-P-------G---LI--
C7Q5R9_CATAD/2-105-------------------HRTLIVAR--MKPDSAHGIADIFAD-------SD...RS---EL-P-------E---LI--
C9Z709_STRSW/2-105-------------------HQSLIVAR--MAPGSAPDIAKIFEE-------SD...RG---EL-P-------H---LI--
D9SXY7_MICAI/2-104-------------------SRLLVVSR--IVPGAQGRVAQIFAE-------AD...AT---EL-P-------H---LT--
C7QAF1_CATAD/2-106-------------------HSTLIVAR--MDPGSAGDVAKLFGE-------FD...ST---DM-P-------G---RM--
F8B670_FRADG/33-136-------------------HRTLIVAR--ISADDEPAVADIFRE-------SD...DG---EL-P-------H---LL--
D5UC58_CELFN/3-106-------------------HRLLIVAR--MDPGAWSDVAGLFAE-------SD...AS---DL-P-------H---DL--
W5W942_9PSEU/116-220-------------------FQTVIVAR--IKPGAEPDVARIFGE-------SD...AG---PL-P-------V---EM--
YHB2_STRCO/2-106-------------------HHTLIVAR--MAPGAAPDIAKVFAE-------SD...SG---EL-P-------H---LV--
D9SZ16_MICAI/114-218-------------------TLTVIVGR--IKPGAEPDVARVFAE-------SD...AG---SL-P-------A---DL--
Q79ZE6_STRAW/2-108-------------------PSIITVGA--FDSGNVADVTKILQE-------FDGEVAS---EL-P-------Q---L.--
F8B4Y4_FRADG/2-104-------------------HRSLIVAK--IAPGAEKDVARIFAE-------SD...AT---GL-P-------R---IA--
H2JYH9_STRHJ/2-105-------------------HQALIVAR--MAPGSATDIAKVFAE-------SD...RG---EL-P-------H---LV--
K0EZY9_9NOCA/3-105-------------------ELSLIVAR--MRPGDSEQVAELFAR-------SD...QT---EL-P-------A---LV--
C7N0C9_SACVD/2-104-------------------HRTLIVAR--MKQEDSNAVAEVFAE-------SD...ST---EL-P-------H---MV--
F8B0H7_FRADG/2-104-------------------QRTLIVAK--VAPGTEAEVARIFAA-------SD...RT---GL-P-------Q---VA--
F4FBR0_VERMA/3-105-------------------QRTLIIAR--MDEADKQAVADIFAE-------SD...AT---DL-P-------V---LL--
D2S3R9_GEOOG/159-264-------------------EMTVIVQR--MRPGSEEDIARVFAE-------SD...AG---GL-P-------T---ET--
Q9XCV6_STRVP/2-106-------------------HSTLIVAR--MEPGSSTDVAKLFAE-------FD...AS---EM-P-------H---LM--
D2AY42_STRRD/2-104-------------------HRTLIVAR--MEPAEADNVAQIFAD-------SD...AS---DL-P-------R---MV--

PF03927

Q0PAA5_CAMJE/4-75----------------..LSSVLILA.---KEEY-----------------IN---DL---KK-A-------I---SE--
A6Q707_SULNB/2-77----------------.NVSSIVVQA.---LPKN-----------------IN---EL---VA-F-------F---KE--
E6X0J9_NITSE/1-76----------------MNISSIVIRC.---TPEH-----------------YD---EI---KK-W-------C---EE--
Q6LTW0_PHOPR/6-81----------------VHISSLVVHV.---KPEY-----------------LE---EV---KA-Q-------I---LE--
C5B7B8_EDWI9/6-82----------------WHVCGLVVQA.---RPQT-----------------VA---EV---AQ-A-------L---SA--
C0QTT2_PERMH/1-76----------------MNISSIVVMT.---KPEH-----------------IQ---DV---LK-S-------L---EE--
C4K982_THASP/1-77----------------MNIASLVVRA.---FPAD-----------------FP---EI---VE-G-------L---KK--
F7YR78_VIBA7/6-81----------------VHISSLIVHV.---VPEH-----------------LA---AL---KA-T-------I---ES--
S6CGZ1_9GAMM/4-79----------------YNVCGVLVMA.---RPEC-----------------LP---RV---EQ-D-------L---EA--
Q9CKL9_PASMU/13-89----------------WHVCGLVIQG.---NPQK-----------------LE---AI---QT-A-------L---LA--
E6WCW8_PANSA/7-83----------------WHVCGLVIQA.---RPSA-----------------LA---AV---TQ-E-------L---LS--
H7C6L0_BRADU/34-109----------------YEIASIIVQA.---RPER-----------------LA---EV---EA-E-------I---IA--
V5SFH9_9RHIZ/10-84----------------VHISSAVIRC.---LPAA-----------------VE---TV---RG-C-------I---EA--
Q9I4G2_PSEAE/5-80----------------LQIASLILHC.---RPER-----------------LP---AV---KA-N-------L---AL--
D4ZL47_SHEVD/11-86----------------AHISSLIVQV.---SPEH-----------------LE---ET---KK-R-------I---EA--
A4XWL9_PSEMY/5-79----------------THISSLLVHV.---RPEL-----------------LA---AV---KA-N-------L---RQ--
H2FWI7_OCESG/6-81----------------WHVASLVVYC.---RPEH-----------------MQ---AA---MD-A-------I---TR--
Q080B9_SHEFN/5-79----------------LHVTSLIVQV.---HPEQ-----------------MA---EV---RQ-K-------I---MA--
F2NPP1_MARHT/1-76----------------MNISSIIVRT.---PPDR-----------------LE---AV---AE-T-------L---EA--
Q1LFZ4_CUPMC/19-94----------------WHIAGIMVYA.---NPEK-----------------LD---AV---CS-A-------I---DA--
Q2W3T0_MAGSA/19-94----------------ENICGVLIHV.---KPER-----------------RQ---EV---HD-V-------L---TR--
G8PIR3_PSEUV/16-91----------------WHISSVLIQA.---IPEK-----------------RE---QV---CA-A-------I---EQ--
F8AE25_THEID/3-76----------------..IGGFVVHV.---VPGE-----------------KD---KV---LD-S-------L---AS--
Q7VPJ8_HAEDU/10-86----------------WYVCSLVVQA.---KPAK-----------------LP---QV---KA-D-------I---LT--
Q6D5Z1_PECAS/5-81----------------WHVCSVVVHV.---KTER-----------------MA---AV---SD-V-------L---EK--
B0URQ2_HISS2/14-89----------------WHVCGLIIQV.---NPQK-----------------IA---QV---KT-A-------L---LT--
A0RQ30_CAMFF/1-74----------------MNISSVVVNVI---DPGF-----------------VS---DV---IS-S-------I---SD--
Q487G3_COLP3/11-86----------------YHVASLVASP.---IFAQ-----------------LD---EV---KA-V-------I---TA--
E6WPJ5_PSEUU/9-82----------------VHIASFVLQH.---RADA-----------------LD---VV---RA-A-------L---AA--
B2V814_SULSY/6-77----------------.NISSIVVQT.---RPEF-----------------LN---DV---LK-E-------L---EN--
E1SPK5_FERBD/5-80----------------YHIAALVVHC.---RAES-----------------RA---SV---CE-A-------I---TA--
A1S9X8_SHEAM/5-80----------------YHVTSLVVHA.---APSQ-----------------AN---VI---SD-A-------I---DA--
G8AUD4_AZOBR/16-89----------------WHIASILVHL.---RPER-----------------SP---DV---RA-A-------V---AA--
NAPD_HAEIN/14-90----------------WHVVGLIVQG.---NPKK-----------------LS---AI---QT-A-------L---LA--
Q21AR5_RHOPB/30-104----------------.EIASILVQA.---RPER-----------------LD---DV---AT-A-------I---LA--
A1K384_AZOSB/7-82----------------VHVTGVLVQA.---LPDH-----------------VQ---AV---CV-A-------V---AN--
A7I3Z3_CAMHC/1-75----------------MNISSVIIRIK---DDEK-----------------LK---ST---LQ-I-------L---ND--
Q7VJT0_HELHP/1-77----------------MNISSIVVKT.---TQES-----------------FE---SV---KN-A-------I---KE--
Q79HQ5_WOLSU/1-76----------------MNISSVVAKV.---KPED-----------------LE---AS---IK-R-------L---QE--
E8RJB8_DESPD/3-76----------------..IGGAVIAI.---RPAD-----------------ME---TA---TT-Q-------L---LA--
Q5E3J5_VIBF1/10-85----------------VHISSLVVHV.---RPES-----------------LE---IT---KE-K-------I---LA--
F6AJN2_PSEF1/5-79----------------LHIASFIVHA.---RPEQ-----------------LD---AV---LA-N-------L---RL--
M9X453_MANHA/11-87----------------WYVCSLVVQA.---KPEK-----------------LE---EV---KA-E-------I---LK--
Q87GW7_VIBPA/6-81----------------VHISSLVVHV.---LPEH-----------------LD---EI---KT-Q-------I---ET--
B6IR09_RHOCS/9-83----------------LHIASLLVQR.---DPGQ-----------------AG---MV---RD-G-------L---AG--
G7Z2F9_AZOL4/7-81----------------VHISSLVIQH.---SPDR-----------------TE---AV---RE-A-------A---NA--
A3QDT7_SHELP/7-80----------------LHVTSLVVQV.---KPEF-----------------MS---SV---RQ-T-------I---MK--
A9I7M2_BORPD/2-76----------------.RIVSLVLRI.---APHS-----------------LP---AA---ES-A-------L---AA--
C9R7H4_AGGAD/15-91----------------WHIVGLVVQG.---KPQK-----------------IT---AI---RT-A-------L---LA--
G7ZD38_AZOL4/15-89----------------LHIASLLLHV.---RPDR-----------------QP---TV---RA-A-------I---AA--
E7A9K1_HELFC/1-76----------------MNISSVIVKV.---QLES-----------------FE---QS---LK-A-------I---EA--
A1BB87_PARDP/30-103----------------LHISSAIVTA.---RPDR-----------------AA---EL---AR-H-------F---AT--
E4U743_OCEP5/2-76----------------.NVSGLVVRV.---NPER-----------------FA---QV---LE-V-------L---EA--
A8GHJ5_SERP5/6-82----------------WHVSGLVVQA.---RPEK-----------------IP---RL---VA-D-------L---LA--
D6E6X0_9ACTN/3-75----------------..ISSLVVET.---TPET-----------------TA---RV---AE-D-------L---GR--
I2B9N7_SHIBC/5-81----------------WQVCSLIVQA.---RSGD-----------------FA---AI---CA-Q-------L---RQ--
S6CE21_9ACTN/6-80----------------VVISSLVVEA.---RPES-----------------VD---AV---AR-A-------L---AA--
A3QHX3_SHELP/5-80----------------YHVTSLVVHA.---APGQ-----------------VA---KV---TE-D-------I---NA--
M1PB12_DESSD/3-76----------------..IGGFVVQT.---LPGE-----------------RN---VI---VE-K-------L---TS--
Q13I16_BURXL/18-93----------------LHIAGIVVHV.---QPRR-----------------IA---GV---RQ-A-------I---GM--
A0KIM0_AERHH/5-80----------------FHVSSLVVLT.---QPSL-----------------RH---QL---AD-E-------I---AT--
A1SWQ1_PSYIN/6-81----------------LHISSLIVHI.---RPEK-----------------RQ---EI---ET-S-------I---NL--
A6Q5Z8_NITSB/2-76----------------.NVSSCVVRC.---NPED-----------------VE---SV---KK-R-------I---EE--
C5ZXD4_9HELI/11-84----------------FNVSSLVVMC.---KGED-----------------IQ---RL---WE-E-------I---EK--
V6F139_9PROT/20-94----------------.NICGVLVHV.---VPRD-----------------RN---RI---KA-A-------L---EA--
G8QFB1_DECSP/1-76----------------MNISSILVNA.---GPQQ-----------------IA---AV---EA-G-------L---AT--
E1SPK8_FERBD/5-79----------------YHISSFVVHC.---LPDD-----------------IR---GV---RR-A-------I---GA--
F8E847_FLESM/4-77----------------...SGSLITV.---KENK-----------------LN---DV---TE-F-------L---KN--
Q92Z35_RHIME/8-82----------------YHISSAVIVT.---MPHM-----------------RE---RV---VG-S-------L---LE--
M4U4Q1_9GAMM/6-81----------------LHISSLIVHM.---RPHK-----------------SE---SI---KK-S-------I---NA--
A4Z0A0_BRASO/31-105----------------.EIASIIVQT.---RPDQ-----------------LD---RV---AN-D-------I---AA--
C7N4I2_SLAHD/2-77----------------.TISSLIIET.---LPSY-----------------TR---AV---SD-E-------A---AR--
Q5P545_AROAE/99-172----------------AHVPGILVET.---EPER-----------------TA---EV---AR-A-------I---AA--
Q47A86_DECAR/4-79----------------MNISSAIMYI.---APER-----------------LE---EA---CV-A-------L---LQ--
V9VYJ2_9RHOB/5-78----------------IHISSLLVRS.---NPAQ-----------------ME---AV---LA-G-------I---KS--
C8WHW5_EGGLE/3-75----------------..ISSLVVET.---MPDR-----------------TD---DV---AR-E-------L---AL--
E1SPL2_FERBD/5-80----------------YHISSLVVQY.---RPDT-----------------QQ---SV---LA-A-------L---SA--
Q32I07_SHIDS/5-81----------------WQVCSLVVQA.---KSER-----------------IS---DI---ST-Q-------L---NA--
Q2SGV8_HAHCH/5-80----------------EHIVSFLIQC.---APQR-----------------VT---FL---SQ-Q-------L---HQ--
D7A7N1_STAND/6-78----------------.HISSAVVIA.---FPHR-----------------CA---EV---AA-R-------L---EA--
Q12P45_SHEDO/5-78----------------LHVTSLIVQV.---KPEM-----------------MT---QV---RQ-A-------I---LE--
R5ED13_9BURK/4-77----------------...SGVLVSA.---FPGR-----------------YD---EM---LR-E-------L---DT--
F8KQ14_HELBC/1-77----------------MNISSVIVKV.---DLNR-----------------FE---GV---LE-A-------L---KA--
H5WUJ8_9BURK/2-77----------------.SILGLIVRA.---RPAD-----------------LP---DI---RR-R-------L---AA--
Q3IV44_RHOS4/6-80----------------AHISSAILRV.---RPGE-----------------EA---AV---VR-R-------V---MA--
D1B0Z4_SULD5/1-76----------------MNISSIVVQA.---KPLH-----------------VK---AL---ID-L-------F---DA--
F4H9V5_GALAU/13-88----------------WHVCGVVVQG.---RPEK-----------------LD---QI---SA-A-------L---LA--
Q7WXC4_CUPNH/19-94----------------WHIAGIVVHT.---LPDS-----------------LP---QV---RA-A-------I---EA--
S6AI66_9PROT/1-76----------------MNISGIVVHA.---SPDN-----------------ID---IV---RS-Q-------L---EK--
G8B0E5_AZOBR/4-78----------------LHISSLVIQH.---APDR-----------------TA---AL---KE-V-------V---LA--
A1KCK3_AZOSB/2-77----------------.RIASLVVRA.---KPEH-----------------FA---EL---NE-T-------L---GE--
Q0WCM9_YERPE/6-81----------------WHVCGLVLQA.---KPAR-----------------FV---QL---MD-H-------L---LA--
R5QDQ6_9BURK/4-76----------------...SAILVIA.---LPGR-----------------LQ---DV---IT-A-------I---NR--
Q8EIJ0_SHEON/5-80----------------YHVTSLVVHA.---APNA-----------------LQ---QV---EA-D-------I---TA--
A4VJ12_PSEU5/21-93----------------LHIASLLVHC.---RPEW-----------------LA---AL---KT-N-------L---QL--
L0F5T8_DESDL/3-76----------------..ISSVLVKC.---MDGT-----------------EN---AL---LV-Q-------L---KK--
D0J758_COMT2/1-75----------------MHITSLVVHV.---LPQA-----------------LA---QV---AA-G-------I---VT--
I7H569_9HELI/1-77----------------MNISSIVIKT.---TQPA-----------------FS---SV---KE-A-------I---LE--
Q9KLR5_VIBCH/18-93----------------VHISSLVVHT.---LPEH-----------------LL---TV---KQ-Q-------V---SE--
R7C3D0_9BURK/5-78----------------...SGLVVTC.---APGA-----------------MD---AV---LA-A-------L---KS--
Q21PN2_SACD2/11-86----------------VHITSFILLV.---QHGF-----------------AE---KI---LR-A-------Y---AN--
K4KH51_SIMAS/8-79----------------LHIASLIVQC.---LPAA-----------------QA---PL---KL-L-------I---ES--
C1D9G2_LARHH/1-73----------------MNISGVVVRC.---RPDQ-----------------SC---HV---QT-A-------L---AA--
F7UYF5_EEGSY/3-75----------------..ISSLVIET.---VPEL-----------------TT---DA---AG-K-------L---DA--
A9CGL4_AGRFC/8-82----------------YHVSSAVVAV.---MPQM-----------------RD---AV---FA-T-------L---LT--
C7RM77_ACCPU/1-76----------------MNISSVLVNA.---RPEA-----------------IT---RV---KA-S-------L---CA--
B0UD65_METS4/21-95----------------HHVSGLVVHA.---RPER-----------------LA---GV---LA-S-------L---RA--
B1Y6A7_LEPCP/2-77----------------.SILGAIIRT.---RIGN-----------------VA---DV---AQ-Q-------L---QG--
B2UBL6_RALPJ/21-96----------------WHIAGVLVQT.---RPTH-----------------IA---RV---SE-S-------I---ES--
M4R765_BIBTR/2-75----------------...ASLVLQV.---RPEY-----------------IN---EV---KD-K-------L---AT--
B3E654_GEOLS/3-76----------------..VSGVVLSC.---RPGK-----------------ET---LV---AE-L-------A---RL--
H0Q103_9RHOO/2-77----------------.KIASLVVHV.---KPEH-----------------ID---AL---SA-S-------L---RD--
A8LLZ0_DINSH/2-76----------------.NVCGCLVHA.---APDR-----------------VD---GC---AE-D-------M---LA--
B8F7K3_HAEPS/16-92----------------WYVCSLVVQV.---KPEK-----------------LD---LV---KQ-A-------L---TE--

PF01037

GRP_ZYMMO/71-144---------------------VCIRC----A.EHS...-..QDW-------LD---NF---LQ-I-------V---NE..
ZRP_ZYMMO/68-141---------------------LLVKT----G.LHT...-..GNY-------LE---QF---HA-A-------V---SA..
Q92MD2_RHIME/86-156---------------------LLVTL----KRTP....-.....-------SL---GV---LD-R-------L---AG..
Q7D0A6_AGRFC/69-139---------------------VLITI----GPKA....-.....-------LP---AV---TA-A-------L---TA..
Q8XUT3_RALSO/72-151---------------------INVRL----E.KQGGAP-KGKAP-------SD---IF---RA-A-------V---AT..
Q6FBR8_ACIAD/74-148---------------------VEVLL----D.KTT...-..TNG-------LE---EF---IE-A-------V---AQ..
Q5UYW6_HALMA/69-139---------------------IQLKV----EGSS....-.....-------LP---AV---TE-D-------L---KE..
O28651_ARCFU/68-142---------------------INVKV----SLTR....-..EKG-------YD---DI---AK-R-------I---AK..
Q97KE2_CLOAB/74-146---------------------VGIYI----DKAA....-....S-------YP---KV---LE-A-------M---RD..
Q6LFY1_PHOPR/75-149---------------------VQVTL----E.RER...-..VDL-------MH---NF---KK-E-------M---NA..
Q9KKN4_VIBCH/69-143---------------------IHIRL----D.QSS...-..FSI-------FE---RF---AH-A-------V---AD..
Q88Q35_PSEPK/72-143---------------------IFVYR----YDRM....-....R-------GE---AV---LD-A-------L---RQ..
LRPB_BACSU/69-136---------------------VFFFM----NAYM....-.....-------HD---DL---LK-F-------I---AT..
Q8ELF6_OCEIH/69-140---------------------FDIDV----EPKQ....-.....-------LQ---EV---AQ-N-------L---AN..
Q7P0K6_CHRVO/67-134---------------------IELTV----KHLE....-.....-------YY---VV---ID-E-------I---RK..
Q5LQ65_RUEPO/71-144---------------------VLIRT----S.EHE...-..AEW-------QQ---QF---LK-A-------L---QD..
Q6NDU4_RHOPA/81-154---------------------VSIES----G.DHS...-..DAW-------LK---TF---AD-A-------V---SA..
Q8XS36_RALSO/102-176---------------------IGVVL----D.RST...-..PES-------FA---DF---EK-A-------V---QK..
Q6N2H6_RHOPA/71-144---------------------ASVHL----S.SQA...-..EAD-------LR---GF---EE-F-------V---RN..
Q9RT71_DEIRA/109-183---------------------VRVTL----D.KQT...-..KQG-------FQ---DF---AE-H-------M---RA..
Q87GT1_VIBPA/66-140---------------------FALKF----DTSIS...-..SYY-------CE---SY---AD-E-------L---YK..
Q6LY54_METMP/67-138---------------------TGFDT----NPED....-.....-------FL---SV---AQ-E-------L---CK..
Q6L2L7_PICTO/21-92---------------------IGLEA----DINA....-.....-------VD---DI---GK-E-------I---AT..
Q5V2Q8_HALMA/69-143---------------------VELNV----TLDR....-..ETS-------YD---DI---SD-R-------I---AK..
Q9HQ13_HALSA/69-140---------------------VGLRV----EQGR....-.....-------ED---ET---LD-R-------L---TG..
Q8E9E7_SHEON/75-150---------------------IHVRM----E.KHT...-..PAI-------LN---QF---ET-N-------V---LA..
A9CFY0_AGRFC/67-137---------------------MMIEI----EGHV....-.....-------TD---RV---IR-T-------L---GG..
Q63VD1_BURPS/71-145---------------------IEVGL----D.RQT...-..AED-------YD---AF---EA-Y-------A---CA..
Q8XQA9_RALSO/69-143---------------------ARIWL----K.GQD...-..AAT-------VD---AF---TA-A-------I---QQ..
Q6A8E6_PROAC/82-152---------------------IFLNP----IDPE....-....E-------DE---TI---PG-I-------L---RT..
Q9L101_STRCO/68-139---------------------VEIFC----RRNT....-....S-------PE---TI---QR-G-------L---ER..
Q5YPF7_NOCFA/74-144---------------------VTLEI----AQGA....-.....-------LD---TL---AA-E-------L---DA..
Q98D73_RHILO/70-144---------------------IQVRL----V.SHS...-..DGS-------PE---SF---IA-A-------V---QR..
Q98F66_RHILO/68-135---------------------VRIRP----LPGK....-.....-------LH---IV---QK-L-------I---EE..
Q9A2I8_CAUCR/74-148---------------------VTVTL----S.SQA...-..ESA-------LS---AF---EK-A-------I---AT..
Q9AAL7_CAUCR/79-153---------------------AEVTL----K.RHH...-..PDD-------FL---VF---ET-A-------I---AD..
Q5LQ72_RUEPO/75-142---------------------VRFRP----LPGK....-.....-------RH---IL---EQ-R-------I---QE..
A9CFA2_AGRFC/70-143---------------------ISVTL----E.RQI...-..KEA-------LT---TF---EH-H-------V---AS..
Q5ZSK0_LEGPH/69-144---------------------VLVGL----N.NHQ...-..PEV-------MN---QF---EK-T-------I---QL..
Q98PB1_RHILO/72-146---------------------ASIKL----E.RQR...-..EDD-------LD---RF---SQ-A-------V---LR..
Q92LN5_RHIME/67-137---------------------VMIEV----HGKM....-.....-------AD---RV---AE-Q-------L---RG..
Q92U21_RHIME/82-152---------------------MMIEV----VGKS....-.....-------TT---QV---VR-K-------L---RG..
Q88GR4_PSEPK/67-141---------------------VFVTL----R.EVT...-..RQP-------VA---DF---ET-A-------L---AQ..
Q5LX17_RUEPO/69-143---------------------VEITL----Q.GQA...-..DEV-------LD---AF---EK-A-------V---AR..
Q8KCK3_CHLTE/71-142---------------------VRVRV----DSSK....-....H-------YK---SF---VE-H-------V---MK..
Q9I287_PSEAE/71-145---------------------AQIKL----N.AHG...-..RKN-------LT---DF---AE-A-------M---HQ..
Q9A5B5_CAUCR/107-181---------------------VEVQV----D.RHS...-..EEA-------AE---AF---QQ-A-------V---LR..
Q5YR66_NOCFA/67-141---------------------LDLSL----E.SHD...-..ART-------TE---HF---ET-T-------M---RG..
Q8NMC1_CORGL/75-149---------------------LGIQI----RPHA....-..RDT-------AN---DF---VQ-K-------V---LA..
Q82QC2_STRAW/71-138---------------------VRLKY----PGNR....-.....-------HQ---PL---RR-L-------L---AE..
Q898A1_CLOTE/78-150---------------------VGINL----EKAS....-....Y-------LT---EV---AN-K-------L---EE..
Q88H33_PSEPK/67-137---------------------TSIGI----SGHH....-.....-------AA---EV---KH-A-------L---RG..
Q88DP7_PSEPK/70-145---------------------VLIGM----D.RHT...-..PER-------FE---TF---EA-A-------I---RN..
Q9KYP0_STRCO/82-153---------------------IGVSL----SDAA....-....D-------HE---DV---AQ-R-------L---KE..
Q9EX07_STRCO/69-139---------------------VHIEV----TQGH....-.....-------LD---EV---GE-A-------L---AA..
Q74NJ3_NANEQ/8-78---------------------ILIQV----KPGY....-.....-------ET---SV---AE-T-------L---TS..
Q5UXF0_HALMA/63-134---------------------IEVSV----DVNV....-....D-------TA---EV---SD-R-------I---AD..
LYSM_SULTO/67-138---------------------VMVKT----NPQI....-....P-------TP---EI---SK-K-------I---IK..
Q7VRX6_BORPE/85-159---------------------VHVSL----D.QSQ...-..AGW-------HE---AF---VA-R-------L---AG..
HOSA_SULTO/388-459---------------------ISVKC----ESNV....-....Y-------TT---AV---TR-R-------L---SV..
Q6L0M6_PICTO/71-145---------------------ILIEY----DSKA....-..KID-------QK---TL---CR-N-------L---AA..
Q7NXB3_CHRVO/75-142---------------------VGITV----PQPD....-.....-------KK---TL---LA-R-------L---EA..
Q8XJU9_CLOPE/76-148---------------------VGIHV----NSTS....-....S-------YT---HV---FD-E-------L---SK..
Q82JE5_STRAW/69-138---------------------IRVNP----HAGY....-..SLR-------HP---RT---LE-L-------L---AR..
Y4TD_SINFN/84-158---------------------VMVSL----E.RER...-..ADI-------VD---RF---KS-S-------I---RN..
Q9K0L9_NEIMB/99-172---------------------IRVSI----..RKA...-..KDA-------RE---DF---AA-S-------V---RK..
Q87PU4_VIBPA/76-146---------------------LLISC----EKGK....-.....-------KN---EV---TN-A-------L---KE..
Q5Z126_NOCFA/77-147---------------------VSVVL----DQHR....-.....-------LD---AV---VD-A-------L---AE..
Q89LX8_BRADU/73-146---------------------VSIQL----G.SQA...-..QPV-------LE---AF---EG-S-------I---AA..
Q5LQW1_RUEPO/67-141---------------------IEVKL----N.SQR...-..RED-------LE---AF---EK-A-------I---LS..
Q65N91_BACLD/69-136---------------------IEATV----KNGE....-.....-------YE---RF---KA-Y-------I---ER..
Q92XD8_RHIME/73-147---------------------CQVRM----K.SHD...-..PVA-------RR---NF---ER-F-------V---ES..
Q8FLW4_COREF/255-325---------------------LWVQT----TPQS....-.....-------VE---AI---GH-Q-------L---AG..
Q5LTP6_RUEPO/68-142---------------------LRVTL----DKTQ....-..PRA-------FD---DF---IE-A-------A---RK..
Q8XVM9_RALSO/69-143---------------------VWVEL----D.RQH...-..SAA-------LR---DF---ER-K-------M---SA..
Q98KG1_RHILO/93-160---------------------LRIRP----VPGQ....-.....-------LS---VV---AE-I-------I---RE..
Q8A556_BACTN/73-147---------------------CSVKL----R.RLN...-..RDI-------AA---EF---TR-I-------I---QD..
Q7NU65_CHRVO/74-148---------------------VQVGF----G.SHI...-..GDA-------PL---RF---EE-Q-------V---QA..
Q5NMJ8_ZYMMO/67-141---------------------VFVTL----S.ESN...-..KQL-------VQ---IF---ED-A-------L---LT..
Q7VRX9_BORPE/76-153---------------------VTIKL----N.KHSG..-GSHAP-------MG---NF---AR-D-------V---QL..
Q6FCQ3_ACIAD/67-137---------------------MNIMV----EGNK....-.....-------AS---AV---IR-E-------L---RI..
Q6A5I2_PROAC/64-135---------------------VEVDC----HTES....-.....-------LP---QV---IK-T-------L---CA..
Q8ZT22_PYRAE/67-153---------------------VLVSV----RRGAAPKE-AKPLQ-------LE---VA---EK-V-------L---AECN
Q9KFQ5_BACHD/69-136---------------------IEATV----KHGE....-.....-------YS---RF---KQ-V-------V---EG..
Q63M55_BURPS/72-146---------------------VQVTM----E.RGH...-..IRD-------LS---TF---QK-L-------V---SE..
Q9RKY4_STRCO/86-156---------------------ISVKP----FDPS....-....A-------PD---DI---AD-R-------L---AG..
Q89QF0_BRADU/95-169---------------------VRIAL----E.SQS...-..DEA-------LK---AF---EA-E-------V---VK..
Q7NH56_GLOVI/75-142---------------------IRINT----AGKK....-.....-------SA---QL---GA-F-------A---CS..
Q5WIR4_BACSK/69-136---------------------VEASI----KHGR....-.....-------YD---AF---KH-Y-------I---QT..
Q82AJ9_STRAW/6-77---------------------VLIKT----SVDR....-.....-------IP---EI---AE-S-------I---AA..
Q7VV34_BORPE/67-140---------------------ISVKT----N.QHS...-..QAW-------LD---RF---AD-H-------V---TD..
Q63K02_BURPS/70-144---------------------VLLRC----S.VHD...-..RSV-------AN---RF---ER-E-------V---LG..
Q9K6T5_BACHD/69-140---------------------IGIKT----QLGK....-.....-------QE---TI---AT-K-------L---NE..
O29671_ARCFU/66-134---------------------LLISA----ENPE....-.....-------..---KV---FN-N-------I---KA..
Q6AF01_LEIXX/80-150---------------------IGLRV----TGDT....-.....-------.R---LV---AD-K-------L---AA..
Q98JQ8_RHILO/76-143---------------------IRVRT----THEH....-.....-------IR---PC---LK-Q-------F---AE..
Q9XAG4_STRCO/72-142---------------------TTFEV----DQPA....-.....-------RE---AI---AA-R-------L---RA..
Q92PN1_RHIME/74-147---------------------VMIRT----R.HHS...-..KEW-------SD---GF---RA-H-------V---EK..
O86743_STRCO/86-156---------------------VGVNV----EGDV....-.....-------.E---SV---AE-A-------L---SA..
Q7VXK7_BORPE/69-143---------------------VTLEF----A.RHG...-..SEY-------RR---TF---ME-Q-------V---AL..
Q9RK86_STRCO/67-136---------------------VLVDS----TAWM....-.....-------.G---DR---AE-D-------F---AA..
Q9RXV6_DEIRA/89-157---------------------IGVKD----SGRN....-.....-------DP---AL---VR-W-------A---RE..
O29606_ARCFU/6-76---------------------TMVNV----APGK....-.....-------EK---DV---YL-A-------V---KG..
Q6ANT7_DESPS/69-143---------------------IIVSV----N.LHQ...-..VSS-------LT---AV---KE-K-------L---KA..
REG1_PYRFU/70-146---------------------IEIEL----ADPE....-..SDE-------LS---KL---IR-P-------I---LK..
Q98K63_RHILO/72-146---------------------ATIRL----S.RQN...-..EDE-------IV---MF---EE-A-------I---RG..
Q9HLH1_THEAC/98-168---------------------IIIDV----DPNK....-.....-------MD---DV---AN-S-------I---TD..
O29117_ARCFU/70-140---------------------IGITA----EGGY....-.....-------LT---EI---EK-E-------I---AK..
Q983I9_RHILO/78-152---------------------ISVTL----A.THN...-..RDN-------AR---RF---GE-L-------V---AR..
Q972L7_SULTO/67-140---------------------SLIRG----KYSK....-...DY-------HI---EL---GS-K-------L---AN..
Q5V2P2_HALMA/69-140---------------------VGIDI----ASDC....-.....-------YV---EA---TR-N-------L---KE..
Q87GV1_VIBPA/67-140---------------------VEVSL----N.NHQ...-..ASS-------ID---EF---ET-A-------I---VD..
Q8XX00_RALSO/74-141---------------------IRIQT----THAQ....-.....-------IT---KC---LK-A-------F---AT..
Q987B0_RHILO/72-146---------------------MEVTL----A.SHR...-..QAD-------FD---RF---ER-V-------I---RD..
Q9A3N3_CAUCR/116-190---------------------VRVRL----D.RHG...-..QDL-------IK---GF---ED-A-------V---AR..
Q7NT80_CHRVO/75-149---------------------ANVSL----E.RHN...-..EAA-------LQ---DF---AQ-S-------I---DN..
Q5LKR4_RUEPO/67-141---------------------VRIRL----E.RHN...-..QED-------VH---RF---ET-R-------V---RQ..
P71888_MYCTU/70-141---------------------VQIFC----HGRI....-....A-------PD---QL---RA-A-------W---VN..
Q5LTI9_RUEPO/68-142---------------------IQVHL----G.THG...-..PDQ-------SA---KF---AR-M-------V---NS..
Q88E71_PSEPK/78-152---------------------VQLKT----Q.RHD...-..SAW-------LE---QF---AA-T-------V---TG..
Q82M14_STRAW/244-315---------------------LWITT----SPGA....-.....-------LH---SV---GE-A-------L---AT..
Q5LX25_RUEPO/67-137---------------------VLLEV----QQKE....-.....-------TT---RI---VK-R-------L---EA..
Q981V1_RHILO/75-149---------------------VEVTA----K.NGK...-..PHL-------LD---GM---KR-R-------F---LN..
Q97J19_CLOAB/69-136---------------------VKVTM----KNGQ....-.....-------YE---KF---KI-F-------I---KE..
Q89XH4_BRADU/78-152---------------------IQVGL----A.THS...-..PDN-------SK---RF---RA-L-------V---NR..
Q984M5_RHILO/74-148---------------------VEVEL----E.SER...-..TEL-------ID---AA---KR-Q-------F---SQ..
Q9HQ33_HALSA/67-138---------------------LEVLT----SYDG....-....G-------YE---DV---AD-E-------I---SA..
Q93IX1_STRCO/72-139---------------------VRLRY----PVAN....-.....-------YK---PF---HD-L-------V---AV..
Q975B9_SULTO/71-141---------------------VLIKA----DPKK....-.....-------YE---QI---LK-K-------I---YE..
Q745M6_MYCPA/252-323---------------------LWLTV----APRD....-.....-------VH---TV---GE-R-------I---AA..
Q5LNM4_RUEPO/70-143---------------------VMLRT----R.HHS...-..AEW-------LQ---KF---RT-H-------V---LT..
Q93IX5_STRCO/73-147---------------------LLVQV----RPHR....-..REL-------VG---PF---VE-R-------I---RA..
Q92MD5_RHIME/70-144---------------------IEVML----D.KTT...-..PEV-------FD---QF---AA-A-------I---KQ..
Q9RS40_DEIRA/9-80---------------------VMVQA----ERHR....-.....-------IQ---ET---AE-A-------L---AA..
Q5KVS2_GEOKA/71-145---------------------IDVKV----TPKR....-..GVG-------FD---EV---AE-R-------I---YR..
Q5LUB6_RUEPO/69-143---------------------VAAEI----A.DHT...-..AAS-------FR---AF---EA-A-------M---QR..
BKDR_PSEAE/70-144---------------------VSVSL----E.KQT...-..GDY-------LA---RF---EE-R-------I---VD..
Q8ZX24_PYRAE/6-77---------------------VFINT----EIGA....-.....-------ED---EV---ME-A-------L---VK..
Q8XFM7_RALSO/75-142---------------------IRIGA----SAER....-.....-------GT---SL---LK-T-------F---RE..
REG8_PYRFU/69-139---------------------IGIKA----QGKK....-.....-------IR---EI---ER-I-------I---AR..
Q5UZ96_HALMA/68-138---------------------FQLSV----EGDG....-.....-------LG---RV---VD-Q-------L---RD..
Q5QV65_IDILO/67-141---------------------VTIGL----S.DHR...-..RSS-------QL---AF---EQ-H-------V---AD..
Q5LRE1_RUEPO/71-145---------------------VMVEL----D.RET...-..LQQ-------LD---LF---RK-R-------A---KA..
Q6D0Y1_PECAS/70-144---------------------IEVRL----I.NHT...-..SEY-------VE---RF---HQ-M-------L---GE..
Q98N03_RHILO/69-143---------------------VHISL----S.GQF...-..EKT-------LS---DF---EA-A-------I---KR..
Q880K0_PSESM/71-145---------------------VEVKL----S.GHG...-..RRY-------LA---EF---EE-A-------I---IG..
Q8ZWW2_PYRAE/87-153---------------------ILVKI----EPKY....-.....-------RD---KV---YD-A-------A---KK..
Q986N0_RHILO/91-161---------------------VHIDT----RGWG....-.....-------KT---PE---LM-A-------V---SQ..
Q9HV24_PSEAE/67-134---------------------IELRI----TEKD....-.....-------CQ---SV---LD-E-------L---AR..
Q6LS33_PHOPR/66-136---------------------FEIRH----QCAR....-.....-------CA---DV---VE-I-------F---KT..
Q9A4E7_CAUCR/94-165---------------------ALATV----EFAR....-.....-------YE---AF---EA-A-------V---LR..
Q89D55_BRADU/68-142---------------------LHVSL----E.RHD...-..AKF-------VD---EF---VA-R-------V---TT..
Q6AIZ2_DESPS/68-140---------------------IEVTP----KPDA....-....Y-------IP---DL---GE-K-------L---AA..
Q5LTP5_RUEPO/70-144---------------------LGVKL----A.RKG...-..RVS-------LE---DF---ER-A-------V---SA..
Q88AX2_PSESM/73-147---------------------TEISL----S.DHK...-..RED-------FA---KF---EA-N-------I---RH..
Q8A637_BACTN/72-143---------------------IGIYL----KDPE....-....S-------FD---SV---TR-A-------L---EA..
A9CJY9_AGRFC/67-141---------------------VTVEL----K.LHG...-..EQH-------MR---RF---LD-I-------A---SA..
Q826R1_STRAW/74-145---------------------VEVYC----EGAA....-....P-------PR---RL---AE-V-------V---RN..
Q9KGA0_BACHD/67-134---------------------IQVSE----VTVP....-.....-------YA---TF---EK-F-------V---EE..
Q8G6L1_BIFLO/70-140---------------------VNVTP----LDYS....-....A-------ES---SI---PD-K-------L---NN..
Q6AQ93_DESPS/16-87---------------------ILLRV----ERTK....-.....-------VN---DV---AE-K-------L---AD..
Q81G47_BACCR/69-136---------------------LEITL----KNGD....-.....-------TT---RM---QQ-F-------I---QS..
Q5NRK7_ZYMMO/74-148---------------------VEVHL----I.NER...-..MDT-------VN---NA---KR-L-------F---HN..
Q6FAP4_ACIAD/69-144---------------------LQVSL----SKHD....-..TET-------FD---KF---LA-E-------L---ED..
Q7VUI7_BORPE/70-140---------------------TLIEV----RGAA....-.....-------TD---AV---VA-A-------L---RR..
AZLB_BACSU/71-145---------------------ALINL----S.PLN...-..RET-------IH---SF---LE-D-------I---NK..
O28824_ARCFU/64-138---------------------VAMEV----ESSD....-....A-------LR---KI---IE-K-------F---RD..
Q6NCU7_RHOPA/67-141---------------------AFIRV----E.RHS...-..RDN-------AE---SF---IE-A-------V---QT..
Q5LMF1_RUEPO/70-144---------------------MGVGL----G.EHT...-..KAA-------QE---RF---ER-A-------V---AR..
Q5WDD1_BACSK/69-140---------------------IGIHS----QLGK....-.....-------QH---EI---GQ-W-------L---KT..
Q9XA32_STRCO/57-128---------------------ITLKI----VQNS....-.....-------WR---TV---RA-Q-------L---RQ..
Q9A3M5_CAUCR/129-203---------------------CTVKL----S.LPT...-..KEN-------LD---TF---EQ-A-------V---GK..
Q6L1Y9_PICTO/97-167---------------------IRVDT----DAER....-.....-------ID---EI---AS-K-------I---AE..
Q6W0Z0_SINFN/69-143---------------------TEITL----K.NHR...-..QVD-------FA---RF---LA-A-------I---EK..
Q87WM3_PSESM/56-130---------------------VHLSV----D.LHT...-..EEV-------TR---KL---EE-K-------I---IL..
Q5NNH9_ZYMMO/73-147---------------------AMVSL----K.SQA...-..EDD-------LR---QF---EE-H-------V---AT..
PTR1_METJA/68-139---------------------LGLYI----KPSK....-.....-------VE---ET---LN-K-------L---KE..
Q92NU2_RHIME/68-141---------------------ALIKT----A.HHS...-..DDW-------IE---KF---RR-A-------I---SD..
LRP_RHIME/73-147---------------------CMVGL----K.HQS...-..DAN-------LK---AF---AA-R-------T---AS..
Q8XU40_RALSO/70-144---------------------ASVKL----A.HHG...-..DAI-------VE---RF---RE-E-------I---LL..
Q65G37_BACLD/68-136---------------------INIYT----KSTY....-.....-------HK---PY---LS-F-------I---KA..
Y224_HAEIN/85-159---------------------VMVEM----D.NQH...-..SYY-------QE---QF---ER-K-------M---RQ..
Q65E48_BACLD/78-149---------------------FNVEV----EPQY....-.....-------LE---AV---AV-A-------L---EK..
Q6W241_SINFN/68-142---------------------TTISL----S.SHT...-..EEG-------NR---RL---HS-F-------I---ED..
O28868_ARCFU/6-77---------------------VLIKV----SPGK....-.....-------ER---KV---YD-A-------L---AA..
Q63I71_BURPS/69-143---------------------VHVAM----R.PDI...-..EDW-------HD---SF---VA-A-------I---QS..
O27261_METTH/78-148---------------------IGVKV----KGGV....-.....-------LR---NW---ET-R-------T---AY..
Q5LWR4_RUEPO/91-158---------------------IRARP----LPGE....-.....-------MA---NM---IE-A-------I---QD..
Q9K655_BACHD/67-134---------------------ILVSG----LRVP....-.....-------LK---DF---ED-M-------V---KS..
Q980N2_SULSO/6-77---------------------VLINT----DAGG....-.....-------EE---EV---FE-K-------L---KN..
Q5P347_AROAE/71-145---------------------VTVTL----E.KRR...-..DTP-------MH---AF---HA-A-------V---QS..
Q8NTP9_CORGL/72-146---------------------VDVTL----S.NFD...-..RST-------VD---NF---ES-S-------V---AQ..
Q5YZ22_NOCFA/6-77---------------------VLIHA----DNAR....-.....-------IP---ET---AQ-A-------V---AD..
Q92S84_RHIME/6-77---------------------VQLQC----APGK....-.....-------TY---EV---AD-E-------I---YR..
Q5LVX6_RUEPO/69-143---------------------VHVHL----T.RHD...-..PDG-------IV---AF---IR-A-------I---ET..
Q6FCJ8_ACIAD/71-145---------------------IEIKL----Q.HYS...-..LET-------LE---KF---LD-F-------V---KN..
Q9HVR3_PSEAE/69-143---------------------VGIKV----E.RHR...-..QEQ-------AE---AF---HR-A-------V---VD..
Q5LXH4_RUEPO/67-141---------------------VSVEL----E.RQE...-..RAA-------VD---AF---ER-A-------I---RT..
Q8Y353_RALSO/69-136---------------------IQIET----THAH....-.....-------IR---KY---IQ-L-------F---EA..
A9CG60_AGRFC/77-149---------------------.EVKL----SDTR....-..EKA-------LE---EF---NT-A-------V---RK..
A9IKA3_BORPD/73-141---------------------..ISV----LPKT....-.....-------PA---AV---IR-E-------L---SK..
B2FLQ0_STRMK/74-148---------------------VEISL----AYKS....-..GDI-------FE---EF---RR-A-------A---LK..
C1A292_RHOE4/70-138---------------------VGLEL----EQGK....-.....-------IS---AV---AR-S-------L---TE..
D5AV63_RHOCB/70-137---------------------.LVEL----QGKL....-.....-------SR---QV---IR-T-------L---TG..
F2Z5Y7_SULAC/76-144---------------------.MIKV----DGKH....-.....-------IL---EF---EK-E-------V---SN..
G4RMH4_THETK/397-468---------------------IWIKV----DENV....-....Y-------TT---SV---AR-R-------V---ST..
YBAO_ECOLI/68-142---------------------VLIKT----QHHS....-..SEW-------YC---RF---VT-V-------V---TE..
REG7_PYRFU/69-138---------------------.GVDT----KPEK....-.....-------LF---EV---AE-K-------L---KE..
Q0K0V9_CUPNH/87-161---------------------IEVTL----ERHD....-..DDM-------LY---RF---GK-A-------L---AE..
Q1DFS8_MYXXD/69-140---------------------IGVSI----EHPK....-....Y-------FD---EF---LQ-K-------V---LL..
Q2K1K4_RHIEC/70-143---------------------VGMEI----ERDN....-..YDA-------LA---KF---RV-W-------A---EK..
Q2YIU7_BRUA2/70-144---------------------VRITL----DR.QT...-..EEY-------LN---RF---EE-A-------V---RR..
Q2YL25_BRUA2/72-139---------------------.RIRL----DQQD....-..EET-------LQ---KF---AN-E-------I---MR..
Q2YQJ2_BRUA2/71-144---------------------ILVRT----SAHD....-..PEW-------LN---KF---RA-A-------V---AR..
Q5JGT9_THEKO/6-76---------------------VLLTV----EIGK....-.....-------VE---SV---IE-A-------L---RK..
Q5L7H5_BACFN/70-142---------------------VGIKL----EKGS....-....M-------YK---AV---VA-E-------L---QK..
Q5LDE0_BACFN/71-144---------------------.NVSL----AVHD....-..DEH-------IK---RF---QE-E-------I---KE..
Q5SK07_THET8/6-76---------------------VLIRP----RGNR....-.....-------VQ---AL---GE-A-------I---AE..
Q5ZVF4_LEGPH/88-161---------------------VNITL----EKQR....-..EDL-------LA---HF---ER-K-------M---QE..
Q63LV0_BURPS/69-143---------------------VNISL----D.SHT...-..EKT-------CR---AF---EA-G-------V---MA..
Q63PU3_BURPS/81-154---------------------.HVHL----T.RHN...-..EGG-------VE---QF---ER-E-------I---AT..
Q63WP2_BURPS/72-146---------------------VQVSM----RNDQ....-..TQW-------HE---RF---AQ-A-------V---RE..
Q79Z48_STRAW/82-148---------------------...EI----RQGQ....-.....-------GP---DV---RA-H-------L---TT..
Q7LX67_SULSO/76-145---------------------.EIET----VPYS....-.....-------IK---KV---AQ-D-------L---GE..
Q7VSF7_BORPE/69-142---------------------VHVTL----ESHS....-..EET-------LY---EF---GR-A-------L---AQ..
Q7VUR8_BORPE/71-143---------------------VSIKT----NQHN....-..AKW-------TD---NL---IN-A-------V---MS..
Q7VUU2_BORPE/68-141---------------------.QISL----ERHS....-..AGT-------VE---TF---ER-S-------V---RD..
Q7VVL9_BORPE/71-144---------------------.EIRL----SAKS....-..GDV-------FD---KV---KQ-E-------L---LY..
Q81UN4_BACAN/77-147---------------------..MST----NIHQ....-..SDK-------LE---VL---EK-E-------L---EA..
Q88EQ3_PSEPK/70-143---------------------IHVSL----E.KQV...-..EQS-------LH---RF---EE-E-------I---AE..
Q88NA5_PSEPK/72-143---------------------.SIMM----D.SHT...-..KDM-------AL---AF---EQ-R-------L---ME..
Q88QV0_PSEPK/75-144---------------------VGIKV----QPRS....-.....-------GK---DV---VR-R-------L---SA..
Q8PE26_XANCP/73-147---------------------VRVQL----E.QHG...-..QPD-------IE---HF---AA-G-------V---RG..
REG6_PYRFU/71-140---------------------ILIKV----KAGK....-.....-------YS---EV---AS-K-------L---VK..
Q8ZKW5_SALTY/74-143---------------------..IIL----KSAK....-....D-------YP---SA---LA-R-------L---ES..
Q98A93_RHILO/76-149---------------------VEVVL----ERHR....-..LED-------QR---HF---ET-A-------I---GE..
Q9HKJ0_THEAC/68-141---------------------.LIAY----TPKD....-..GLS-------QR---EL---AA-K-------I---AN..
A0A089UKH2_9ENTR/78-152---------------------VEITL----NRGA....-..PDV-------FE---QF---NA-A-------V---QK..

PF08734

Q1IPM3_KORVE/4-93---------------------YISLIR---YTQQGAAN-I.KES-------PK---RL---DA-A-------K---KAA.
G2MLB5_9ARCH/4-91---------------------YLALHK---HRKEGAQT-I.KQL-------PE---RV---EQ-A-------K---QLA.
H1XQS5_9BACT/4-95---------------------FILLTK---LSPSAMKD-A.RTR-------EQ---IG---RE-W-------F---ETVK
D7BJC3_MEISD/4-95---------------------YLLQVN---YVGEGIRG-LLKEG-------GT---SR---KA-A-------A---EAAV
G8MII4_9BURK/4-93---------------------YIMLLN---WTDQGVRS-A.KDT-------IK---RA---RA-F-------G---ETS.
L0AFR4_NATGS/4-92---------------------YVSLIE---LADRDVQN-T.QEL-------AS---IW---GE-I-------R---TEF.
F4F772_VERMA/4-95---------------------FLLTTN---YTGGGLEG-LTADG-------GT---VR---VE-V-------V---RALV
Q5SI26_THET8/4-92---------------------FIVLST---LTDDGAET-L.VKN-------PE---RI---KE-V-------N---QELE
H6R075_NOCCG/4-95---------------------YLWRVS---YTQDGASG-LLAQG-------GS---VR---RA-A-------I---TEMV
G2NSS9_STRVO/4-93---------------------YITLLN---WTEQGVRA-Y.KDT-------TK---RT---ED-F-------A---AAL.
I4F214_9ACTN/4-95---------------------FVIFFA---YTPETWGR-MVEQ.-------PG---DR---TA-A-------V---RASA
I4ETI0_9ACTN/4-94---------------------YMFIVD---YAPQGAKA-LLQVG-------GS---DR---RT-T-------M---EKTA
Q01ZT0_SOLUE/4-95---------------------YLFQAS---YSSSAWSA-MVKD.-------PQ---NR---AE-A-------