Sequence alignment for CL0032

PF03795

YJPA_BACSU/6-82--------------------------------------------------------------------------------
Q9I3Z5_PSEAE/1-116--------------------------------------------------------------------------------
Q98EG6_RHILO/1-116--------------------------------------------------------------------------------
Q9AB44_CAUCR/10-125--------------------------------------------------------------------------------
Q9I3Z0_PSEAE/1-123--------------------------------------------------------------------------------
Q98I36_RHILO/1-116--------------------------------------------------------------------------------
Q98DP4_RHILO/1-116--------------------------------------------------------------------------------
Q98HH2_RHILO/1-118--------------------------------------------------------------------------------
Q98H82_RHILO/1-116--------------------------------------------------------------------------------
Q984U5_RHILO/1-115--------------------------------------------------------------------------------
P73587_SYNY3/2-86--------------------------------------------------------------------------------
Q983T6_RHILO/165-255--------------------------------------------------------------------------------
Q9RVF8_DEIRA/6-88--------------------------------------------------------------------------------
Q97TR0_CLOAB/1-82--------------------------------------------------------------------------------
Q9X7N1_STRCO/1-82--------------------------------------------------------------------------------
Q98H68_RHILO/7-87--------------------------------------------------------------------------------
Q9ZNA3_9RHOB/1-86--------------------------------------------------------------------------------
Q9AJZ7_STRCO/1-88--------------------------------------------------------------------------------
Q45075_BURCE/1-92--------------------------------------------------------------------------------
Q98EI5_RHILO/1-89--------------------------------------------------------------------------------
Q9AC00_CAUCR/2-87--------------------------------------------------------------------------------
Q9F188_CUPNE/1-88--------------------------------------------------------------------------------
Y828_HAEIN/1-95--------------------------------------------------------------------------------
Q9KRE0_VIBCH/1-95--------------------------------------------------------------------------------
YCII_SHIFL/1-95--------------------------------------------------------------------------------
Q9HZ38_PSEAE/1-95--------------------------------------------------------------------------------

PF07045

Q89BY8_BRAJA/78-142--------------------------------------------------------------------------------
A4T848_MYCGI/15-77--------------------------------------------------------------------------------
Q1MHU6_RHIL3/14-77--------------------------------------------------------------------------------
A1B208_PARDP/14-78--------------------------------------------------------------------------------
Q98DD6_RHILO/15-78--------------------------------------------------------------------------------
A6VTU1_MARMS/14-77--------------------------------------------------------------------------------
Q0C268_HYPNA/14-78--------------------------------------------------------------------------------
Q1GHA0_SILST/14-77--------------------------------------------------------------------------------
B1KC06_BURCC/15-78--------------------------------------------------------------------------------
Q391P0_BURS3/15-78--------------------------------------------------------------------------------
Q28QV7_JANSC/15-78--------------------------------------------------------------------------------
A1K1N9_AZOSB/14-77--------------------------------------------------------------------------------
Q7VAI4_PROMA/19-83--------------------------------------------------------------------------------
Q6SHS9_9BACT/17-82--------------------------------------------------------------------------------
Q3JLQ5_BURP1/14-78--------------------------------------------------------------------------------
Q1GFX6_SILST/15-78--------------------------------------------------------------------------------
Q07UT1_RHOP5/15-78--------------------------------------------------------------------------------
Q0FAX8_9RHOB/16-79--------------------------------------------------------------------------------
A5V7J9_SPHWW/14-78--------------------------------------------------------------------------------
Q2BPT9_9GAMM/14-76--------------------------------------------------------------------------------
Q0KCE3_CUPNH/15-79--------------------------------------------------------------------------------
A6UK15_SINMW/14-77--------------------------------------------------------------------------------
Q6NCX9_RHOPA/15-79--------------------------------------------------------------------------------
Q7WD74_BORBR/14-77--------------------------------------------------------------------------------
Q28UH1_JANSC/39-104--------------------------------------------------------------------------------
Q89JB1_BRAJA/26-90--------------------------------------------------------------------------------
A7HSS3_PARL1/14-78--------------------------------------------------------------------------------
Q5NR08_ZYMMO/14-78--------------------------------------------------------------------------------
Q28SX7_JANSC/15-78--------------------------------------------------------------------------------
Q742V7_MYCPA/18-80--------------------------------------------------------------------------------
Q1I972_PSEE4/14-78--------------------------------------------------------------------------------
A9AQ60_BURM1/15-78--------------------------------------------------------------------------------
Q8TNJ5_METAC/3-67--------------------------------------------------------------------------------
Q16DN6_ROSDO/15-78--------------------------------------------------------------------------------
A6VY75_MARMS/14-79--------------------------------------------------------------------------------
Q0FH20_9RHOB/10-73--------------------------------------------------------------------------------
Q0RQX9_FRAAA/15-78--------------------------------------------------------------------------------
A0P3L8_9RHOB/15-78--------------------------------------------------------------------------------
Q8FXW8_BRUSU/15-78--------------------------------------------------------------------------------
B2JPM5_BURP8/16-79--------------------------------------------------------------------------------
Q1QS87_NITHX/15-78--------------------------------------------------------------------------------
Q11E97_MESSB/14-79--------------------------------------------------------------------------------
A9BN41_DELAS/15-79--------------------------------------------------------------------------------
Q98G06_RHILO/36-99--------------------------------------------------------------------------------
A1TLS8_ACIAC/15-79--------------------------------------------------------------------------------
Q28KV2_JANSC/15-79--------------------------------------------------------------------------------
A5FY88_ACICJ/15-78--------------------------------------------------------------------------------
Q46FP8_METBF/16-80--------------------------------------------------------------------------------
A4XXX9_PSEMY/29-93--------------------------------------------------------------------------------
A7IC73_XANP2/126-189--------------------------------------------------------------------------------
Q0C4G1_HYPNA/15-78--------------------------------------------------------------------------------
B2TDH4_BURPP/15-78--------------------------------------------------------------------------------
Q0FEP2_9RHOB/15-78--------------------------------------------------------------------------------
Q2KDF1_RHIEC/15-78--------------------------------------------------------------------------------
A5E903_BRASB/8-72--------------------------------------------------------------------------------
Q128E5_POLSJ/15-79--------------------------------------------------------------------------------
Q65SN3_MANSM/36-100--------------------------------------------------------------------------------
Q1BE44_MYCSS/14-78--------------------------------------------------------------------------------
A9ATA2_BURM1/14-77--------------------------------------------------------------------------------
A0PQ06_MYCUA/14-78--------------------------------------------------------------------------------
A8L5T2_FRASN/24-88--------------------------------------------------------------------------------
Q484V4_COLP3/14-77--------------------------------------------------------------------------------
Q98JP1_RHILO/57-122--------------------------------------------------------------------------------
A0YH96_9GAMM/14-79--------------------------------------------------------------------------------
A0YGY6_9GAMM/14-78--------------------------------------------------------------------------------
Q47EX6_DECAR/15-79--------------------------------------------------------------------------------
B2SY97_BURPP/15-78--------------------------------------------------------------------------------
B2U9C2_RALPJ/15-79--------------------------------------------------------------------------------
Q6F9F1_ACIAD/14-77--------------------------------------------------------------------------------
B2TES1_BURPP/15-78--------------------------------------------------------------------------------
Q39MC4_BURS3/15-78--------------------------------------------------------------------------------
Q0FH19_9RHOB/14-77--------------------------------------------------------------------------------
Q05S93_9SYNE/15-78--------------------------------------------------------------------------------
Q0FAW6_9RHOB/16-82--------------------------------------------------------------------------------
A0YEI5_9GAMM/17-82--------------------------------------------------------------------------------
A6UFC5_SINMW/15-78--------------------------------------------------------------------------------
A0Y8B3_9GAMM/7-71--------------------------------------------------------------------------------
Q28P24_JANSC/18-83--------------------------------------------------------------------------------
Q7V2V4_PROMP/19-83--------------------------------------------------------------------------------
Q1YYX4_PHOPR/14-77--------------------------------------------------------------------------------
A1B8D1_PARDP/15-78--------------------------------------------------------------------------------
A0Y900_9GAMM/14-78--------------------------------------------------------------------------------
A0QZT5_MYCS2/14-78--------------------------------------------------------------------------------
Q127Z9_POLSJ/14-78--------------------------------------------------------------------------------
Q89X32_BRAJA/34-98--------------------------------------------------------------------------------
Q0RXH4_RHOSR/14-78--------------------------------------------------------------------------------
A4XTJ7_PSEMY/15-78--------------------------------------------------------------------------------
A1AZL7_PARDP/14-77--------------------------------------------------------------------------------
Q9LCS9_BRAJP/15-78--------------------------------------------------------------------------------
O85836_SPHAR/14-79--------------------------------------------------------------------------------
A1BAV2_PARDP/15-78--------------------------------------------------------------------------------
Q98CT4_RHILO/21-84--------------------------------------------------------------------------------
A8KZG9_FRASN/14-78--------------------------------------------------------------------------------
A2BXC0_PROM5/33-96--------------------------------------------------------------------------------
Q68E53_AERPU/15-78--------------------------------------------------------------------------------
B1KGZ1_SHEWM/14-79--------------------------------------------------------------------------------
A6WA35_KINRD/26-89--------------------------------------------------------------------------------
A1B124_PARDP/15-78--------------------------------------------------------------------------------
Q215U7_RHOPB/14-78--------------------------------------------------------------------------------
Q3KB77_PSEPF/14-78--------------------------------------------------------------------------------
Q984S8_RHILO/14-78--------------------------------------------------------------------------------
Q165U6_ROSDO/14-77--------------------------------------------------------------------------------
Q1V0T9_PELUQ/15-78--------------------------------------------------------------------------------
A4X3R6_SALTO/15-79--------------------------------------------------------------------------------
Q2VZK5_MAGSA/14-79--------------------------------------------------------------------------------
Q2BJZ2_9GAMM/14-79--------------------------------------------------------------------------------
Q0B1J7_BURCM/14-78--------------------------------------------------------------------------------
Q2BHP1_9GAMM/14-77--------------------------------------------------------------------------------
Q48IM5_PSE14/14-78--------------------------------------------------------------------------------
A0NLT0_9RHOB/14-79--------------------------------------------------------------------------------
Q11KJ1_MESSB/15-78--------------------------------------------------------------------------------
Q3J0R2_RHOS4/15-78--------------------------------------------------------------------------------
Q0FAQ5_9RHOB/14-77--------------------------------------------------------------------------------
Q87W43_PSESM/18-82--------------------------------------------------------------------------------
A0NQZ0_9RHOB/15-78--------------------------------------------------------------------------------
B2JHP1_BURP8/15-78--------------------------------------------------------------------------------
Q15VR2_PSEA6/41-104--------------------------------------------------------------------------------
Q1D8Q3_MYXXD/14-78--------------------------------------------------------------------------------
A5V7D8_SPHWW/14-79--------------------------------------------------------------------------------
Q21DJ6_SACD2/14-78--------------------------------------------------------------------------------
Q1YE00_MOBAS/23-86--------------------------------------------------------------------------------
Q65QR7_MANSM/32-95--------------------------------------------------------------------------------
Q5YTA0_NOCFA/14-78--------------------------------------------------------------------------------
Q3AME8_SYNSC/24-88--------------------------------------------------------------------------------
A8LJW3_DINSH/15-78--------------------------------------------------------------------------------
Q129N1_POLSJ/23-84--------------------------------------------------------------------------------
Q0I7X2_SYNS3/15-78--------------------------------------------------------------------------------
A8LL19_DINSH/14-77--------------------------------------------------------------------------------
Q1GHQ7_SILST/14-79--------------------------------------------------------------------------------
Q46KM6_PROMT/19-83--------------------------------------------------------------------------------
Q2C9X6_9RHOB/15-78--------------------------------------------------------------------------------
Q0C383_HYPNA/14-80--------------------------------------------------------------------------------
A7IC73_XANP2/15-78--------------------------------------------------------------------------------
A0R1N9_MYCS2/15-77--------------------------------------------------------------------------------
Q5FU37_GLUOX/15-78--------------------------------------------------------------------------------
Q1LPI6_RALME/15-79--------------------------------------------------------------------------------

PF07110

Q98J67_RHILO/10-91--------------------------------------------------------------------------------
YTH4_RHOER/10-90--------------------------------------------------------------------------------
Q89V09_BRAJA/21-102--------------------------------------------------------------------------------
Q93EX2_9NOCA/10-91--------------------------------------------------------------------------------
Q9KGB0_BACHD/16-96--------------------------------------------------------------------------------
Q884M0_PSESM/10-93--------------------------------------------------------------------------------
Q2N8F2_ERYLH/12-112--------------------------------------------------------------------------------
D0J371_COMT2/26-114--------------------------------------------------------------------------------
Q2UH77_ASPOR/43-139--------------------------------------------------------------------------------
C9S7C3_VERA1/40-151--------------------------------------------------------------------------------
Q0UAA8_PHANO/20-125--------------------------------------------------------------------------------
B6QRR3_PENMQ/18-114--------------------------------------------------------------------------------
C9SY64_VERA1/65-158--------------------------------------------------------------------------------
B8MSU2_TALSN/18-112--------------------------------------------------------------------------------
A5VH99_SPHWW/138-221--------------------------------------------------------------------------------
A5V521_SPHWW/98-177--------------------------------------------------------------------------------
B9K152_AGRVS/13-109--------------------------------------------------------------------------------
B2W3U7_PYRTR/13-127--------------------------------------------------------------------------------
Q0U4N6_PHANO/13-123--------------------------------------------------------------------------------
B2WDV2_PYRTR/13-120--------------------------------------------------------------------------------
Q0U5I6_PHANO/13-111--------------------------------------------------------------------------------
A2QB94_ASPNC/13-115--------------------------------------------------------------------------------
A2QVN7_ASPNC/13-122--------------------------------------------------------------------------------
B8MPG2_TALSN/43-154--------------------------------------------------------------------------------
A6RYK8_BOTFB/14-123--------------------------------------------------------------------------------
Q2UT25_ASPOR/23-122--------------------------------------------------------------------------------
C9Z9Q5_STRSW/12-103--------------------------------------------------------------------------------
A2R8B5_ASPNC/14-111--------------------------------------------------------------------------------
A5VH99_SPHWW/12-106--------------------------------------------------------------------------------
Q396J2_BURS3/130-221--------------------------------------------------------------------------------
A6GBX1_9DELT/12-106--------------------------------------------------------------------------------
C9Z9Q5_STRSW/139-234--------------------------------------------------------------------------------
B5HPI7_9ACTO/138-233--------------------------------------------------------------------------------
A8L3R3_FRASN/10-95--------------------------------------------------------------------------------
A5V7F6_SPHWW/12-99--------------------------------------------------------------------------------
A5V7F6_SPHWW/139-229--------------------------------------------------------------------------------
A4XEJ1_NOVAD/13-101--------------------------------------------------------------------------------
C7Z3Q5_NECH7/37-130--------------------------------------------------------------------------------
Q140F8_BURXL/125-207--------------------------------------------------------------------------------
C8ND54_9GAMM/12-105--------------------------------------------------------------------------------
C2M2M0_CAPGI/12-107--------------------------------------------------------------------------------
Q93AB2_YERPE/18-98--------------------------------------------------------------------------------
B8MF02_TALSN/21-117--------------------------------------------------------------------------------
C8VQ65_EMENI/29-132--------------------------------------------------------------------------------
C5FQT1_ARTOC/22-118--------------------------------------------------------------------------------
Q2GSS6_CHAGB/53-131--------------------------------------------------------------------------------
B8NJL1_ASPFN/19-113--------------------------------------------------------------------------------
C8VTL3_EMENI/15-109--------------------------------------------------------------------------------
Q0UIY9_PHANO/18-106--------------------------------------------------------------------------------
A2QH37_ASPNC/566-663--------------------------------------------------------------------------------
B6QDA9_PENMQ/20-117--------------------------------------------------------------------------------
A2QDU1_ASPNC/19-117--------------------------------------------------------------------------------
B0YAX3_ASPFC/21-118--------------------------------------------------------------------------------
B2WLL6_PYRTR/30-124--------------------------------------------------------------------------------
Q4P1P8_USTMA/29-132--------------------------------------------------------------------------------
C7Z0I7_NECH7/17-115--------------------------------------------------------------------------------
Q9F3V8_9PSEU/12-93--------------------------------------------------------------------------------

PF09448

O51799_CUPNE/2-113--------------------------------------------------------------------------------
Q471R3_CUPPJ/2-113--------------------------------------------------------------------------------
Q7WWV7_CUPNH/2-112--------------------------------------------------------------------------------

PF03927

C6BCZ8_RALP1/19-97--------------------------------------------------------------------------------
Q5E3J5_VIBF1/8-86--------------------------------------------------------------------------------
A0KIM0_AERHH/3-81--------------------------------------------------------------------------------
A8GHJ5_SERP5/4-83--------------------------------------------------------------------------------
Q1Z7G7_PHOPR/4-82--------------------------------------------------------------------------------
A4NJ35_HAEIF/12-91--------------------------------------------------------------------------------
A8H5B1_SHEPA/3-80--------------------------------------------------------------------------------
A8FUK0_SHESH/4-82--------------------------------------------------------------------------------
A1S9X8_SHEAM/3-81--------------------------------------------------------------------------------
A4WZM9_RHOS5/4-81--------------------------------------------------------------------------------
A8G0D7_SHESH/3-81--------------------------------------------------------------------------------
A4BGQ8_9GAMM/12-90--------------------------------------------------------------------------------
Q3HS06_PSEST/3-81--------------------------------------------------------------------------------
Q21PN2_SACD2/9-87--------------------------------------------------------------------------------
A1K384_AZOSB/5-83--------------------------------------------------------------------------------
A3EIL2_VIBCL/16-94--------------------------------------------------------------------------------
Q93HX4_MAGMG/16-95--------------------------------------------------------------------------------
Q6D5Z1_ERWCT/3-82--------------------------------------------------------------------------------
Q7VPJ8_HAEDU/8-87--------------------------------------------------------------------------------
Q9Z3W5_9RHIZ/4-81--------------------------------------------------------------------------------
Q080B9_SHEFN/3-80--------------------------------------------------------------------------------
A7ZP29_ECO24/3-82--------------------------------------------------------------------------------
Q1LFZ4_RALME/17-95--------------------------------------------------------------------------------
A5ED22_BRASB/28-106--------------------------------------------------------------------------------
Q7WIQ2_BORBR/20-98--------------------------------------------------------------------------------
A6WJJ0_SHEB8/3-81--------------------------------------------------------------------------------
A6UJX6_SINMW/6-83--------------------------------------------------------------------------------
A6FC51_9GAMM/4-82--------------------------------------------------------------------------------
Q9Z3V0_RHOSP/37-115--------------------------------------------------------------------------------
E6XM26_SHEP2/3-80--------------------------------------------------------------------------------
Q12P45_SHEDO/3-80--------------------------------------------------------------------------------
A6CVN7_9VIBR/4-82--------------------------------------------------------------------------------
Q0I5G8_HAES1/75-153--------------------------------------------------------------------------------
Q9CKL9_PASMU/11-90--------------------------------------------------------------------------------
A6VQY8_ACTSZ/8-87--------------------------------------------------------------------------------
Q7WXC4_CUPNH/17-95--------------------------------------------------------------------------------
A9CGL4_AGRT5/6-83--------------------------------------------------------------------------------
A1SWQ1_PSYIN/4-82--------------------------------------------------------------------------------
A0NZM7_9RHOB/3-81--------------------------------------------------------------------------------
Q487G3_COLP3/9-87--------------------------------------------------------------------------------
A3USH4_VIBSP/4-82--------------------------------------------------------------------------------
Q13I16_BURXL/16-97--------------------------------------------------------------------------------
A4XWL9_PSEMY/3-81--------------------------------------------------------------------------------
Q9F5L4_BRAJP/32-110--------------------------------------------------------------------------------
B1KH53_SHEWM/3-81--------------------------------------------------------------------------------
A4U4X6_9PROT/17-95--------------------------------------------------------------------------------
Q5P545_AROAE/97-175--------------------------------------------------------------------------------
Q1ZGB7_9GAMM/4-82--------------------------------------------------------------------------------
A7JS88_PASHA/9-88--------------------------------------------------------------------------------
A7N7J4_VIBHB/4-82--------------------------------------------------------------------------------
NAPD_PARPN/28-105--------------------------------------------------------------------------------
A7M679_9PSED/3-81--------------------------------------------------------------------------------
A3QHX3_SHELP/3-81--------------------------------------------------------------------------------
Q02IZ5_PSEAB/3-81--------------------------------------------------------------------------------
O86475_RHOSH/4-81--------------------------------------------------------------------------------
A1JL25_YERE8/4-83--------------------------------------------------------------------------------
A8H065_SHEPA/3-81--------------------------------------------------------------------------------
Q2SGV8_HAHCH/3-81--------------------------------------------------------------------------------
Q47A86_DECAR/2-80--------------------------------------------------------------------------------

PF01037

GRP_ZYMMO/71-144--------------------------------------------------------------------------------
ZRP_ZYMMO/68-141--------------------------------------------------------------------------------
Q92MD2_RHIME/86-156--------------------------------------------------------------------------------
Q7D0A6_AGRT5/69-139--------------------------------------------------------------------------------
Q8XUT3_RALSO/72-151--------------------------------------------------------------------------------
Q6FBR8_ACIAD/74-148--------------------------------------------------------------------------------
Q5UYW6_HALMA/69-139--------------------------------------------------------------------------------
O28651_ARCFU/68-142--------------------------------------------------------------------------------
Q97KE2_CLOAB/74-146--------------------------------------------------------------------------------
Q6LFY1_PHOPR/75-149--------------------------------------------------------------------------------
Q9KKN4_VIBCH/69-143--------------------------------------------------------------------------------
Q88Q35_PSEPK/72-143--------------------------------------------------------------------------------
LRPB_BACSU/69-136--------------------------------------------------------------------------------
Q8ELF6_OCEIH/69-140--------------------------------------------------------------------------------
Q7P0K6_CHRVO/67-134--------------------------------------------------------------------------------
Q5LQ65_SILPO/71-144--------------------------------------------------------------------------------
Q6NDU4_RHOPA/81-154--------------------------------------------------------------------------------
Q8XS36_RALSO/102-176--------------------------------------------------------------------------------
Q6N2H6_RHOPA/71-144--------------------------------------------------------------------------------
REG3_PYRHO/78-149--------------------------------------------------------------------------------
Q9RT71_DEIRA/109-183--------------------------------------------------------------------------------
Q8KJG4_RHILI/76-150--------------------------------------------------------------------------------
PUTR_RHIRD/76-150--------------------------------------------------------------------------------
Q87GT1_VIBPA/66-140--------------------------------------------------------------------------------
Q6LY54_METMP/67-138--------------------------------------------------------------------------------
Q6L2L7_PICTO/21-92--------------------------------------------------------------------------------
Q5V2Q8_HALMA/69-143--------------------------------------------------------------------------------
Q9HQ13_HALSA/69-140--------------------------------------------------------------------------------
Q8E9E7_SHEON/75-150--------------------------------------------------------------------------------
Q7WKQ4_BORBR/91-161--------------------------------------------------------------------------------
Q7WFA6_BORBR/67-141--------------------------------------------------------------------------------
Q8PJL5_XANAC/72-142--------------------------------------------------------------------------------
Q97C07_THEVO/6-77--------------------------------------------------------------------------------
A9CFY0_AGRT5/67-137--------------------------------------------------------------------------------
Q8D573_VIBVU/77-150--------------------------------------------------------------------------------
Q63VD1_BURPS/71-145--------------------------------------------------------------------------------
Q8XQA9_RALSO/69-143--------------------------------------------------------------------------------
Q64MN4_BACFR/70-142--------------------------------------------------------------------------------
Q6A8E6_PROAC/82-152--------------------------------------------------------------------------------
Q9L101_STRCO/68-139--------------------------------------------------------------------------------
Q7TXW4_MYCBO/98-164--------------------------------------------------------------------------------
Q5YPF7_NOCFA/74-144--------------------------------------------------------------------------------
Q98D73_RHILO/70-144--------------------------------------------------------------------------------
Q98F66_RHILO/68-135--------------------------------------------------------------------------------
Q9A2I8_CAUCR/74-148--------------------------------------------------------------------------------
Q9AAL7_CAUCR/79-153--------------------------------------------------------------------------------
Q649E6_9ARCH/43-117--------------------------------------------------------------------------------
Q5LQ72_SILPO/75-142--------------------------------------------------------------------------------
Q8KJC0_RHILI/68-142--------------------------------------------------------------------------------
Q9AHF1_RHIRD/77-151--------------------------------------------------------------------------------
Q9F185_CUPNE/87-161--------------------------------------------------------------------------------
A9CFA2_AGRT5/70-143--------------------------------------------------------------------------------
Q5ZSK0_LEGPH/69-144--------------------------------------------------------------------------------
Q98PB1_RHILO/72-146--------------------------------------------------------------------------------
Q92LN5_RHIME/67-137--------------------------------------------------------------------------------
Q92U21_RHIME/82-152--------------------------------------------------------------------------------
Q88GR4_PSEPK/67-141--------------------------------------------------------------------------------
Q647R1_9ARCH/70-143--------------------------------------------------------------------------------
Q81BC4_BACCR/67-132--------------------------------------------------------------------------------
Q5LX17_SILPO/69-143--------------------------------------------------------------------------------
Q8VM90_RHILV/70-144--------------------------------------------------------------------------------
Q8KCK3_CHLTE/71-142--------------------------------------------------------------------------------
Q7WFT7_BORBR/71-144--------------------------------------------------------------------------------
Q9I287_PSEAE/71-145--------------------------------------------------------------------------------
Q9A5B5_CAUCR/107-181--------------------------------------------------------------------------------
Q5YR66_NOCFA/67-141--------------------------------------------------------------------------------
Q8NMC1_CORGL/75-149--------------------------------------------------------------------------------
Q8J2Y4_PYRAB/6-77--------------------------------------------------------------------------------
Q82QC2_STRAW/71-138--------------------------------------------------------------------------------
Q898A1_CLOTE/78-150--------------------------------------------------------------------------------
Q62M96_BURMA/72-146--------------------------------------------------------------------------------
Q88H33_PSEPK/67-137--------------------------------------------------------------------------------
Q738U3_BACC1/67-132--------------------------------------------------------------------------------
Q88DP7_PSEPK/70-145--------------------------------------------------------------------------------
Q9KYP0_STRCO/82-153--------------------------------------------------------------------------------
Q53106_RHOER/70-140--------------------------------------------------------------------------------
Q9EX07_STRCO/69-139--------------------------------------------------------------------------------
Q74NJ3_NANEQ/8-78--------------------------------------------------------------------------------
Q5UXF0_HALMA/63-134--------------------------------------------------------------------------------
Q7W2M4_BORPA/69-143--------------------------------------------------------------------------------
LYSM_SULTO/67-138--------------------------------------------------------------------------------
Q7VRX6_BORPE/85-159--------------------------------------------------------------------------------
HOSA_SULTO/388-459--------------------------------------------------------------------------------
Q6L0M6_PICTO/71-145--------------------------------------------------------------------------------
Q6HMY8_BACHK/75-147--------------------------------------------------------------------------------
O33467_PSEPU/71-145--------------------------------------------------------------------------------
Q8PGC8_XANAC/74-148--------------------------------------------------------------------------------
Q83SF4_SHIFL/97-171--------------------------------------------------------------------------------
Q7NXB3_CHRVO/75-142--------------------------------------------------------------------------------
Q8XJU9_CLOPE/76-148--------------------------------------------------------------------------------
Q82JE5_STRAW/69-138--------------------------------------------------------------------------------
Y4TD_RHISN/84-158--------------------------------------------------------------------------------
Q9K0L9_NEIMB/99-172--------------------------------------------------------------------------------
Q87PU4_VIBPA/76-146--------------------------------------------------------------------------------
Q5Z126_NOCFA/77-147--------------------------------------------------------------------------------
Q89LX8_BRAJA/73-146--------------------------------------------------------------------------------
Q8Z2Q8_SALTI/72-144--------------------------------------------------------------------------------
Q5LQW1_SILPO/67-141--------------------------------------------------------------------------------
Q65N91_BACLD/69-136--------------------------------------------------------------------------------
Q92XD8_RHIME/73-147--------------------------------------------------------------------------------
Q8FLW4_COREF/255-325--------------------------------------------------------------------------------
Q6SH05_9BACT/70-144--------------------------------------------------------------------------------
Q703X8_THETE/397-468--------------------------------------------------------------------------------
Q5LTP6_SILPO/68-142--------------------------------------------------------------------------------
Q8XVM9_RALSO/69-143--------------------------------------------------------------------------------
Q8PQZ4_XANAC/73-147--------------------------------------------------------------------------------
Q736J6_BACC1/67-134--------------------------------------------------------------------------------
Q62BJ3_BURMA/69-143--------------------------------------------------------------------------------
Q8FVC2_BRUSU/70-144--------------------------------------------------------------------------------
Q8YIT5_BRUME/83-156--------------------------------------------------------------------------------
Q8KM39_MYXXA/69-141--------------------------------------------------------------------------------
O54287_9CREN/75-145--------------------------------------------------------------------------------
Q979E1_THEVO/57-127--------------------------------------------------------------------------------
Q98KG1_RHILO/93-160--------------------------------------------------------------------------------
Q8A556_BACTN/73-147--------------------------------------------------------------------------------
Q7NU65_CHRVO/74-148--------------------------------------------------------------------------------
Q5NMJ8_ZYMMO/67-141--------------------------------------------------------------------------------
Q7VRX9_BORPE/76-153--------------------------------------------------------------------------------
Q6FCQ3_ACIAD/67-137--------------------------------------------------------------------------------
REG6_PYRHO/71-141--------------------------------------------------------------------------------
Q6A5I2_PROAC/64-135--------------------------------------------------------------------------------
Q93HN7_STRAW/79-149--------------------------------------------------------------------------------
P95905_SULSF/75-146--------------------------------------------------------------------------------
Q8ZT22_PYRAE/67-153--------------------------------------------------------------------------------
Q9KFQ5_BACHD/69-136--------------------------------------------------------------------------------
Q63M55_BURPS/72-146--------------------------------------------------------------------------------
Q9RKY4_STRCO/86-156--------------------------------------------------------------------------------
Q89QF0_BRAJA/95-169--------------------------------------------------------------------------------
Q7NH56_GLOVI/75-142--------------------------------------------------------------------------------
Q5WIR4_BACSK/69-136--------------------------------------------------------------------------------
Q82AJ9_STRAW/6-77--------------------------------------------------------------------------------
Q669R6_YERPS/67-134--------------------------------------------------------------------------------
Q7VV34_BORPE/67-140--------------------------------------------------------------------------------
Q63K02_BURPS/70-144--------------------------------------------------------------------------------
REG2_PYRHO/69-142--------------------------------------------------------------------------------
Q9K6T5_BACHD/69-140--------------------------------------------------------------------------------
O29671_ARCFU/66-134--------------------------------------------------------------------------------
Q6AF01_LEIXX/80-150--------------------------------------------------------------------------------
Q98JQ8_RHILO/76-143--------------------------------------------------------------------------------
Q9XAG4_STRCO/72-142--------------------------------------------------------------------------------
Q92PN1_RHIME/74-147--------------------------------------------------------------------------------
O86743_STRCO/86-156--------------------------------------------------------------------------------
Q7VXK7_BORPE/69-143--------------------------------------------------------------------------------
REG7_PYRHO/68-139--------------------------------------------------------------------------------
Q9RK86_STRCO/67-136--------------------------------------------------------------------------------
Q9RXV6_DEIRA/89-157--------------------------------------------------------------------------------
O29606_ARCFU/6-76--------------------------------------------------------------------------------
Q6ANT7_DESPS/69-143--------------------------------------------------------------------------------
REG1_PYRFU/70-146--------------------------------------------------------------------------------
Q6WB88_ALCFA/69-143--------------------------------------------------------------------------------
Q98K63_RHILO/72-146--------------------------------------------------------------------------------
Q9HLH1_THEAC/98-168--------------------------------------------------------------------------------
O29117_ARCFU/70-140--------------------------------------------------------------------------------
Q983I9_RHILO/78-152--------------------------------------------------------------------------------
Q6FZR6_BARQU/62-134--------------------------------------------------------------------------------
Q972L7_SULTO/67-140--------------------------------------------------------------------------------
Q5V2P2_HALMA/69-140--------------------------------------------------------------------------------
Q87GV1_VIBPA/67-140--------------------------------------------------------------------------------
Q8XX00_RALSO/74-141--------------------------------------------------------------------------------
Q987B0_RHILO/72-146--------------------------------------------------------------------------------
Q9A3N3_CAUCR/116-190--------------------------------------------------------------------------------
Q7NT80_CHRVO/75-149--------------------------------------------------------------------------------
Q5LKR4_SILPO/67-141--------------------------------------------------------------------------------
P71888_MYCTU/70-141--------------------------------------------------------------------------------
Q9RIR7_SALCE/71-142--------------------------------------------------------------------------------
Q5LTI9_SILPO/68-142--------------------------------------------------------------------------------
Q7WI06_BORBR/70-144--------------------------------------------------------------------------------
Q88E71_PSEPK/78-152--------------------------------------------------------------------------------
Q82M14_STRAW/244-315--------------------------------------------------------------------------------
Q5LX25_SILPO/67-137--------------------------------------------------------------------------------
Q981V1_RHILO/75-149--------------------------------------------------------------------------------
Q97J19_CLOAB/69-136--------------------------------------------------------------------------------
Q89XH4_BRAJA/78-152--------------------------------------------------------------------------------
Q984M5_RHILO/74-148--------------------------------------------------------------------------------
Q72K70_THET2/6-77--------------------------------------------------------------------------------
Q9HQ33_HALSA/67-138--------------------------------------------------------------------------------
Q93IX1_STRCO/72-139--------------------------------------------------------------------------------
Q975B9_SULTO/71-141--------------------------------------------------------------------------------
Q745M6_MYCPA/252-323--------------------------------------------------------------------------------
Q81BI2_BACCR/73-138--------------------------------------------------------------------------------
Q5LNM4_SILPO/70-143--------------------------------------------------------------------------------
Q93IX5_STRCO/73-147--------------------------------------------------------------------------------
Q92MD5_RHIME/70-144--------------------------------------------------------------------------------
Q9RS40_DEIRA/9-80--------------------------------------------------------------------------------
Q5KVS2_GEOKA/71-145--------------------------------------------------------------------------------
Q5LUB6_SILPO/69-143--------------------------------------------------------------------------------
BKDR_PSEAE/70-144--------------------------------------------------------------------------------
Q8ZX24_PYRAE/6-77--------------------------------------------------------------------------------
Q7X134_PSEFL/67-134--------------------------------------------------------------------------------
O68050_RHOCA/69-139--------------------------------------------------------------------------------
Q8XFM7_RALSO/75-142--------------------------------------------------------------------------------
BKDR_PSEPU/70-143--------------------------------------------------------------------------------
REG8_PYRFU/69-139--------------------------------------------------------------------------------
Q5UZ96_HALMA/68-138--------------------------------------------------------------------------------
REG9_PYRAB/71-145--------------------------------------------------------------------------------
Q5QV65_IDILO/67-141--------------------------------------------------------------------------------
Q7WM72_BORBR/71-145--------------------------------------------------------------------------------
Q5LRE1_SILPO/71-145--------------------------------------------------------------------------------
Q8YCL0_BRUME/71-145--------------------------------------------------------------------------------
Q6D0Y1_ERWCT/70-144--------------------------------------------------------------------------------
Q98N03_RHILO/69-143--------------------------------------------------------------------------------
Q880K0_PSESM/71-145--------------------------------------------------------------------------------
Q8ZWW2_PYRAE/87-153--------------------------------------------------------------------------------
Q986N0_RHILO/91-161--------------------------------------------------------------------------------
Q5X578_LEGPA/88-162--------------------------------------------------------------------------------
Q9HV24_PSEAE/67-134--------------------------------------------------------------------------------
Q6LS33_PHOPR/66-136--------------------------------------------------------------------------------
Q9A4E7_CAUCR/94-165--------------------------------------------------------------------------------
Q89D55_BRAJA/68-142--------------------------------------------------------------------------------
Q6AIZ2_DESPS/68-140--------------------------------------------------------------------------------
Q5LTP5_SILPO/70-144--------------------------------------------------------------------------------
Q88AX2_PSESM/73-147--------------------------------------------------------------------------------
Q8A637_BACTN/72-143--------------------------------------------------------------------------------
A9CJY9_AGRT5/67-141--------------------------------------------------------------------------------
Q826R1_STRAW/74-145--------------------------------------------------------------------------------
Q93FY6_PSEPU/75-145--------------------------------------------------------------------------------
Q9KGA0_BACHD/67-134--------------------------------------------------------------------------------
Q8G6L1_BIFLO/70-140--------------------------------------------------------------------------------
Q6AQ93_DESPS/16-87--------------------------------------------------------------------------------
Q81G47_BACCR/69-136--------------------------------------------------------------------------------
Q5NRK7_ZYMMO/74-148--------------------------------------------------------------------------------
Q6FAP4_ACIAD/69-144--------------------------------------------------------------------------------
Q7VUI7_BORPE/70-140--------------------------------------------------------------------------------
AZLB_BACSU/71-145--------------------------------------------------------------------------------
O28824_ARCFU/64-138--------------------------------------------------------------------------------
Q6NCU7_RHOPA/67-141--------------------------------------------------------------------------------
Q5LMF1_SILPO/70-144--------------------------------------------------------------------------------
Q7TWT2_MYCBO/71-141--------------------------------------------------------------------------------
Q5WDD1_BACSK/69-140--------------------------------------------------------------------------------
Q9XA32_STRCO/57-128--------------------------------------------------------------------------------
Q9A3M5_CAUCR/129-203--------------------------------------------------------------------------------
Q6L1Y9_PICTO/97-167--------------------------------------------------------------------------------
Q6W0Z0_RHISN/69-143--------------------------------------------------------------------------------
Q87WM3_PSESM/56-130--------------------------------------------------------------------------------
Q5NNH9_ZYMMO/73-147--------------------------------------------------------------------------------
PTR1_METJA/68-139--------------------------------------------------------------------------------
Q92NU2_RHIME/68-141--------------------------------------------------------------------------------
LRP_RHIME/73-147--------------------------------------------------------------------------------
Q8XU40_RALSO/70-144--------------------------------------------------------------------------------
Q65G37_BACLD/68-136--------------------------------------------------------------------------------
Y224_HAEIN/85-159--------------------------------------------------------------------------------
Q8Z815_SALTI/78-152--------------------------------------------------------------------------------
Q65E48_BACLD/78-149--------------------------------------------------------------------------------
Q6W241_RHISN/68-142--------------------------------------------------------------------------------
Q64UG5_BACFR/70-144--------------------------------------------------------------------------------
O28868_ARCFU/6-77--------------------------------------------------------------------------------
Q63I71_BURPS/69-143--------------------------------------------------------------------------------
Q62FW3_BURMA/69-143--------------------------------------------------------------------------------
O27261_METTH/78-148--------------------------------------------------------------------------------
Q5LWR4_SILPO/91-158--------------------------------------------------------------------------------
Q9K655_BACHD/67-134--------------------------------------------------------------------------------
Q980N2_SULSO/6-77--------------------------------------------------------------------------------
Q5P347_AROAE/71-145--------------------------------------------------------------------------------
Q8NTP9_CORGL/72-146--------------------------------------------------------------------------------
Q5YZ22_NOCFA/6-77--------------------------------------------------------------------------------
Q92S84_RHIME/6-77--------------------------------------------------------------------------------
Q5LVX6_SILPO/69-143--------------------------------------------------------------------------------
Q6FCJ8_ACIAD/71-145--------------------------------------------------------------------------------
Q9HVR3_PSEAE/69-143--------------------------------------------------------------------------------
Q5LXH4_SILPO/67-141--------------------------------------------------------------------------------
Q97B02_THEVO/67-141--------------------------------------------------------------------------------
Q702E3_9CREN/6-76--------------------------------------------------------------------------------
Q8Y353_RALSO/69-136--------------------------------------------------------------------------------

PF02426

CATC_RHOOP/2-92--------------------------------------------------------------------------------
CATC_PSEPU/1-91--------------------------------------------------------------------------------
CATC1_ACILW/1-91--------------------------------------------------------------------------------
O07243_MYCTU/1-94--------------------------------------------------------------------------------
CATC_ACIAD/1-91--------------------------------------------------------------------------------
O51800_CUPNE/1-91--------------------------------------------------------------------------------
CATC2_ACILW/1-91--------------------------------------------------------------------------------

PF06778

Y3825_BACHD/31-235--------------------------------------------------------------------------------
Q9YFL1_AERPE/27-208--------------------------------------------------------------------------------
Y2021_HALSA/31-240--------------------------------------------------------------------------------
Q8FPI6_COREF/56-245--------------------------------------------------------------------------------
Q8KP26_9RHOO/66-261--------------------------------------------------------------------------------
O69830_STRCO/43-230--------------------------------------------------------------------------------
Y3023_OCEIH/31-235--------------------------------------------------------------------------------
Y2676_MYCTU/30-218--------------------------------------------------------------------------------
YWFI_BACSU/37-240--------------------------------------------------------------------------------
Q9RUB0_DEIRA/82-276--------------------------------------------------------------------------------
Q9HKT8_THEAC/28-211--------------------------------------------------------------------------------
Q97AK5_THEVO/23-209--------------------------------------------------------------------------------
Q97WP2_SULSO/26-213--------------------------------------------------------------------------------
Y358_STAES/31-235--------------------------------------------------------------------------------
Y2113_LISMO/31-237--------------------------------------------------------------------------------

PF04261

Q9KQ59_VIBCH/5-294QTAILPEAGPFALYTLLKVRQNHAHVL....QALKALPALVEE.........................I.NQNQPGAELT
EFEN_BACSU/66-405QAGITTAHQTYVYFAALDVTAKDKSD...IITLFRNWTSLTQMLTSGKKMS..AEQRNQYLPPQDTGESADLS..PSNLT
Q98KG6_RHILO/13-313AQSVDAPLSQSAIFLVVTVAGEQPA........LAKVCSVLGELD...................DLVKTVGFRDLGGRLS
Q9FBY9_STRCO/10-309PQMVLSPLTSAAIFLVVTIDSGG.......EDTVRDLLSDVASLERA.....................VGFRAQPDGRLS
EFEB_ECOLI/61-411QAGILTPQQAAMMLVAFDVLASDKADL...ERLFRLLTQRFAFLTQGGAAP...ETPNPRLPPLDSGILGGYIAP.DNLT
Q9K1P5_NEIMB/60-410QAGIVTPQQAFSIMCAFDVTAQSAKQL...ENLFRTLTARIEFLTQGGEY....QDGDDKLPPAGSGILGKAFN.PDGLT
Q9ZBW9_STRCO/87-434QPGITTPMQARGHLVAFDLAAGAGRKE..AAALLRRWSDTARRLMAGEPAG...........SRDTDVA.RDAG.PSSLT
Q9I078_PSEAE/11-290QPGILTPIPVVGRYLFFSISQPE............QVAATLASLAAA............................TDGYQ
Q9CNH6_PASMU/4-293QSGVLLEHCKAAIYLEANITD...................LTVIPEASRQ............FCDKLAQLQQTYPDARLG
Q9RKQ2_STRCO/65-406QAGIATPVQDRLHFAAFDVTT.EDRAA..FVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEAL.GLKP.SRLT
Q9RH20_ZYMMB/19-318PQAIVTPITPAAIFLVVTLKEGKEA.....EDNIRSFCPDLSALRR......................TVSLRDRDARLT
YFEX_ECOLI/5-296QSGILPEHCRAAIWIEANVK..................GEVDALRAASKT............FADKLATFEAKFPDAHLG
Q9K036_NEIMB/5-299QSAIIPDHAQAGIFIEADFAA.................NRLNDIKAACRAS............LDALTALKARFPDDILG
Q99WN3_STAAM/26-361QPGITTPTQKTCNFVALDLKS.KDRDA..IKAMFKKWTVMADRMMDGDTVG..KTSNNPLMPPVDTGESI.GLG.ASKLT
O07180_MYCTU/8-306PQPILAPLTPAAIFLVATIGAD...GEATVHDALSKISGLVRA.........................IGFR.DPTKHLS

PF13826

Q5B835_EMENI/129-253--------------------------------------------------LIVFHL------------------------
A0YDB6_9GAMM/17-134--------------------------------------------------FVVFLI------------------------
C2ZRM2_BACCE/19-135--------------------------------------------------FVVFII------------------------
A6CKD6_9BACI/18-135--------------------------------------------------LVVFII------------------------
Q7NL77_GLOVI/17-135--------------------------------------------------FVVFLI------------------------
C0ZHQ2_BREBN/17-134--------------------------------------------------FVVFII------------------------
B1XXV3_LEPCP/17-135--------------------------------------------------FVVFII------------------------
A6G876_9DELT/21-138--------------------------------------------------VVVFLT------------------------
D3EAC5_GEOS4/17-135--------------------------------------------------FVVFVI------------------------
C2W9D0_BACCE/18-134--------------------------------------------------FVVFII------------------------
Q65NQ4_BACLD/18-134--------------------------------------------------VVVFVI------------------------
D0L3R6_GORB4/18-133--------------------------------------------------TALFLI------------------------
A8FJ75_BACP2/18-135--------------------------------------------------IVVFII------------------------
Q0SFP1_RHOSR/17-134--------------------------------------------------LVVFLI------------------------
B2IYY5_NOSP7/17-135--------------------------------------------------FIVFLI------------------------
B4D6M5_9BACT/15-132--------------------------------------------------FCVFLI------------------------
Q8ELJ8_OCEIH/18-135--------------------------------------------------IVVFII------------------------
A4TGL1_MYCGI/21-140--------------------------------------------------VVVFLI------------------------
Q9K5Y3_BACHD/18-135--------------------------------------------------VVVFII------------------------
Q82JR6_STRAW/18-140--------------------------------------------------VVVLLI------------------------
C8X6B7_NAKMY/17-134--------------------------------------------------LVVFHI------------------------
C9Z558_STRSW/19-141--------------------------------------------------VVVLLI------------------------
D7B5B0_NOCDD/17-134--------------------------------------------------LVVFHI------------------------
D2SAG2_GEOOG/17-134--------------------------------------------------LTVFLI------------------------
D2Q510_KRIFD/15-133--------------------------------------------------LVVFLI------------------------
C6XKE2_HIRBI/17-135--------------------------------------------------FVVFLT------------------------
Q49UK4_STAS1/14-130--------------------------------------------------VTVFLI------------------------
D2RPK7_HALTV/35-154--------------------------------------------------IVVFHI------------------------
A1R2W1_ARTAT/19-136--------------------------------------------------VTVFLI------------------------
Q5WGK6_BACSK/15-132--------------------------------------------------VVIFIV------------------------
B1YGH8_EXIS2/12-125--------------------------------------------------IVVFII------------------------
A6R852_AJECN/119-243--------------------------------------------------LVVFLI------------------------
D5UWZ5_TSUPD/14-139--------------------------------------------------LVVFLL------------------------
C0PC33_MAIZE/119-243--------------------------------------------------IVVFHL------------------------
Q2TWA6_ASPOR/121-245--------------------------------------------------IVVFHL------------------------
B6QJL8_PENMQ/116-242--------------------------------------------------VVVLFL------------------------
Q0CTD2_ASPTN/81-205--------------------------------------------------IVVFHL------------------------
Q2GR33_CHAGB/122-248--------------------------------------------------VVVLHL------------------------
C7YU85_NECH7/113-235--------------------------------------------------VVVFNL------------------------
B8MRW9_TALSN/40-166--------------------------------------------------IVVLLL------------------------
A1DA85_NEOFI/113-235--------------------------------------------------VVVFHL------------------------
B7KQ80_METC4/27-137--------------------------------------------------LVVVYL------------------------
Q7S613_NEUCR/120-245--------------------------------------------------IVVFHL------------------------
Q01W86_SOLUE/18-128--------------------------------------------------LVVIYL------------------------
A5G2Z4_ACICJ/18-128--------------------------------------------------LTVVYL------------------------
B1LSK9_METRJ/27-140--------------------------------------------------LVVIYL------------------------
B0U9U6_METS4/19-131--------------------------------------------------LVVMYL------------------------
B8EMQ3_METSB/15-128--------------------------------------------------LVVMML------------------------

PF13816

C7Z148_NECH7/36-347--------------------------------------------------TAYIGIQKHSNDQA....TSDAQKEATSAI
Q5B890_EMENI/325-643--------------------------------------------------LAVFGIQRLEANN..........A...NLL
C9STN6_VERA1/45-354--------------------------------------------------LAVVGAQYPSASRN........DGNAIKAV
Q4VYU2_RHIRD/43-343--------------------------------------------------MGYFGIQYYGE.EK........KPEALAAL
C0ZVD3_RHOE4/60-360--------------------------------------------------MGYLGVQFRGE.DQ........RSAALQSM
B8NPL1_ASPFN/36-350--------------------------------------------------TTYIGVQRHHG.......LDIGLTKCLAAI
Q6FBU3_ACIAD/43-342--------------------------------------------------MAYFGVQFKSE..Q........KAIALKAM
C3KC36_PSEFS/43-343--------------------------------------------------MAYLGVQYRGD.AQ........REPALQAM
Q1BN36_BURCA/43-343--------------------------------------------------MGYFGVQYSGA.DK........RAAALAAL
A1CY61_NEOFI/6-331--------------------------------------------------TAYVGVQRRGAQTD.EGLLTESVNAAVESI
C9SXX8_VERA1/36-349--------------------------------------------------TAYIGVQRHAADEP....CLRADAQIASAI
Q500U2_PSEU2/43-341--------------------------------------------------MAYFGVQ.....SL........HPVGLPEL
C5CKL2_VARPS/43-346--------------------------------------------------MGYFGVQSRGA.GM........QGRACAAL
D4DHU0_TRIVH/55-363--------------------------------------------------MAIIGAQYASAAGN........DGAAISKI
Q0U2P3_PHANO/36-345--------------------------------------------------TAYIGVQQHIDDNE....AANSAAQAIQQV
Q2WG72_GIBZA/14-329--------------------------------------------------VSVFGCQYHSEAP..........SVEKTEL
C5G803_AJEDR/44-352--------------------------------------------------MAVVGAQYSTPTDE........DGLAMSTV
OXD_BACSX/28-329--------------------------------------------------FAQIGIQSKSL............DHAAEHL
A1CFW9_ASPCL/35-358--------------------------------------------------TAYIGVQDRESCANGQPIHNKAYQDAVEAI
Q0CF39_ASPTN/14-333--------------------------------------------------LAVFGCQYHGLQP..........NASKSAL
B1KM99_SHEWM/29-326--------------------------------------------------CGLFAIQGQHSAPL........DDWAKKA.
C1H9S7_PARBA/44-352--------------------------------------------------MAVIGAQYAASPEE........DGSAMSTL
A1R5Y5_ARTAT/54-350--------------------------------------------------CAFLGVQSRAPLSH........EAKVASAG
A5V4Y9_SPHWW/43-337--------------------------------------------------MASYGVQGRES.GD........VAAALAHV
A7IFL4_XANP2/39-340--------------------------------------------------CAYFGLQGQDLAWD...........EQKAF
C6WDR0_ACTMD/39-337--------------------------------------------------VARFGVQTDDS............AAGVKAI
A5EKU7_BRASB/43-335--------------------------------------------------MAYFGVQYRAE............TPAAAST
B2WMJ9_PYRTR/6-318--------------------------------------------------MAIMGAQHACTIGA........DSAGISTI
C7ZFH7_NECH7/15-326--------------------------------------------------YGIYGIQYQGQSP..........SGRQLDL
C5FDU1_ARTOC/81-390--------------------------------------------------MAIIGAQYSSAAEN........DGVAMSKV
B8NMG3_ASPFN/16-332--------------------------------------------------YTLFGVQQPDDVQ..........SPATENL
F0QD95_ACIAP/43-343--------------------------------------------------MAYFGIQYQGE.AQ........KPRALAVL
Q0C7P1_ASPTN/35-346--------------------------------------------------TAYIGIQQHDDSAA....GQDAFRTAADVV

PF07876

Q748N1_GEOSL/2-96--------------------------------------------------------------------------------
A9CJX0_AGRT5/2-102--------------------------------------------------------------------------------
Q740A8_MYCPA/82-179--------------------------------------------------------------------------------
Q7S333_NEUCR/57-160--------------------------------------------------------------------------------
Q98H26_RHILO/2-102--------------------------------------------------------------------------------
Y4036_STRCO/2-97--------------------------------------------------------------------------------
Q89RS9_BRAJA/5-102--------------------------------------------------------------------------------
Q9AMS9_BRAJP/2-94--------------------------------------------------------------------------------
Q9SYD8_ARATH/116-206--------------------------------------------------------------------------------
Q9SYD8_ARATH/5-102--------------------------------------------------------------------------------
Q8XM37_CLOPE/2-100--------------------------------------------------------------------------------
O80887_ARATH/57-152--------------------------------------------------------------------------------
Q98BN1_RHILO/2-96--------------------------------------------------------------------------------
Q6J6I3_ENTCL/2-99--------------------------------------------------------------------------------
Q41049_9ROSI/9-107--------------------------------------------------------------------------------
Q7MWG5_PORGI/2-100--------------------------------------------------------------------------------
Q7UFZ5_RHOBA/16-113--------------------------------------------------------------------------------
Q8G2X5_BRUSU/2-94--------------------------------------------------------------------------------
POP3_ARATH/8-104--------------------------------------------------------------------------------
Y5258_ARATH/6-100--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/40-141--------------------------------------------------------------------------------
Q7N2N7_PHOLL/12-107--------------------------------------------------------------------------------
Q9SIP1_ARATH/158-254--------------------------------------------------------------------------------
Q7WCF6_BORPA/2-96--------------------------------------------------------------------------------
Q7SEW8_NEUCR/10-117--------------------------------------------------------------------------------
Q9FDL1_ZYMMB/42-154--------------------------------------------------------------------------------
Q27103_TRYVI/1-105--------------------------------------------------------------------------------
Q9ZA13_PSEHY/291-383--------------------------------------------------------------------------------
Q7D0A2_AGRT5/2-93--------------------------------------------------------------------------------
Q42482_9ROSI/16-112--------------------------------------------------------------------------------
Q84FK9_ENTAG/2-99--------------------------------------------------------------------------------
Q726I9_DESVH/2-101--------------------------------------------------------------------------------
O80887_ARATH/172-247--------------------------------------------------------------------------------
Q7URH4_RHOBA/33-129--------------------------------------------------------------------------------
Q97LN9_CLOAB/2-94--------------------------------------------------------------------------------
Q6LGQ4_PHOPR/2-98--------------------------------------------------------------------------------
Q8KCZ4_CHLTE/2-100--------------------------------------------------------------------------------
Q7S418_NEUCR/3-107--------------------------------------------------------------------------------
Q6PWS2_9GAMM/35-133--------------------------------------------------------------------------------
Q8ABC5_BACTN/2-99--------------------------------------------------------------------------------
Q6LYV0_METMP/2-100--------------------------------------------------------------------------------
Q82QQ6_STRAW/2-93--------------------------------------------------------------------------------
Q9F304_STRCO/2-93--------------------------------------------------------------------------------
Q9SIP1_ARATH/49-144--------------------------------------------------------------------------------
Q8RF81_FUSNN/2-98--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/154-248--------------------------------------------------------------------------------
Q9A628_CAUCR/2-100--------------------------------------------------------------------------------
Q93NG5_ARTNI/9-103--------------------------------------------------------------------------------
Q7XBH1_ORYSJ/11-107--------------------------------------------------------------------------------
Q7W8L7_BORPA/4-98--------------------------------------------------------------------------------
O31026_VIBCL/2-98--------------------------------------------------------------------------------

PF03992

YETG_BACSU/1-78--------------------------------------------------------------------------------
Q930A7_RHIME/30-107--------------------------------------------------------------------------------
Q9L164_STRCO/44-120--------------------------------------------------------------------------------
Q9AE39_RHILE/1-81--------------------------------------------------------------------------------
Q930L9_RHIME/3-79--------------------------------------------------------------------------------
ISDG_LISMO/1-86--------------------------------------------------------------------------------
WH42_STRCO/45-121--------------------------------------------------------------------------------
ISDG_STAAW/2-79--------------------------------------------------------------------------------
Q8Y476_LISMO/1-77--------------------------------------------------------------------------------
Q98L66_RHILO/1-81--------------------------------------------------------------------------------
Q98HA4_RHILO/1-77--------------------------------------------------------------------------------
Q9A6W1_CAUCR/113-186--------------------------------------------------------------------------------
O33291_MYCTU/2-75--------------------------------------------------------------------------------
Q9L4Y0_9ACTO/10-86--------------------------------------------------------------------------------
Q8YAL6_LISMO/1-77--------------------------------------------------------------------------------
Q9S457_SALTM/1-77--------------------------------------------------------------------------------
Q5LR19_SILPO/12-92--------------------------------------------------------------------------------
NECA1_HUMAN/251-326--------------------------------------------------------------------------------
Q8XYB2_RALSO/23-99--------------------------------------------------------------------------------
Q9CLF6_PASMU/1-77--------------------------------------------------------------------------------
Q8KSW0_9ACTO/5-83--------------------------------------------------------------------------------
Q8NLF1_CORGL/2-78--------------------------------------------------------------------------------
O06569_MYCTU/1-77--------------------------------------------------------------------------------
Q8NRX5_CORGL/1-76--------------------------------------------------------------------------------
Q9I1R9_PSEAE/4-80--------------------------------------------------------------------------------
O32459_9ACTO/5-81--------------------------------------------------------------------------------
Q9I267_PSEAE/43-119--------------------------------------------------------------------------------
Q9RTW6_DEIRA/23-100--------------------------------------------------------------------------------
Q9RXN8_DEIRA/1-77--------------------------------------------------------------------------------
Q9FC02_STRCO/14-92--------------------------------------------------------------------------------
Q9K649_BACHD/1-78--------------------------------------------------------------------------------
Q92MY2_RHIME/1-77--------------------------------------------------------------------------------
O54259_STRNO/13-88--------------------------------------------------------------------------------
ISDG_BACHD/1-78--------------------------------------------------------------------------------
Q8KY33_STRCU/4-79--------------------------------------------------------------------------------
Q9RX23_DEIRA/3-80--------------------------------------------------------------------------------
Q9ESB4_RAT/251-326--------------------------------------------------------------------------------
Q92N21_RHIME/1-81--------------------------------------------------------------------------------
Q99IW7_9BACT/1-74--------------------------------------------------------------------------------
SCHA_STRHA/23-99--------------------------------------------------------------------------------
NECA2_HUMAN/285-360--------------------------------------------------------------------------------
Q8XW80_RALSO/11-88--------------------------------------------------------------------------------
Q9HY51_PSEAE/4-80--------------------------------------------------------------------------------
O68922_9ACTO/6-81--------------------------------------------------------------------------------
Q97V29_SULSO/1-78--------------------------------------------------------------------------------
Y1783_SYNY3/49-125--------------------------------------------------------------------------------
Q53908_STRCH/10-88--------------------------------------------------------------------------------
O06156_MYCTU/2-78--------------------------------------------------------------------------------
A9CGS9_AGRT5/10-86--------------------------------------------------------------------------------
Y2021_HALSA/401-477--------------------------------------------------------------------------------
Q8UIT6_AGRT5/6-83--------------------------------------------------------------------------------
Q9XAT7_RHOER/8-84--------------------------------------------------------------------------------
Q8NRX6_CORGL/1-76--------------------------------------------------------------------------------
Q93HM4_STRAW/16-92--------------------------------------------------------------------------------
Q9ABN2_CAUCR/2-78--------------------------------------------------------------------------------
Q9YCC3_AERPE/2-78--------------------------------------------------------------------------------
Q8TTU6_METAC/1-76--------------------------------------------------------------------------------
Q8PWK2_METMA/2-78--------------------------------------------------------------------------------
CURD_STRCN/16-90--------------------------------------------------------------------------------
Q9X9W3_STRCO/128-214--------------------------------------------------------------------------------
O54100_STRCO/29-106--------------------------------------------------------------------------------
Q9CFE4_LACLA/2-80--------------------------------------------------------------------------------
Q92Y06_RHIME/4-80--------------------------------------------------------------------------------
YQJZ_BACSU/12-86--------------------------------------------------------------------------------
Q8PEE0_XANCP/7-83--------------------------------------------------------------------------------
A9CLL3_AGRT5/1-78--------------------------------------------------------------------------------
Q9FD14_STRCU/8-84--------------------------------------------------------------------------------
Q9HYL5_PSEAE/1-78--------------------------------------------------------------------------------
Q7CRR7_AGRT5/5-81--------------------------------------------------------------------------------
Q8YJD4_BRUME/1-77--------------------------------------------------------------------------------
Q9HHS4_HALSA/1-77--------------------------------------------------------------------------------
Q9I5L9_PSEAE/2-79--------------------------------------------------------------------------------
TCMH_STRGA/10-86--------------------------------------------------------------------------------
Q54813_STRPE/13-95--------------------------------------------------------------------------------
Q8KL47_RHIEC/8-84--------------------------------------------------------------------------------
Q8KSV9_9ACTO/5-80--------------------------------------------------------------------------------
LSRG_ECOLI/1-77--------------------------------------------------------------------------------
Q98HP0_RHILO/1-74--------------------------------------------------------------------------------
Q8Y824_LISMO/4-80--------------------------------------------------------------------------------
Q9I6L9_PSEAE/2-78--------------------------------------------------------------------------------
Q8YC27_BRUME/1-81--------------------------------------------------------------------------------
ISDI_STAAM/1-78--------------------------------------------------------------------------------
Q9KLV5_VIBCH/1-77--------------------------------------------------------------------------------
YGIN_SHIFL/1-87--------------------------------------------------------------------------------
Q983R7_RHILO/10-88--------------------------------------------------------------------------------
O32458_9ACTO/9-85--------------------------------------------------------------------------------
NECA3_HUMAN/295-370--------------------------------------------------------------------------------
Q8NMA1_CORGL/2-78--------------------------------------------------------------------------------
Q9RSM4_DEIRA/18-94--------------------------------------------------------------------------------
O86332_MYCTU/4-79--------------------------------------------------------------------------------
Q9JYI1_NEIMB/3-79--------------------------------------------------------------------------------
Q9A6G2_CAUCR/1-78--------------------------------------------------------------------------------
Q97SM8_STRPN/11-89--------------------------------------------------------------------------------
Q9I1K5_PSEAE/247-321--------------------------------------------------------------------------------
Q97DS8_CLOAB/1-78--------------------------------------------------------------------------------
Q927R5_LISIN/1-77--------------------------------------------------------------------------------
Q9X5D6_ZYMMB/6-82--------------------------------------------------------------------------------
Q9L552_9ACTO/13-88--------------------------------------------------------------------------------
Q9CHY3_LACLA/1-77--------------------------------------------------------------------------------
A9CJ79_AGRT5/1-77--------------------------------------------------------------------------------
Q8NUM1_STAAW/43-119--------------------------------------------------------------------------------
Q98DQ1_RHILO/1-77--------------------------------------------------------------------------------
YHGC_BACSU/65-140--------------------------------------------------------------------------------
YCZJ_BACSU/1-78--------------------------------------------------------------------------------
Q9RSI3_DEIRA/10-86--------------------------------------------------------------------------------
Q93LN2_FLAJO/1-77--------------------------------------------------------------------------------
Q92VV2_RHIME/1-77--------------------------------------------------------------------------------
Q8RDZ4_FUSNN/112-188--------------------------------------------------------------------------------
Q93SH3_BRAJP/1-79--------------------------------------------------------------------------------
A9CHT4_AGRT5/1-79--------------------------------------------------------------------------------
Q9RKA2_STRCO/1-77--------------------------------------------------------------------------------
Q9ZBJ4_STRCO/2-77--------------------------------------------------------------------------------
Q9RX69_DEIRA/1-77--------------------------------------------------------------------------------
YCNE_BACSU/1-77--------------------------------------------------------------------------------

PF11695

A3K1D6_9RHOB/5-147--------------------------------------------------------------------------------
A3UM10_VIBSP/3-142--------------------------------------------------------------------------------
A4ELL4_9RHOB/3-145--------------------------------------------------------------------------------
Q9A5F4_CAUCR/31-169--------------------------------------------------------------------------------
A4XU80_PSEMY/15-153--------------------------------------------------------------------------------
A0P3D7_9RHOB/6-156--------------------------------------------------------------------------------
Q0RBQ9_FRAAA/10-154--------------------------------------------------------------------------------
A3VI98_9RHOB/8-150--------------------------------------------------------------------------------
Q1KY61_9BURK/6-145--------------------------------------------------------------------------------
Q2JDS7_FRASC/6-149--------------------------------------------------------------------------------
A1K291_AZOSB/3-141--------------------------------------------------------------------------------
A2TR58_9FLAO/5-145--------------------------------------------------------------------------------
B0T5Z4_CAUSK/7-145--------------------------------------------------------------------------------
Q027R7_SOLUE/5-144--------------------------------------------------------------------------------
A4FAH4_SACEN/6-146--------------------------------------------------------------------------------
Q2CEG7_9RHOB/3-154--------------------------------------------------------------------------------
Q9XAE9_STRCO/9-148--------------------------------------------------------------------------------
A9B229_HERA2/6-144--------------------------------------------------------------------------------
A4CB40_9GAMM/3-142--------------------------------------------------------------------------------
E0TC84_PARBH/7-147--------------------------------------------------------------------------------
Q2CA10_9RHOB/6-148--------------------------------------------------------------------------------
Q0RPH8_FRAAA/6-149--------------------------------------------------------------------------------
A4BK13_9GAMM/5-143--------------------------------------------------------------------------------
Q0APS8_MARMM/5-140--------------------------------------------------------------------------------
Q163R1_ROSDO/8-150--------------------------------------------------------------------------------
Q0BYF9_HYPNA/5-156--------------------------------------------------------------------------------
A1WRH2_VEREI/5-144--------------------------------------------------------------------------------
A5VYW1_PSEP1/5-142--------------------------------------------------------------------------------
A3JUK4_9RHOB/9-148--------------------------------------------------------------------------------
A0NQQ0_9RHOB/7-146--------------------------------------------------------------------------------
A5FB02_FLAJ1/6-148--------------------------------------------------------------------------------
A3XCS8_9RHOB/4-143--------------------------------------------------------------------------------
Q15UR5_PSEA6/3-142--------------------------------------------------------------------------------
B1KJR7_SHEWM/10-149--------------------------------------------------------------------------------

PF07682

Q972K4_SULTO/2-304--------------------------------------------------------------------------------
O66762_AQUAE/7-333--------------------------------------------------------------------------------
Q977W3_9CREN/2-304--------------------------------------------------------------------------------

PF07978

Q7PGV6_ANOGA/173-270--------------------------------------------------------------------------------
Q7SGJ2_NEUCR/232-329--------------------------------------------------------------------------------
Q5LMH4_SILPO/1-102--------------------------------------------------------------------------------
Q6W252_RHISN/3-102--------------------------------------------------------------------------------
Q7ZWJ6_DANRE/154-253--------------------------------------------------------------------------------
Q7A8Q2_ECO57/4-98--------------------------------------------------------------------------------
Q98EJ3_RHILO/1-102--------------------------------------------------------------------------------
Q89P12_BRAJA/7-101--------------------------------------------------------------------------------
Q89KU9_BRAJA/3-106--------------------------------------------------------------------------------
Q8GHL5_PSERE/107-204--------------------------------------------------------------------------------
Q8P3X3_XANCP/13-105--------------------------------------------------------------------------------
Q82QD1_STRAW/4-107--------------------------------------------------------------------------------
NIPS2_MOUSE/182-279--------------------------------------------------------------------------------
Q98DQ0_RHILO/2-103--------------------------------------------------------------------------------
Q98IN9_RHILO/48-151--------------------------------------------------------------------------------
Q89JD9_BRAJA/9-109--------------------------------------------------------------------------------
Q5M949_RAT/37-136--------------------------------------------------------------------------------
Q7VX89_BORPE/3-102--------------------------------------------------------------------------------
Q9L992_VIBMI/3-103--------------------------------------------------------------------------------
Q8FYG5_BRUSU/1-102--------------------------------------------------------------------------------
Q983U2_RHILO/146-257--------------------------------------------------------------------------------
Q8GHL5_PSERE/5-96--------------------------------------------------------------------------------
NIPS1_MOUSE/185-282--------------------------------------------------------------------------------
Q6DJ76_XENTR/46-144--------------------------------------------------------------------------------
Q88JP3_PSEPK/3-104--------------------------------------------------------------------------------
Q6C7U3_YARLI/393-490--------------------------------------------------------------------------------
Q5M949_RAT/146-245--------------------------------------------------------------------------------
Q89P26_BRAJA/3-96--------------------------------------------------------------------------------
Q89P26_BRAJA/107-202--------------------------------------------------------------------------------
Q983U2_RHILO/19-118--------------------------------------------------------------------------------
A9CLJ4_AGRT5/3-102--------------------------------------------------------------------------------
NPS3A_PONAB/37-136--------------------------------------------------------------------------------
A9CJ80_AGRT5/1-102--------------------------------------------------------------------------------
Q6DJ76_XENTR/154-253--------------------------------------------------------------------------------
Q9R6I8_RHIRD/8-124--------------------------------------------------------------------------------
YMQ1_CAEEL/427-524--------------------------------------------------------------------------------
Q63UF8_BURPS/3-102--------------------------------------------------------------------------------
Q7ZWJ6_DANRE/45-143--------------------------------------------------------------------------------
Q6N5T9_RHOPA/71-174--------------------------------------------------------------------------------
Q9PU59_DANRE/177-274--------------------------------------------------------------------------------
Q9AH04_RHOER/3-100--------------------------------------------------------------------------------
Q7UP06_RHOBA/160-263--------------------------------------------------------------------------------

PF05336

Q7CTD6_AGRT5/2-109--------------------------------------------------------------------------------
Q7CW72_AGRT5/2-109--------------------------------------------------------------------------------
RHAM_MANSM/2-104--------------------------------------------------------------------------------
RHAM_OCEIH/2-104--------------------------------------------------------------------------------
RHAM_RHILO/3-105--------------------------------------------------------------------------------
RHAM_VEREI/4-106--------------------------------------------------------------------------------
RHAM_ENT38/2-104--------------------------------------------------------------------------------
B8G8A8_CHLAD/2-107--------------------------------------------------------------------------------
Q0U0I1_PHANO/9-125--------------------------------------------------------------------------------
Q2CGS4_9RHOB/3-103--------------------------------------------------------------------------------
RHAM_RHIL3/4-106--------------------------------------------------------------------------------
Q5YUK3_NOCFA/6-109--------------------------------------------------------------------------------
Q9RD70_STRCO/2-106--------------------------------------------------------------------------------
RHAM_ROSDO/3-105--------------------------------------------------------------------------------
RHAM_CLOB8/2-104--------------------------------------------------------------------------------
A6UJC5_SINMW/2-109--------------------------------------------------------------------------------
Q2CD72_9RHOB/2-104--------------------------------------------------------------------------------
B2TGR4_BURPP/1-110--------------------------------------------------------------------------------
Q01TX0_SOLUE/2-105--------------------------------------------------------------------------------
A5FI86_FLAJ1/2-110--------------------------------------------------------------------------------
A1CPH6_ASPCL/5-116--------------------------------------------------------------------------------
A1RB67_ARTAT/3-104--------------------------------------------------------------------------------
Q1J3P3_DEIGD/11-115--------------------------------------------------------------------------------
Q9HK61_THEAC/1-101--------------------------------------------------------------------------------
RHAM_BACSU/2-104--------------------------------------------------------------------------------
Q7SE90_NEUCR/56-169--------------------------------------------------------------------------------
Q0S9A0_RHOSR/2-105--------------------------------------------------------------------------------
A1ULG3_MYCSK/7-108--------------------------------------------------------------------------------
A0M226_GRAFK/5-115--------------------------------------------------------------------------------
RHAM_BACTN/2-104--------------------------------------------------------------------------------
Q55IY9_CRYNB/18-130--------------------------------------------------------------------------------
Q9RC86_BACHO/5-108--------------------------------------------------------------------------------
Q4EHA7_LISMN/2-104--------------------------------------------------------------------------------
Q0FS08_9RHOB/4-106--------------------------------------------------------------------------------
RHAM_YERPE/2-104--------------------------------------------------------------------------------
Q8A896_BACTN/18-128--------------------------------------------------------------------------------
RHAM_CLOPH/2-104--------------------------------------------------------------------------------
A0NP38_9RHOB/2-104--------------------------------------------------------------------------------
Q017X5_OSTTA/19-126--------------------------------------------------------------------------------
A0RPU5_CAMFF/262-367--------------------------------------------------------------------------------
A1WK61_VEREI/2-109--------------------------------------------------------------------------------
RHAM_ERWCT/2-104--------------------------------------------------------------------------------
RHAM_BURPP/2-104--------------------------------------------------------------------------------
A0K063_ARTS2/1-107--------------------------------------------------------------------------------
A1RAY8_ARTAT/1-104--------------------------------------------------------------------------------
RHAM_FLAJ1/5-107--------------------------------------------------------------------------------
RHAM_LACS1/3-108--------------------------------------------------------------------------------
Q0PB25_CAMJE/2-105--------------------------------------------------------------------------------
RHAM_BACSK/2-104--------------------------------------------------------------------------------
Q1GLV0_SILST/2-109--------------------------------------------------------------------------------
Q986Z5_RHILO/2-109--------------------------------------------------------------------------------
Q0G1U8_9RHIZ/12-114--------------------------------------------------------------------------------
Q0C0B4_HYPNA/2-109--------------------------------------------------------------------------------
A0QQ10_MYCS2/2-106--------------------------------------------------------------------------------
Q9RJV5_STRCO/8-113--------------------------------------------------------------------------------
Q826A8_STRAW/1-104--------------------------------------------------------------------------------
RHAM_LACPL/2-104--------------------------------------------------------------------------------
RHAM_JANSC/2-104--------------------------------------------------------------------------------
RHAM_AGRT5/5-107--------------------------------------------------------------------------------
RHAM_BURCH/2-104--------------------------------------------------------------------------------
RHAM_ACICJ/2-104--------------------------------------------------------------------------------

PF05949

A4XI07_CALS8/93-243--------------------------------------------------------------------------------
YLXW_BACSU/89-226--------------------------------------------------------------------------------
YLXX_BACSU/83-233--------------------------------------------------------------------------------
A0LU92_ACIC1/145-295--------------------------------------------------------------------------------
A3TKX2_9MICO/127-287--------------------------------------------------------------------------------
A1SK85_NOCSJ/127-266--------------------------------------------------------------------------------
A6WCM5_KINRD/131-288--------------------------------------------------------------------------------
A0QGP0_MYCA1/147-305--------------------------------------------------------------------------------
A1KJN5_MYCBP/147-305--------------------------------------------------------------------------------
A0QYG6_MYCS2/148-306--------------------------------------------------------------------------------
A1T9U1_MYCVP/136-294--------------------------------------------------------------------------------
Q1B829_MYCSS/143-301--------------------------------------------------------------------------------
Q0SI94_RHOSR/127-284--------------------------------------------------------------------------------
Q8G9N0_RHOFA/126-281--------------------------------------------------------------------------------
A8KY04_FRASN/136-295--------------------------------------------------------------------------------
A7BCD9_9ACTO/130-277--------------------------------------------------------------------------------
Q6A8T9_PROAC/110-254--------------------------------------------------------------------------------
A7A5S8_BIFAD/121-280--------------------------------------------------------------------------------
Q8G697_BIFLO/165-324--------------------------------------------------------------------------------
A0LQT1_ACIC1/85-241--------------------------------------------------------------------------------
A8LWH0_SALAI/110-266--------------------------------------------------------------------------------
Q0RB08_FRAAA/88-247--------------------------------------------------------------------------------
Q2J4K8_FRASC/167-328--------------------------------------------------------------------------------
A8LCG0_FRASN/122-286--------------------------------------------------------------------------------
A6W3X9_KINRD/92-247--------------------------------------------------------------------------------
A3TN20_9MICO/92-247--------------------------------------------------------------------------------
Q82FC4_STRAW/110-269--------------------------------------------------------------------------------
Q6ABC5_PROAC/122-276--------------------------------------------------------------------------------
A0PKC5_MYCUA/85-242--------------------------------------------------------------------------------
A4KN44_MYCTU/100-257--------------------------------------------------------------------------------
Q1BG49_MYCSS/116-273--------------------------------------------------------------------------------
A0ZZD3_BIFAA/87-247--------------------------------------------------------------------------------
Q8G6P6_BIFLO/94-254--------------------------------------------------------------------------------
A1SCN6_NOCSJ/110-267--------------------------------------------------------------------------------
Q251Q0_DESHY/89-241--------------------------------------------------------------------------------
A9AXV7_HERA2/93-248--------------------------------------------------------------------------------
A4J2B7_DESRM/82-226--------------------------------------------------------------------------------
A5D137_PELTS/88-234--------------------------------------------------------------------------------
Q3AAF2_CARHZ/83-228--------------------------------------------------------------------------------
Q67L65_SYMTH/79-224--------------------------------------------------------------------------------
A6P1Q7_9FIRM/94-243--------------------------------------------------------------------------------
Q2RGA3_MOOTA/82-238--------------------------------------------------------------------------------
A6CTV4_9BACI/94-231--------------------------------------------------------------------------------
Q2B4P0_9BACI/100-237--------------------------------------------------------------------------------
Q65JX7_BACLD/88-225--------------------------------------------------------------------------------
Q5L0X4_GEOKA/92-229--------------------------------------------------------------------------------
Q9K9T3_BACHD/98-239--------------------------------------------------------------------------------
A0Q065_CLONN/89-243--------------------------------------------------------------------------------
A5N7F2_CLOK5/89-240--------------------------------------------------------------------------------
A7FQ29_CLOB1/87-241--------------------------------------------------------------------------------
Q894C4_CLOTE/87-241--------------------------------------------------------------------------------
Q97H91_CLOAB/88-246--------------------------------------------------------------------------------
Q0SRW9_CLOPS/87-241--------------------------------------------------------------------------------
A6LTT1_CLOB8/87-240--------------------------------------------------------------------------------
B8I727_CLOCE/90-232--------------------------------------------------------------------------------
A3DEC8_CLOTH/87-233--------------------------------------------------------------------------------
A3DEC9_CLOTH/87-236--------------------------------------------------------------------------------
A4IM11_GEOTN/83-232--------------------------------------------------------------------------------
A6CTV5_9BACI/80-233--------------------------------------------------------------------------------
Q2B4N9_9BACI/85-238--------------------------------------------------------------------------------
Q9K9T4_BACHD/82-232--------------------------------------------------------------------------------
A8FCY5_BACP2/83-233--------------------------------------------------------------------------------
Q65JX6_BACLD/83-233--------------------------------------------------------------------------------
A6TMJ2_ALKMQ/87-232--------------------------------------------------------------------------------
A8MIM5_ALKOO/74-221--------------------------------------------------------------------------------
Q180E1_CLOD6/78-226--------------------------------------------------------------------------------
A6TKZ4_ALKMQ/88-242--------------------------------------------------------------------------------
A6TS58_ALKMQ/88-242--------------------------------------------------------------------------------
Q182Y3_CLOD6/85-232--------------------------------------------------------------------------------
Q251P9_DESHY/84-225--------------------------------------------------------------------------------
A1HU46_9FIRM/75-225--------------------------------------------------------------------------------
B0KDA6_THEP3/93-243--------------------------------------------------------------------------------
Q8R9G9_THETN/86-236--------------------------------------------------------------------------------
A4J2B6_DESRM/80-231--------------------------------------------------------------------------------
A5D138_PELTS/79-229--------------------------------------------------------------------------------
Q3AAF1_CARHZ/87-236--------------------------------------------------------------------------------
Q67Q42_SYMTH/86-236--------------------------------------------------------------------------------
Q0AYQ4_SYNWW/82-232--------------------------------------------------------------------------------
A6TS57_ALKMQ/86-237--------------------------------------------------------------------------------
A0Q063_CLONN/87-239--------------------------------------------------------------------------------
A5N7F0_CLOK5/88-236--------------------------------------------------------------------------------
A7GDF0_CLOBL/87-234--------------------------------------------------------------------------------
Q894C2_CLOTE/87-233--------------------------------------------------------------------------------
Q97H89_CLOAB/87-241--------------------------------------------------------------------------------
A6LTS9_CLOB8/88-240--------------------------------------------------------------------------------
Q0TPA0_CLOP1/87-237--------------------------------------------------------------------------------
Q2RGA2_MOOTA/88-230--------------------------------------------------------------------------------
A3KKU2_STRAM/149-288--------------------------------------------------------------------------------
A3TKX4_9MICO/129-268--------------------------------------------------------------------------------
A6WCM3_KINRD/104-249--------------------------------------------------------------------------------
Q0RNH1_FRAAA/108-249--------------------------------------------------------------------------------
A8KY02_FRASN/141-282--------------------------------------------------------------------------------
C1APA2_MYCBT/148-291--------------------------------------------------------------------------------
A3Q0H9_MYCSJ/122-269--------------------------------------------------------------------------------
A4TA87_MYCGI/105-253--------------------------------------------------------------------------------
Q0SI96_RHOSR/103-247--------------------------------------------------------------------------------
Q8G9M8_RHOFA/99-242--------------------------------------------------------------------------------
A1SK83_NOCSJ/101-242--------------------------------------------------------------------------------
Q6A8T7_PROAC/107-249--------------------------------------------------------------------------------
A7A5S6_BIFAD/132-273--------------------------------------------------------------------------------
Q8G699_BIFLO/131-272--------------------------------------------------------------------------------
A7BCD7_9ACTO/127-266--------------------------------------------------------------------------------
A9AXV6_HERA2/92-230--------------------------------------------------------------------------------

PF03795

YJPA_BACSU/6-82-----------------------------------MLTMRTEKFNQEHV.........-...AGH-YEFLDRLQA-----
Q9I3Z5_PSEAE/1-116-----------------------------------MKYLCLIYFDEAKLAAVPAEELA-AIVDEC-MTYSDQLGK-----
Q98EG6_RHILO/1-116-----------------------------------MKYVCLVYGEEKDLYALTVERGA-KLDADS-LAYDRSLDQ-----
Q9AB44_CAUCR/10-125-----------------------------------MQYALLLYENEAVYAEEGAMSLE-AIIAAH-NAFAADLAQ-----
Q9I3Z0_PSEAE/1-123-----------------------------------MRFMVIVKATQASEA..GEMPSE-ELLAAM-GRYNEELVK-----
Q98I36_RHILO/1-116-----------------------------------MRFMMLMIPGGYAEAAPDVRPDA-KGVEAM-MKYNEELKK-----
Q98DP4_RHILO/1-116-----------------------------------MRYMLMINNDESALAAMPVEKTQ-QMSAAY-GAYTEALKK-----
Q98HH2_RHILO/1-118-----------------------------------MLYAILCYASEDVVSSWSKAQDD-EVMANL-INVQDKYAK-----
Q98H82_RHILO/1-116-----------------------------------MFYAILAYHMEDAIKALTPQEDA-ALMADL-LKINTRLRE-----
Q984U5_RHILO/1-115-----------------------------------MRYACLIYYHPQTLFG.GSPQAD-AALAEC-AGYDEVLKA-----
P73587_SYNY3/2-86-----------------------------------AKYVLWGTYCDNVE.....EKRA-PHRQAH-LDGLKVQKE-----
Q983T6_RHILO/165-255-----------------------------------VFHCRLIPPRPDFAFT.LTDAER-GLMKQH-SDYLRDRLG-----
Q9RVF8_DEIRA/6-88-----------------------------------TLWVVHSTYLKTG......DELN-ATTPKH-REWLDQHYR-----
Q97TR0_CLOAB/1-82-----------------------------------MFILLLKYIKPV.......EEVD-KELENH-IKYLNKYYS-----
Q9X7N1_STRCO/1-82-----------------------------------MFVLELSYTAPL.......EAVD-ALLPDH-VAWLDGLYE-----
Q98H68_RHILO/7-87-----------------------------------MFVVALNYKVPL.......TEID-RLQAAH-IEWLKACYA-----
Q9ZNA3_9RHOB/1-86-----------------------------------MLVALIAHDKPGAL.....PIRQ-ENRPAH-VEYLKSSTA-----
Q9AJZ7_STRCO/1-88-----------------------------------MEFLCYHRDRPASL.....SLRY-ELGEAH-WSYMDQYAK-----
Q45075_BURCE/1-92-----------------------------------MLFLIYRKDRPGSL.....QVRI-DNYAAH-LAYLEPLKA-----
Q98EI5_RHILO/1-89-----------------------------------MLFAFVCKDKPGSL.....QVRL-DTRPEH-VAFLEGLNA-----
Q9AC00_CAUCR/2-87-----------------------------------ALFAILCKDKPGAL.....DTRL-ATRPTH-LDYLN..QS-----
Q9F188_CUPNE/1-88-----------------------------------MPYLIETVDKPNHQ.....HVRQ-ATRASH-LDYLE..AN-----
Y828_HAEIN/1-95-----------------------------------MYYVIFAQDIPNTL.....EKRL-AVREQH-LARLKQLQA-----
Q9KRE0_VIBCH/1-95-----------------------------------MWYVIFAQDVENSL.....EKRL-SVRPKH-LERLQQLQD-----
YCII_SHIFL/1-95-----------------------------------MLYVIYAQDKADSL.....EKRL-SVRPAH-LARLQLLHD-----
Q9HZ38_PSEAE/1-95-----------------------------------MLYAIIARDIPASQ.....ERRL-ASRPAH-LARLEQLKE-----

PF07045

Q89BY8_BRAJA/78-142-----------------------------------------------------EAQYQ.KYVQAV-VPFIASFGG-----
A4T848_MYCGI/15-77-----------------------------------------------------QAGMG.EYAKLA-GKTMG..AA-----
Q1MHU6_RHIL3/14-77-----------------------------------------------------PEAIA.DYRSRA-LPLVAKAGG-----
A1B208_PARDP/14-78-----------------------------------------------------IERYR.RYQAAF-AEVFGKFNG-----
Q98DD6_RHILO/15-78-----------------------------------------------------AEGYK.EYIAAS-KLAFERFGA-----
A6VTU1_MARMS/14-77-----------------------------------------------------KTKLT.EYSTLA-AETLKPFNG-----
Q0C268_HYPNA/14-78-----------------------------------------------------RAVYQ.RYVDRF-LPVLAAYGG-----
Q1GHA0_SILST/14-77-----------------------------------------------------ADAYG.KYAELA-GPAIAKHGG-----
B1KC06_BURCC/15-78-----------------------------------------------------QHELD.IYASQV-GATLAGHPV-----
Q391P0_BURS3/15-78-----------------------------------------------------GDDIV.EYLERI-DGTLAPYDG-----
Q28QV7_JANSC/15-78-----------------------------------------------------DAAYS.KYAALA-TDAITAHGG-----
A1K1N9_AZOSB/14-77-----------------------------------------------------SERFM.NYAQLA-GPALKLYGA-----
Q7VAI4_PROMA/19-83-----------------------------------------------------QALFA.EYVGKV-GPWLKGVGG-----
Q6SHS9_9BACT/17-82-----------------------------------------------------KETYR.LYEKGF-FPILKKHEG-----
Q3JLQ5_BURP1/14-78-----------------------------------------------------PSKYA.RYKALT-PDIIARYGG-----
Q1GFX6_SILST/15-78-----------------------------------------------------MERYK.AYIDAN-AAPFREYGA-----
Q07UT1_RHOP5/15-78-----------------------------------------------------MDGYK.EYVAQN-GSVFHQFGA-----
Q0FAX8_9RHOB/16-79-----------------------------------------------------PEKLA.AYAVLA-RPAMEKAGA-----
A5V7J9_SPHWW/14-78-----------------------------------------------------MEGQD.QYARII-GDIGQRFPY-----
Q2BPT9_9GAMM/14-76-----------------------------------------------------QDRIE.ELGPLS-KPIIAKYGG-----
Q0KCE3_CUPNH/15-79-----------------------------------------------------PQQYE.EYKVLS-SKAMQIHGA-----
A6UK15_SINMW/14-77-----------------------------------------------------RKSIE.DYRSKA-LPLVAKAGG-----
Q6NCX9_RHOPA/15-79-----------------------------------------------------LDGYKRDYVAHN-GAVFAKYGA-----
Q7WD74_BORBR/14-77-----------------------------------------------------PAQYE.DYKRLS-TLAMRAYDA-----
Q28UH1_JANSC/39-104-----------------------------------------------------LTAYFDRYGAPV-FPMLAAAGA-----
Q89JB1_BRAJA/26-90-----------------------------------------------------QAMME.AYRALA-AQTIAQYGG-----
A7HSS3_PARL1/14-78-----------------------------------------------------RARYE.AYAARF-AETMKGRKG-----
Q5NR08_ZYMMO/14-78-----------------------------------------------------PDAWK.IYIGLA-AAAIKQYGG-----
Q28SX7_JANSC/15-78-----------------------------------------------------PEAYK.EYIERD-TPILLSHGA-----
Q742V7_MYCPA/18-80-----------------------------------------------------PEGMK.AYAKAA-GSAMS..GA-----
Q1I972_PSEE4/14-78-----------------------------------------------------PEQYQ.QYTQRA-PAAFAAFGG-----
A9AQ60_BURM1/15-78-----------------------------------------------------CDDIV.EYLERI-DDTLAPFGG-----
Q8TNJ5_METAC/3-67-----------------------------------------------------HELYA.GYVEKV-PEIIKKHGG-----
Q16DN6_ROSDO/15-78-----------------------------------------------------ADAYK.PYSLRN-DEIVPRHGG-----
A6VY75_MARMS/14-79-----------------------------------------------------KAKYQ.DYLALA-PAALQKYGA-----
Q0FH20_9RHOB/10-73-----------------------------------------------------PEEYA.IYAGQT-VALAEKFGG-----
Q0RQX9_FRAAA/15-78-----------------------------------------------------ESKVA.AYAELA-GPALRAAGG-----
A0P3L8_9RHOB/15-78-----------------------------------------------------ADGYP.AYVETA-KPAFERFGA-----
Q8FXW8_BRUSU/15-78-----------------------------------------------------PERYK.DYVSTA-KPAFERFGA-----
B2JPM5_BURP8/16-79-----------------------------------------------------AAALA.AYAQLA-LPAITAAGG-----
Q1QS87_NITHX/15-78-----------------------------------------------------SERYP.DYLAAA-QPAFEKFRA-----
Q11E97_MESSB/14-79-----------------------------------------------------EEPMQ.EYHRLT-ELALQKYPN-----
A9BN41_DELAS/15-79-----------------------------------------------------PEQYE.EYRKWS-TEAMRVHGA-----
Q98G06_RHILO/36-99-----------------------------------------------------GPQIV.EYLHKI-DATLEPFGG-----
A1TLS8_ACIAC/15-79-----------------------------------------------------PEQYE.DYRRLS-TQAMQVHGA-----
Q28KV2_JANSC/15-79-----------------------------------------------------MDKMQ.EYATTV-EPITHAFKG-----
A5FY88_ACICJ/15-78-----------------------------------------------------AEAYA.AYVREN-AVAFAKYGA-----
Q46FP8_METBF/16-80-----------------------------------------------------PIRYA.EYIAAV-KAIVEQHGG-----
A4XXX9_PSEMY/29-93-----------------------------------------------------PARYA.EYTSRA-PAVFAHFGG-----
A7IC73_XANP2/126-189-----------------------------------------------------PERYK.DYIAAN-AEPFAEYGA-----
Q0C4G1_HYPNA/15-78-----------------------------------------------------EEAMA.RYAKAA-GDARGDHQI-----
B2TDH4_BURPP/15-78-----------------------------------------------------GDDIV.EYLNCI-DATLAPFDG-----
Q0FEP2_9RHOB/15-78-----------------------------------------------------KEKFA.AFSGMA-APVIKAHGG-----
Q2KDF1_RHIEC/15-78-----------------------------------------------------AERYK.DYVAAA-KPAFEKYGA-----
A5E903_BRASB/8-72-----------------------------------------------------RAAYD.RYLAGF-FDVFRNYNV-----
Q128E5_POLSJ/15-79-----------------------------------------------------PEQYE.TYKKLS-SIAMQVHGA-----
Q65SN3_MANSM/36-100-----------------------------------------------------REGIK.AYSAQV-ESTFKPYSG-----
Q1BE44_MYCSS/14-78-----------------------------------------------------RTAYD.RYQAAF-MEVFARYSG-----
A9ATA2_BURM1/14-77-----------------------------------------------------PVKYK.DYTDLA-PQAFKKFDA-----
A0PQ06_MYCUA/14-78-----------------------------------------------------RPAYD.RYQAAF-MQVFDRYAG-----
A8L5T2_FRASN/24-88-----------------------------------------------------PEGMA.AYSRLS-GPSVAAAGA-----
Q484V4_COLP3/14-77-----------------------------------------------------AEKLQ.QYGARV-ASTLAKYSG-----
Q98JP1_RHILO/57-122-----------------------------------------------------PKWVP.AYAASV-HDIVHKHGG-----
A0YH96_9GAMM/14-79-----------------------------------------------------PVAYE.AYKLQA-KPIAEKFGG-----
A0YGY6_9GAMM/14-78-----------------------------------------------------RSEYD.RYSAGF-SDVFKKFDG-----
Q47EX6_DECAR/15-79-----------------------------------------------------AAKWD.EYRSQV-PATLAPWQA-----
B2SY97_BURPP/15-78-----------------------------------------------------PAKLD.EYKQVA-PATFERHPV-----
B2U9C2_RALPJ/15-79-----------------------------------------------------PVQYE.QYKTLS-TKAMQAHGA-----
Q6F9F1_ACIAD/14-77-----------------------------------------------------MQQYQ.EYMKLA-PAAFQKYGA-----
B2TES1_BURPP/15-78-----------------------------------------------------QAELD.IYQSKV-GETFKGHPV-----
Q39MC4_BURS3/15-78-----------------------------------------------------QQELD.RYQDQV-GATLAGHPL-----
Q0FH19_9RHOB/14-77-----------------------------------------------------EEAYG.RYAKLA-GPAIAKHGG-----
Q05S93_9SYNE/15-78-----------------------------------------------------PEGMG.AYLTAA-QPYLAKCGA-----
Q0FAW6_9RHOB/16-82-----------------------------------------------------PIKKA.AYNLLA-RDALEKAGG-----
A0YEI5_9GAMM/17-82-----------------------------------------------------VDSYR.AYEKGF-FSFLKKYEG-----
A6UFC5_SINMW/15-78-----------------------------------------------------PERYK.DYVAAA-KPAFEKYGA-----
A0Y8B3_9GAMM/7-71-----------------------------------------------------RSQYD.LYESGF-AEVFAKVDG-----
Q28P24_JANSC/18-83-----------------------------------------------------MPTFFEDYANPL-QAIHARHGV-----
Q7V2V4_PROMP/19-83-----------------------------------------------------QELFD.EYVNKV-APWLKEVGG-----
Q1YYX4_PHOPR/14-77-----------------------------------------------------PQKYT.RYTELA-PAAFQQFNA-----
A1B8D1_PARDP/15-78-----------------------------------------------------PAAYD.AYRQAN-AAAFAKYGA-----
A0Y900_9GAMM/14-78-----------------------------------------------------REQYS.KYEDGF-MAIFEKFKG-----
A0QZT5_MYCS2/14-78-----------------------------------------------------PAAFE.EYKTLS-PPSVAKYGG-----
Q127Z9_POLSJ/14-78-----------------------------------------------------PQIYD.EYKRQV-APLVAKFGG-----
Q89X32_BRAJA/34-98-----------------------------------------------------RAAYD.RYQARF-FDVFRKYSG-----
Q0RXH4_RHOSR/14-78-----------------------------------------------------ADKYE.SYKPLS-KQAIEEFGG-----
A4XTJ7_PSEMY/15-78-----------------------------------------------------GPEIR.EYLQRI-DATLAPFSG-----
A1AZL7_PARDP/14-77-----------------------------------------------------PEAYG.EYARLA-GPAIAAHGG-----
Q9LCS9_BRAJP/15-78-----------------------------------------------------DEGYK.PYAVAN-GAIFKKWGG-----
O85836_SPHAR/14-79-----------------------------------------------------ETWVA.GYMAAV-PALVGRHGG-----
A1BAV2_PARDP/15-78-----------------------------------------------------GPDIV.AYLEAI-DATLAPFAG-----
Q98CT4_RHILO/21-84-----------------------------------------------------AEGYQ.RYREAI-GDAISHFGG-----
A8KZG9_FRASN/14-78-----------------------------------------------------EEASL.AYAAVA-QPSVLSHGG-----
A2BXC0_PROM5/33-96-----------------------------------------------------PVAFK.EYVQEF-KPWLKSVGG-----
Q68E53_AERPU/15-78-----------------------------------------------------PEELA.TYSAGV-GPSFDGHDV-----
B1KGZ1_SHEWM/14-79-----------------------------------------------------DIWVP.EYAASV-HEIVHRHGG-----
A6WA35_KINRD/26-89-----------------------------------------------------PAGAQ.RYAELT-PATVEKFGG-----
A1B124_PARDP/15-78-----------------------------------------------------PEPYA.IYAEGA-SQAFRKFGA-----
Q215U7_RHOPB/14-78-----------------------------------------------------PEQYQ.EFISGV-KPALETAGA-----
Q3KB77_PSEPF/14-78-----------------------------------------------------PDHYS.QYTQRA-PKAFAEFGA-----
Q984S8_RHILO/14-78-----------------------------------------------------QEAFQ.TYRSRA-AASIAHYGG-----
Q165U6_ROSDO/14-77-----------------------------------------------------EEAYG.KYAALA-TEAIAAHGG-----
Q1V0T9_PELUQ/15-78-----------------------------------------------------QENLK.NYGAKV-TGIIKSYGG-----
A4X3R6_SALTO/15-79-----------------------------------------------------PEAMA.EYRAKV-GSTLALHGG-----
Q2VZK5_MAGSA/14-79-----------------------------------------------------PELYE.EYKHKA-RPLIERWGG-----
Q2BJZ2_9GAMM/14-79-----------------------------------------------------GDWGE.AYVKET-LPILQEYGG-----
Q0B1J7_BURCM/14-78-----------------------------------------------------PEIYS.GYTALS-PTVIEAHGG-----
Q2BHP1_9GAMM/14-77-----------------------------------------------------SEKLA.QYSQLA-APTVAKFGG-----
Q48IM5_PSE14/14-78-----------------------------------------------------PQQYT.EYTQRA-PAAFVLFGG-----
A0NLT0_9RHOB/14-79-----------------------------------------------------REALG.AYREKA-ADALARHGG-----
Q11KJ1_MESSB/15-78-----------------------------------------------------PERYK.DYIAAA-KPAFEKYGA-----
Q3J0R2_RHOS4/15-78-----------------------------------------------------AEAYG.RYAKGA-GPAIAAHGG-----
Q0FAQ5_9RHOB/14-77-----------------------------------------------------SEEYA.KYAALA-GPAVQKYGG-----
Q87W43_PSESM/18-82-----------------------------------------------------QARYD.NYKRLT-PDIVKAHGG-----
A0NQZ0_9RHOB/15-78-----------------------------------------------------GPDIV.AYLEGI-DATLAAFEG-----
B2JHP1_BURP8/15-78-----------------------------------------------------GMEIV.EYLKRI-DATLAPYGG-----
Q15VR2_PSEA6/41-104-----------------------------------------------------WDKFK.LYTQAV-PPLIKKFGG-----
Q1D8Q3_MYXXD/14-78-----------------------------------------------------AQTYE.RYKQLA-PPSLKAYGG-----
A5V7D8_SPHWW/14-79-----------------------------------------------------WDWYR.EYRKVT-EALVAEHGG-----
Q21DJ6_SACD2/14-78-----------------------------------------------------DNWLE.EYSSKI-LPLIEKHGG-----
Q1YE00_MOBAS/23-86-----------------------------------------------------NQGIV.DYLERI-DATLVPFGG-----
Q65QR7_MANSM/32-95-----------------------------------------------------QAAYD.RYLQLG-VPTLAPFGG-----
Q5YTA0_NOCFA/14-78-----------------------------------------------------RAAYD.RYQARF-MDVFTKYSG-----
Q3AME8_SYNSC/24-88-----------------------------------------------------PEGMQ.AYYERT-PAVIEQFGG-----
A8LJW3_DINSH/15-78-----------------------------------------------------METIG.RFAAAA-GPVIAEYGG-----
Q129N1_POLSJ/23-84-----------------------------------------------------PVGWK.TYVDAA-RAL..PTSG-----
Q0I7X2_SYNS3/15-78-----------------------------------------------------PLGMV.PFINKF-NAWLPTVGA-----
A8LL19_DINSH/14-77-----------------------------------------------------ADRYG.EYAKRA-TVAIAEHGG-----
Q1GHQ7_SILST/14-79-----------------------------------------------------RDWME.EYYAKV-PQVLEAHGG-----
Q46KM6_PROMT/19-83-----------------------------------------------------QELFD.EYVEKV-GPWLKENGG-----
Q2C9X6_9RHOB/15-78-----------------------------------------------------EAAYG.EYAKRA-TDAIAAHGG-----
Q0C383_HYPNA/14-80-----------------------------------------------------RQRFMTEYGAPT-AALIAHFGG-----
A7IC73_XANP2/15-78-----------------------------------------------------PVDYI.TYREAN-ARYAAEHDL-----
A0R1N9_MYCS2/15-77-----------------------------------------------------PAGMA.EYAKAA-GPTMG..GA-----
Q5FU37_GLUOX/15-78-----------------------------------------------------PAEFQ.KYSEVV-GETFKGFPA-----
Q1LPI6_RALME/15-79-----------------------------------------------------PQQYE.QYKVLS-TKAMQAHGA-----

PF07110

Q98J67_RHILO/10-91-------------------------------------------------TPADPAAFERHYHDIH-VPLAKQLPG.....
YTH4_RHOER/10-90-------------------------------------------------HPADPAAFDEHYSSKH-VPLVQQIPS.....
Q89V09_BRAJA/21-102-------------------------------------------------TPKDAAAFDKYYAETH-IPLAKKLPG.....
Q93EX2_9NOCA/10-91-------------------------------------------------QPTDTEAFDTYYDSTH-VPLANKLPG.....
Q9KGB0_BACHD/16-96-------------------------------------------------QPEDKQAFDEHYFNTH-APLTRKIPG.....
Q884M0_PSESM/10-93-------------------------------------------------YEEGARFDHDYYRDKH-LPLVQELMG.....
Q2N8F2_ERYLH/12-112-------------------------------------------------PSLSRDEFQHYRRETH-APLVRAAAPHL...
D0J371_COMT2/26-114-------------------------------------------------PALRPEEFAQAWRE.H-SALGRQCRN.....
Q2UH77_ASPOR/43-139-------------------------------------------------PDWAREEFWTHWQTEH-APKVAPLAT.YFNI
C9S7C3_VERA1/40-151-------------------------------------------------PDFTRQEFWDYWQTQH-APRVAPLAA.HFNI
Q0UAA8_PHANO/20-125-------------------------------------------------RSLTRAQFYTHWEMIH-APKVLFLFP.....
B6QRR3_PENMQ/18-114-------------------------------------------------EGTTPEEFYHHWYEVH-GPKMLDLSLRY...
C9SY64_VERA1/65-158-------------------------------------------------QGITQEQFNRYWAYNH-AELATPFHLRL...
B8MSU2_TALSN/18-112-------------------------------------------------PSLTVEEFHRQWTEVH-AQLLKHWLE....C
A5VH99_SPHWW/138-221-------------------------------------------------RDMTPEEFQVQWADYG-RSLASNDAY.....
A5V521_SPHWW/98-177-------------------------------------------------AELTHDAFRDRWLHGH-APFGLRTSA.....
B9K152_AGRVS/13-109-------------------------------------------------LGQTLAEQRAHMKDHH-GKLVLDYIA.HDPV
B2W3U7_PYRTR/13-127-------------------------------------------------PDLSPEEFQTYMEGTH-MPLVKEIFGDQAPL
Q0U4N6_PHANO/13-123-------------------------------------------------PETSPEEFKRYMEENH-IPLMREALGIHFPA
B2WDV2_PYRTR/13-120-------------------------------------------------HALSSEEFRDYYEHRH-IPLAYSLLTQCWPI
Q0U5I6_PHANO/13-111-------------------------------------------------PTLSPTDFQAAYEN.H-VPFLRDTVGSGAPE
A2QB94_ASPNC/13-115-------------------------------------------------PETSPSTFKSRLEA.H-IALVKHLTGPDFPL
A2QVN7_ASPNC/13-122-------------------------------------------------PGLSLSTFRERYEA.H-IDLVRHISGEDFPL
B8MPG2_TALSN/43-154-------------------------------------------------SGLTLEEFKSYSEQ.H-GHLLKRLASDVFPI
A6RYK8_BOTFB/14-123-------------------------------------------------KGLTPEEFKNHYETVH-IPILQEIAGDKFPK
Q2UT25_ASPOR/23-122-------------------------------------------------EGLTPDQYRDHYENVH-IPLMKNLTGDTFPL
C9Z9Q5_STRSW/12-103-------------------------------------------------PGMTHLAFVHHLHHVH-GPLAAAKPL.....
A2R8B5_ASPNC/14-111-------------------------------------------------AGMTKDEFFNYHYQVH-GALSTGPSPSETPL
A5VH99_SPHWW/12-106-------------------------------------------------PTLSRPEFFHYMANVH-APMATSLPA.....
Q396J2_BURS3/130-221-------------------------------------------------PRLTHEAWLDVWHGHH-TRVAIDTQD.....
A6GBX1_9DELT/12-106-------------------------------------------------PALSVAEFRDKLNE.Y-GFVVKDIAD.....
C9Z9Q5_STRSW/139-234-------------------------------------------------QGVSLDNFTERALGAH-EAALSRDEP.....
B5HPI7_9ACTO/138-233-------------------------------------------------EGLLPADVTGRWRAAH-EEVITEGAP.....
A8L3R3_FRASN/10-95-------------------------------------------------RGCAPDDFVPAWRAAM-GAAAAAPPD.....
A5V7F6_SPHWW/12-99-------------------------------------------------AGIARGELIDRYEREH-APLVSLLLP.....
A5V7F6_SPHWW/139-229-------------------------------------------------ADMSREAFVARYEQGH-CAVALDVLK.....
A4XEJ1_NOVAD/13-101-------------------------------------------------EGMSKADFIAYYESRH-RLIGEKVLS.....
C7Z3Q5_NECH7/37-130-------------------------------------------------DSIDYDTFFGHWQTVH-ADLAVATLA...FR
Q140F8_BURXL/125-207-------------------------------------------------PGMEPSAFRRHWDD.H-ALNVIATQG.....
C8ND54_9GAMM/12-105-------------------------------------------------DGLSDAEFRSRWQA.H-SEKVLGFQA....A
C2M2M0_CAPGI/12-107-------------------------------------------------ASLTKEEFIKLWEA.H-SQKVIKYKE....I
Q93AB2_YERPE/18-98-------------------------------------------------KGQSFEDFVKHWEEVH-TAITLKLPG.....
B8MF02_TALSN/21-117-------------------------------------------------PGLTEEELCSFQVCQH-SQLVCGLMEKY...
C8VQ65_EMENI/29-132-------------------------------------------------QGMSEEAYRKHMIEHS-APLTKDLMIKY...
C5FQT1_ARTOC/22-118-------------------------------------------------GGMDEEAYRSYMTKVH-APLVQGLMVKH...
Q2GSS6_CHAGB/53-131-------------------------------------------------EGIDLAEYRNYMANVH-APLVAGLMQKY...
B8NJL1_ASPFN/19-113-------------------------------------------------PGLTEEELHHHLCEVH-APKASPFLEKY...
C8VTL3_EMENI/15-109-------------------------------------------------PGLDESSLHEYLTNHH-APLALPFLLKY...
Q0UIY9_PHANO/18-106-------------------------------------------------PGMDEDAYHKYISETH-AGHLKHLLVEK...
A2QH37_ASPNC/566-663-------------------------------------------------PGMPEDEYHRYLSEHH-AVLVRNHLVKM...
B6QDA9_PENMQ/20-117-------------------------------------------------PHLTHEEFMKWIVDEH-LPLAMPVFKKH...
A2QDU1_ASPNC/19-117-------------------------------------------------EGISWKDFHEYGTRQH-APKAARIQERHGAY
B0YAX3_ASPFC/21-118-------------------------------------------------PNVSEEEFYQWVTEQH-AARAAKLHAKNGIE
B2WLL6_PYRTR/30-124-------------------------------------------------DGMSDADFIDYYNNNH-AQRAIPILQRH...
Q4P1P8_USTMA/29-132-------------------------------------------------DDISDQKFSDYYAQTH-AALAGPVLLRHNCV
C7Z0I7_NECH7/17-115-------------------------------------------------EGVSQEEFSRRFAR.H-GTLAGPVIKKHNGI
Q9F3V8_9PSEU/12-93-------------------------------------------------EGIDRDEALRYWREQH-GPLASKVPG.....

PF09448

O51799_CUPNE/2-113-----------------------------------IRLLYLLVKPAGMSDETFRAECLRHYEMSHDVPGLHKYEV-----
Q471R3_CUPPJ/2-113-----------------------------------IRLLYLLVKPAGMSDETFRAECLRHYEMSHDVPGLHKYEV-----
Q7WWV7_CUPNH/2-112-----------------------------------IRMLYLLVKPEGMTDEAFRAECLRHYEMSHDVPGLHRYEV-----

PF03927

C6BCZ8_RALP1/19-97-----------------------------------------DEW.HIAGVLVQTRPTH----------I-ARVSESIES-
Q5E3J5_VIBF1/8-86-----------------------------------------NEV.HISSLVVHVRPES----------L-EITKEKILA-
A0KIM0_AERHH/3-81-----------------------------------------QEF.HVSSLVVLTQPSL----------R-HQLADEIAT-
A8GHJ5_SERP5/4-83-----------------------------------------NEW.HVSGLVVQARPEK----------I-PRLVADLLA-
Q1Z7G7_PHOPR/4-82-----------------------------------------EEV.HISSLVVHVKPEY----------L-EEVKAQILE-
A4NJ35_HAEIF/12-91-----------------------------------------RDW.HVVGLIVQGNPKK----------L-SAIQTALLA-
A8H5B1_SHEPA/3-80-----------------------------------------NEL.HVTSLVLQVQPEQ----------M-SAVRQTIIE-
A8FUK0_SHESH/4-82-----------------------------------------AEA.HISSLLVQVSPEH----------L-NTTKKLIEA-
A1S9X8_SHEAM/3-81-----------------------------------------QEY.HVTSLVVHAAPSQ----------A-NVISDAIDA-
A4WZM9_RHOS5/4-81-----------------------------------------AQG.HISSAILRVRPGD----------E-APVAARVAG-
A8G0D7_SHESH/3-81-----------------------------------------QEY.HVTSLVVHAAPKA----------V-SQVETNIRA-
A4BGQ8_9GAMM/12-90-----------------------------------------EEE.HIVSVIVHVLPEH----------R-LSVIQGMAQ-
Q3HS06_PSEST/3-81-----------------------------------------HPL.HIASLLVHCRPEW----------L-AALKTNLQL-
Q21PN2_SACD2/9-87-----------------------------------------EPV.HITSFILLVQHGF----------A-EKILRAYAN-
A1K384_AZOSB/5-83-----------------------------------------IEV.HVTGVLVQALPDH----------V-QAVCVAVAN-
A3EIL2_VIBCL/16-94-----------------------------------------HEV.HISSLVVHTLPEH----------L-LTVKQQVSE-
Q93HX4_MAGMG/16-95-----------------------------------------EQVENICGVLIHAKPER----------R-HEVQDALGR-
Q6D5Z1_ERWCT/3-82-----------------------------------------TVW.HVCSVVVHVKTER----------M-AAVSDVLEK-
Q7VPJ8_HAEDU/8-87-----------------------------------------QNW.YVCSLVVQAKPAK----------L-PQVKADILT-
Q9Z3W5_9RHIZ/4-81-----------------------------------------PQH.HISSAVVVVRLEA----------V-ERMTAALTE-
Q080B9_SHEFN/3-80-----------------------------------------NEL.HVTSLIVQVHPEQ----------M-AEVRQKIMA-
A7ZP29_ECO24/3-82-----------------------------------------TNW.QVCSLVVQAKSER----------I-SDISTQLNA-
Q1LFZ4_RALME/17-95-----------------------------------------EEW.HIAGIMVYANPEK----------L-DAVCSAIDA-
A5ED22_BRASB/28-106-----------------------------------------PSG.EIASIIVQTRPDQ----------L-DRVAAEILA-
Q7WIQ2_BORBR/20-98-----------------------------------------AEL.HITSMVVHALPGR----------A-QALGAAIAA-
A6WJJ0_SHEB8/3-81-----------------------------------------QEY.HVTSLVVHAAPKT----------L-QQVEANICA-
A6UJX6_SINMW/6-83-----------------------------------------ASY.HISSAVIMTMPHM----------R-ERVVATLAE-
A6FC51_9GAMM/4-82-----------------------------------------QEV.HISSLIIHVKPEF----------L-EIVKNKIAA-
Q9Z3V0_RHOSP/37-115-----------------------------------------PGG.EIASILVQARPER----------L-DEVAAAIVA-
E6XM26_SHEP2/3-80-----------------------------------------KEL.HITSLVVQVLPQK----------M-ADVRQHILT-
Q12P45_SHEDO/3-80-----------------------------------------NEL.HVTSLIVQVKPEM----------M-TQVRQAILE-
A6CVN7_9VIBR/4-82-----------------------------------------NEV.HISSLVVHCKAEH----------L-AEIKAQIEQ-
Q0I5G8_HAES1/75-153-----------------------------------------EEW.HVCGLIIQVNPQK----------I-AQVKTALLT-
Q9CKL9_PASMU/11-90-----------------------------------------KNW.HVCGLVIQGNPQK----------L-EAIQTALLA-
A6VQY8_ACTSZ/8-87-----------------------------------------ENW.YVCSLVVQAKPVK----------L-EQVKADILN-
Q7WXC4_CUPNH/17-95-----------------------------------------EEW.HIAGIVVHTLPDS----------L-PQVRAAIEA-
A9CGL4_AGRT5/6-83-----------------------------------------GRY.HVSSAVVAVMPQM----------R-DAVFATLLT-
A1SWQ1_PSYIN/4-82-----------------------------------------EEL.HISSLIVHIRPEK----------R-QEIETSINL-
A0NZM7_9RHOB/3-81-----------------------------------------ATV.HIASLLVHARAEA----------I-SQVERNLLA-
Q487G3_COLP3/9-87-----------------------------------------PEY.HVASLVASPIFAQ----------L-DEVKAVITA-
A3USH4_VIBSP/4-82-----------------------------------------NEV.HISSLVVHVSPEH----------L-DEIKAQIEK-
Q13I16_BURXL/16-97-----------------------------------------DEL.HIAGIVVHVQPRR----------I-AGVRQAIGM-
A4XWL9_PSEMY/3-81-----------------------------------------APT.HISSLLVHVRPEL----------L-AAVKANLRQ-
Q9F5L4_BRAJP/32-110-----------------------------------------PGY.EIASIIVQARPER----------L-AEVEAEIIA-
B1KH53_SHEWM/3-81-----------------------------------------QEY.HVTSLVVHAAPAE----------V-SQVEAKIRS-
A4U4X6_9PROT/17-95-----------------------------------------SVE.NICGVLVHVVPRD----------R-NRIKAALEA-
Q5P545_AROAE/97-175-----------------------------------------SPA.HVPGILVETEPER----------T-AEVARAIAA-
Q1ZGB7_9GAMM/4-82-----------------------------------------AEL.HISSLIVHMRPHK----------S-ESIKKSINA-
A7JS88_PASHA/9-88-----------------------------------------ENW.YVCSLVVQAKPEK----------L-EEVKAEILK-
A7N7J4_VIBHB/4-82-----------------------------------------NEV.HISSLVVHVLPEH----------L-AEVKTQIEA-
NAPD_PARPN/28-105-----------------------------------------RFL.HISSAIVTARPDR----------A-ADLARHFAT-
A7M679_9PSED/3-81-----------------------------------------NAL.HIASLLVHCRPEL----------L-DAVKQNLLL-
A3QHX3_SHELP/3-81-----------------------------------------QEY.HVTSLVVHAAPGQ----------V-AKVTEDINA-
Q02IZ5_PSEAB/3-81-----------------------------------------EAL.QIASLILHCRPER----------L-PAVKANLAL-
O86475_RHOSH/4-81-----------------------------------------PEA.HISSAILRVRPGE----------E-AAVVRRVMA-
A1JL25_YERE8/4-83-----------------------------------------KEW.HVCGLVIQAKPAR----------I-APLIDSLLA-
A8H065_SHEPA/3-81-----------------------------------------QEF.HITSLVVHAAPHA----------V-TEIKNRISV-
Q2SGV8_HAHCH/3-81-----------------------------------------QDE.HIVSFLIQCAPQR----------V-TFLSQQLHQ-
Q47A86_DECAR/2-80-----------------------------------------GRM.NISSAIMYIAPER----------L-EEACVALLQ-

PF01037

GRP_ZYMMO/71-144-------------------------------------------------VCIRCA.EHS.....Q-DWL-DNFLQIVNE.
ZRP_ZYMMO/68-141-------------------------------------------------LLVKTG.LHT.....G-NYL-EQFHAAVSA.
Q92MD2_RHIME/86-156-------------------------------------------------LLVTLKRTP.......-..S-LGVLDRLAG.
Q7D0A6_AGRT5/69-139-------------------------------------------------VLITIGPKA.......-..L-PAVTAALTA.
Q8XUT3_RALSO/72-151-------------------------------------------------INVRLE.KQGGAPKGK-APS-DIFRAAVAT.
Q6FBR8_ACIAD/74-148-------------------------------------------------VEVLLD.KTT.....T-NGL-EEFIEAVAQ.
Q5UYW6_HALMA/69-139-------------------------------------------------IQLKVEGSS.......-..L-PAVTEDLKE.
O28651_ARCFU/68-142-------------------------------------------------INVKVSLTR......E-KGY-DDIAKRIAK.
Q97KE2_CLOAB/74-146-------------------------------------------------VGIYIDKAA.......-.SY-PKVLEAMRD.
Q6LFY1_PHOPR/75-149-------------------------------------------------VQVTLE.RER.....V-DLM-HNFKKEMNA.
Q9KKN4_VIBCH/69-143-------------------------------------------------IHIRLD.QSS.....F-SIF-ERFAHAVAD.
Q88Q35_PSEPK/72-143-------------------------------------------------IFVYRYDRM.......-.RG-EAVLDALRQ.
LRPB_BACSU/69-136-------------------------------------------------VFFFMNAYM.......-..H-DDLLKFIAT.
Q8ELF6_OCEIH/69-140-------------------------------------------------FDIDVEPKQ.......-..L-QEVAQNLAN.
Q7P0K6_CHRVO/67-134-------------------------------------------------IELTVKHLE.......-..Y-YVVIDEIRK.
Q5LQ65_SILPO/71-144-------------------------------------------------VLIRTS.EHE.....A-EWQ-QQFLKALQD.
Q6NDU4_RHOPA/81-154-------------------------------------------------VSIESG.DHS.....D-AWL-KTFADAVSA.
Q8XS36_RALSO/102-176-------------------------------------------------IGVVLD.RST.....P-ESF-ADFEKAVQK.
Q6N2H6_RHOPA/71-144-------------------------------------------------ASVHLS.SQA.....E-ADL-RGFEEFVRN.
REG3_PYRHO/78-149-------------------------------------------------IAVDAEPAK.......-..V-KQVVEELAK.
Q9RT71_DEIRA/109-183-------------------------------------------------VRVTLD.KQT.....K-QGF-QDFAEHMRA.
Q8KJG4_RHILI/76-150-------------------------------------------------VEVVLE.RHR.....L-EDQ-RHFETAIGE.
PUTR_RHIRD/76-150-------------------------------------------------AEVKLS.DTR.....E-KAL-EEFNTAVRK.
Q87GT1_VIBPA/66-140-------------------------------------------------FALKFDTSIS.....S-YYC-ESYADELYK.
Q6LY54_METMP/67-138-------------------------------------------------TGFDTNPED.......-..F-LSVAQELCK.
Q6L2L7_PICTO/21-92-------------------------------------------------IGLEADINA.......-..V-DDIGKEIAT.
Q5V2Q8_HALMA/69-143-------------------------------------------------VELNVTLDR......E-TSY-DDISDRIAK.
Q9HQ13_HALSA/69-140-------------------------------------------------VGLRVEQGR.......-..E-DETLDRLTG.
Q8E9E7_SHEON/75-150-------------------------------------------------IHVRME.KHT.....P-AIL-NQFETNVLA.
Q7WKQ4_BORBR/91-161-------------------------------------------------CFLSVLPKT.......-..P-AAVMRELAR.
Q7WFA6_BORBR/67-141-------------------------------------------------AQISLE.RHS.....A-GTV-ETFERSVRD.
Q8PJL5_XANAC/72-142-------------------------------------------------ILITVLPKK.......-..M-PAVVKALRD.
Q97C07_THEVO/6-77-------------------------------------------------VLISTVPGK.......-..E-HEVYNKVLK.
A9CFY0_AGRT5/67-137-------------------------------------------------MMIEIEGHV.......-..T-DRVIRTLGG.
Q8D573_VIBVU/77-150-------------------------------------------------TLVTLG.SHE.....V-ENT-TPFEDFVAE.
Q63VD1_BURPS/71-145-------------------------------------------------IEVGLD.RQT.....A-EDY-DAFEAYACA.
Q8XQA9_RALSO/69-143-------------------------------------------------ARIWLK.GQD.....A-ATV-DAFTAAIQQ.
Q64MN4_BACFR/70-142-------------------------------------------------VGIKLEKGS.......-.MY-KAVVAELQK.
Q6A8E6_PROAC/82-152-------------------------------------------------IFLNPIDPE.......-.ED-ETIPGILRT.
Q9L101_STRCO/68-139-------------------------------------------------VEIFCRRNT.......-.SP-ETIQRGLER.
Q7TXW4_MYCBO/98-164-------------------------------------------------ISVNLQSSA......R-GKI-RSFIQQIRR.
Q5YPF7_NOCFA/74-144-------------------------------------------------VTLEIAQGA.......-..L-DTLAAELDA.
Q98D73_RHILO/70-144-------------------------------------------------IQVRLV.SHS.....D-GSP-ESFIAAVQR.
Q98F66_RHILO/68-135-------------------------------------------------VRIRPLPGK.......-..L-HIVQKLIEE.
Q9A2I8_CAUCR/74-148-------------------------------------------------VTVTLS.SQA.....E-SAL-SAFEKAIAT.
Q9AAL7_CAUCR/79-153-------------------------------------------------AEVTLK.RHH.....P-DDF-LVFETAIAD.
Q649E6_9ARCH/43-117-------------------------------------------------IDIKISPER......G-TGY-DSVAERISK.
Q5LQ72_SILPO/75-142-------------------------------------------------VRFRPLPGK.......-..R-HILEQRIQE.
Q8KJC0_RHILI/68-142-------------------------------------------------VNVELD.RER.....L-DLV-DEFKRAMRA.
Q9AHF1_RHIRD/77-151-------------------------------------------------VGVVLD.RST.....P-ESF-AVFEKAVKA.
Q9F185_CUPNE/87-161-------------------------------------------------IEVTLE.RHD.....D-DML-YRFGKALAE.
A9CFA2_AGRT5/70-143-------------------------------------------------ISVTLE.RQI.....K-EAL-TTFEHHVAS.
Q5ZSK0_LEGPH/69-144-------------------------------------------------VLVGLN.NHQ.....P-EVM-NQFEKTIQL.
Q98PB1_RHILO/72-146-------------------------------------------------ASIKLE.RQR.....E-DDL-DRFSQAVLR.
Q92LN5_RHIME/67-137-------------------------------------------------VMIEVHGKM.......-..A-DRVAEQLRG.
Q92U21_RHIME/82-152-------------------------------------------------MMIEVVGKS.......-..T-TQVVRKLRG.
Q88GR4_PSEPK/67-141-------------------------------------------------VFVTLR.EVT.....R-QPV-ADFETALAQ.
Q647R1_9ARCH/70-143-------------------------------------------------IGIEVEQEQ.......-DKL-KKVIDKLKS.
Q81BC4_BACCR/67-132-------------------------------------------------VLMEPRDCN.......-...-.KYKKFAME.
Q5LX17_SILPO/69-143-------------------------------------------------VEITLQ.GQA.....D-EVL-DAFEKAVAR.
Q8VM90_RHILV/70-144-------------------------------------------------VGMEIE.RDN.....Y-DAL-AKFRLWAEK.
Q8KCK3_CHLTE/71-142-------------------------------------------------VRVRVDSSK.......-.HY-KSFVEHVMK.
Q7WFT7_BORBR/71-144-------------------------------------------------VSIKTN.QHN.....A-KWT-DNLINAVMS.
Q9I287_PSEAE/71-145-------------------------------------------------AQIKLN.AHG.....R-KNL-TDFAEAMHQ.
Q9A5B5_CAUCR/107-181-------------------------------------------------VEVQVD.RHS.....E-EAA-EAFQQAVLR.
Q5YR66_NOCFA/67-141-------------------------------------------------LDLSLE.SHD.....A-RTT-EHFETTMRG.
Q8NMC1_CORGL/75-149-------------------------------------------------LGIQIRPHA......R-DTA-NDFVQKVLA.
Q8J2Y4_PYRAB/6-77-------------------------------------------------VLLTIEIGK.......-..V-EKVIEELKK.
Q82QC2_STRAW/71-138-------------------------------------------------VRLKYPGNR.......-..H-QPLRRLLAE.
Q898A1_CLOTE/78-150-------------------------------------------------VGINLEKAS.......-.YL-TEVANKLEE.
Q62M96_BURMA/72-146-------------------------------------------------VQVSMR.NDQ.....T-QWH-ERFAQAVRE.
Q88H33_PSEPK/67-137-------------------------------------------------TSIGISGHH.......-..A-AEVKHALRG.
Q738U3_BACC1/67-132-------------------------------------------------ILFKSTNCK.......-...-.ALSNFCYN.
Q88DP7_PSEPK/70-145-------------------------------------------------VLIGMD.RHT.....P-ERF-ETFEAAIRN.
Q9KYP0_STRCO/82-153-------------------------------------------------IGVSLSDAA.......-.DH-EDVAQRLKE.
Q53106_RHOER/70-140-------------------------------------------------VGLELEQGK.......-..I-SAVARSLTE.
Q9EX07_STRCO/69-139-------------------------------------------------VHIEVTQGH.......-..L-DEVGEALAA.
Q74NJ3_NANEQ/8-78-------------------------------------------------ILIQVKPGY.......-..E-TSVAETLTS.
Q5UXF0_HALMA/63-134-------------------------------------------------IEVSVDVNV.......-.DT-AEVSDRIAD.
Q7W2M4_BORPA/69-143-------------------------------------------------VHVTLE.SHS.....E-ETL-YEFGRALAQ.
LYSM_SULTO/67-138-------------------------------------------------VMVKTNPQI.......-.PT-PEISKKIIK.
Q7VRX6_BORPE/85-159-------------------------------------------------VHVSLD.QSQ.....A-GWH-EAFVARLAG.
HOSA_SULTO/388-459-------------------------------------------------ISVKCESNV.......-.YT-TAVTRRLSV.
Q6L0M6_PICTO/71-145-------------------------------------------------ILIEYDSKA......K-IDQ-KTLCRNLAA.
Q6HMY8_BACHK/75-147-------------------------------------------------IFMSTNIHQ......S-DKL-EVLEKELEA.
O33467_PSEPU/71-145-------------------------------------------------VSIMMD.SHS.....K-EMA-RAFEQRLMD.
Q8PGC8_XANAC/74-148-------------------------------------------------VEISLA.YKS.....G-DIF-EEFRRAALK.
Q83SF4_SHIFL/97-171-------------------------------------------------VLIKTQ.HHS.....S-EWY-CRFVTVVTE.
Q7NXB3_CHRVO/75-142-------------------------------------------------VGITVPQPD.......-..K-KTLLARLEA.
Q8XJU9_CLOPE/76-148-------------------------------------------------VGIHVNSTS.......-.SY-THVFDELSK.
Q82JE5_STRAW/69-138-------------------------------------------------IRVNPHAGY......S-LRH-PRTLELLAR.
Y4TD_RHISN/84-158-------------------------------------------------VMVSLE.RER.....A-DIV-DRFKSSIRN.
Q9K0L9_NEIMB/99-172-------------------------------------------------IRVSI..RKA.....K-DAR-EDFAASVRK.
Q87PU4_VIBPA/76-146-------------------------------------------------LLISCEKGK.......-..K-NEVTNALKE.
Q5Z126_NOCFA/77-147-------------------------------------------------VSVVLDQHR.......-..L-DAVVDALAE.
Q89LX8_BRAJA/73-146-------------------------------------------------VSIQLG.SQA.....Q-PVL-EAFEGSIAA.
Q8Z2Q8_SALTI/72-144-------------------------------------------------IGIILKSAK.......-.DY-PSALARLES.
Q5LQW1_SILPO/67-141-------------------------------------------------IEVKLN.SQR.....R-EDL-EAFEKAILS.
Q65N91_BACLD/69-136-------------------------------------------------IEATVKNGE.......-..Y-ERFKAYIER.
Q92XD8_RHIME/73-147-------------------------------------------------CQVRMK.SHD.....P-VAR-RNFERFVES.
Q8FLW4_COREF/255-325-------------------------------------------------LWVQTTPQS.......-..V-EAIGHQLAG.
Q6SH05_9BACT/70-144-------------------------------------------------VQVALQ.RTS.....G-NAF-KAFTDAIEV.
Q703X8_THETE/397-468-------------------------------------------------IWIKVDENV.......-.YT-TSVARRVST.
Q5LTP6_SILPO/68-142-------------------------------------------------LRVTLDKTQ......P-RAF-DDFIEAARK.
Q8XVM9_RALSO/69-143-------------------------------------------------VWVELD.RQH.....S-AAL-RDFERKMSA.
Q8PQZ4_XANAC/73-147-------------------------------------------------VRVQLE.QHG.....Q-ADI-EHFAEGVRG.
Q736J6_BACC1/67-134-------------------------------------------------LRIENLKIP.......-..C-KKFEEKIYE.
Q62BJ3_BURMA/69-143-------------------------------------------------VNISLD.SHT.....E-KTC-RAFEAGVMA.
Q8FVC2_BRUSU/70-144-------------------------------------------------VRITLD.RQT.....E-EYL-NRFEEAVRR.
Q8YIT5_BRUME/83-156-------------------------------------------------ILVRTS.AHD.....P-EWL-NKFRAAVAR.
Q8KM39_MYXXA/69-141-------------------------------------------------IGVSIEHPK.......-.YF-DEFLQKVLL.
O54287_9CREN/75-145-------------------------------------------------LMIKVDGKH.......-..I-LEFEKEVSN.
Q979E1_THEVO/57-127-------------------------------------------------IGFNVPPDK.......-..I-DDFVEQAKK.
Q98KG1_RHILO/93-160-------------------------------------------------LRIRPVPGQ.......-..L-SVVAEIIRE.
Q8A556_BACTN/73-147-------------------------------------------------CSVKLR.RLN.....R-DIA-AEFTRIIQD.
Q7NU65_CHRVO/74-148-------------------------------------------------VQVGFG.SHI.....G-DAP-LRFEEQVQA.
Q5NMJ8_ZYMMO/67-141-------------------------------------------------VFVTLS.ESN.....K-QLV-QIFEDALLT.
Q7VRX9_BORPE/76-153-------------------------------------------------VTIKLN.KHSG..GSH-APM-GNFARDVQL.
Q6FCQ3_ACIAD/67-137-------------------------------------------------MNIMVEGNK.......-..A-SAVIRELRI.
REG6_PYRHO/71-141-------------------------------------------------ILVKVKAGK.......-..Y-SEVASNLAK.
Q6A5I2_PROAC/64-135-------------------------------------------------VEVDCHTES.......-..L-PQVIKTLCA.
Q93HN7_STRAW/79-149-------------------------------------------------ATLEIRQGQ.......-..G-PDVRAHLTT.
P95905_SULSF/75-146-------------------------------------------------MEIETVPYS.......-..I-KKVAQDLGE.
Q8ZT22_PYRAE/67-153-------------------------------------------------VLVSVRRGAAPKEAKP-LQL-EVAEKVLAEC
Q9KFQ5_BACHD/69-136-------------------------------------------------IEATVKHGE.......-..Y-SRFKQVVEG.
Q63M55_BURPS/72-146-------------------------------------------------VQVTME.RGH.....I-RDL-STFQKLVSE.
Q9RKY4_STRCO/86-156-------------------------------------------------ISVKPFDPS.......-.AP-DDIADRLAG.
Q89QF0_BRAJA/95-169-------------------------------------------------VRIALE.SQS.....D-EAL-KAFEAEVVK.
Q7NH56_GLOVI/75-142-------------------------------------------------IRINTAGKK.......-..S-AQLGAFACS.
Q5WIR4_BACSK/69-136-------------------------------------------------VEASIKHGR.......-..Y-DAFKHYIQT.
Q82AJ9_STRAW/6-77-------------------------------------------------VLIKTSVDR.......-..I-PEIAESIAA.
Q669R6_YERPS/67-134-------------------------------------------------VRVKPVANM.......-..L-DAVEKMIKD.
Q7VV34_BORPE/67-140-------------------------------------------------ISVKTN.QHS.....Q-AWL-DRFADHVTD.
Q63K02_BURPS/70-144-------------------------------------------------VLLRCS.VHD.....R-SVA-NRFEREVLG.
REG2_PYRHO/69-142-------------------------------------------------VLIKSKVPS.......-.DA-DKVISEISD.
Q9K6T5_BACHD/69-140-------------------------------------------------IGIKTQLGK.......-..Q-ETIATKLNE.
O29671_ARCFU/66-134-------------------------------------------------LLISAENPE.......-...-.KVFNNIKA.
Q6AF01_LEIXX/80-150-------------------------------------------------IGLRVTGDT.......-...-RLVADKLAA.
Q98JQ8_RHILO/76-143-------------------------------------------------IRVRTTHEH.......-..I-RPCLKQFAE.
Q9XAG4_STRCO/72-142-------------------------------------------------TTFEVDQPA.......-..R-EAIAARLRA.
Q92PN1_RHIME/74-147-------------------------------------------------VMIRTR.HHS.....K-EWS-DGFRAHVEK.
O86743_STRCO/86-156-------------------------------------------------VGVNVEGDV.......-...-ESVAEALSA.
Q7VXK7_BORPE/69-143-------------------------------------------------VTLEFA.RHG.....S-EYR-RTFMEQVAL.
REG7_PYRHO/68-139-------------------------------------------------TGVDTRPEK.......-..L-FEVAEKLKE.
Q9RK86_STRCO/67-136-------------------------------------------------VLVDSTAWM.......-...-GDRAEDFAA.
Q9RXV6_DEIRA/89-157-------------------------------------------------IGVKDSGRN.......-..D-PALVRWARE.
O29606_ARCFU/6-76-------------------------------------------------TMVNVAPGK.......-..E-KDVYLAVKG.
Q6ANT7_DESPS/69-143-------------------------------------------------IIVSVN.LHQ.....V-SSL-TAVKEKLKA.
REG1_PYRFU/70-146-------------------------------------------------IEIELADPE......S-DEL-SKLIRPILK.
Q6WB88_ALCFA/69-143-------------------------------------------------VEVNIA.QLN.....E-SEH-QYLSKALAT.
Q98K63_RHILO/72-146-------------------------------------------------ATIRLS.RQN.....E-DEI-VMFEEAIRG.
Q9HLH1_THEAC/98-168-------------------------------------------------IIIDVDPNK.......-..M-DDVANSITD.
O29117_ARCFU/70-140-------------------------------------------------IGITAEGGY.......-..L-TEIEKEIAK.
Q983I9_RHILO/78-152-------------------------------------------------ISVTLA.THN.....R-DNA-RRFGELVAR.
Q6FZR6_BARQU/62-134-------------------------------------------------VSICTNTYS......H-EWL-KCFSKIVQK.
Q972L7_SULTO/67-140-------------------------------------------------SLIRGKYSK.......-DYH-IELGSKLAN.
Q5V2P2_HALMA/69-140-------------------------------------------------VGIDIASDC.......-..Y-VEATRNLKE.
Q87GV1_VIBPA/67-140-------------------------------------------------VEVSLN.NHQ.....A-SSI-DEFETAIVD.
Q8XX00_RALSO/74-141-------------------------------------------------IRIQTTHAQ.......-..I-TKCLKAFAT.
Q987B0_RHILO/72-146-------------------------------------------------MEVTLA.SHR.....Q-ADF-DRFERVIRD.
Q9A3N3_CAUCR/116-190-------------------------------------------------VRVRLD.RHG.....Q-DLI-KGFEDAVAR.
Q7NT80_CHRVO/75-149-------------------------------------------------ANVSLE.RHN.....E-AAL-QDFAQSIDN.
Q5LKR4_SILPO/67-141-------------------------------------------------VRIRLE.RHN.....Q-EDV-HRFETRVRQ.
P71888_MYCTU/70-141-------------------------------------------------VQIFCHGRI.......-.AP-DQLRAAWVN.
Q9RIR7_SALCE/71-142-------------------------------------------------IMINISEEQ.......-..Y-ASISEKIKS.
Q5LTI9_SILPO/68-142-------------------------------------------------IQVHLG.THG.....P-DQS-AKFARMVNS.
Q7WI06_BORBR/70-144-------------------------------------------------LEIRLS.AKS.....G-DVF-DKVKQELLY.
Q88E71_PSEPK/78-152-------------------------------------------------VQLKTQ.RHD.....S-AWL-EQFAATVTG.
Q82M14_STRAW/244-315-------------------------------------------------LWITTSPGA.......-..L-HSVGEALAT.
Q5LX25_SILPO/67-137-------------------------------------------------VLLEVQQKE.......-..T-TRIVKRLEA.
Q981V1_RHILO/75-149-------------------------------------------------VEVTAK.NGK.....P-HLL-DGMKRRFLN.
Q97J19_CLOAB/69-136-------------------------------------------------VKVTMKNGQ.......-..Y-EKFKIFIKE.
Q89XH4_BRAJA/78-152-------------------------------------------------IQVGLA.THS.....P-DNS-KRFRALVNR.
Q984M5_RHILO/74-148-------------------------------------------------VEVELE.SER.....T-ELI-DAAKRQFSQ.
Q72K70_THET2/6-77-------------------------------------------------VLIRARGNR.......-..V-QALGEAIAE.
Q9HQ33_HALSA/67-138-------------------------------------------------LEVLTSYDG.......-.GY-EDVADEISA.
Q93IX1_STRCO/72-139-------------------------------------------------VRLRYPVAN.......-..Y-KPFHDLVAV.
Q975B9_SULTO/71-141-------------------------------------------------VLIKADPKK.......-..Y-EQILKKIYE.
Q745M6_MYCPA/252-323-------------------------------------------------LWLTVAPRD.......-..V-HTVGERIAA.
Q81BI2_BACCR/73-138-------------------------------------------------IMFKTSQCS.......-...-.DFIQFCNA.
Q5LNM4_SILPO/70-143-------------------------------------------------VMLRTR.HHS.....A-EWL-QKFRTHVLT.
Q93IX5_STRCO/73-147-------------------------------------------------LLVQVRPHR......R-ELV-GPFVERIRA.
Q92MD5_RHIME/70-144-------------------------------------------------IEVMLD.KTT.....P-EVF-DQFAAAIKQ.
Q9RS40_DEIRA/9-80-------------------------------------------------VMVQAERHR.......-..I-QETAEALAA.
Q5KVS2_GEOKA/71-145-------------------------------------------------IDVKVTPKR......G-VGF-DEVAERIYR.
Q5LUB6_SILPO/69-143-------------------------------------------------VAAEIA.DHT.....A-ASF-RAFEAAMQR.
BKDR_PSEAE/70-144-------------------------------------------------VSVSLE.KQT.....G-DYL-ARFEERIVD.
Q8ZX24_PYRAE/6-77-------------------------------------------------VFINTEIGA.......-..E-DEVMEALVK.
Q7X134_PSEFL/67-134-------------------------------------------------VGMTTLKPA.......-..K-SKLIATLND.
O68050_RHOCA/69-139-------------------------------------------------TLVELQGKL.......-..S-RQVIRTLTG.
Q8XFM7_RALSO/75-142-------------------------------------------------IRIGASAER.......-..G-TSLLKTFRE.
BKDR_PSEPU/70-143-------------------------------------------------IHVSLE.KQV.....E-QSL-HRFEEEIAE.
REG8_PYRFU/69-139-------------------------------------------------IGIKAQGKK.......-..I-REIERIIAR.
Q5UZ96_HALMA/68-138-------------------------------------------------FQLSVEGDG.......-..L-GRVVDQLRD.
REG9_PYRAB/71-145-------------------------------------------------ILIRYDPDS......G-LTQ-RQVAEQIAK.
Q5QV65_IDILO/67-141-------------------------------------------------VTIGLS.DHR.....R-SSQ-LAFEQHVAD.
Q7WM72_BORBR/71-145-------------------------------------------------VEVKIE.NER.....L-DLL-DEVTNRFVR.
Q5LRE1_SILPO/71-145-------------------------------------------------VMVELD.RET.....L-QQL-DLFRKRAKA.
Q8YCL0_BRUME/71-145-------------------------------------------------TRIRLD.QQD.....E-ETL-QKFANEIMR.
Q6D0Y1_ERWCT/70-144-------------------------------------------------IEVRLI.NHT.....S-EYV-ERFHQMLGE.
Q98N03_RHILO/69-143-------------------------------------------------VHISLS.GQF.....E-KTL-SDFEAAIKR.
Q880K0_PSESM/71-145-------------------------------------------------VEVKLS.GHG.....R-RYL-AEFEEAIIG.
Q8ZWW2_PYRAE/87-153-------------------------------------------------ILVKIEPKY.......-..R-DKVYDAAKK.
Q986N0_RHILO/91-161-------------------------------------------------VHIDTRGWG.......-..K-TPELMAVSQ.
Q5X578_LEGPA/88-162-------------------------------------------------VNITLE.KQR.....E-DLL-THFERKMHE.
Q9HV24_PSEAE/67-134-------------------------------------------------IELRITEKD.......-..C-QSVLDELAR.
Q6LS33_PHOPR/66-136-------------------------------------------------FEIRHQCAR.......-..C-ADVVEIFKT.
Q9A4E7_CAUCR/94-165-------------------------------------------------ALATVEFAR.......-..Y-EAFEAAVLR.
Q89D55_BRAJA/68-142-------------------------------------------------LHVSLE.RHD.....A-KFV-DEFVARVTT.
Q6AIZ2_DESPS/68-140-------------------------------------------------IEVTPKPDA.......-.YI-PDLGEKLAA.
Q5LTP5_SILPO/70-144-------------------------------------------------LGVKLA.RKG.....R-VSL-EDFERAVSA.
Q88AX2_PSESM/73-147-------------------------------------------------TEISLS.DHK.....R-EDF-AKFEANIRH.
Q8A637_BACTN/72-143-------------------------------------------------IGIYLKDPE.......-.SF-DSVTRALEA.
A9CJY9_AGRT5/67-141-------------------------------------------------VTVELK.LHG.....E-QHM-RRFLDIASA.
Q826R1_STRAW/74-145-------------------------------------------------VEVYCEGAA.......-.PP-RRLAEVVRN.
Q93FY6_PSEPU/75-145-------------------------------------------------VGIKVQPRS.......-..G-KDVVRRLSA.
Q9KGA0_BACHD/67-134-------------------------------------------------IQVSEVTVP.......-..Y-ATFEKFVEE.
Q8G6L1_BIFLO/70-140-------------------------------------------------VNVTPLDYS.......-.AE-SSIPDKLNN.
Q6AQ93_DESPS/16-87-------------------------------------------------ILLRVERTK.......-..V-NDVAEKLAD.
Q81G47_BACCR/69-136-------------------------------------------------LEITLKNGD.......-..T-TRMQQFIQS.
Q5NRK7_ZYMMO/74-148-------------------------------------------------VEVHLI.NER.....M-DTV-NNAKRLFHN.
Q6FAP4_ACIAD/69-144-------------------------------------------------LQVSLSKHD......T-ETF-DKFLAELED.
Q7VUI7_BORPE/70-140-------------------------------------------------TLIEVRGAA.......-..T-DAVVAALRR.
AZLB_BACSU/71-145-------------------------------------------------ALINLS.PLN.....R-ETI-HSFLEDINK.
O28824_ARCFU/64-138-------------------------------------------------VAMEVESSD.......-.AL-RKIIEKFRD.
Q6NCU7_RHOPA/67-141-------------------------------------------------AFIRVE.RHS.....R-DNA-ESFIEAVQT.
Q5LMF1_SILPO/70-144-------------------------------------------------MGVGLG.EHT.....K-AAQ-ERFERAVAR.
Q7TWT2_MYCBO/71-141-------------------------------------------------VAITPLDPS.......-.QP-DDAPARLEH.
Q5WDD1_BACSK/69-140-------------------------------------------------IGIHSQLGK.......-..Q-HEIGQWLKT.
Q9XA32_STRCO/57-128-------------------------------------------------ITLKIVQNS.......-..W-RTVRAQLRQ.
Q9A3M5_CAUCR/129-203-------------------------------------------------CTVKLS.LPT.....K-ENL-DTFEQAVGK.
Q6L1Y9_PICTO/97-167-------------------------------------------------IRVDTDAER.......-..I-DEIASKIAE.
Q6W0Z0_RHISN/69-143-------------------------------------------------TEITLK.NHR.....Q-VDF-ARFLAAIEK.
Q87WM3_PSESM/56-130-------------------------------------------------VHLSVD.LHT.....E-EVT-RKLEEKIIL.
Q5NNH9_ZYMMO/73-147-------------------------------------------------AMVSLK.SQA.....E-DDL-RQFEEHVAT.
PTR1_METJA/68-139-------------------------------------------------LGLYIKPSK.......-..V-EETLNKLKE.
Q92NU2_RHIME/68-141-------------------------------------------------ALIKTA.HHS.....D-DWI-EKFRRAISD.
LRP_RHIME/73-147-------------------------------------------------CMVGLK.HQS.....D-ANL-KAFAARTAS.
Q8XU40_RALSO/70-144-------------------------------------------------ASVKLA.HHG.....D-AIV-ERFREEILL.
Q65G37_BACLD/68-136-------------------------------------------------INIYTKSTY.......-..H-KPYLSFIKA.
Y224_HAEIN/85-159-------------------------------------------------VMVEMD.NQH.....S-YYQ-EQFERKMRQ.
Q8Z815_SALTI/78-152-------------------------------------------------VEITLN.RGA.....P-DVF-EQFNAAVKK.
Q65E48_BACLD/78-149-------------------------------------------------FNVEVEPQY.......-..L-EAVAVALEK.
Q6W241_RHISN/68-142-------------------------------------------------TTISLS.SHT.....E-EGN-RRLHSFIED.
Q64UG5_BACFR/70-144-------------------------------------------------CNVSLA.VHD.....D-EHI-KRFQEEIKE.
O28868_ARCFU/6-77-------------------------------------------------VLIKVSPGK.......-..E-RKVYDALAA.
Q63I71_BURPS/69-143-------------------------------------------------VHVAMR.PDI.....E-DWH-DSFVAAIQS.
Q62FW3_BURMA/69-143-------------------------------------------------AHVHLT.RHN.....E-GGV-EQFEREIAT.
O27261_METTH/78-148-------------------------------------------------IGVKVKGGV.......-..L-RNWETRTAY.
Q5LWR4_SILPO/91-158-------------------------------------------------IRARPLPGE.......-..M-ANMIEAIQD.
Q9K655_BACHD/67-134-------------------------------------------------ILVSGLRVP.......-..L-KDFEDMVKS.
Q980N2_SULSO/6-77-------------------------------------------------VLINTDAGG.......-..E-EEVFEKLKN.
Q5P347_AROAE/71-145-------------------------------------------------VTVTLE.KRR.....D-TPM-HAFHAAVQS.
Q8NTP9_CORGL/72-146-------------------------------------------------VDVTLS.NFD.....R-STV-DNFESSVAQ.
Q5YZ22_NOCFA/6-77-------------------------------------------------VLIHADNAR.......-..I-PETAQAVAD.
Q92S84_RHIME/6-77-------------------------------------------------VQLQCAPGK.......-..T-YEVADEIYR.
Q5LVX6_SILPO/69-143-------------------------------------------------VHVHLT.RHD.....P-DGI-VAFIRAIET.
Q6FCJ8_ACIAD/71-145-------------------------------------------------IEIKLQ.HYS.....L-ETL-EKFLDFVKN.
Q9HVR3_PSEAE/69-143-------------------------------------------------VGIKVE.RHR.....Q-EQA-EAFHRAVVD.
Q5LXH4_SILPO/67-141-------------------------------------------------VSVELE.RQE.....R-AAV-DAFERAIRT.
Q97B02_THEVO/67-141-------------------------------------------------ILVAYTPKD......G-ISQ-RDLAAKIAT.
Q702E3_9CREN/6-76-------------------------------------------------ILINCDFKS.......-..A-NEVINQLKE.
Q8Y353_RALSO/69-136-------------------------------------------------IQIETTHAH.......-..I-RKYIQLFEA.

PF02426

CATC_RHOOP/2-92-----------------------------------------ALFHVRMDVAIPRDLDPKVRDETI-AKE-KAYSQELQR-
CATC_PSEPU/1-91-----------------------------------------MLFHVKMTVKLPVDMDPAKATQLK-ADE-KELAQRLQR-
CATC1_ACILW/1-91-----------------------------------------MLFHVRMDVNIPDDMPVEVADEIK-ARE-KAYSQALQK-
O07243_MYCTU/1-94-----------------------------------------MEFLVTMTTRVPDSMPADAVERVR-ARE-AARSRELAA-
CATC_ACIAD/1-91-----------------------------------------MLFQVRMDVHLPVSMPTDQANQIK-SVE-KAYSQELQR-
O51800_CUPNE/1-91-----------------------------------------MLYCVQMEVNIPDSLPADRAEAIK-TAE-RARAIEIQK-
CATC2_ACILW/1-91-----------------------------------------MLFHVEMTVNLPSDMDAERAARLK-SDE-KAMSQKLQQ-

PF06778

Y3825_BACHD/31-235------------EERQQIINEFLDL.MEKWNDTEAQGEGS.HAVYTIVGQKAD..VMLMILRPSM-EEL-NEIETAFNKS
Q9YFL1_AERPE/27-208------------AWRSV....VSEA........AESSDATVSRAYLNISGPGH..LSLVAAFTEA-GGL-GRL..RLELS
Y2021_HALSA/31-240------------RDRTAALDDAASF.LADREALADADEGES.GVFSITGQKAD..LLFVHFRESL-DEL-DRIQRAFEQT
Q8FPI6_COREF/56-245------------DDRTAVIEQAREF.FTNL...VNEGRVVIRGIYNATGLRAEADYMIWWHAEEF-DEL-QKAFADFRRT
Q8KP26_9RHOO/66-261------------AERKGAAAEVVAVV.......EKYKDKVKAEAYLTRGFEAQSDFFLRIHSYDM-AAT-QAFLVDFRAT
O69830_STRCO/43-230------------EDRAGYADEVQEL.FDQLAAKDVTIRG....TYDLSGLRADADLMIWWHAETA-DQL-QEAYNLFRRT
Y3023_OCEIH/31-235------------EERQAAIDEFQQL.ISKWEAVEEEKQGS.HGIYKVVGNKAD..FMFIFLRESF-QEL-EQIKTEINKT
Y2676_MYCTU/30-218------------DQRDAIIDDASTF.FKQ....QEERGVVVRGLYDVAGLRADADFMVWTHAERV-EAL-QATYADFRRT
YWFI_BACSU/37-240------------DERQSIIHEFTGL.LEKWGVAQKEGKGS.QTLYSIVGQKAD..FMLMILRPTM-EEL-NQIELEFNKS
Q9RUB0_DEIRA/82-276------------AEREEIKAEFQAA.VEDWVNDAEPRQGLILRSYSLVGIRDDVDFMLWRIAFDV-NDF-QAAQARLNRT
Q9HKT8_THEAC/28-211------------DRMMRSIDEFFS............ANPGYINFHIYRSYRTDSDVIFWYSSRNP-DLM-ILAKERVQAS
Q97AK5_THEVO/23-209------------SVKEP.LNKLSSIL........RDAKSKMINLHTYRSFRYDSDLVFWFSSRTP-DDI-LELKEKIGFT
Q97WP2_SULSO/26-213------------EERRSAINEIESV........ESQFRNNLISLKRYISLRNDSDIIYWVTSSDT-SKL-..LEFKYTLL
Y358_STAES/31-235------------DDREAMITELETF.IKDKTVARESHQGD.HAIYNITGQKAD..LLLWFLRPEM-KEL-NQIENEFNKL
Y2113_LISMO/31-237------------GNQELMLNELSHF.LSDMEITKNIGEGE.HTIYSILGQKAD..LVFFTLRDSL-EAL-NEVENRFNKL

PF04261

Q9KQ59_VIBCH/5-294VSVAFSKGFWS.....HF.EM.ASPPELIDFPELGEGETHAPSTDVDVLIHCHATRHDLLFYTLR-KGI-SDIAQDIEIV
EFEN_BACSU/66-405VTFGFGPGFFEKDGKDRFGLKSKKPKHLAALPAMPNDNLDEKQGGGDICIQVCADDEQVAFHALR-NLL-NQAVGTCEVR
Q98KG6_RHILO/13-313CIAGIGRDLWD.....RLSPG.RRPLELKPFAPIKGAVHSAPSTPGDLLFHIRAERSDMCFEFER-ILL-DRFGPDVNVV
Q9FBY9_STRCO/10-309CVTGIGSEAWD.....RLFSG.ARPAGLHPFRELDGPVHRAVATPGDLLFHIRASRLDLCFALAT-EIM-GRLRGAVTPQ
EFEB_ECOLI/61-411ITLSVGHSLFD....ERFGLAPQMPKKLQKMTRFPNDSLDAALCHGDVLLQICANTQDTVIHALR-DII-KHTPDLLSVR
Q9K1P5_NEIMB/60-410VTVGVGSSLFD....GRFGLKDKKPIHLQEMRDFSNDKLQKSWCDGDLSLQICAFTPETCQAALR-DII-KHTVQTAVIR
Q9ZBW9_STRCO/87-434VTFGFGHSFFG.....RTGLEEQRPVALDPLPDFSSDHLDKNRSNGDLWVQIGADDALVAFHALR-AIQ-RDAGAAARVR
Q9I078_PSEAE/11-290LVVGIGHSLML.....SLG...KTVEGMKDYPVLAAPGIDLPSTPSALWCWLRGEDRGEVTLRSH-ALE-RSLAPAFQRT
Q9CNH6_PASMU/4-293AVVAFGDRVWK.....QLAGE.NSAKELKPFVTLGKGDASAPATQWDLLIHIQSLRPDVNFSVAL-AAM-NCFGKAIQVE
Q9RKQ2_STRCO/65-406LTIGFGPSLFT.....RFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIR-NLA-RIGFGKVVVR
Q9RH20_ZYMMB/19-318CVMGIGSEAWN.....RLFPDAPRPKELHPFKELKGVH.HAVSTAGDLLFHIRAHRMDICFEMAS-LIM-ERIRSAVQVQ
YFEX_ECOLI/5-296AVVAFGNNTWR.....ALSGG.VGAEELKDFPGYGKG..LAPTTQFDVLIHILSLRHDVNFSVAQ-AAM-EAFGDCIEVK
Q9K036_NEIMB/5-299LTIAFGSKAWA.....TFGHT.DEGSEIKPFSEMGNG..LAPSTQHDMSIHIQSFRQNAAYALAQ-SVL-GAFGDSICVA
Q99WN3_STAAM/26-361ITFGISKSLMK.....KIGLSSKIPDAFKDLPHFPNDQLIDDYSDGDIMIQACSNDSQVSFHAVH-NLV-RPFRDIVKVR
O07180_MYCTU/8-306VVVSIGSDAWD.....RLFAG.PRPTELHPFVELTGPRHTAPATPGDLLFHIRAETMDVCFELAG-RIL-KSMGDAVTVV

PF13826

Q5B835_EMENI/129-253--------------------------------------------------GARCNHPLGLL.-----..APGYKELG---
A0YDB6_9GAMM/17-134--------------------------------------------------GLRVNKPWKI..-----...HKWLPIT---
C2ZRM2_BACCE/19-135--------------------------------------------------GMRINNLLKF..-----...WKWLPVF---
A6CKD6_9BACI/18-135--------------------------------------------------GMRINKPFAF..-----...HKWLPVM---
Q7NL77_GLOVI/17-135--------------------------------------------------GMRINQFWAL..-----...GKWVPTL---
C0ZHQ2_BREBN/17-134--------------------------------------------------GMRINRMLAV..-----...HKWMPVA---
B1XXV3_LEPCP/17-135--------------------------------------------------GMRINRLLAV..-----...HKWLPVA---
A6G876_9DELT/21-138--------------------------------------------------GMRINKWWRP..-----...SHWLPVF---
D3EAC5_GEOS4/17-135--------------------------------------------------GFRINKWWAV..-----...HKWLPVM---
C2W9D0_BACCE/18-134--------------------------------------------------GMRINKIFSF..-----...TKWIPVF---
Q65NQ4_BACLD/18-134--------------------------------------------------GMRVNKWHAV..-----...HKWWPVF---
D0L3R6_GORB4/18-133--------------------------------------------------GMRVTKPWRV..-----...RAWTYVF---
A8FJ75_BACP2/18-135--------------------------------------------------GMRINKRWAV..-----...HQWMPVF---
Q0SFP1_RHOSR/17-134--------------------------------------------------GMTVNRPWRP..-----...DLWLPTF---
B2IYY5_NOSP7/17-135--------------------------------------------------GMRVNKLFAF..-----...SKWVPTA---
B4D6M5_9BACT/15-132--------------------------------------------------GMRINRPWKV..-----...HRWLPVF---
Q8ELJ8_OCEIH/18-135--------------------------------------------------GMRINKYIAI..-----...HKWLPVF---
A4TGL1_MYCGI/21-140--------------------------------------------------GMRINRPWQV..-----...WSWLPIF---
Q9K5Y3_BACHD/18-135--------------------------------------------------GMRVNKRWAL..-----...GKWLPVF---
Q82JR6_STRAW/18-140--------------------------------------------------GMRINHLWAV..-----...HQWLPVF---
C8X6B7_NAKMY/17-134--------------------------------------------------GMTINRWHRP..-----...DLWWPTF---
C9Z558_STRSW/19-141--------------------------------------------------GTRINHFWAV..-----...HHWMPVL---
D7B5B0_NOCDD/17-134--------------------------------------------------GATFNHWWRP..-----...DLWFTVE---
D2SAG2_GEOOG/17-134--------------------------------------------------GMRINRPWRL..-----...DAWLPVF---
D2Q510_KRIFD/15-133--------------------------------------------------GMRVNKLRAW..-----...RQWLPVA---
C6XKE2_HIRBI/17-135--------------------------------------------------GMRINKWWKV..-----...WKWLPVF---
Q49UK4_STAS1/14-130--------------------------------------------------GLHINKWYKV..-----...HHWLPVL---
D2RPK7_HALTV/35-154--------------------------------------------------GMRINALWKI..-----...QLWLPIL---
A1R2W1_ARTAT/19-136--------------------------------------------------GMRANRWWKM..-----...GRVAKVA---
Q5WGK6_BACSK/15-132--------------------------------------------------GMKIQQWWNI..-----...KAWGPVF---
B1YGH8_EXIS2/12-125--------------------------------------------------GLRINRLRSV..-----...RKWWPAV---
A6R852_AJECN/119-243--------------------------------------------------GAKSSHPLGAF.-----..DPVFLKLA---
D5UWZ5_TSUPD/14-139--------------------------------------------------GMRPRRAWRL..-----...GQAFFVS---
C0PC33_MAIZE/119-243--------------------------------------------------GARCHHPLGLL.-----..APGMKELG---
Q2TWA6_ASPOR/121-245--------------------------------------------------GTRSNHPLGLL.-----..APGFSELN---
B6QJL8_PENMQ/116-242--------------------------------------------------GFKSNHPLRMLA-----PGFKETASHF---
Q0CTD2_ASPTN/81-205--------------------------------------------------GARSNHPFGPL.-----..APGMRDLS---
Q2GR33_CHAGB/122-248--------------------------------------------------GARFNHPLGAL.-----..APGSKEVG---
C7YU85_NECH7/113-235--------------------------------------------------GVQSNHPLGVA.-----..APHFDKVG---
B8MRW9_TALSN/40-166--------------------------------------------------GFKSNRPLRMLS-----SGFKETSDHF---
A1DA85_NEOFI/113-235--------------------------------------------------GIQYNHPLGIF.-----..APHMLEIS---
B7KQ80_METC4/27-137--------------------------------------------------GFRVGRMWGL..-----...KA....L---
Q7S613_NEUCR/120-245--------------------------------------------------GVSYNHPLGPA.-----..SPGAYELF---
Q01W86_SOLUE/18-128--------------------------------------------------GMRVNALTGV..-----...KT...LL---
A5G2Z4_ACICJ/18-128--------------------------------------------------GMKVTKIRGV..-----...A....TL---
B1LSK9_METRJ/27-140--------------------------------------------------GMKVRTLAGV..-----...K....TL---
B0U9U6_METS4/19-131--------------------------------------------------GMHVRALFGL..-----...KT....L---
B8EMQ3_METSB/15-128--------------------------------------------------GMRARTLRAF..-----...RR....L---

PF13816

C7Z148_NECH7/36-347QAWLK.....GHHGPSAFESFTVIDGSDVEETSIWVSYWLEESKYKLSIEKLSLPSIYSSLSTPG-RASIGIWREAFTTE
Q5B890_EMENI/325-643IDAFNAVFTTNVPIIEHL.EQD.....DPTPTRLWLTYWPSRAVFETWWNSGPVSSFWSSLP...-.DDAGVYREIMTVP
C9STN6_VERA1/45-354SSFIDL..SSPRSRPGFH.EVAAVTDNQGHFNIAVLLYWKSKANYDEWLATSGFGRWWDELT.PG-TDQHGWFLEVFYPT
Q4VYU2_RHIRD/43-343RHIVSD..FSGVDGPMEY.DLTHHRDAQGYDNLIAVGYWRDPEAQQRWQSAPAVSGWWNSDD.RL-AENIGYFREIVAPR
C0ZVD3_RHOE4/60-360RDIVAG..FDLPDGPAHH.DLTHHVDNQGYENLIVVGYWKDVSSQHRWSTSAPVASWWESED.RL-SDGLGFFREIVAPR
B8NPL1_ASPFN/36-350ERWLA...TDQDNAPAAVERFRVIDGDDTPDSLVFACYWDTESKYENGIKGLNLTQLYQKLDKSI-QPTVGLWCERFVSH
Q6FBU3_ACIAD/43-342QHIVQS..FSLDNGPQNH.DITHHTDNQGYENYIVVGYWRDPGAYCRWFRSTEVSHWWDSDE.RL-NDGIGYFREIVIPR
C3KC36_PSEFS/43-343RHIVGS..FSLADGPQTY.DLTHHTDSSGFDNLIVVGYWKDPAAHCRWLRSPQVNDWWSSPD.RL-GEGLGYFREITAPR
Q1BN36_BURCA/43-343RRIVAD..FGMQDGPNNF.DLTQHTDDQGYENLIAVGYWRDPAAYARWIASPALVEWWASDA.RL-ADGIGYFREIVAPR
A1CY61_NEOFI/6-331QRWIV...ENPSTAPASIEQFQVLDGDDVPNSTVWVCYWNEASKYEDSIRRLSLVNIHQKLNAPH-RESVGLWCERFTSH
C9SXX8_VERA1/36-349RAWLE.....AGHGPAVFEAFAMIDGAEATDTSVWVCYWQDADKYDAALQALALPALFSRLETRD-RESIGLWRECFATA
Q500U2_PSEU2/43-341AAITAW..FDSDSGPRYW.DSACCVDADGFHTCIAIAYWHDVDAFNRWRNSSGFLRWWQDPA.RE-TGPLGWFLEVVCPS
C5CKL2_VARPS/43-346MKIAAG..FALPDGPGHH.DFAHHVDAAGCDNMVAIAYWNDPAAHARWCTAPEVDAWWRSDE.RL-ADGLGYFREIVAPR
D4DHU0_TRIVH/55-363LEFVKSP.TDTEVRPSFW.ELASVTDANGSYNIAILAYWPSQETYESWNKVSNFRSWWEGLD.TE-NQQHGWFLEVFSPT
Q0U2P3_PHANO/36-345KKWLV.....QDDGPATHESFTVIEDDSTKDVAVWVCYWNDLEKHKSSMEKLSLSSIHSSLSSP.-..SIGLWRETFTSS
Q2WG72_GIBZA/14-329IGRFDKLIDSAAIHVEHL.EQN......DVPSKIWMSYWESPQKFKQWWEKDDTASFWASLP...-.DDAGFWRETFSLP
C5G803_AJEDR/44-352SGFINNP.TAAGKKPSFW.ELASVTDNRGAYNIAVLAYWPDKGSYTEWATTSGFQTWWDTLD.PE-TQRHGWFLEVFSPT
OXD_BACSX/28-329GMMKKS..FDLRTGPKHV.DRALHQGADGYQDSIFLAYWDEPETFKSWVADPEVQKWWSGKKIDE-NSPIGYWSEVTTIP
A1CFW9_ASPCL/35-358QTWIT...ADPSIAASSVEQFEVLDGDDTPGSTVWACYWDDAAKYEASLQRLNLVAPFEQLDSTN-RQSIGLWCERFTTR
Q0CF39_ASPTN/14-333ASEFNDLIQEASVPVEVMEHDD..FELEDCRSKVWMGYWKTPEDYRAWWCSPKVAAFWSKLP...-.DNAGFWRESLRFA
B1KM99_SHEWM/29-326........FTGEFSPKLL.EQGMFTDKAGITNYLYIAYWFASD.YKTWWQQSAANSWWASPL.LD-EGDISVWREVFTMP
C1H9S7_PARBA/44-352LGFIKDS.PSVEQKPSFW.ELASVTDTNGAYNIAVISYWPNKESYTEWGAASGFQNWWETLN.PE-EQNHGWFLEVFFPT
A1R5Y5_ARTAT/54-350MWEL....CANEDGPMSR.EHAVHTDEQGFDNQVIIAYWDDVDAYGRWFKKHRDALIGAGLE.P.-.SDYGRWIEAVTPE
A5V4Y9_SPHWW/43-337RALR....ATLDADVRHV.DLARYVDEAGYDTLVLQPYWTDPEAFRRWEARADVAALLAAET...-..GLGHFREILTPT
A7IFL4_XANP2/39-340FDRLQT..SFGTDGPVAH.EIMRMHDETGAVNAILVAYWLDATAHARWERNSPFMAWFRDPA.RL-EGTRGVWRETMHVP
C6WDR0_ACTMD/39-337ARVLEL..AAGESGPALV.ERVSDDDSE.....MAVCYWPDPEAHRAWWASGPVRDWWASL..PV-DGPIGHWHETSVTP
A5EKU7_BRASB/43-335ADFMVL..VSRADGPSHW.DLAHYVDQAGFANDVFVAYWDDVVRFDSWFEPARAA..WTGPG...-AEGGGRFIEVLRPA
B2WMJ9_PYRTR/6-318KEFVRD..APESLRPSFW.EVTSVVDKKGAYNVAVVAYWPSTNLHRDWQEKSGFNVWWQSSD.RE-KDGYGWFQEVLSPT
C7ZFH7_NECH7/15-326IQKFDELISGQAHL.....DRITVPGNDGFATQIWLSYWW.PDSHTGWWSKPAVKDFWDNLP...-.EDAGMWREVLTVS
C5FDU1_ARTOC/81-390LEFMKNP.SDATAQPSFR.ELVSVTDPNGSYNIAVIAYWPCRESYERWSVASTFTDWWEGLV.VE-DEHHGWFLEVFSPT
B8NMG3_ASPFN/16-332IRTFSHLITGANCHLDQV.TQDGIVSPGIGKTRIWIATWKSIADFEAWWESDSVIKFWSSLP...-.PDAGMWREFVKVP
F0QD95_ACIAP/43-343REWVAA..FGAPDGPLRH.DLTHHIDAQGYDNLIAVGYWRDPEAHRRWMQAPAQAGWWNAPE.RL-QEGLGYFREVSAPR
Q0C7P1_ASPTN/35-346REFVKS..MSCQDQSRVTETFRFLDGDDCKNAIIHVCYWEDARSYEEDLSRLRPMDIYTRVQ..R-APGIGIWCERFTTP

PF07876

Q748N1_GEOSL/2-96---------------------------------------------------ITHIVFFK-LT--D-PSA-PTIA..A---
A9CJX0_AGRT5/2-102---------------------------------------------------ILHCVFLR-FK--A-ATA-SSEK..H---
Q740A8_MYCPA/82-179---------------------------------------------------VYRTLLLA-VS--P-DTA-EDTV..A---
Q7S333_NEUCR/57-160---------------------------------------------------ITHIVLFK-FK--P-DAG-ADRI..K---
Q98H26_RHILO/2-102---------------------------------------------------IRHCVFVR-FR--G-DVP-ESER..A---
Y4036_STRCO/2-97---------------------------------------------------IRHLVLFK-LN--D-GVG-RDEPRVL---
Q89RS9_BRAJA/5-102---------------------------------------------------IRHIVMWR-LR--G-ETP-EERSAAR---
Q9AMS9_BRAJP/2-94---------------------------------------------------IRHIVFFS-AK--D-EAH-IHQI...---
Q9SYD8_ARATH/116-206---------------------------------------------------IGKITLLK-LK--E-NVM-EEAK...---
Q9SYD8_ARATH/5-102---------------------------------------------------VEHVVLFK-LN--D-DDV-DSGK.IN---
Q8XM37_CLOPE/2-100---------------------------------------------------IKHIVMWK-LK--D-EAE-GNSK..A---
O80887_ARATH/57-152---------------------------------------------------VEHVCLLK-AK--E-GLS-EEVE..K---
Q98BN1_RHILO/2-96---------------------------------------------------IRHTVVFT-LK--H-ASH-SLEE..K---
Q6J6I3_ENTCL/2-99---------------------------------------------------YKHIILFK-FK--E-FVS-ATNA..L---
Q41049_9ROSI/9-107---------------------------------------------------VKHTLLTR-FK--D-EIT-REQI..D---
Q7MWG5_PORGI/2-100---------------------------------------------------IKHIVMFK-LA--G-FDS-AEAK..T---
Q7UFZ5_RHOBA/16-113---------------------------------------------------LAHQVFFT-.T--K-DRS-DETI..N---
Q8G2X5_BRUSU/2-94---------------------------------------------------IRHIVFFS-VK--E-GQD-IETV...---
POP3_ARATH/8-104---------------------------------------------------VKHVLLAS-FK--D-GVS-PEKI..E---
Y5258_ARATH/6-100---------------------------------------------------FKHLVVVK-FK--E-DTK-VDEI...---
Q6YTX5_ORYSJ/40-141---------------------------------------------------VEHIVLIK-VR--P-EAA-SSGA.AA---
Q7N2N7_PHOLL/12-107---------------------------------------------------IAHQVLFT-FK--D-GIS-WDSE..K---
Q9SIP1_ARATH/158-254---------------------------------------------------VAKLTLLK-LK--E-DVA-DEAK..S---
Q7WCF6_BORPA/2-96---------------------------------------------------FRHIVMLG-FK--Q-PLT-TQDH..D---
Q7SEW8_NEUCR/10-117---------------------------------------------------IHRMTLFK-IP--D-ETN-QKRL..L---
Q9FDL1_ZYMMB/42-154---------------------------------------------------LQHIVLFR-FK--K-NVT-EAER..R---
Q27103_TRYVI/1-105---------------------------------------------------ICHAVFFS-LD--P-EKM-AANLPGN---
Q9ZA13_PSEHY/291-383---------------------------------------------------VEHVIFHC-WS--S-DVS-DVAA..M---
Q7D0A2_AGRT5/2-93---------------------------------------------------IRHIVFFT-VP--E-ENR-DAVR...---
Q42482_9ROSI/16-112---------------------------------------------------LKHIVFVR-FN--D-GIT-DEQI..E---
Q84FK9_ENTAG/2-99---------------------------------------------------YKHIILFK-FQ--T-SVS-TAEA..L---
Q726I9_DESVH/2-101---------------------------------------------------LKHIVWWT-LK--D-EAE-GATG..A---
O80887_ARATH/172-247---------------------------------------------------EEFVLLIT-FA--K-SAS-EKNT..K---
Q7URH4_RHOBA/33-129---------------------------------------------------LRHVVMFG-FK--D-ASS-EADV..Q---
Q97LN9_CLOAB/2-94---------------------------------------------------LTHIVFFK-LH--D-KKD-VGKV...---
Q6LGQ4_PHOPR/2-98---------------------------------------------------IRHILLIK-FK--D-SSP-ASEI..N---
Q8KCZ4_CHLTE/2-100---------------------------------------------------VKHIVMWR-LC--D-EAH-GNSA..Q---
Q7S418_NEUCR/3-107---------------------------------------------------IVHVELFE-FK--P-LAT-QEEV..Q---
Q6PWS2_9GAMM/35-133---------------------------------------------------LVHHVFFW-LK--R-PGS-PADR..E---
Q8ABC5_BACTN/2-99---------------------------------------------------VKHIVLFK-LK--D-EVP-EAEK..L---
Q6LYV0_METMP/2-100---------------------------------------------------IKHIVMWK-LK--E-NDK-DNDK..F---
Q82QQ6_STRAW/2-93---------------------------------------------------IYHINRVT-MK--A-TAT-PEQI..E---
Q9F304_STRCO/2-93---------------------------------------------------IHHQIRLA-MR--P-DAP-RDKV..E---
Q9SIP1_ARATH/49-144---------------------------------------------------IEHIVLFK-TK--D-DAD-STKI..T---
Q8RF81_FUSNN/2-98---------------------------------------------------LNHIVMWK-IK--E-DVE-DKEK..V---
Q6YTX5_ORYSJ/154-248---------------------------------------------------AVRLSLAK-LK--E-GVE-AHQL..A---
Q9A628_CAUCR/2-100---------------------------------------------------LFHQVFFW-LK--N-PGD-KADR..D---
Q93NG5_ARTNI/9-103---------------------------------------------------VRHVFAWR-VA--E-GSN-QEEI...---
Q7XBH1_ORYSJ/11-107---------------------------------------------------VKHILLAR-FK--E-DVA-PERL..D---
Q7W8L7_BORPA/4-98---------------------------------------------------FLHVVMME-FD--D-GID-AGFF..R---
O31026_VIBCL/2-98---------------------------------------------------IRHILLIK-FK--A-SAE-PSEI..E---

PF03992

YETG_BACSU/1-78--------------------------------------------------MFVQLRKMT.VK--E-GFA.DKVI--E---
Q930A7_RHIME/30-107--------------------------------------------------PVIRIAELE.ID--P-AQM.AAYS--A---
Q9L164_STRCO/44-120--------------------------------------------------RLRVVLLVE.VY--D-GAQ.QQFL--E---
Q9AE39_RHILE/1-81--------------------------------------------------MYIAMNRFK.VA--T-GSE.GDFE--T---
Q930L9_RHIME/3-79--------------------------------------------------DLTNVAYFT.AK--P-GRS.GELG--D---
ISDG_LISMO/1-86--------------------------------------------------MIIVTNTIK.VE--K-GAA.EHVI--R---
WH42_STRCO/45-121--------------------------------------------------RVRVVLMLD.VH--D-GMQ.QEFL--D---
ISDG_STAAW/2-79--------------------------------------------------KFMAENRLT.LT--K-GTA.KDII--E---
Q8Y476_LISMO/1-77--------------------------------------------------MLHIQAKVQ.VK--P-DLV.AEFL--V---
Q98L66_RHILO/1-81--------------------------------------------------MCIAMNRFK.VQ--N-GSE.ADFE--A---
Q98HA4_RHILO/1-77--------------------------------------------------MLLIIGTIR.LA--P-DRF.EEAR--P---
Q9A6W1_CAUCR/113-186--------------------------------------------------MYGLIGQML.AA--P-GKR.DELL--A---
O33291_MYCTU/2-75--------------------------------------------------PVVVVATLT.AK--P-ESV.DTVR--D---
Q9L4Y0_9ACTO/10-86--------------------------------------------------YYTLVNVFT.VS--P-DDQ.EKLY--R---
Q8YAL6_LISMO/1-77--------------------------------------------------MLHIEAQIT.VK--K-EQT.EAFL--Q---
Q9S457_SALTM/1-77--------------------------------------------------MIAVIFEVQ.IQ--P-DQQ.TRYL--T---
Q5LR19_SILPO/12-92--------------------------------------------------MREVVIVKSTPQ--R-GKF.NAFA--E---
NECA1_HUMAN/251-326--------------------------------------------------IMLVQRQMS.VI--E-EDL.EEFQ--L---
Q8XYB2_RALSO/23-99--------------------------------------------------PVVLVNLFL.LD--K-ADE.EAFL--R---
Q9CLF6_PASMU/1-77--------------------------------------------------MFAMLVEIN.IK--E-GKE.QEFL--E---
Q8KSW0_9ACTO/5-83--------------------------------------------------TFRVMLRMQ.IK--P-GME.ADFE--R---
Q8NLF1_CORGL/2-78--------------------------------------------------SIVKINAIS.VP--E-GAG.EELE--K---
O06569_MYCTU/1-77--------------------------------------------------MIFIVVKFE.TK--P-EWT.ERWP--D---
Q8NRX5_CORGL/1-76--------------------------------------------------MHIVNIRFK.PK--A-KYV.DTFR--Y---
Q9I1R9_PSEAE/4-80--------------------------------------------------AVRVVALLQ.AR--E-GRA.AEVE--R---
O32459_9ACTO/5-81--------------------------------------------------QVRVLVRYQ.AP--G-DDP.EAVV--Q---
Q9I267_PSEAE/43-119--------------------------------------------------RASHLVSIR.AR--S-GQS.HRLG--L---
Q9RTW6_DEIRA/23-100--------------------------------------------------PVLEIAMLN.VR--P-GQT.AEFE--A---
Q9RXN8_DEIRA/1-77--------------------------------------------------MITVANRIF.VN--P-ERA.AAFE--E---
Q9FC02_STRCO/14-92--------------------------------------------------PVVLIKTYT.VP--S-EEA.DYFT--E---
Q9K649_BACHD/1-78--------------------------------------------------MFFQVKTLR.VE--E-GHS.DKIV--E---
Q92MY2_RHIME/1-77--------------------------------------------------MVYIIAYLT.AH--A-GKG.DEVV--A---
O54259_STRNO/13-88--------------------------------------------------EVTFVNRFT.VH--G-GPA..EFE--S---
ISDG_BACHD/1-78--------------------------------------------------MVIVTNTSK.IT--K-GNG.EKLI--E---
Q8KY33_STRCU/4-79--------------------------------------------------GAIEVVLYH.L.--S-DEP.DLVL--P---
Q9RX23_DEIRA/3-80--------------------------------------------------PVSVHAVLT.PK--P-EHL.TEVE--A---
Q9ESB4_RAT/251-326--------------------------------------------------LQLVRQEMA.VC--P-EQL.GEFL--D---
Q92N21_RHIME/1-81--------------------------------------------------MYFAMNRFR.VA--A-GQE.EAFE--A---
Q99IW7_9BACT/1-74--------------------------------------------------MYGLIGKMR.AT--P-GQR.DALI--A---
SCHA_STRHA/23-99--------------------------------------------------RVRVVLMLD.IR--D-GTQ.AEVL--D---
NECA2_HUMAN/285-360--------------------------------------------------LQLVRQEMA.VC--P-EQL.SEFL--D---
Q8XW80_RALSO/11-88--------------------------------------------------MIAMTVSLA.VV--P-DSG.EAFE--R---
Q9HY51_PSEAE/4-80--------------------------------------------------PLTLIATIT.AA--P-GHA.EALE--R---
O68922_9ACTO/6-81--------------------------------------------------MVTMINQM..LL--H-GDE.SRFL--A---
Q97V29_SULSO/1-78--------------------------------------------------MINVGFYYK.VK--R-GFE.KDFE--N---
Y1783_SYNY3/49-125--------------------------------------------------PIVVAGNIK.VK--P-DKK.EEFI--A---
Q53908_STRCH/10-88--------------------------------------------------GFVAVVTFPVDG--P-ATQ.HKLV--E---
O06156_MYCTU/2-78--------------------------------------------------PVVKINAIE.VP--A-GAG.PELE--K---
A9CGS9_AGRT5/10-86--------------------------------------------------AVRLSGFLRCLS--E-DDV.ELVR--Q---
Y2021_HALSA/401-477--------------------------------------------------FGTMGMFYE.TK--P-EHT.AEFV--E---
Q8UIT6_AGRT5/6-83--------------------------------------------------PVVRMAEIE.ID--P-THL.EAYR--R---
Q9XAT7_RHOER/8-84--------------------------------------------------YVTVVWDAK.AK--A-GRE.ADLK--A---
Q8NRX6_CORGL/1-76--------------------------------------------------MILINVKFK.PL--P-EYV.DTFR--E---
Q93HM4_STRAW/16-92--------------------------------------------------RLRVVLLLD.LH--D-GAQ.KQFL--E---
Q9ABN2_CAUCR/2-78--------------------------------------------------TLILAGSIR.IA--P-ERL.AELR--P---
Q9YCC3_AERPE/2-78--------------------------------------------------AFAIANYIR.AE--T-PEAFDKVI--E---
Q8TTU6_METAC/1-76--------------------------------------------------M.KVVAKNQ.VK--P-EKI.QEFM--D---
Q8PWK2_METMA/2-78--------------------------------------------------AIRVVAKNQ.VK--P-EKV.QEFM--N---
CURD_STRCN/16-90--------------------------------------------------RMRVTLLVD.PS--R-RRQ.QEFL--D---
Q9X9W3_STRCO/128-214--------------------------------------------------IVIVDIEFEGPD--P-DRQ.RAWV--D---
O54100_STRCO/29-106--------------------------------------------------MSTAVTEFT.VA--A-PAQ.GAFE--N---
Q9CFE4_LACLA/2-80--------------------------------------------------TITVNILYQ.GE--G-EKA.HLFA--D---
Q92Y06_RHIME/4-80--------------------------------------------------SIKVVARVM.IT--P-GNE.DAFE--T---
YQJZ_BACSU/12-86--------------------------------------------------PYYAVIFSS.VK--S-END.TGYG--E---
Q8PEE0_XANCP/7-83--------------------------------------------------PIVVVARWS.VP--A-SAR.AIVL--A---
A9CLL3_AGRT5/1-78--------------------------------------------------MIYEIAMLP.VQ--K-DKI.SEFR--Q---
Q9FD14_STRCU/8-84--------------------------------------------------VFRVMLRMQ.IK--S-GME.HEFE--K---
Q9HYL5_PSEAE/1-78--------------------------------------------------MYCIFIKAR.LR--P-GCA.EAFI--D---
Q7CRR7_AGRT5/5-81--------------------------------------------------AFVVIAEFR.VK--P-DAM.DAFL--D---
Q8YJD4_BRUME/1-77--------------------------------------------------MIAVIFEAW.VP--G-EAQ.TEYL--D---
Q9HHS4_HALSA/1-77--------------------------------------------------MIVVHATFR.FD--P-DAR.DDAL--E---
Q9I5L9_PSEAE/2-79--------------------------------------------------TYHVLVQFD.VP--S-DKR.EAFA--A---
TCMH_STRGA/10-86--------------------------------------------------LFTLVNVFG.VA--P-EKQ.RELR--D---
Q54813_STRPE/13-95--------------------------------------------------SVTFVNRFT.LS--G-SAE.D.FE--A---
Q8KL47_RHIEC/8-84--------------------------------------------------EQHLVVEFK.TT--S-QNR.NRVK--E---
Q8KSV9_9ACTO/5-80--------------------------------------------------PAVEVVLYH.L.--S-PSG.EDVL--A---
LSRG_ECOLI/1-77--------------------------------------------------MHVTLVEIN.VH--E-DKV.DEFI--E---
Q98HP0_RHILO/1-74--------------------------------------------------MYGLIGKMR.AS--R-GQR.DAVM--D---
Q8Y824_LISMO/4-80--------------------------------------------------GYGLLTAFY.TH--P-GER.DHLV--K---
Q9I6L9_PSEAE/2-78--------------------------------------------------SASQVIRIR.AR--N-GQS.ERLG--L---
Q8YC27_BRUME/1-81--------------------------------------------------MFIAMNRFK.VR--I-GSE.TDFE--T---
ISDI_STAAM/1-78--------------------------------------------------MFMAENRLQ.LQ--K-GSA.EETI--E---
Q9KLV5_VIBCH/1-77--------------------------------------------------MIHLLAEIK.AF--P-DSA.QQVQ--A---
YGIN_SHIFL/1-87--------------------------------------------------MLTVIAEIR.TR--P-GQHHRQAV--L---
Q983R7_RHILO/10-88--------------------------------------------------VITQINVFT.VP--E-GGQ.QALI--D---
O32458_9ACTO/9-85--------------------------------------------------VFRVMLRME.IV--P-GRE.AEFE--R---
NECA3_HUMAN/295-370--------------------------------------------------ILMAQRQVQ.VA--E-EGL.QDFH--R---
Q8NMA1_CORGL/2-78--------------------------------------------------SFVNITALT.FP--A-GAE.KEIE--Q---
Q9RSM4_DEIRA/18-94--------------------------------------------------MVISHGTLS.AS--A-EHA.AHLR--Q---
O86332_MYCTU/4-79--------------------------------------------------PVAVIARFM.PR--P-DAR.SALR--A---
Q9JYI1_NEIMB/3-79--------------------------------------------------NIKIVALVT.VK--P-EYT.ETLA--A---
Q9A6G2_CAUCR/1-78--------------------------------------------------MIGVVATLK.VQ--P-AKA.AEFE--K---
Q97SM8_STRPN/11-89--------------------------------------------------TLTIHVYYK.GD--G-DSA.IKFA--R---
Q9I1K5_PSEAE/247-321--------------------------------------------------PYYAVIFSS.HR--S-AVD.DGYA--E---
Q97DS8_CLOAB/1-78--------------------------------------------------MVKVVAKNF.IK--E-EKI.EDVL--K---
Q927R5_LISIN/1-77--------------------------------------------------MIHIEAKIQ.VK--P-DFI.ESFL--K---
Q9X5D6_ZYMMB/6-82--------------------------------------------------EFDITTILT.AK--A-DQQ.EALQ--Q---
Q9L552_9ACTO/13-88--------------------------------------------------AVTFVNTFT.VH--A-EPE..VFE--K---
Q9CHY3_LACLA/1-77--------------------------------------------------MIIVNAKFY.IK--E-DKK.SQFL--K---
A9CJ79_AGRT5/1-77--------------------------------------------------MIAVIFEVW.PA--E-GEK.QHYL--D---
Q8NUM1_STAAW/43-119--------------------------------------------------SLCVLNHLY.IN--E-GQE.ETFE--Q---
Q98DQ1_RHILO/1-77--------------------------------------------------MIAVIFEVQ.PA--E-GRR.DAYL--A---
YHGC_BACSU/65-140--------------------------------------------------GFAVLNNIA.VT--Q-EGR.PLFE--N---
YCZJ_BACSU/1-78--------------------------------------------------MVREAAMLH.IK--E-GLE.QEFE--D---
Q9RSI3_DEIRA/10-86--------------------------------------------------PVSLVIRRR.IR--P-GKE.AEYE--A---
Q93LN2_FLAJO/1-77--------------------------------------------------MFVRIVKMS.FH--E-EKI.PDFL--E---
Q92VV2_RHIME/1-77--------------------------------------------------MLIQMVSIN.VK--Q-GHA.ADFL--E---
Q8RDZ4_FUSNN/112-188--------------------------------------------------TFAVYTVID.VK--P-END.KEFA--E---
Q93SH3_BRAJP/1-79--------------------------------------------------MFIAMNRFQ.VK--K-GAE.TAFE--T---
A9CHT4_AGRT5/1-79--------------------------------------------------MFIAMNRFR.VV--P-GYE.ETFE--S---
Q9RKA2_STRCO/1-77--------------------------------------------------MIFITAKFR.VL--P-EHA.DQWP--Q---
Q9ZBJ4_STRCO/2-77--------------------------------------------------TYGCIASMK.TR--P-GFR.EEVV--S---
Q9RX69_DEIRA/1-77--------------------------------------------------MITVMNRIG.VK--P-EFA.AQFE--E---
YCNE_BACSU/1-77--------------------------------------------------MIVLQAYIK.VK--P-EKR.EEFL--S---

PF11695

A3K1D6_9RHOB/5-147---------------------------------------------------LAELNIGR.LV--A-.PT-DDPR------
A3UM10_VIBSP/3-142---------------------------------------------------LAQLNIAL.AK--Y-.PL-DAPE------
A4ELL4_9RHOB/3-145---------------------------------------------------LAELNIGR.LL--A-.PT-DDPR------
Q9A5F4_CAUCR/31-169---------------------------------------------------LAQVNVGR.LK--A-.PI-DHPM------
A4XU80_PSEMY/15-153---------------------------------------------------LAQLNIAW.MK--A-.SL-ESPE------
A0P3D7_9RHOB/6-156---------------------------------------------------LALYTFGQ.FR--T-.RS-DHPD------
Q0RBQ9_FRAAA/10-154---------------------------------------------------LAQVNIAR.LR--A-.PL-DDPI------
A3VI98_9RHOB/8-150---------------------------------------------------LAELNVGR.LV--A-.DT-EDPR------
Q1KY61_9BURK/6-145---------------------------------------------------LAQINIAH.AQ--A-.PM-DSAL------
Q2JDS7_FRASC/6-149---------------------------------------------------LAQVNIAR.LL--A-.PP-GSSA------
A1K291_AZOSB/3-141---------------------------------------------------LAELNVAR.LL--A-.PI-DSPQ------
A2TR58_9FLAO/5-145---------------------------------------------------LAQLNVAR.MK--G-VSI-EDPE------
B0T5Z4_CAUSK/7-145---------------------------------------------------LAQVNFGR.LR--A-.PV-DHPM------
Q027R7_SOLUE/5-144---------------------------------------------------LAQVNIGR.IL--H-.PI-DDPR------
A4FAH4_SACEN/6-146---------------------------------------------------LAQVNIAL.PV--A-.PM-DSAE------
Q2CEG7_9RHOB/3-154---------------------------------------------------LALYTFGQ.FI--E-.PA-DDEA------
Q9XAE9_STRCO/9-148---------------------------------------------------LAQVNIAR.LK--A-.PL-DSPQ------
A9B229_HERA2/6-144---------------------------------------------------LAQLNIGT.IK--A-.PL-DTPL------
A4CB40_9GAMM/3-142---------------------------------------------------LAQLNIAK.AK--Y-.SL-EAPE------
E0TC84_PARBH/7-147---------------------------------------------------LAQVNIGR.VL--G-.GP-DAPA------
Q2CA10_9RHOB/6-148---------------------------------------------------LAELNVGR.LV--A-.DT-DDPC------
Q0RPH8_FRAAA/6-149---------------------------------------------------LAQVNIAR.VL--A-.PL-DSPA------
A4BK13_9GAMM/5-143---------------------------------------------------LAQLNIAE.LK--A-.PL-DSPE------
Q0APS8_MARMM/5-140---------------------------------------------------LAQLNIAW.MR--G-.SI-DDPV------
Q163R1_ROSDO/8-150---------------------------------------------------LAELNVGR.LA--A-.PT-DDPR------
Q0BYF9_HYPNA/5-156---------------------------------------------------LVHFNCVRPLG--A-FAL-DNPY------
A1WRH2_VEREI/5-144---------------------------------------------------FAQFNVAW.LK--K-.PL-DHPD------
A5VYW1_PSEP1/5-142---------------------------------------------------LAQFDLVK.PS--F-.PR-GHVK------
A3JUK4_9RHOB/9-148---------------------------------------------------LAEINVGR.LI--A-.DV-DDPR------
A0NQQ0_9RHOB/7-146---------------------------------------------------LAELNVAR.LR--Y-.EI-TDPR------
A5FB02_FLAJ1/6-148---------------------------------------------------LAEINIAK.MK--G-VNI-NDPI------
A3XCS8_9RHOB/4-143---------------------------------------------------LAEINIAR.LK--H-.DA-DDLR------
Q15UR5_PSEA6/3-142---------------------------------------------------LAQLNIAT.TL--Y-.PI-DAPE------
B1KJR7_SHEWM/10-149---------------------------------------------------LAQLNIAK.AR--G-.EM-DEPL------

PF07682

Q972K4_SULTO/2-304------------------------------------------------PKPYVAINMVE-VR--N-DPKTLELF--G---
O66762_AQUAE/7-333------------------------------------------------KGVAVAINKAK-VN--N-TPRFQELM--Y---
Q977W3_9CREN/2-304------------------------------------------------PKPYIAINMAD-LK--N-EPKTFEMF--S---

PF07978

Q7PGV6_ANOGA/173-270--------------------------------------------------YE..IRSYR-LK--P-GTM-IEW.------
Q7SGJ2_NEUCR/232-329--------------------------------------------------FE..LRSYT-LH--P-GNL-LEW.------
Q5LMH4_SILPO/1-102--------------------------------------------------MLTCIIRYH-ID--P-TKR-AQF.------
Q6W252_RHISN/3-102--------------------------------------------------YE..IRTYR-LK--N-GAI-PAY.------
Q7ZWJ6_DANRE/154-253--------------------------------------------------FE..LATFQ-MK--S-GGP-AVW.------
Q7A8Q2_ECO57/4-98--------------------------------------------------VE..ILQYT-LR--K-GSG-AAF.------
Q98EJ3_RHILO/1-102--------------------------------------------------MITCYLKYV-ID--P-YKL-AEF.------
Q89P12_BRAJA/7-101--------------------------------------------------VD..LRVYT-IR--L-RKM-AEF.------
Q89KU9_BRAJA/3-106--------------------------------------------------YE..MRVYR-CV--P-GRL-PAL.------
Q8GHL5_PSERE/107-204--------------------------------------------------YE..LRVYD-LV--P-AGL-APT.------
Q8P3X3_XANCP/13-105--------------------------------------------------ENQLFAALC-DR--P-YLL-AEF.------
Q82QD1_STRAW/4-107--------------------------------------------------YQ..LRVYT-LR--S-PEA-LVA.------
NIPS2_MOUSE/182-279--------------------------------------------------YE..LRSYQ-LR--P-GTM-IEW.------
Q98DQ0_RHILO/2-103--------------------------------------------------TITCFIRYE-ID--P-FGK-AAF.------
Q98IN9_RHILO/48-151--------------------------------------------------YE..LRIYD-CL--P-GRL-PAL.------
Q89JD9_BRAJA/9-109--------------------------------------------------SVTVFIRYQ-LD--P-FKR-AQF.------
Q5M949_RAT/37-136--------------------------------------------------YE..FRTYS-LK--P-SKT-NAF.------
Q7VX89_BORPE/3-102--------------------------------------------------IE..ERDYR-IK--P-GKA-GLF.------
Q9L992_VIBMI/3-103--------------------------------------------------MITCYVRYV-ID--P-KKV-NEF.------
Q8FYG5_BRUSU/1-102--------------------------------------------------MITCVITYD-ID--P-NRQ-ELF.------
Q983U2_RHILO/146-257--------------------------------------------------VV..IRIHH-LR--S-GAE-TEF.------
Q8GHL5_PSERE/5-96--------------------------------------------------YE..LMTFT-VR--V-RTV-TPA.------
NIPS1_MOUSE/185-282--------------------------------------------------YE..LRTYK-LK--P-GTM-IEW.------
Q6DJ76_XENTR/46-144--------------------------------------------------YE..FRTYT-VK--P-AMM-SDF.------
Q88JP3_PSEPK/3-104--------------------------------------------------YE..LRTYT-LD--P-LKM-ADW.------
Q6C7U3_YARLI/393-490--------------------------------------------------FE..LRTYD-LK--P-GKL-MEW.------
Q5M949_RAT/146-245--------------------------------------------------YE..LATFQ-MK--P-GGP-ALW.------
Q89P26_BRAJA/3-96--------------------------------------------------YE..IATLT-VK--L-GTA-AKA.------
Q89P26_BRAJA/107-202--------------------------------------------------YE..IRTYR-LK--H-GGV-PPT.------
Q983U2_RHILO/19-118--------------------------------------------------VE..LRQYT-LN--P-GQR-ETL.------
A9CLJ4_AGRT5/3-102--------------------------------------------------VE..ERIYR-IR--G-GKM-QEY.------
NPS3A_PONAB/37-136--------------------------------------------------YE..FRSYY-LK--P-SKM-NEF.------
A9CJ80_AGRT5/1-102--------------------------------------------------MLTCFIRYE-ID--P-FKV-DAF.------
Q6DJ76_XENTR/154-253--------------------------------------------------YE..LVSFQ-FK--P-GGP-AVW.------
Q9R6I8_RHIRD/8-124--------------------------------------------------PVTCEVRYR-VD--Q-CRV-SEF.------
YMQ1_CAEEL/427-524--------------------------------------------------YD..LRSYV-LQ--P-GTM-IDW.------
Q63UF8_BURPS/3-102--------------------------------------------------YE..IRTYR-VK--T-GAV-LAY.------
Q7ZWJ6_DANRE/45-143--------------------------------------------------YE..FRTYY-IQ--P-HLN-AAF.------
Q6N5T9_RHOPA/71-174--------------------------------------------------YE..SRVYR-CV--P-GKL-PAI.------
Q9PU59_DANRE/177-274--------------------------------------------------YE..LRSYQ-LL--P-GTM-IEW.------
Q9AH04_RHOER/3-100--------------------------------------------------HE..LREYL-AL--P-GRA-EDL.------
Q7UP06_RHOBA/160-263--------------------------------------------------YE..LRLYE-SA--N-ERL-GDLK------

PF05336

Q7CTD6_AGRT5/2-109---------------------------------------------------PRMGFCLN-LR..P-GTV-EEYKRLH---
Q7CW72_AGRT5/2-109---------------------------------------------------QRMGMVIG-VK..P-EMI-AEYKRLH---
RHAM_MANSM/2-104---------------------------------------------------IRKGFVMQ-VN..P-DCH-AEYKKRH---
RHAM_OCEIH/2-104---------------------------------------------------KRKGFIMT-VY..P-DKH-DEYEKRH---
RHAM_RHILO/3-105---------------------------------------------------EKYAFKMK-LK..P-GMK-AEYKKRH---
RHAM_VEREI/4-106---------------------------------------------------EKVAFRMF-LI..P-GCA-AEYQRRH---
RHAM_ENT38/2-104---------------------------------------------------IRKAFVMQ-VN..P-DSH-DEYERRH---
B8G8A8_CHLAD/2-107---------------------------------------------------KRVGFTLK-VK..P-ELI-EEYKAHH---
Q0U0I1_PHANO/9-125---------------------------------------------------RRIGQWLY-LN..P-ARI-DEYKKCH---
Q2CGS4_9RHOB/3-103---------------------------------------------------FRRAWTMR-LR..A-GAE-AAYDAAH---
RHAM_RHIL3/4-106---------------------------------------------------EKHAFKMQ-LN..P-GME-AEYRRRH---
Q5YUK3_NOCFA/6-109---------------------------------------------------ERVCFLLS-LR..P-DRI-EDYLAAH---
Q9RD70_STRCO/2-106---------------------------------------------------QRVCFLLK-VR..R-DRI-AEYRERH---
RHAM_ROSDO/3-105---------------------------------------------------ERYVFRMR-LN..P-GKQ-AEYQRRH---
RHAM_CLOB8/2-104---------------------------------------------------IQKAFKMK-LF..E-GKE-EEYKKRH---
A6UJC5_SINMW/2-109---------------------------------------------------QRMGMVIG-LE..S-AKL-AEYKRLH---
Q2CD72_9RHOB/2-104---------------------------------------------------QKYAFRMN-LH..P-GKA-EEYKSRH---
B2TGR4_BURPP/1-110---------------------------------------------------MRYCFALD-LKDDQ-ALI-ESYEKYH---
Q01TX0_SOLUE/2-105---------------------------------------------------PRYAFKLR-IK..P-EAV-EEYEIEH---
A5FI86_FLAJ1/2-110---------------------------------------------------QKYCLALD-LNNHP-DLI-AEYIDYH---
A1CPH6_ASPCL/5-116---------------------------------------------------RRIAQIVH-LK..P-SAV-AAYKECH---
A1RB67_ARTAT/3-104---------------------------------------------------ESIALHTR-LK..P-GTE-EAYADAH---
Q1J3P3_DEIGD/11-115---------------------------------------------------QRVCFLLQ-VR..P-DRL-AEYRARH---
Q9HK61_THEAC/1-101---------------------------------------------------MRYAFHLR-LK..E-GSE-EEYTRRH---
RHAM_BACSU/2-104---------------------------------------------------KRKASIMF-VH..Q-DKY-EEYKQRH---
Q7SE90_NEUCR/56-169---------------------------------------------------RRFAQIIK-LK..A-EYI-DKYREVH---
Q0S9A0_RHOSR/2-105---------------------------------------------------NKYCFTLQ-LR..P-DRI-DEYVRRH---
A1ULG3_MYCSK/7-108---------------------------------------------------ERVCFLLH-LK..R-DRI-DDYLTAH---
A0M226_GRAFK/5-115---------------------------------------------------KRLCYSCD-LKDDP-QLI-EKYKEYH---
RHAM_BACTN/2-104---------------------------------------------------KREAFKMY-LK..P-GYE-AEYEKRH---
Q55IY9_CRYNB/18-130---------------------------------------------------KRICQIVK-VK..P-ERL-DEYKKVH---
Q9RC86_BACHO/5-108---------------------------------------------------KKFAWTWT-VK..E-SCL-EEYVAMH---
Q4EHA7_LISMN/2-104---------------------------------------------------ERVASIMY-LY..P-GNQ-EEYKKRH---
Q0FS08_9RHOB/4-106---------------------------------------------------EKHAFRMV-LN..E-GQL-DEYKRRH---
RHAM_YERPE/2-104---------------------------------------------------IRKAFVMA-VN..P-DAH-AEYQRRH---
Q8A896_BACTN/18-128---------------------------------------------------KRYCQTLD-LRDSP-ELI-AEYRKRH---
RHAM_CLOPH/2-104---------------------------------------------------VRKAFKMQ-LF..E-GQA-KEYEKRH---
A0NP38_9RHOB/2-104---------------------------------------------------EKYAFKMK-LN..P-GME-AEYRKRH---
Q017X5_OSTTA/19-126---------------------------------------------------KTYAQTIE-LR..A-DGV-EEYVRLH---
A0RPU5_CAMFF/262-367---------------------------------------------------QKFASVIK-IR..K-DKI-DTYKKLH---
A1WK61_VEREI/2-109---------------------------------------------------QRHGAVIG-IR..A-EML-EEYKALH---
RHAM_ERWCT/2-104---------------------------------------------------LRKAFVMS-VF..P-DSH-DEYQRRH---
RHAM_BURPP/2-104---------------------------------------------------ETIAFRMV-LN..P-GMR-EEYERRH---
A0K063_ARTS2/1-107---------------------------------------------------MRVCFRSS-VQ..P-GLI-DEYRRRH---
A1RAY8_ARTAT/1-104---------------------------------------------------MRVCFRSS-VQ..P-ELM-AEYKQRH---
RHAM_FLAJ1/5-107---------------------------------------------------IRNAFTMK-VK..S-GFE-TEYKIRH---
RHAM_LACS1/3-108---------------------------------------------------VRLGQIMH-VN..P-NYY-DEYEKRH---
Q0PB25_CAMJE/2-105---------------------------------------------------QRYGQIIK-IK..K-EKI-EEYKELH---
RHAM_BACSK/2-104---------------------------------------------------IRKATVMK-VY..K-DKY-DDYKQRH---
Q1GLV0_SILST/2-109---------------------------------------------------QRMGMVIG-IK..P-ERL-DEYKRLH---
Q986Z5_RHILO/2-109---------------------------------------------------QRMGMVLG-LK..P-EKV-EEYVRLH---
Q0G1U8_9RHIZ/12-114---------------------------------------------------ERYAFRMA-LN..S-GMA-DEYRRRH---
Q0C0B4_HYPNA/2-109---------------------------------------------------LRKAMMIR-LN..P-EKM-EEYKRLH---
A0QQ10_MYCS2/2-106---------------------------------------------------QRVCFVLQ-LR..P-ERM-DEYLTAH---
Q9RJV5_STRCO/8-113---------------------------------------------------RRVASVIR-LR..P-EHA-ERYRELH---
Q826A8_STRAW/1-104---------------------------------------------------MRIALHTK-VR..A-DRV-AAYEAAH---
RHAM_LACPL/2-104---------------------------------------------------VRLGQVMY-LH..K-DAY-EEYAKRH---
RHAM_JANSC/2-104---------------------------------------------------EKYAFKMQ-LT..P-GCL-AEYRKRH---
RHAM_AGRT5/5-107---------------------------------------------------EKHAFRMK-LF..A-GKE-VEYKKRH---
RHAM_BURCH/2-104---------------------------------------------------ETIAFRMH-LH..P-GKR-DEYRRRH---
RHAM_ACICJ/2-104---------------------------------------------------EQIAFRMQ-LD..P-AQA-AEYERRH---

PF05949

A4XI07_CALS8/93-243------------------------------------------------KDELDKVKILAGLTDVE-GPG-IIITLDD---
YLXW_BACSU/89-226------------------------------------------------LEDTEKYRMYIGEVGVQ-GEG-VEVTLED---
YLXX_BACSU/83-233------------------------------------------------NNTLQSLKKTAGMTDIT-GSG-IVITISP---
A0LU92_ACIC1/145-295------------------------------------------------RAELDRLSLLTGATPVA-GPG-AEVTLAD---
A3TKX2_9MICO/127-287------------------------------------------------AQSVERLSLVAGAVPVR-GPG-FVVTLDD---
A1SK85_NOCSJ/127-266------------------------------------------------QARVQRLGAVTGFGAVT-GPG-VRVTVDD---
A6WCM5_KINRD/131-288------------------------------------------------DARAEGLAVAAAATAVT-GPG-LQVVLDD---
A0QGP0_MYCA1/147-305------------------------------------------------LKRLDALGLAAASTAVI-GPG-LKVTVTD---
A1KJN5_MYCBP/147-305------------------------------------------------LARLDVLSLAAASAPVV-GPG-LTVTVTD---
A0QYG6_MYCS2/148-306------------------------------------------------LDDLDSANVAAAAVPMI-GPG-LTVTVTD---
A1T9U1_MYCVP/136-294------------------------------------------------LTDLDQAEQAAAATPVI-GPG-VTITVTD---
Q1B829_MYCSS/143-301------------------------------------------------LADLDVADVAAAATPVI-GPG-LTVAVTD---
Q0SI94_RHOSR/127-284------------------------------------------------LDELRGLEGDAGVEAVH-GPG-LTVTLTD---
Q8G9N0_RHOFA/126-281------------------------------------------------LDRLDAVESAAGIDSVT-GPG-LSVVVTE---
A8KY04_FRASN/136-295------------------------------------------------NAEIDALAAPAGLAPAR-GPG-ARVTLVD---
A7BCD9_9ACTO/130-277------------------------------------------------IAVDGARDLVTATRPVS-GPG-ITVTLTD---
Q6A8T9_PROAC/110-254------------------------------------------------TPRNDEAGQDSAMIPMA-GPG-VRIILDD---
A7A5S8_BIFAD/121-280------------------------------------------------NQTMQDDEMVNGTLPVQ-GEG-IVLTVAN---
Q8G697_BIFLO/165-324------------------------------------------------SDTLIQDEMVNGATVVE-GEG-ITMTLAD---
A0LQT1_ACIC1/85-241------------------------------------------------RTAADELAGSVGLRPET-GPG-LIVTLDD---
A8LWH0_SALAI/110-266------------------------------------------------QARAAASREAAGFTELT-GQA-VTVELDD---
Q0RB08_FRAAA/88-247------------------------------------------------GGPVTGLAAAAGLAPVH-GPA-LTVELDD---
Q2J4K8_FRASC/167-328------------------------------------------------RSLVESLAGPAGLAPVR-GPA-LTVELDD---
A8LCG0_FRASN/122-286------------------------------------------------LDRRAALAAQVGLTAMR-GPA-VTVELDD---
A6W3X9_KINRD/92-247------------------------------------------------PLRDAALGTASGALAVT-GPG-VTVTLDD---
A3TN20_9MICO/92-247------------------------------------------------ERKADALGVSAGRTAVQ-GPV-VEVQLDD---
Q82FC4_STRAW/110-269------------------------------------------------EEKLAALEKSAGTQKLK-GKA-VTVTLND---
Q6ABC5_PROAC/122-276------------------------------------------------ISSASALAPSVGLGAVS-GKA-LRVTLDD---
A0PKC5_MYCUA/85-242------------------------------------------------LRRARELASEADMDPAH-GPG-LVVTLND---
A4KN44_MYCTU/100-257------------------------------------------------QRRSAKLAGVAAMNPVH-GPG-LVVTLQD---
Q1BG49_MYCSS/116-273------------------------------------------------TNRSAALAAEAGLNPVK-GPG-LVVTLND---
A0ZZD3_BIFAA/87-247------------------------------------------------SQDSESAGNGTMLPAVE-GPG-LVVTLDD---
Q8G6P6_BIFLO/94-254------------------------------------------------GKDSSNVDSSLMLPALS-GSG-VTVTLDD---
A1SCN6_NOCSJ/110-267------------------------------------------------QRRVEELKDPAGLVPRS-GPG-ISVTLSD---
Q251Q0_DESHY/89-241------------------------------------------------LEQLDTAKRNAGLTKVT-GPG-LRITLDD---
A9AXV7_HERA2/93-248------------------------------------------------RTQIDQQQQMAALVAMR-GPG-VVVTLND---
A4J2B7_DESRM/82-226------------------------------------------------QEELEKIRQLAGLTKLQ-GPG-VEVNLSP---
A5D137_PELTS/88-234------------------------------------------------ESELAKVRLYAGLTPVQ-GPG-VEVVLEN---
Q3AAF2_CARHZ/83-228------------------------------------------------ISEINKNRFWAGATPAY-GPG-VRVILNN---
Q67L65_SYMTH/79-224------------------------------------------------EAELERLRLLAGTTAVT-GPG-VVVTLSE---
A6P1Q7_9FIRM/94-243------------------------------------------------RAEVDKLEMEAGLVEVV-GPG-VMVSLQD---
Q2RGA3_MOOTA/82-238------------------------------------------------QKEIDSLRLTAGLVAVT-GPG-ITVTLDD---
A6CTV4_9BACI/94-231------------------------------------------------AEDAEKYRMFLGKVKVQ-GPG-VRVTLSD---
Q2B4P0_9BACI/100-237------------------------------------------------AEDAEKYRMYLGKVAVL-GKG-VEVTLAD---
Q65JX7_BACLD/88-225------------------------------------------------VEDVERYRMFVGEIGVQ-GEG-IKVTLKD---
Q5L0X4_GEOKA/92-229------------------------------------------------AKEAEQLRMHVGKARVK-GKG-VAVTLSD---
Q9K9T3_BACHD/98-239------------------------------------------------IEDVEKLRKITGAVPVQ-GQG-IEITLDD---
A0Q065_CLONN/89-243------------------------------------------------KNEILNNEMILGNEDVE-GEG-VIVTLGD---
A5N7F2_CLOK5/89-240------------------------------------------------NEEIDKANILLGKVAVE-GQG-ISIYLDD---
A7FQ29_CLOB1/87-241------------------------------------------------NKEIFQNKLQLGTIPVE-GPG-VKIVLND---
Q894C4_CLOTE/87-241------------------------------------------------KMQIEENNINIGLVDME-GPG-IELTMED---
Q97H91_CLOAB/88-246------------------------------------------------EDELILNKMELGTLDVV-GEG-VEITLDD---
Q0SRW9_CLOPS/87-241------------------------------------------------IEELNNNLMLSGLEEAK-GPG-LKIVLED---
A6LTT1_CLOB8/87-240------------------------------------------------KTQISDYKSFIGSNNVE-GPG-IILKIND---
B8I727_CLOCE/90-232------------------------------------------------SDEIQKLKTVAGLTKVK-GKG-VIVTFSK---
A3DEC8_CLOTH/87-233------------------------------------------------KEQLTRARMLAGLVDVQ-GPG-VEIVLDD---
A3DEC9_CLOTH/87-236------------------------------------------------AREWEKAKLVAGLTDVV-GNG-VIVYLAD---
A4IM11_GEOTN/83-232------------------------------------------------EATVAELREEAGLTKVK-GSG-IVLMIAP---
A6CTV5_9BACI/80-233------------------------------------------------RETLEELKEEAGLVEKS-GPG-LILTVEP---
Q2B4N9_9BACI/85-238------------------------------------------------KETLDELKEEAGLTEVK-GPG-VIILIEP---
Q9K9T4_BACHD/82-232------------------------------------------------EEQIETLRESAGLTEVS-GEG-LVITIKS---
A8FCY5_BACP2/83-233------------------------------------------------TKTLKDLKEKAGFTEVE-GEG-IEIEISQ---
Q65JX6_BACLD/83-233------------------------------------------------NETLQNLKKQAGFTDVT-GNG-IIITISQ---
A6TMJ2_ALKMQ/87-232------------------------------------------------RIEVDQHRLLAGHTDVE-GPG-MIITIEG---
A8MIM5_ALKOO/74-221------------------------------------------------KGNVDEYKMIAGYTNVS-GPG-INIVLDS---
Q180E1_CLOD6/78-226------------------------------------------------ISEIETLRDSLSYSDVK-GSG-IILSIDA---
A6TKZ4_ALKMQ/88-242------------------------------------------------KTDLQRYHMMIGSTDVK-GPG-LKITLTD---
A6TS58_ALKMQ/88-242------------------------------------------------RNDLDRFQIMSGSKALQ-GPG-VSITIAD---
Q182Y3_CLOD6/85-232------------------------------------------------KSEIEKYETLAGYTDVE-GTG-IKIEINS---
Q251P9_DESHY/84-225------------------------------------------------LAELDRYRMMEGTVNVQ-GPG-IVITIDD---
A1HU46_9FIRM/75-225------------------------------------------------SRETELIKMGAGVVALH-GPG-IIVTIDD---
B0KDA6_THEP3/93-243------------------------------------------------QQDVEKYKILAGLTDMV-GPG-VIVTVND---
Q8R9G9_THETN/86-236------------------------------------------------KSEVEKYKELAGLTDLQ-GPG-VIVTVND---
A4J2B6_DESRM/80-231------------------------------------------------RTDLETFRILAGIKAVK-GPG-VEVTLND---
A5D138_PELTS/79-229------------------------------------------------KEELEKVGIMAGVTELT-GPG-VEVTLND---
Q3AAF1_CARHZ/87-236------------------------------------------------QDTLTKYQILAGTLAVE-GPG-VEVTLDD---
Q67Q42_SYMTH/86-236------------------------------------------------AERLEQAQIHAGLLPLT-GPG-VTVVMAD---
Q0AYQ4_SYNWW/82-232------------------------------------------------QADLQDANMSAGLMAVE-GPG-VIITVND---
A6TS57_ALKMQ/86-237------------------------------------------------EAEIDNMMLTSGMIDLE-GPG-VTVRMTD---
A0Q063_CLONN/87-239------------------------------------------------VKKLEDTRILTGSVDVE-GEG-VIIYITP---
A5N7F0_CLOK5/88-236------------------------------------------------LKDLEDSRMLTGEVDVK-GPG-VIIYLTP---
A7GDF0_CLOBL/87-234------------------------------------------------IKELETTRLLIGNTNVE-GPG-VVIYLNP---
Q894C2_CLOTE/87-233------------------------------------------------LKELEKTRLLTGTTDVE-GPG-ITIYLVP---
Q97H89_CLOAB/87-241------------------------------------------------VNELNTSNMLIGSVDVT-GPG-IILVITP---
A6LTS9_CLOB8/88-240------------------------------------------------KNQLDEARMHLGIVDVK-GQG-IVLTITP---
Q0TPA0_CLOP1/87-237------------------------------------------------KEQLDKTRMILGTEEVK-GPG-IILSITP---
Q2RGA2_MOOTA/88-230------------------------------------------------EKELARLQMNTGLAAVK-GPG-ITVTITG---
A3KKU2_STRAM/149-288------------------------------------------------LEKERQLGVLAGTVAAQ-GPG-ITVTIQD---
A3TKX4_9MICO/129-268------------------------------------------------QQRLDSLAIMAGTAPAR-GPG-IVLTIRD---
A6WCM3_KINRD/104-249------------------------------------------------QQRAREYGLLAGTLPAH-GPG-IVATVGD---
Q0RNH1_FRAAA/108-249------------------------------------------------RARADELAILAGTVPVG-GPG-LELTIRD---
A8KY02_FRASN/141-282------------------------------------------------RREAEALAVLAGTGPAT-GPG-VTLRIDD---
C1APA2_MYCBT/148-291------------------------------------------------QARLAALSILVGAVGAT-GPG-VMITIDD---
A3Q0H9_MYCSJ/122-269------------------------------------------------QARLAALSILIGAVGAT-GPG-VVLTITD---
A4TA87_MYCGI/105-253------------------------------------------------RARLAALSILIGSIAAT-GPG-VILTVTD---
Q0SI96_RHOSR/103-247------------------------------------------------QARLTALSIQVGSAPAT-GPG-VTMRITD---
Q8G9M8_RHOFA/99-242------------------------------------------------QERLSALSIQIGTVAAR-GPG-VTLTIDD---
A1SK83_NOCSJ/101-242------------------------------------------------QQEADTLSILAGLVPVT-GPG-IRVTVTE---
Q6A8T7_PROAC/107-249------------------------------------------------EERLTRMKILAGTIPVH-GPG-IKITIDD---
A7A5S6_BIFAD/132-273------------------------------------------------KQNAQTNGILSGRLAAT-GEG-VVIRISQ---
Q8G699_BIFLO/131-272------------------------------------------------KQNEETSGLISGRLPAK-GQG-VTIRIGR---
A7BCD7_9ACTO/127-266------------------------------------------------RKAETQAQIAAGTVPVH-GPG-VTVSVVD---
A9AXV6_HERA2/92-230------------------------------------------------ANDLNRYKLHTGAVQVQ-GGG-VTITINY---

PF03795

YJPA_BACSU/6-82--------------------------------------------------------------------------------
Q9I3Z5_PSEAE/1-116--------------------------------------------------------------------------------
Q98EG6_RHILO/1-116--------------------------------------------------------------------------------
Q9AB44_CAUCR/10-125--------------------------------------------------------------------------------
Q9I3Z0_PSEAE/1-123--------------------------------------------------------------------------------
Q98I36_RHILO/1-116--------------------------------------------------------------------------------
Q98DP4_RHILO/1-116--------------------------------------------------------------------------------
Q98HH2_RHILO/1-118--------------------------------------------------------------------------------
Q98H82_RHILO/1-116--------------------------------------------------------------------------------
Q984U5_RHILO/1-115--------------------------------------------------------------------------------
P73587_SYNY3/2-86--------------------------------------------------------------------------------
Q983T6_RHILO/165-255--------------------------------------------------------------------------------
Q9RVF8_DEIRA/6-88--------------------------------------------------------------------------------
Q97TR0_CLOAB/1-82--------------------------------------------------------------------------------
Q9X7N1_STRCO/1-82--------------------------------------------------------------------------------
Q98H68_RHILO/7-87--------------------------------------------------------------------------------
Q9ZNA3_9RHOB/1-86--------------------------------------------------------------------------------
Q9AJZ7_STRCO/1-88--------------------------------------------------------------------------------
Q45075_BURCE/1-92--------------------------------------------------------------------------------
Q98EI5_RHILO/1-89--------------------------------------------------------------------------------
Q9AC00_CAUCR/2-87--------------------------------------------------------------------------------
Q9F188_CUPNE/1-88--------------------------------------------------------------------------------
Y828_HAEIN/1-95--------------------------------------------------------------------------------
Q9KRE0_VIBCH/1-95--------------------------------------------------------------------------------
YCII_SHIFL/1-95--------------------------------------------------------------------------------
Q9HZ38_PSEAE/1-95--------------------------------------------------------------------------------

PF07045

Q89BY8_BRAJA/78-142--------------------------------------------------------------------------------
A4T848_MYCGI/15-77--------------------------------------------------------------------------------
Q1MHU6_RHIL3/14-77--------------------------------------------------------------------------------
A1B208_PARDP/14-78--------------------------------------------------------------------------------
Q98DD6_RHILO/15-78--------------------------------------------------------------------------------
A6VTU1_MARMS/14-77--------------------------------------------------------------------------------
Q0C268_HYPNA/14-78--------------------------------------------------------------------------------
Q1GHA0_SILST/14-77--------------------------------------------------------------------------------
B1KC06_BURCC/15-78--------------------------------------------------------------------------------
Q391P0_BURS3/15-78--------------------------------------------------------------------------------
Q28QV7_JANSC/15-78--------------------------------------------------------------------------------
A1K1N9_AZOSB/14-77--------------------------------------------------------------------------------
Q7VAI4_PROMA/19-83--------------------------------------------------------------------------------
Q6SHS9_9BACT/17-82--------------------------------------------------------------------------------
Q3JLQ5_BURP1/14-78--------------------------------------------------------------------------------
Q1GFX6_SILST/15-78--------------------------------------------------------------------------------
Q07UT1_RHOP5/15-78--------------------------------------------------------------------------------
Q0FAX8_9RHOB/16-79--------------------------------------------------------------------------------
A5V7J9_SPHWW/14-78--------------------------------------------------------------------------------
Q2BPT9_9GAMM/14-76--------------------------------------------------------------------------------
Q0KCE3_CUPNH/15-79--------------------------------------------------------------------------------
A6UK15_SINMW/14-77--------------------------------------------------------------------------------
Q6NCX9_RHOPA/15-79--------------------------------------------------------------------------------
Q7WD74_BORBR/14-77--------------------------------------------------------------------------------
Q28UH1_JANSC/39-104--------------------------------------------------------------------------------
Q89JB1_BRAJA/26-90--------------------------------------------------------------------------------
A7HSS3_PARL1/14-78--------------------------------------------------------------------------------
Q5NR08_ZYMMO/14-78--------------------------------------------------------------------------------
Q28SX7_JANSC/15-78--------------------------------------------------------------------------------
Q742V7_MYCPA/18-80--------------------------------------------------------------------------------
Q1I972_PSEE4/14-78--------------------------------------------------------------------------------
A9AQ60_BURM1/15-78--------------------------------------------------------------------------------
Q8TNJ5_METAC/3-67--------------------------------------------------------------------------------
Q16DN6_ROSDO/15-78--------------------------------------------------------------------------------
A6VY75_MARMS/14-79--------------------------------------------------------------------------------
Q0FH20_9RHOB/10-73--------------------------------------------------------------------------------
Q0RQX9_FRAAA/15-78--------------------------------------------------------------------------------
A0P3L8_9RHOB/15-78--------------------------------------------------------------------------------
Q8FXW8_BRUSU/15-78--------------------------------------------------------------------------------
B2JPM5_BURP8/16-79--------------------------------------------------------------------------------
Q1QS87_NITHX/15-78--------------------------------------------------------------------------------
Q11E97_MESSB/14-79--------------------------------------------------------------------------------
A9BN41_DELAS/15-79--------------------------------------------------------------------------------
Q98G06_RHILO/36-99--------------------------------------------------------------------------------
A1TLS8_ACIAC/15-79--------------------------------------------------------------------------------
Q28KV2_JANSC/15-79--------------------------------------------------------------------------------
A5FY88_ACICJ/15-78--------------------------------------------------------------------------------
Q46FP8_METBF/16-80--------------------------------------------------------------------------------
A4XXX9_PSEMY/29-93--------------------------------------------------------------------------------
A7IC73_XANP2/126-189--------------------------------------------------------------------------------
Q0C4G1_HYPNA/15-78--------------------------------------------------------------------------------
B2TDH4_BURPP/15-78--------------------------------------------------------------------------------
Q0FEP2_9RHOB/15-78--------------------------------------------------------------------------------
Q2KDF1_RHIEC/15-78--------------------------------------------------------------------------------
A5E903_BRASB/8-72--------------------------------------------------------------------------------
Q128E5_POLSJ/15-79--------------------------------------------------------------------------------
Q65SN3_MANSM/36-100--------------------------------------------------------------------------------
Q1BE44_MYCSS/14-78--------------------------------------------------------------------------------
A9ATA2_BURM1/14-77--------------------------------------------------------------------------------
A0PQ06_MYCUA/14-78--------------------------------------------------------------------------------
A8L5T2_FRASN/24-88--------------------------------------------------------------------------------
Q484V4_COLP3/14-77--------------------------------------------------------------------------------
Q98JP1_RHILO/57-122--------------------------------------------------------------------------------
A0YH96_9GAMM/14-79--------------------------------------------------------------------------------
A0YGY6_9GAMM/14-78--------------------------------------------------------------------------------
Q47EX6_DECAR/15-79--------------------------------------------------------------------------------
B2SY97_BURPP/15-78--------------------------------------------------------------------------------
B2U9C2_RALPJ/15-79--------------------------------------------------------------------------------
Q6F9F1_ACIAD/14-77--------------------------------------------------------------------------------
B2TES1_BURPP/15-78--------------------------------------------------------------------------------
Q39MC4_BURS3/15-78--------------------------------------------------------------------------------
Q0FH19_9RHOB/14-77--------------------------------------------------------------------------------
Q05S93_9SYNE/15-78--------------------------------------------------------------------------------
Q0FAW6_9RHOB/16-82--------------------------------------------------------------------------------
A0YEI5_9GAMM/17-82--------------------------------------------------------------------------------
A6UFC5_SINMW/15-78--------------------------------------------------------------------------------
A0Y8B3_9GAMM/7-71--------------------------------------------------------------------------------
Q28P24_JANSC/18-83--------------------------------------------------------------------------------
Q7V2V4_PROMP/19-83--------------------------------------------------------------------------------
Q1YYX4_PHOPR/14-77--------------------------------------------------------------------------------
A1B8D1_PARDP/15-78--------------------------------------------------------------------------------
A0Y900_9GAMM/14-78--------------------------------------------------------------------------------
A0QZT5_MYCS2/14-78--------------------------------------------------------------------------------
Q127Z9_POLSJ/14-78--------------------------------------------------------------------------------
Q89X32_BRAJA/34-98--------------------------------------------------------------------------------
Q0RXH4_RHOSR/14-78--------------------------------------------------------------------------------
A4XTJ7_PSEMY/15-78--------------------------------------------------------------------------------
A1AZL7_PARDP/14-77--------------------------------------------------------------------------------
Q9LCS9_BRAJP/15-78--------------------------------------------------------------------------------
O85836_SPHAR/14-79--------------------------------------------------------------------------------
A1BAV2_PARDP/15-78--------------------------------------------------------------------------------
Q98CT4_RHILO/21-84--------------------------------------------------------------------------------
A8KZG9_FRASN/14-78--------------------------------------------------------------------------------
A2BXC0_PROM5/33-96--------------------------------------------------------------------------------
Q68E53_AERPU/15-78--------------------------------------------------------------------------------
B1KGZ1_SHEWM/14-79--------------------------------------------------------------------------------
A6WA35_KINRD/26-89--------------------------------------------------------------------------------
A1B124_PARDP/15-78--------------------------------------------------------------------------------
Q215U7_RHOPB/14-78--------------------------------------------------------------------------------
Q3KB77_PSEPF/14-78--------------------------------------------------------------------------------
Q984S8_RHILO/14-78--------------------------------------------------------------------------------
Q165U6_ROSDO/14-77--------------------------------------------------------------------------------
Q1V0T9_PELUQ/15-78--------------------------------------------------------------------------------
A4X3R6_SALTO/15-79--------------------------------------------------------------------------------
Q2VZK5_MAGSA/14-79--------------------------------------------------------------------------------
Q2BJZ2_9GAMM/14-79--------------------------------------------------------------------------------
Q0B1J7_BURCM/14-78--------------------------------------------------------------------------------
Q2BHP1_9GAMM/14-77--------------------------------------------------------------------------------
Q48IM5_PSE14/14-78--------------------------------------------------------------------------------
A0NLT0_9RHOB/14-79--------------------------------------------------------------------------------
Q11KJ1_MESSB/15-78--------------------------------------------------------------------------------
Q3J0R2_RHOS4/15-78--------------------------------------------------------------------------------
Q0FAQ5_9RHOB/14-77--------------------------------------------------------------------------------
Q87W43_PSESM/18-82--------------------------------------------------------------------------------
A0NQZ0_9RHOB/15-78--------------------------------------------------------------------------------
B2JHP1_BURP8/15-78--------------------------------------------------------------------------------
Q15VR2_PSEA6/41-104--------------------------------------------------------------------------------
Q1D8Q3_MYXXD/14-78--------------------------------------------------------------------------------
A5V7D8_SPHWW/14-79--------------------------------------------------------------------------------
Q21DJ6_SACD2/14-78--------------------------------------------------------------------------------
Q1YE00_MOBAS/23-86--------------------------------------------------------------------------------
Q65QR7_MANSM/32-95--------------------------------------------------------------------------------
Q5YTA0_NOCFA/14-78--------------------------------------------------------------------------------
Q3AME8_SYNSC/24-88--------------------------------------------------------------------------------
A8LJW3_DINSH/15-78--------------------------------------------------------------------------------
Q129N1_POLSJ/23-84--------------------------------------------------------------------------------
Q0I7X2_SYNS3/15-78--------------------------------------------------------------------------------
A8LL19_DINSH/14-77--------------------------------------------------------------------------------
Q1GHQ7_SILST/14-79--------------------------------------------------------------------------------
Q46KM6_PROMT/19-83--------------------------------------------------------------------------------
Q2C9X6_9RHOB/15-78--------------------------------------------------------------------------------
Q0C383_HYPNA/14-80--------------------------------------------------------------------------------
A7IC73_XANP2/15-78--------------------------------------------------------------------------------
A0R1N9_MYCS2/15-77--------------------------------------------------------------------------------
Q5FU37_GLUOX/15-78--------------------------------------------------------------------------------
Q1LPI6_RALME/15-79--------------------------------------------------------------------------------

PF07110

Q98J67_RHILO/10-91.......................---------------------------------------------------------
YTH4_RHOER/10-90.......................---------------------------------------------------------
Q89V09_BRAJA/21-102.......................---------------------------------------------------------
Q93EX2_9NOCA/10-91.......................---------------------------------------------------------
Q9KGB0_BACHD/16-96.......................---------------------------------------------------------
Q884M0_PSESM/10-93......................S---------------------------------------------------------
Q2N8F2_ERYLH/12-112G.IARYIQC...........HTE---------------------------------------------------------
D0J371_COMT2/26-114...................VGQR---------------------------------------------------------
Q2UH77_ASPOR/43-139TRNQQILVG..............---------------------------------------------------------
C9S7C3_VERA1/40-151SRYQQVKSNHHSPLTPSLLRRPG---------------------------------------------------------
Q0UAA8_PHANO/20-125..FPPPPFPQPPQIHTTGSMVPI---------------------------------------------------------
B6QRR3_PENMQ/18-114G.VVEYRQY............HT---------------------------------------------------------
C9SY64_VERA1/65-158G.VVKYSQY..............---------------------------------------------------------
B8MSU2_TALSN/18-112HGVHRYTIF..............---------------------------------------------------------
A5VH99_SPHWW/138-221...................RALA---------------------------------------------------------
A5V521_SPHWW/98-177.......................---------------------------------------------------------
B9K152_AGRVS/13-109TAPQRYVQN..............---------------------------------------------------------
B2W3U7_PYRTR/13-127SCTLRFPVRVKSGAGDRLGAPTS---------------------------------------------------------
Q0U4N6_PHANO/13-123SFPRRYLAR....VESGAGDRLG---------------------------------------------------------
B2WDV2_PYRTR/13-120SFTRRYLAR........ISRKGF---------------------------------------------------------
Q0U5I6_PHANO/13-111TFTRQYVRR..............---------------------------------------------------------
A2QB94_ASPNC/13-115SHRRSYIDR............PT---------------------------------------------------------
A2QVN7_ASPNC/13-122SHRRTYIAR...TTVDSPPAGAT---------------------------------------------------------
B8MPG2_TALSN/43-154SHRRSYIAR...EEKGSDADATE---------------------------------------------------------
A6RYK8_BOTFB/14-123THTRHYVVR......TAEGATSD---------------------------------------------------------
Q2UT25_ASPOR/23-122THVRHYVKR..............---------------------------------------------------------
C9Z9Q5_STRSW/12-103G.VRRYVQN..............---------------------------------------------------------
A2R8B5_ASPNC/14-111KYFQTHFLD..............---------------------------------------------------------
A5VH99_SPHWW/12-106..IAANILH...........ATQ---------------------------------------------------------
Q396J2_BURS3/130-221.......................---------------------------------------------------------
A6GBX1_9DELT/12-106..............ELGAARVAI---------------------------------------------------------
C9Z9Q5_STRSW/139-234.............HTKAVRAHVH---------------------------------------------------------
B5HPI7_9ACTO/138-233.............HTKALRGCVQ---------------------------------------------------------
A8L3R3_FRASN/10-95.......................---------------------------------------------------------
A5V7F6_SPHWW/12-99....................HFS---------------------------------------------------------
A5V7F6_SPHWW/139-229....................KGD---------------------------------------------------------
A4XEJ1_NOVAD/13-101GWATRYV................---------------------------------------------------------
C7Z3Q5_NECH7/37-130NHIVRYAQH..............---------------------------------------------------------
Q140F8_BURXL/125-207..ISRYV................---------------------------------------------------------
C8ND54_9GAMM/12-105LRIRGYAKT..............---------------------------------------------------------
C2M2M0_CAPGI/12-107LLIKDYTKT..............---------------------------------------------------------
Q93AB2_YERPE/18-98..LRGYVLN..............---------------------------------------------------------
B8MF02_TALSN/21-117G.VVRYS...........ITHNA---------------------------------------------------------
C8VQ65_EMENI/29-132G.ILRWTVK....CPDRSKIHNP---------------------------------------------------------
C5FQT1_ARTOC/22-118G.IDKFS...........MTHNP---------------------------------------------------------
Q2GSS6_CHAGB/53-131G.FLQWS................---------------------------------------------------------
B8NJL1_ASPFN/19-113G.ILEYNVI..............---------------------------------------------------------
C8VTL3_EMENI/15-109G.VKEYSLI..............---------------------------------------------------------
Q0UIY9_PHANO/18-106K.IVDYT...........MD...---------------------------------------------------------
A2QH37_ASPNC/566-663G.IVRYT...........LTHNT---------------------------------------------------------
B6QDA9_PENMQ/20-117G.VLSYTLF..........VTPA---------------------------------------------------------
A2QDU1_ASPNC/19-117KITHVYTPP.............I---------------------------------------------------------
B0YAX3_ASPFC/21-118GFCIYFTPQ..............---------------------------------------------------------
B2WLL6_PYRTR/30-124G.IISYSLT.............Y---------------------------------------------------------
Q4P1P8_USTMA/29-132SYTQFHCMS.........EKAKQ---------------------------------------------------------
C7Z0I7_NECH7/17-115AYIQHHVFD.............A---------------------------------------------------------
Q9F3V8_9PSEU/12-93.......................---------------------------------------------------------

PF09448

O51799_CUPNE/2-113--------------------------------------------------------------------------------
Q471R3_CUPPJ/2-113--------------------------------------------------------------------------------
Q7WWV7_CUPNH/2-112--------------------------------------------------------------------------------

PF03927

C6BCZ8_RALP1/19-97--------------------------------------------------------------------------------
Q5E3J5_VIBF1/8-86--------------------------------------------------------------------------------
A0KIM0_AERHH/3-81--------------------------------------------------------------------------------
A8GHJ5_SERP5/4-83--------------------------------------------------------------------------------
Q1Z7G7_PHOPR/4-82--------------------------------------------------------------------------------
A4NJ35_HAEIF/12-91--------------------------------------------------------------------------------
A8H5B1_SHEPA/3-80--------------------------------------------------------------------------------
A8FUK0_SHESH/4-82--------------------------------------------------------------------------------
A1S9X8_SHEAM/3-81--------------------------------------------------------------------------------
A4WZM9_RHOS5/4-81--------------------------------------------------------------------------------
A8G0D7_SHESH/3-81--------------------------------------------------------------------------------
A4BGQ8_9GAMM/12-90--------------------------------------------------------------------------------
Q3HS06_PSEST/3-81--------------------------------------------------------------------------------
Q21PN2_SACD2/9-87--------------------------------------------------------------------------------
A1K384_AZOSB/5-83--------------------------------------------------------------------------------
A3EIL2_VIBCL/16-94--------------------------------------------------------------------------------
Q93HX4_MAGMG/16-95--------------------------------------------------------------------------------
Q6D5Z1_ERWCT/3-82--------------------------------------------------------------------------------
Q7VPJ8_HAEDU/8-87--------------------------------------------------------------------------------
Q9Z3W5_9RHIZ/4-81--------------------------------------------------------------------------------
Q080B9_SHEFN/3-80--------------------------------------------------------------------------------
A7ZP29_ECO24/3-82--------------------------------------------------------------------------------
Q1LFZ4_RALME/17-95--------------------------------------------------------------------------------
A5ED22_BRASB/28-106--------------------------------------------------------------------------------
Q7WIQ2_BORBR/20-98--------------------------------------------------------------------------------
A6WJJ0_SHEB8/3-81--------------------------------------------------------------------------------
A6UJX6_SINMW/6-83--------------------------------------------------------------------------------
A6FC51_9GAMM/4-82--------------------------------------------------------------------------------
Q9Z3V0_RHOSP/37-115--------------------------------------------------------------------------------
E6XM26_SHEP2/3-80--------------------------------------------------------------------------------
Q12P45_SHEDO/3-80--------------------------------------------------------------------------------
A6CVN7_9VIBR/4-82--------------------------------------------------------------------------------
Q0I5G8_HAES1/75-153--------------------------------------------------------------------------------
Q9CKL9_PASMU/11-90--------------------------------------------------------------------------------
A6VQY8_ACTSZ/8-87--------------------------------------------------------------------------------
Q7WXC4_CUPNH/17-95--------------------------------------------------------------------------------
A9CGL4_AGRT5/6-83--------------------------------------------------------------------------------
A1SWQ1_PSYIN/4-82--------------------------------------------------------------------------------
A0NZM7_9RHOB/3-81--------------------------------------------------------------------------------
Q487G3_COLP3/9-87--------------------------------------------------------------------------------
A3USH4_VIBSP/4-82--------------------------------------------------------------------------------
Q13I16_BURXL/16-97--------------------------------------------------------------------------------
A4XWL9_PSEMY/3-81--------------------------------------------------------------------------------
Q9F5L4_BRAJP/32-110--------------------------------------------------------------------------------
B1KH53_SHEWM/3-81--------------------------------------------------------------------------------
A4U4X6_9PROT/17-95--------------------------------------------------------------------------------
Q5P545_AROAE/97-175--------------------------------------------------------------------------------
Q1ZGB7_9GAMM/4-82--------------------------------------------------------------------------------
A7JS88_PASHA/9-88--------------------------------------------------------------------------------
A7N7J4_VIBHB/4-82--------------------------------------------------------------------------------
NAPD_PARPN/28-105--------------------------------------------------------------------------------
A7M679_9PSED/3-81--------------------------------------------------------------------------------
A3QHX3_SHELP/3-81--------------------------------------------------------------------------------
Q02IZ5_PSEAB/3-81--------------------------------------------------------------------------------
O86475_RHOSH/4-81--------------------------------------------------------------------------------
A1JL25_YERE8/4-83--------------------------------------------------------------------------------
A8H065_SHEPA/3-81--------------------------------------------------------------------------------
Q2SGV8_HAHCH/3-81--------------------------------------------------------------------------------
Q47A86_DECAR/2-80--------------------------------------------------------------------------------

PF01037

GRP_ZYMMO/71-144.-------------------------------------------------------------------------------
ZRP_ZYMMO/68-141.-------------------------------------------------------------------------------
Q92MD2_RHIME/86-156.-------------------------------------------------------------------------------
Q7D0A6_AGRT5/69-139.-------------------------------------------------------------------------------
Q8XUT3_RALSO/72-151.-------------------------------------------------------------------------------
Q6FBR8_ACIAD/74-148.-------------------------------------------------------------------------------
Q5UYW6_HALMA/69-139.-------------------------------------------------------------------------------
O28651_ARCFU/68-142.-------------------------------------------------------------------------------
Q97KE2_CLOAB/74-146.-------------------------------------------------------------------------------
Q6LFY1_PHOPR/75-149.-------------------------------------------------------------------------------
Q9KKN4_VIBCH/69-143.-------------------------------------------------------------------------------
Q88Q35_PSEPK/72-143.-------------------------------------------------------------------------------
LRPB_BACSU/69-136.-------------------------------------------------------------------------------
Q8ELF6_OCEIH/69-140.-------------------------------------------------------------------------------
Q7P0K6_CHRVO/67-134.-------------------------------------------------------------------------------
Q5LQ65_SILPO/71-144.-------------------------------------------------------------------------------
Q6NDU4_RHOPA/81-154.-------------------------------------------------------------------------------
Q8XS36_RALSO/102-176.-------------------------------------------------------------------------------
Q6N2H6_RHOPA/71-144.-------------------------------------------------------------------------------
REG3_PYRHO/78-149.-------------------------------------------------------------------------------
Q9RT71_DEIRA/109-183.-------------------------------------------------------------------------------
Q8KJG4_RHILI/76-150.-------------------------------------------------------------------------------
PUTR_RHIRD/76-150.-------------------------------------------------------------------------------
Q87GT1_VIBPA/66-140.-------------------------------------------------------------------------------
Q6LY54_METMP/67-138.-------------------------------------------------------------------------------
Q6L2L7_PICTO/21-92.-------------------------------------------------------------------------------
Q5V2Q8_HALMA/69-143.-------------------------------------------------------------------------------
Q9HQ13_HALSA/69-140.-------------------------------------------------------------------------------
Q8E9E7_SHEON/75-150.-------------------------------------------------------------------------------
Q7WKQ4_BORBR/91-161.-------------------------------------------------------------------------------
Q7WFA6_BORBR/67-141.-------------------------------------------------------------------------------
Q8PJL5_XANAC/72-142.-------------------------------------------------------------------------------
Q97C07_THEVO/6-77.-------------------------------------------------------------------------------
A9CFY0_AGRT5/67-137.-------------------------------------------------------------------------------
Q8D573_VIBVU/77-150.-------------------------------------------------------------------------------
Q63VD1_BURPS/71-145.-------------------------------------------------------------------------------
Q8XQA9_RALSO/69-143.-------------------------------------------------------------------------------
Q64MN4_BACFR/70-142.-------------------------------------------------------------------------------
Q6A8E6_PROAC/82-152.-------------------------------------------------------------------------------
Q9L101_STRCO/68-139.-------------------------------------------------------------------------------
Q7TXW4_MYCBO/98-164.-------------------------------------------------------------------------------
Q5YPF7_NOCFA/74-144.-------------------------------------------------------------------------------
Q98D73_RHILO/70-144.-------------------------------------------------------------------------------
Q98F66_RHILO/68-135.-------------------------------------------------------------------------------
Q9A2I8_CAUCR/74-148.-------------------------------------------------------------------------------
Q9AAL7_CAUCR/79-153.-------------------------------------------------------------------------------
Q649E6_9ARCH/43-117.-------------------------------------------------------------------------------
Q5LQ72_SILPO/75-142.-------------------------------------------------------------------------------
Q8KJC0_RHILI/68-142.-------------------------------------------------------------------------------
Q9AHF1_RHIRD/77-151.-------------------------------------------------------------------------------
Q9F185_CUPNE/87-161.-------------------------------------------------------------------------------
A9CFA2_AGRT5/70-143.-------------------------------------------------------------------------------
Q5ZSK0_LEGPH/69-144.-------------------------------------------------------------------------------
Q98PB1_RHILO/72-146.-------------------------------------------------------------------------------
Q92LN5_RHIME/67-137.-------------------------------------------------------------------------------
Q92U21_RHIME/82-152.-------------------------------------------------------------------------------
Q88GR4_PSEPK/67-141.-------------------------------------------------------------------------------
Q647R1_9ARCH/70-143.-------------------------------------------------------------------------------
Q81BC4_BACCR/67-132.-------------------------------------------------------------------------------
Q5LX17_SILPO/69-143.-------------------------------------------------------------------------------
Q8VM90_RHILV/70-144.-------------------------------------------------------------------------------
Q8KCK3_CHLTE/71-142.-------------------------------------------------------------------------------
Q7WFT7_BORBR/71-144.-------------------------------------------------------------------------------
Q9I287_PSEAE/71-145.-------------------------------------------------------------------------------
Q9A5B5_CAUCR/107-181.-------------------------------------------------------------------------------
Q5YR66_NOCFA/67-141.-------------------------------------------------------------------------------
Q8NMC1_CORGL/75-149.-------------------------------------------------------------------------------
Q8J2Y4_PYRAB/6-77.-------------------------------------------------------------------------------
Q82QC2_STRAW/71-138.-------------------------------------------------------------------------------
Q898A1_CLOTE/78-150.-------------------------------------------------------------------------------
Q62M96_BURMA/72-146.-------------------------------------------------------------------------------
Q88H33_PSEPK/67-137.-------------------------------------------------------------------------------
Q738U3_BACC1/67-132.-------------------------------------------------------------------------------
Q88DP7_PSEPK/70-145.-------------------------------------------------------------------------------
Q9KYP0_STRCO/82-153.-------------------------------------------------------------------------------
Q53106_RHOER/70-140.-------------------------------------------------------------------------------
Q9EX07_STRCO/69-139.-------------------------------------------------------------------------------
Q74NJ3_NANEQ/8-78.-------------------------------------------------------------------------------
Q5UXF0_HALMA/63-134.-------------------------------------------------------------------------------
Q7W2M4_BORPA/69-143.-------------------------------------------------------------------------------
LYSM_SULTO/67-138.-------------------------------------------------------------------------------
Q7VRX6_BORPE/85-159.-------------------------------------------------------------------------------
HOSA_SULTO/388-459.-------------------------------------------------------------------------------
Q6L0M6_PICTO/71-145.-------------------------------------------------------------------------------
Q6HMY8_BACHK/75-147.-------------------------------------------------------------------------------
O33467_PSEPU/71-145.-------------------------------------------------------------------------------
Q8PGC8_XANAC/74-148.-------------------------------------------------------------------------------
Q83SF4_SHIFL/97-171.-------------------------------------------------------------------------------
Q7NXB3_CHRVO/75-142.-------------------------------------------------------------------------------
Q8XJU9_CLOPE/76-148.-------------------------------------------------------------------------------
Q82JE5_STRAW/69-138.-------------------------------------------------------------------------------
Y4TD_RHISN/84-158.-------------------------------------------------------------------------------
Q9K0L9_NEIMB/99-172.-------------------------------------------------------------------------------
Q87PU4_VIBPA/76-146.-------------------------------------------------------------------------------
Q5Z126_NOCFA/77-147.-------------------------------------------------------------------------------
Q89LX8_BRAJA/73-146.-------------------------------------------------------------------------------
Q8Z2Q8_SALTI/72-144.-------------------------------------------------------------------------------
Q5LQW1_SILPO/67-141.-------------------------------------------------------------------------------
Q65N91_BACLD/69-136.-------------------------------------------------------------------------------
Q92XD8_RHIME/73-147.-------------------------------------------------------------------------------
Q8FLW4_COREF/255-325.-------------------------------------------------------------------------------
Q6SH05_9BACT/70-144.-------------------------------------------------------------------------------
Q703X8_THETE/397-468.-------------------------------------------------------------------------------
Q5LTP6_SILPO/68-142.-------------------------------------------------------------------------------
Q8XVM9_RALSO/69-143.-------------------------------------------------------------------------------
Q8PQZ4_XANAC/73-147.-------------------------------------------------------------------------------
Q736J6_BACC1/67-134.-------------------------------------------------------------------------------
Q62BJ3_BURMA/69-143.-------------------------------------------------------------------------------
Q8FVC2_BRUSU/70-144.-------------------------------------------------------------------------------
Q8YIT5_BRUME/83-156.-------------------------------------------------------------------------------
Q8KM39_MYXXA/69-141.-------------------------------------------------------------------------------
O54287_9CREN/75-145.-------------------------------------------------------------------------------
Q979E1_THEVO/57-127.-------------------------------------------------------------------------------
Q98KG1_RHILO/93-160.-------------------------------------------------------------------------------
Q8A556_BACTN/73-147.-------------------------------------------------------------------------------
Q7NU65_CHRVO/74-148.-------------------------------------------------------------------------------
Q5NMJ8_ZYMMO/67-141.-------------------------------------------------------------------------------
Q7VRX9_BORPE/76-153.-------------------------------------------------------------------------------
Q6FCQ3_ACIAD/67-137.-------------------------------------------------------------------------------
REG6_PYRHO/71-141.-------------------------------------------------------------------------------
Q6A5I2_PROAC/64-135.-------------------------------------------------------------------------------
Q93HN7_STRAW/79-149.-------------------------------------------------------------------------------
P95905_SULSF/75-146.-------------------------------------------------------------------------------
Q8ZT22_PYRAE/67-153N-------------------------------------------------------------------------------
Q9KFQ5_BACHD/69-136.-------------------------------------------------------------------------------
Q63M55_BURPS/72-146.-------------------------------------------------------------------------------
Q9RKY4_STRCO/86-156.-------------------------------------------------------------------------------
Q89QF0_BRAJA/95-169.-------------------------------------------------------------------------------
Q7NH56_GLOVI/75-142.-------------------------------------------------------------------------------
Q5WIR4_BACSK/69-136.-------------------------------------------------------------------------------
Q82AJ9_STRAW/6-77.-------------------------------------------------------------------------------
Q669R6_YERPS/67-134.-------------------------------------------------------------------------------
Q7VV34_BORPE/67-140.-------------------------------------------------------------------------------
Q63K02_BURPS/70-144.-------------------------------------------------------------------------------
REG2_PYRHO/69-142.-------------------------------------------------------------------------------
Q9K6T5_BACHD/69-140.-------------------------------------------------------------------------------
O29671_ARCFU/66-134.-------------------------------------------------------------------------------
Q6AF01_LEIXX/80-150.-------------------------------------------------------------------------------
Q98JQ8_RHILO/76-143.-------------------------------------------------------------------------------
Q9XAG4_STRCO/72-142.-------------------------------------------------------------------------------
Q92PN1_RHIME/74-147.-------------------------------------------------------------------------------
O86743_STRCO/86-156.-------------------------------------------------------------------------------
Q7VXK7_BORPE/69-143.-------------------------------------------------------------------------------
REG7_PYRHO/68-139.-------------------------------------------------------------------------------
Q9RK86_STRCO/67-136.-------------------------------------------------------------------------------
Q9RXV6_DEIRA/89-157.-------------------------------------------------------------------------------
O29606_ARCFU/6-76.-------------------------------------------------------------------------------
Q6ANT7_DESPS/69-143.-------------------------------------------------------------------------------
REG1_PYRFU/70-146.-------------------------------------------------------------------------------
Q6WB88_ALCFA/69-143.-------------------------------------------------------------------------------
Q98K63_RHILO/72-146.-------------------------------------------------------------------------------
Q9HLH1_THEAC/98-168.-------------------------------------------------------------------------------
O29117_ARCFU/70-140.-------------------------------------------------------------------------------
Q983I9_RHILO/78-152.-------------------------------------------------------------------------------
Q6FZR6_BARQU/62-134.-------------------------------------------------------------------------------
Q972L7_SULTO/67-140.-------------------------------------------------------------------------------
Q5V2P2_HALMA/69-140.-------------------------------------------------------------------------------
Q87GV1_VIBPA/67-140.-------------------------------------------------------------------------------
Q8XX00_RALSO/74-141.-------------------------------------------------------------------------------
Q987B0_RHILO/72-146.-------------------------------------------------------------------------------
Q9A3N3_CAUCR/116-190.-------------------------------------------------------------------------------
Q7NT80_CHRVO/75-149.-------------------------------------------------------------------------------
Q5LKR4_SILPO/67-141.-------------------------------------------------------------------------------
P71888_MYCTU/70-141.-------------------------------------------------------------------------------
Q9RIR7_SALCE/71-142.-------------------------------------------------------------------------------
Q5LTI9_SILPO/68-142.-------------------------------------------------------------------------------
Q7WI06_BORBR/70-144.-------------------------------------------------------------------------------
Q88E71_PSEPK/78-152.-------------------------------------------------------------------------------
Q82M14_STRAW/244-315.-------------------------------------------------------------------------------
Q5LX25_SILPO/67-137.-------------------------------------------------------------------------------
Q981V1_RHILO/75-149.-------------------------------------------------------------------------------
Q97J19_CLOAB/69-136.-------------------------------------------------------------------------------
Q89XH4_BRAJA/78-152.-------------------------------------------------------------------------------
Q984M5_RHILO/74-148.-------------------------------------------------------------------------------
Q72K70_THET2/6-77.-------------------------------------------------------------------------------
Q9HQ33_HALSA/67-138.-------------------------------------------------------------------------------
Q93IX1_STRCO/72-139.-------------------------------------------------------------------------------
Q975B9_SULTO/71-141.-------------------------------------------------------------------------------
Q745M6_MYCPA/252-323.-------------------------------------------------------------------------------
Q81BI2_BACCR/73-138.-------------------------------------------------------------------------------
Q5LNM4_SILPO/70-143.-------------------------------------------------------------------------------
Q93IX5_STRCO/73-147.-------------------------------------------------------------------------------
Q92MD5_RHIME/70-144.-------------------------------------------------------------------------------
Q9RS40_DEIRA/9-80.-------------------------------------------------------------------------------
Q5KVS2_GEOKA/71-145.-------------------------------------------------------------------------------
Q5LUB6_SILPO/69-143.-------------------------------------------------------------------------------
BKDR_PSEAE/70-144.-------------------------------------------------------------------------------
Q8ZX24_PYRAE/6-77.-------------------------------------------------------------------------------
Q7X134_PSEFL/67-134.-------------------------------------------------------------------------------
O68050_RHOCA/69-139.-------------------------------------------------------------------------------
Q8XFM7_RALSO/75-142.-------------------------------------------------------------------------------
BKDR_PSEPU/70-143.-------------------------------------------------------------------------------
REG8_PYRFU/69-139.-------------------------------------------------------------------------------
Q5UZ96_HALMA/68-138.-------------------------------------------------------------------------------
REG9_PYRAB/71-145.-------------------------------------------------------------------------------
Q5QV65_IDILO/67-141.-------------------------------------------------------------------------------
Q7WM72_BORBR/71-145.-------------------------------------------------------------------------------
Q5LRE1_SILPO/71-145.-------------------------------------------------------------------------------
Q8YCL0_BRUME/71-145.-------------------------------------------------------------------------------
Q6D0Y1_ERWCT/70-144.-------------------------------------------------------------------------------
Q98N03_RHILO/69-143.-------------------------------------------------------------------------------
Q880K0_PSESM/71-145.-------------------------------------------------------------------------------
Q8ZWW2_PYRAE/87-153.-------------------------------------------------------------------------------
Q986N0_RHILO/91-161.-------------------------------------------------------------------------------
Q5X578_LEGPA/88-162.-------------------------------------------------------------------------------
Q9HV24_PSEAE/67-134.-------------------------------------------------------------------------------
Q6LS33_PHOPR/66-136.-------------------------------------------------------------------------------
Q9A4E7_CAUCR/94-165.-------------------------------------------------------------------------------
Q89D55_BRAJA/68-142.-------------------------------------------------------------------------------
Q6AIZ2_DESPS/68-140.-------------------------------------------------------------------------------
Q5LTP5_SILPO/70-144.-------------------------------------------------------------------------------
Q88AX2_PSESM/73-147.-------------------------------------------------------------------------------
Q8A637_BACTN/72-143.-------------------------------------------------------------------------------
A9CJY9_AGRT5/67-141.-------------------------------------------------------------------------------
Q826R1_STRAW/74-145.-------------------------------------------------------------------------------
Q93FY6_PSEPU/75-145.-------------------------------------------------------------------------------
Q9KGA0_BACHD/67-134.-------------------------------------------------------------------------------
Q8G6L1_BIFLO/70-140.-------------------------------------------------------------------------------
Q6AQ93_DESPS/16-87.-------------------------------------------------------------------------------
Q81G47_BACCR/69-136.-------------------------------------------------------------------------------
Q5NRK7_ZYMMO/74-148.-------------------------------------------------------------------------------
Q6FAP4_ACIAD/69-144.-------------------------------------------------------------------------------
Q7VUI7_BORPE/70-140.-------------------------------------------------------------------------------
AZLB_BACSU/71-145.-------------------------------------------------------------------------------
O28824_ARCFU/64-138.-------------------------------------------------------------------------------
Q6NCU7_RHOPA/67-141.-------------------------------------------------------------------------------
Q5LMF1_SILPO/70-144.-------------------------------------------------------------------------------
Q7TWT2_MYCBO/71-141.-------------------------------------------------------------------------------
Q5WDD1_BACSK/69-140.-------------------------------------------------------------------------------
Q9XA32_STRCO/57-128.-------------------------------------------------------------------------------
Q9A3M5_CAUCR/129-203.-------------------------------------------------------------------------------
Q6L1Y9_PICTO/97-167.-------------------------------------------------------------------------------
Q6W0Z0_RHISN/69-143.-------------------------------------------------------------------------------
Q87WM3_PSESM/56-130.-------------------------------------------------------------------------------
Q5NNH9_ZYMMO/73-147.-------------------------------------------------------------------------------
PTR1_METJA/68-139.-------------------------------------------------------------------------------
Q92NU2_RHIME/68-141.-------------------------------------------------------------------------------
LRP_RHIME/73-147.-------------------------------------------------------------------------------
Q8XU40_RALSO/70-144.-------------------------------------------------------------------------------
Q65G37_BACLD/68-136.-------------------------------------------------------------------------------
Y224_HAEIN/85-159.-------------------------------------------------------------------------------
Q8Z815_SALTI/78-152.-------------------------------------------------------------------------------
Q65E48_BACLD/78-149.-------------------------------------------------------------------------------
Q6W241_RHISN/68-142.-------------------------------------------------------------------------------
Q64UG5_BACFR/70-144.-------------------------------------------------------------------------------
O28868_ARCFU/6-77.-------------------------------------------------------------------------------
Q63I71_BURPS/69-143.-------------------------------------------------------------------------------
Q62FW3_BURMA/69-143.-------------------------------------------------------------------------------
O27261_METTH/78-148.-------------------------------------------------------------------------------
Q5LWR4_SILPO/91-158.-------------------------------------------------------------------------------
Q9K655_BACHD/67-134.-------------------------------------------------------------------------------
Q980N2_SULSO/6-77.-------------------------------------------------------------------------------
Q5P347_AROAE/71-145.-------------------------------------------------------------------------------
Q8NTP9_CORGL/72-146.-------------------------------------------------------------------------------
Q5YZ22_NOCFA/6-77.-------------------------------------------------------------------------------
Q92S84_RHIME/6-77.-------------------------------------------------------------------------------
Q5LVX6_SILPO/69-143.-------------------------------------------------------------------------------
Q6FCJ8_ACIAD/71-145.-------------------------------------------------------------------------------
Q9HVR3_PSEAE/69-143.-------------------------------------------------------------------------------
Q5LXH4_SILPO/67-141.-------------------------------------------------------------------------------
Q97B02_THEVO/67-141.-------------------------------------------------------------------------------
Q702E3_9CREN/6-76.-------------------------------------------------------------------------------
Q8Y353_RALSO/69-136.-------------------------------------------------------------------------------

PF02426

CATC_RHOOP/2-92--------------------------------------------------------------------------------
CATC_PSEPU/1-91--------------------------------------------------------------------------------
CATC1_ACILW/1-91--------------------------------------------------------------------------------
O07243_MYCTU/1-94--------------------------------------------------------------------------------
CATC_ACIAD/1-91--------------------------------------------------------------------------------
O51800_CUPNE/1-91--------------------------------------------------------------------------------
CATC2_ACILW/1-91--------------------------------------------------------------------------------

PF06778

Y3825_BACHD/31-235R.FAEFTV-------------------------------------------------PAYSYVSVVELSNYMAGD..SDD
Q9YFL1_AERPE/27-208R.WG.CVE-------------------------------------------------EAVWWPAYYKESPYAR.......
Y2021_HALSA/31-240A.FAEYTE-------------------------------------------------RAHSYVSVVEISGYTAPDYFEDP
Q8FPI6_COREF/56-245TILGQVSE-------------------------------------------------VFWIGNGIHRPS...........
Q8KP26_9RHOO/66-261R.FGMNAE-------------------------------------------------VTENLVGMTKDLNYITKDKSPNL
O69830_STRCO/43-230K.LGRALE-------------------------------------------------PVWSNMALHRPAE..........
Y3023_OCEIH/31-235K.LGDFLI-------------------------------------------------PGYSYVSIIEKTMHDPMKAGEDR
Y2676_MYCTU/30-218TTLGRACT-------------------------------------------------PVWSGVGLHRPAE..........
YWFI_BACSU/37-240R.LAEFTI-------------------------------------------------PAYSYVSVVELSNYLAS...GDG
Q9RUB0_DEIRA/82-276RMMG.YLH-------------------------------------------------QPATYLAMQKRSQYVN.......
Q9HKT8_THEAC/28-211..MRPIAV-------------------------------------------------SSFSSISIYDESPYNA.......
Q97AK5_THEVO/23-209..LLPYAN-------------------------------------------------ATYSSISIYDESPYNAM......
Q97WP2_SULSO/26-213SKIRDLGY-------------------------------------------------ESLSLFSVYRSSPYTRG......
Y358_STAES/31-235R.IADYLI-------------------------------------------------PTYSYVSVIELSNYLAGK..SDE
Y2113_LISMO/31-237A.IADYLL-------------------------------------------------PTYSYISVVELSNYLASHMAGGD

PF04261

Q9KQ59_VIBCH/5-294DETYGFRY.........LDARDMTGFIDGTENPKAEKRAE.V..ALV......ADG..DFAGGSYVMVQRFVHNLPAWNR
EFEN_BACSU/66-405FVNKGFL....SGGKNGETPRNLFGFKDGTGNQSTKDDTLMNSIVWI.....QSGEPDWMTGGTYMAFRKIKMFLEVWDR
Q98KG6_RHILO/13-313DEVTGFRY.........FDARDLLGFIDGTANPTGLDLPAS...ALV......GDEDGDFAGGSYVVVQKYLHDMQAWAR
Q9FBY9_STRCO/10-309DEVHGFKY.........FDERDMLGFVDGTENPTGAAARRA...VLV......GAEDPAFAGGSYAVVQKYLHDIDAWEG
EFEB_ECOLI/61-411WKREGFISDHAARSKGKETPINLLGFKDGTANPDSQNDKLMQKVVWV...TADQQEPAWTIGGSYQAVRLIQFRVEFWDR
Q9K1P5_NEIMB/60-410WSIDGWQP...KSEPGAMAARNLLGFRDGTGNPKVSDPKTADEVLWTGVAANSLDEPEWAKNGSYQAVRLIRHFVEFWDR
Q9ZBW9_STRCO/87-434WQMNGFNR.SPGATAHPMTARNLMGQVDGTRNPKPGEADFDRRIFVPEEPEAGKGGPAWMANGSYVVVRRIRMLLDDWEE
Q9I078_PSEAE/11-290GAVDAFLY.........GEDRDLSGYKDGTENPKGDAALEA...ALV......SGRGAGLDGGSFVAVQQWLHDFDRMQA
Q9CNH6_PASMU/4-293QEIHGFRW.........VEERDFTGFIDGTENPQAAKRAE.V..ALI......AQG..DDTDGSYVFTQRYEHNLTKWEK
Q9RKQ2_STRCO/65-406WSQLGFGK.TSSTTPDEQTPRNLLGFKDGTRNIAGTEKDRLDRFVWA....AEKDGTPWMTGGSYLVARRIRMHIETWDR
Q9RH20_ZYMMB/19-318DEVHGFKY.........FDSRALIGFVDGTENPEDEEACEA...VLI......GEDDPDFKNGSYVIVQKYFHNLDAWNK
YFEX_ECOLI/5-296EEIHGFRW.........VEERDLSGFVDGTENPAGEETRREV..AVI......KDG..VDAGGSYVFVQRWEHNLKQLNR
Q9K036_NEIMB/5-299SEEHGLRL.........YQDRGLDGFVDGTENPQGDENVREV..AII......PEG.KPDAGGSYVLLQKYLHDLKKWDA
Q99WN3_STAAM/26-361WAQSGFIS.....AKGKETPRNLMAFKDGTINPRKSNQLKDY..VFI........DDGWAKHGTYCVVRRIQIHIETWDR
O07180_MYCTU/8-306DEVHGFRF.........FDNRDLLGFVDGTENPSGPIAIKA...TTI......GDEDRNFAGSCYVHVQKYVHDMASWES

PF13826

Q5B835_EMENI/129-253--------------------------------------------------------------------------------
A0YDB6_9GAMM/17-134--------------------------------------------------------------------------------
C2ZRM2_BACCE/19-135--------------------------------------------------------------------------------
A6CKD6_9BACI/18-135--------------------------------------------------------------------------------
Q7NL77_GLOVI/17-135--------------------------------------------------------------------------------
C0ZHQ2_BREBN/17-134--------------------------------------------------------------------------------
B1XXV3_LEPCP/17-135--------------------------------------------------------------------------------
A6G876_9DELT/21-138--------------------------------------------------------------------------------
D3EAC5_GEOS4/17-135--------------------------------------------------------------------------------
C2W9D0_BACCE/18-134--------------------------------------------------------------------------------
Q65NQ4_BACLD/18-134--------------------------------------------------------------------------------
D0L3R6_GORB4/18-133--------------------------------------------------------------------------------
A8FJ75_BACP2/18-135--------------------------------------------------------------------------------
Q0SFP1_RHOSR/17-134--------------------------------------------------------------------------------
B2IYY5_NOSP7/17-135--------------------------------------------------------------------------------
B4D6M5_9BACT/15-132--------------------------------------------------------------------------------
Q8ELJ8_OCEIH/18-135--------------------------------------------------------------------------------
A4TGL1_MYCGI/21-140--------------------------------------------------------------------------------
Q9K5Y3_BACHD/18-135--------------------------------------------------------------------------------
Q82JR6_STRAW/18-140--------------------------------------------------------------------------------
C8X6B7_NAKMY/17-134--------------------------------------------------------------------------------
C9Z558_STRSW/19-141--------------------------------------------------------------------------------
D7B5B0_NOCDD/17-134--------------------------------------------------------------------------------
D2SAG2_GEOOG/17-134--------------------------------------------------------------------------------
D2Q510_KRIFD/15-133--------------------------------------------------------------------------------
C6XKE2_HIRBI/17-135--------------------------------------------------------------------------------
Q49UK4_STAS1/14-130--------------------------------------------------------------------------------
D2RPK7_HALTV/35-154--------------------------------------------------------------------------------
A1R2W1_ARTAT/19-136--------------------------------------------------------------------------------
Q5WGK6_BACSK/15-132--------------------------------------------------------------------------------
B1YGH8_EXIS2/12-125--------------------------------------------------------------------------------
A6R852_AJECN/119-243--------------------------------------------------------------------------------
D5UWZ5_TSUPD/14-139--------------------------------------------------------------------------------
C0PC33_MAIZE/119-243--------------------------------------------------------------------------------
Q2TWA6_ASPOR/121-245--------------------------------------------------------------------------------
B6QJL8_PENMQ/116-242--------------------------------------------------------------------------------
Q0CTD2_ASPTN/81-205--------------------------------------------------------------------------------
Q2GR33_CHAGB/122-248--------------------------------------------------------------------------------
C7YU85_NECH7/113-235--------------------------------------------------------------------------------
B8MRW9_TALSN/40-166--------------------------------------------------------------------------------
A1DA85_NEOFI/113-235--------------------------------------------------------------------------------
B7KQ80_METC4/27-137--------------------------------------------------------------------------------
Q7S613_NEUCR/120-245--------------------------------------------------------------------------------
Q01W86_SOLUE/18-128--------------------------------------------------------------------------------
A5G2Z4_ACICJ/18-128--------------------------------------------------------------------------------
B1LSK9_METRJ/27-140--------------------------------------------------------------------------------
B0U9U6_METS4/19-131--------------------------------------------------------------------------------
B8EMQ3_METSB/15-128--------------------------------------------------------------------------------

PF13816

C7Z148_NECH7/36-347VPRLETNYSGLDYLPGLARLPG.TSFPEHEFSAYWGAARDRIPSSAYDLFPQ.........SADTVPPTTVPRGIGQY.L
Q5B890_EMENI/325-643PGRTQHGTNATERVNGMANLGI..FEDISEKSGYWGCYYDRMADVTRERRNDIRSAASKTPSQSSSALTGEKILRGRVNL
C9STN6_VERA1/45-354IDRFETVIT.TEVPQGAANLRE.TMSGPIQEHVYWGSMRDRFPISQTDALVG....ETSHIHPRNETPAPPSATGRRV.V
Q4VYU2_RHIRD/43-343AEQFETLYAFQDQFPGVGAVMD.GVSDEVEEHGYWGSMRDRFAASQTDWMSA.........TGNLEVISGDPRKGGRVVV
C0ZVD3_RHOE4/60-360AEQFETLYAFQDDLPGVGAVMD.GVSGEINEHGYWGSMRERFPISQTDWMQA.........SGELRVVAGDPAAGGRVVV
B8NPL1_ASPFN/36-350VSRLETNYSGTDYLPGLARLPG.TKTVAHSYSAYWGAARDRIPDSAFELFEQ....DE..NPTATAIPDAMSTSLGKH.L
Q6FBU3_ACIAD/43-342ADQFETLYAFKEDLPGVGAVMD.DISDDIQEHGYWGSARERFPISQTDRMLA.........NGELHIISGDPEKGGRVLV
C3KC36_PSEFS/43-343TEQFETLYAFQENLPGVGAVMD.TTSGEIEEHGYWGSMRDRFPISQTDWMKP.........TSELQVIAGDPAQGGRVLV
Q1BN36_BURCA/43-343AEQFETLYAFTSDFPGVGAIMD.GVSGEIEEHGYWGSMRDRFPISQTDWMNA.........NGELRIVDGDPARGGRVVV
A1CY61_NEOFI/6-331LSRVETNYSGLDYLPGLARLPG.VSTVEHTLTAYWGAARDRIPASATDRFAQ....NEGLEKTQLAPETASPRKTNDYHV
C9SXX8_VERA1/36-349LPRLETNYSGLDYLPGLARLPG.TTTPEHDRSAYWGAARDRIPDAAHDLFPK.......PTDPVSLPPDSAVRGRGQH.L
Q500U2_PSEU2/43-341TERFETLFSAPDVPEGVTHLAT.HMSEPIQEHAYWGSSRDRIPFAQTDALAG.........SSNPS..SADVLRAGRVRM
C5CKL2_VARPS/43-346AEHFETMFNTPDRLEGVGVVMG.GVSGELQEHGYWGSMRDRIPLSQTDAMAP.........SGTRAVIAGAPAPGQRVRI
D4DHU0_TRIVH/55-363TDGFETVASDEKVLEGAACMRE.KASGPILEHVYWGSMRDRMPICQTDAVPG........DTTSSAAQQISSTLRRRVQV
Q0U2P3_PHANO/36-345VSRLETNYSGLDYLPGLARLPR.ADTVEHTLSAYWGAARDRIPDSAHDLFPR.........AAESPPSTTVTSGRGKH.L
Q2WG72_GIBZA/14-329ATRAMYEGTG.KDAYGFGHCGS..LIPLTTKTGYWGAYRSRMTPDF.....EGDTFSSPIPTYADQSVPADKIRPGRVRI
C5G803_AJEDR/44-352IDRFETVFSDNEVPEGAAHMRE.SVSGPLREHVYWGSMRDRLPIAQTDELVG........ESGNTANKPTNSVLRRRIRV
OXD_BACSX/28-329IDHFETLHSGENYDNGVSHFVP...IKHTEVHEYWGAMRDRMPVSASSDLES.......PLGLQLPEPIVRESFGKRLKV
A1CFW9_ASPCL/35-358LSRLETNYSGSDYLPGLARLPG.VSCLEHTLATYWGSARDRIPDSATELFER....EE.VDDHALKAR.SSPVSLKHY.V
Q0CF39_ASPTN/14-333HSRVLFETNQ.KAPNGFAHVGS..FEPLVEKTGYWGSYRDRLEDATELDKLSTPIQPPVLPPRKSTK....NIRLGRVSM
B1KM99_SHEWM/29-326HQRFETLHSSENA.HGAARLSP.SLEGPMMEHGYSGAARDRIPCSSSQDIKN.......DNSIWEHLQVNVENKSNRIKL
C1H9S7_PARBA/44-352IDRFETVFSDTNVIEGVAHMRE.SVSGPIKEHVYWGSMRDRLPAGQTDALVG........ENGRTARKTTNSPLRRRIRV
A1R5Y5_ARTAT/54-350ARGFETLYSSNTFPEGAARMATGGFTGEIQEHGYWGSMRDRLPIAQTDALEP.........VGDPVV....PRNPGIVRV
A5V4Y9_SPHWW/43-337VERLETLYSTEDEMEGLGRALE.RRSPPVQEHAYWGSARDRFPIAQTDALEP.........AGQLGFAADG...AGRVTV
A7IFL4_XANP2/39-340YDRHETIYSTPSYVIGLARTPG.ATRVPITTNGYFGAMRDRMPVSAIDTLES.........PLGAMPPRRAPDSHGRRLT
C6WDR0_ACTMD/39-337VEQFETLYS.AEFAAGPSRFAG...TGPTNLHDYDNSTLDRMPATAHRDLRQ.....ERAEEPTTDLPPGESPRGRRVRL
A5EKU7_BRASB/43-335VERYETLFSSLGRPEGIAVIAE.GMSGEVLEHAYWGGMRDRIPLSQTSEMRS.........LGKPTLVQDGP....RLRV
B2WMJ9_PYRTR/6-318VDRFETVFSNSEHPEGAANMQE.KISGEMEEHGYWGSMRDRLAAAQDDELKGTKWVDSGNAGNASHANGGS...SKRTRI
C7ZFH7_NECH7/15-326PSRVQNACTA.ELKNGLNGLGN..MEPFSDKIGYWGCIRHRIPDANLD.....DKLASSLEEMPSRVPETSDIRPGRTLV
C5FDU1_ARTOC/81-390IDRFETIISGNEVPEGIAHMRE.RVSGPLREHVYWGSMRDRLPISQTDAITG.......ESINEAVHQVGGNTLQRRVRV
B8NMG3_ASPFN/16-332YGRSQYKATQNRQDGQGVHFAH....KPTEKNGYWGWIRDSIRELSKENRMDSPLLVPPIPERKASLKEKT...LGRVTF
F0QD95_ACIAP/43-343AEQFETLYAFQDALPGVGGVME.STSGDIQEHGYWGSMRDRFPASQVDRMQA.........RGTLLIAEGDPAHGGRVVV
Q0C7P1_ASPTN/35-346ISRLETNYSGIDYLPGLAQLSQ.GQPTEHTLTAYWGAARDRIPSSGHDAFPR.......DHPESATYPPQIPRGLGQR.L

PF07876

Q748N1_GEOSL/2-96--------------------------------------------------------------------------------
A9CJX0_AGRT5/2-102--------------------------------------------------------------------------------
Q740A8_MYCPA/82-179--------------------------------------------------------------------------------
Q7S333_NEUCR/57-160--------------------------------------------------------------------------------
Q98H26_RHILO/2-102--------------------------------------------------------------------------------
Y4036_STRCO/2-97--------------------------------------------------------------------------------
Q89RS9_BRAJA/5-102--------------------------------------------------------------------------------
Q9AMS9_BRAJP/2-94--------------------------------------------------------------------------------
Q9SYD8_ARATH/116-206--------------------------------------------------------------------------------
Q9SYD8_ARATH/5-102--------------------------------------------------------------------------------
Q8XM37_CLOPE/2-100--------------------------------------------------------------------------------
O80887_ARATH/57-152--------------------------------------------------------------------------------
Q98BN1_RHILO/2-96--------------------------------------------------------------------------------
Q6J6I3_ENTCL/2-99--------------------------------------------------------------------------------
Q41049_9ROSI/9-107--------------------------------------------------------------------------------
Q7MWG5_PORGI/2-100--------------------------------------------------------------------------------
Q7UFZ5_RHOBA/16-113--------------------------------------------------------------------------------
Q8G2X5_BRUSU/2-94--------------------------------------------------------------------------------
POP3_ARATH/8-104--------------------------------------------------------------------------------
Y5258_ARATH/6-100--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/40-141--------------------------------------------------------------------------------
Q7N2N7_PHOLL/12-107--------------------------------------------------------------------------------
Q9SIP1_ARATH/158-254--------------------------------------------------------------------------------
Q7WCF6_BORPA/2-96--------------------------------------------------------------------------------
Q7SEW8_NEUCR/10-117--------------------------------------------------------------------------------
Q9FDL1_ZYMMB/42-154--------------------------------------------------------------------------------
Q27103_TRYVI/1-105--------------------------------------------------------------------------------
Q9ZA13_PSEHY/291-383--------------------------------------------------------------------------------
Q7D0A2_AGRT5/2-93--------------------------------------------------------------------------------
Q42482_9ROSI/16-112--------------------------------------------------------------------------------
Q84FK9_ENTAG/2-99--------------------------------------------------------------------------------
Q726I9_DESVH/2-101--------------------------------------------------------------------------------
O80887_ARATH/172-247--------------------------------------------------------------------------------
Q7URH4_RHOBA/33-129--------------------------------------------------------------------------------
Q97LN9_CLOAB/2-94--------------------------------------------------------------------------------
Q6LGQ4_PHOPR/2-98--------------------------------------------------------------------------------
Q8KCZ4_CHLTE/2-100--------------------------------------------------------------------------------
Q7S418_NEUCR/3-107--------------------------------------------------------------------------------
Q6PWS2_9GAMM/35-133--------------------------------------------------------------------------------
Q8ABC5_BACTN/2-99--------------------------------------------------------------------------------
Q6LYV0_METMP/2-100--------------------------------------------------------------------------------
Q82QQ6_STRAW/2-93--------------------------------------------------------------------------------
Q9F304_STRCO/2-93--------------------------------------------------------------------------------
Q9SIP1_ARATH/49-144--------------------------------------------------------------------------------
Q8RF81_FUSNN/2-98--------------------------------------------------------------------------------
Q6YTX5_ORYSJ/154-248--------------------------------------------------------------------------------
Q9A628_CAUCR/2-100--------------------------------------------------------------------------------
Q93NG5_ARTNI/9-103--------------------------------------------------------------------------------
Q7XBH1_ORYSJ/11-107--------------------------------------------------------------------------------
Q7W8L7_BORPA/4-98--------------------------------------------------------------------------------
O31026_VIBCL/2-98--------------------------------------------------------------------------------

PF03992

YETG_BACSU/1-78--------------------------------------------------------------------------------
Q930A7_RHIME/30-107--------------------------------------------------------------------------------
Q9L164_STRCO/44-120--------------------------------------------------------------------------------
Q9AE39_RHILE/1-81--------------------------------------------------------------------------------
Q930L9_RHIME/3-79--------------------------------------------------------------------------------
ISDG_LISMO/1-86--------------------------------------------------------------------------------
WH42_STRCO/45-121--------------------------------------------------------------------------------
ISDG_STAAW/2-79--------------------------------------------------------------------------------
Q8Y476_LISMO/1-77--------------------------------------------------------------------------------
Q98L66_RHILO/1-81--------------------------------------------------------------------------------
Q98HA4_RHILO/1-77--------------------------------------------------------------------------------
Q9A6W1_CAUCR/113-186--------------------------------------------------------------------------------
O33291_MYCTU/2-75--------------------------------------------------------------------------------
Q9L4Y0_9ACTO/10-86--------------------------------------------------------------------------------
Q8YAL6_LISMO/1-77--------------------------------------------------------------------------------
Q9S457_SALTM/1-77--------------------------------------------------------------------------------
Q5LR19_SILPO/12-92--------------------------------------------------------------------------------
NECA1_HUMAN/251-326--------------------------------------------------------------------------------
Q8XYB2_RALSO/23-99--------------------------------------------------------------------------------
Q9CLF6_PASMU/1-77--------------------------------------------------------------------------------
Q8KSW0_9ACTO/5-83--------------------------------------------------------------------------------
Q8NLF1_CORGL/2-78--------------------------------------------------------------------------------
O06569_MYCTU/1-77--------------------------------------------------------------------------------
Q8NRX5_CORGL/1-76--------------------------------------------------------------------------------
Q9I1R9_PSEAE/4-80--------------------------------------------------------------------------------
O32459_9ACTO/5-81--------------------------------------------------------------------------------
Q9I267_PSEAE/43-119--------------------------------------------------------------------------------
Q9RTW6_DEIRA/23-100--------------------------------------------------------------------------------
Q9RXN8_DEIRA/1-77--------------------------------------------------------------------------------
Q9FC02_STRCO/14-92--------------------------------------------------------------------------------
Q9K649_BACHD/1-78--------------------------------------------------------------------------------
Q92MY2_RHIME/1-77--------------------------------------------------------------------------------
O54259_STRNO/13-88--------------------------------------------------------------------------------
ISDG_BACHD/1-78--------------------------------------------------------------------------------
Q8KY33_STRCU/4-79--------------------------------------------------------------------------------
Q9RX23_DEIRA/3-80--------------------------------------------------------------------------------
Q9ESB4_RAT/251-326--------------------------------------------------------------------------------
Q92N21_RHIME/1-81--------------------------------------------------------------------------------
Q99IW7_9BACT/1-74--------------------------------------------------------------------------------
SCHA_STRHA/23-99--------------------------------------------------------------------------------
NECA2_HUMAN/285-360--------------------------------------------------------------------------------
Q8XW80_RALSO/11-88--------------------------------------------------------------------------------
Q9HY51_PSEAE/4-80--------------------------------------------------------------------------------
O68922_9ACTO/6-81--------------------------------------------------------------------------------
Q97V29_SULSO/1-78--------------------------------------------------------------------------------
Y1783_SYNY3/49-125--------------------------------------------------------------------------------
Q53908_STRCH/10-88--------------------------------------------------------------------------------
O06156_MYCTU/2-78--------------------------------------------------------------------------------
A9CGS9_AGRT5/10-86--------------------------------------------------------------------------------
Y2021_HALSA/401-477--------------------------------------------------------------------------------
Q8UIT6_AGRT5/6-83--------------------------------------------------------------------------------
Q9XAT7_RHOER/8-84--------------------------------------------------------------------------------
Q8NRX6_CORGL/1-76--------------------------------------------------------------------------------
Q93HM4_STRAW/16-92--------------------------------------------------------------------------------
Q9ABN2_CAUCR/2-78--------------------------------------------------------------------------------
Q9YCC3_AERPE/2-78--------------------------------------------------------------------------------
Q8TTU6_METAC/1-76--------------------------------------------------------------------------------
Q8PWK2_METMA/2-78--------------------------------------------------------------------------------
CURD_STRCN/16-90--------------------------------------------------------------------------------
Q9X9W3_STRCO/128-214--------------------------------------------------------------------------------
O54100_STRCO/29-106--------------------------------------------------------------------------------
Q9CFE4_LACLA/2-80--------------------------------------------------------------------------------
Q92Y06_RHIME/4-80--------------------------------------------------------------------------------
YQJZ_BACSU/12-86--------------------------------------------------------------------------------
Q8PEE0_XANCP/7-83--------------------------------------------------------------------------------
A9CLL3_AGRT5/1-78--------------------------------------------------------------------------------
Q9FD14_STRCU/8-84--------------------------------------------------------------------------------
Q9HYL5_PSEAE/1-78--------------------------------------------------------------------------------
Q7CRR7_AGRT5/5-81--------------------------------------------------------------------------------
Q8YJD4_BRUME/1-77--------------------------------------------------------------------------------
Q9HHS4_HALSA/1-77--------------------------------------------------------------------------------
Q9I5L9_PSEAE/2-79--------------------------------------------------------------------------------
TCMH_STRGA/10-86--------------------------------------------------------------------------------
Q54813_STRPE/13-95--------------------------------------------------------------------------------
Q8KL47_RHIEC/8-84--------------------------------------------------------------------------------
Q8KSV9_9ACTO/5-80--------------------------------------------------------------------------------
LSRG_ECOLI/1-77--------------------------------------------------------------------------------
Q98HP0_RHILO/1-74--------------------------------------------------------------------------------
Q8Y824_LISMO/4-80--------------------------------------------------------------------------------
Q9I6L9_PSEAE/2-78--------------------------------------------------------------------------------
Q8YC27_BRUME/1-81--------------------------------------------------------------------------------
ISDI_STAAM/1-78--------------------------------------------------------------------------------
Q9KLV5_VIBCH/1-77--------------------------------------------------------------------------------
YGIN_SHIFL/1-87--------------------------------------------------------------------------------
Q983R7_RHILO/10-88--------------------------------------------------------------------------------
O32458_9ACTO/9-85--------------------------------------------------------------------------------
NECA3_HUMAN/295-370--------------------------------------------------------------------------------
Q8NMA1_CORGL/2-78--------------------------------------------------------------------------------
Q9RSM4_DEIRA/18-94--------------------------------------------------------------------------------
O86332_MYCTU/4-79--------------------------------------------------------------------------------
Q9JYI1_NEIMB/3-79--------------------------------------------------------------------------------
Q9A6G2_CAUCR/1-78--------------------------------------------------------------------------------
Q97SM8_STRPN/11-89--------------------------------------------------------------------------------
Q9I1K5_PSEAE/247-321--------------------------------------------------------------------------------
Q97DS8_CLOAB/1-78--------------------------------------------------------------------------------
Q927R5_LISIN/1-77--------------------------------------------------------------------------------
Q9X5D6_ZYMMB/6-82--------------------------------------------------------------------------------
Q9L552_9ACTO/13-88--------------------------------------------------------------------------------
Q9CHY3_LACLA/1-77--------------------------------------------------------------------------------
A9CJ79_AGRT5/1-77--------------------------------------------------------------------------------
Q8NUM1_STAAW/43-119--------------------------------------------------------------------------------
Q98DQ1_RHILO/1-77--------------------------------------------------------------------------------
YHGC_BACSU/65-140--------------------------------------------------------------------------------
YCZJ_BACSU/1-78--------------------------------------------------------------------------------
Q9RSI3_DEIRA/10-86--------------------------------------------------------------------------------
Q93LN2_FLAJO/1-77--------------------------------------------------------------------------------
Q92VV2_RHIME/1-77--------------------------------------------------------------------------------
Q8RDZ4_FUSNN/112-188--------------------------------------------------------------------------------
Q93SH3_BRAJP/1-79--------------------------------------------------------------------------------
A9CHT4_AGRT5/1-79--------------------------------------------------------------------------------
Q9RKA2_STRCO/1-77--------------------------------------------------------------------------------
Q9ZBJ4_STRCO/2-77--------------------------------------------------------------------------------
Q9RX69_DEIRA/1-77--------------------------------------------------------------------------------
YCNE_BACSU/1-77--------------------------------------------------------------------------------

PF11695

A3K1D6_9RHOB/5-147--------------------------------------------------------------------------------
A3UM10_VIBSP/3-142--------------------------------------------------------------------------------
A4ELL4_9RHOB/3-145--------------------------------------------------------------------------------
Q9A5F4_CAUCR/31-169--------------------------------------------------------------------------------
A4XU80_PSEMY/15-153--------------------------------------------------------------------------------
A0P3D7_9RHOB/6-156--------------------------------------------------------------------------------
Q0RBQ9_FRAAA/10-154--------------------------------------------------------------------------------
A3VI98_9RHOB/8-150--------------------------------------------------------------------------------
Q1KY61_9BURK/6-145--------------------------------------------------------------------------------
Q2JDS7_FRASC/6-149--------------------------------------------------------------------------------
A1K291_AZOSB/3-141--------------------------------------------------------------------------------
A2TR58_9FLAO/5-145--------------------------------------------------------------------------------
B0T5Z4_CAUSK/7-145--------------------------------------------------------------------------------
Q027R7_SOLUE/5-144--------------------------------------------------------------------------------
A4FAH4_SACEN/6-146--------------------------------------------------------------------------------
Q2CEG7_9RHOB/3-154--------------------------------------------------------------------------------
Q9XAE9_STRCO/9-148--------------------------------------------------------------------------------
A9B229_HERA2/6-144--------------------------------------------------------------------------------
A4CB40_9GAMM/3-142--------------------------------------------------------------------------------
E0TC84_PARBH/7-147--------------------------------------------------------------------------------
Q2CA10_9RHOB/6-148--------------------------------------------------------------------------------
Q0RPH8_FRAAA/6-149--------------------------------------------------------------------------------
A4BK13_9GAMM/5-143--------------------------------------------------------------------------------
Q0APS8_MARMM/5-140--------------------------------------------------------------------------------
Q163R1_ROSDO/8-150--------------------------------------------------------------------------------
Q0BYF9_HYPNA/5-156--------------------------------------------------------------------------------
A1WRH2_VEREI/5-144--------------------------------------------------------------------------------
A5VYW1_PSEP1/5-142--------------------------------------------------------------------------------
A3JUK4_9RHOB/9-148--------------------------------------------------------------------------------
A0NQQ0_9RHOB/7-146--------------------------------------------------------------------------------
A5FB02_FLAJ1/6-148--------------------------------------------------------------------------------
A3XCS8_9RHOB/4-143--------------------------------------------------------------------------------
Q15UR5_PSEA6/3-142--------------------------------------------------------------------------------
B1KJR7_SHEWM/10-149--------------------------------------------------------------------------------

PF07682

Q972K4_SULTO/2-304--------------------------------------------------------------------------------
O66762_AQUAE/7-333--------------------------------------------------------------------------------
Q977W3_9CREN/2-304--------------------------------------------------------------------------------

PF07978

Q7PGV6_ANOGA/173-270--------------------------------------------------------------------------------
Q7SGJ2_NEUCR/232-329--------------------------------------------------------------------------------
Q5LMH4_SILPO/1-102--------------------------------------------------------------------------------
Q6W252_RHISN/3-102--------------------------------------------------------------------------------
Q7ZWJ6_DANRE/154-253--------------------------------------------------------------------------------
Q7A8Q2_ECO57/4-98--------------------------------------------------------------------------------
Q98EJ3_RHILO/1-102--------------------------------------------------------------------------------
Q89P12_BRAJA/7-101--------------------------------------------------------------------------------
Q89KU9_BRAJA/3-106--------------------------------------------------------------------------------
Q8GHL5_PSERE/107-204--------------------------------------------------------------------------------
Q8P3X3_XANCP/13-105--------------------------------------------------------------------------------
Q82QD1_STRAW/4-107--------------------------------------------------------------------------------
NIPS2_MOUSE/182-279--------------------------------------------------------------------------------
Q98DQ0_RHILO/2-103--------------------------------------------------------------------------------
Q98IN9_RHILO/48-151--------------------------------------------------------------------------------
Q89JD9_BRAJA/9-109--------------------------------------------------------------------------------
Q5M949_RAT/37-136--------------------------------------------------------------------------------
Q7VX89_BORPE/3-102--------------------------------------------------------------------------------
Q9L992_VIBMI/3-103--------------------------------------------------------------------------------
Q8FYG5_BRUSU/1-102--------------------------------------------------------------------------------
Q983U2_RHILO/146-257--------------------------------------------------------------------------------
Q8GHL5_PSERE/5-96--------------------------------------------------------------------------------
NIPS1_MOUSE/185-282--------------------------------------------------------------------------------
Q6DJ76_XENTR/46-144--------------------------------------------------------------------------------
Q88JP3_PSEPK/3-104--------------------------------------------------------------------------------
Q6C7U3_YARLI/393-490--------------------------------------------------------------------------------
Q5M949_RAT/146-245--------------------------------------------------------------------------------
Q89P26_BRAJA/3-96--------------------------------------------------------------------------------
Q89P26_BRAJA/107-202--------------------------------------------------------------------------------
Q983U2_RHILO/19-118--------------------------------------------------------------------------------
A9CLJ4_AGRT5/3-102--------------------------------------------------------------------------------
NPS3A_PONAB/37-136--------------------------------------------------------------------------------
A9CJ80_AGRT5/1-102--------------------------------------------------------------------------------
Q6DJ76_XENTR/154-253--------------------------------------------------------------------------------
Q9R6I8_RHIRD/8-124--------------------------------------------------------------------------------
YMQ1_CAEEL/427-524--------------------------------------------------------------------------------
Q63UF8_BURPS/3-102--------------------------------------------------------------------------------
Q7ZWJ6_DANRE/45-143--------------------------------------------------------------------------------
Q6N5T9_RHOPA/71-174--------------------------------------------------------------------------------
Q9PU59_DANRE/177-274--------------------------------------------------------------------------------
Q9AH04_RHOER/3-100--------------------------------------------------------------------------------
Q7UP06_RHOBA/160-263--------------------------------------------------------------------------------

PF05336

Q7CTD6_AGRT5/2-109--------------------------------------------------------------------------------
Q7CW72_AGRT5/2-109--------------------------------------------------------------------------------
RHAM_MANSM/2-104--------------------------------------------------------------------------------
RHAM_OCEIH/2-104--------------------------------------------------------------------------------
RHAM_RHILO/3-105--------------------------------------------------------------------------------
RHAM_VEREI/4-106--------------------------------------------------------------------------------
RHAM_ENT38/2-104--------------------------------------------------------------------------------
B8G8A8_CHLAD/2-107--------------------------------------------------------------------------------
Q0U0I1_PHANO/9-125--------------------------------------------------------------------------------
Q2CGS4_9RHOB/3-103--------------------------------------------------------------------------------
RHAM_RHIL3/4-106--------------------------------------------------------------------------------
Q5YUK3_NOCFA/6-109--------------------------------------------------------------------------------
Q9RD70_STRCO/2-106--------------------------------------------------------------------------------
RHAM_ROSDO/3-105--------------------------------------------------------------------------------
RHAM_CLOB8/2-104--------------------------------------------------------------------------------
A6UJC5_SINMW/2-109--------------------------------------------------------------------------------
Q2CD72_9RHOB/2-104--------------------------------------------------------------------------------
B2TGR4_BURPP/1-110--------------------------------------------------------------------------------
Q01TX0_SOLUE/2-105--------------------------------------------------------------------------------
A5FI86_FLAJ1/2-110--------------------------------------------------------------------------------
A1CPH6_ASPCL/5-116--------------------------------------------------------------------------------
A1RB67_ARTAT/3-104--------------------------------------------------------------------------------
Q1J3P3_DEIGD/11-115--------------------------------------------------------------------------------
Q9HK61_THEAC/1-101--------------------------------------------------------------------------------
RHAM_BACSU/2-104--------------------------------------------------------------------------------
Q7SE90_NEUCR/56-169--------------------------------------------------------------------------------
Q0S9A0_RHOSR/2-105--------------------------------------------------------------------------------
A1ULG3_MYCSK/7-108--------------------------------------------------------------------------------
A0M226_GRAFK/5-115--------------------------------------------------------------------------------
RHAM_BACTN/2-104--------------------------------------------------------------------------------
Q55IY9_CRYNB/18-130--------------------------------------------------------------------------------
Q9RC86_BACHO/5-108--------------------------------------------------------------------------------
Q4EHA7_LISMN/2-104--------------------------------------------------------------------------------
Q0FS08_9RHOB/4-106--------------------------------------------------------------------------------
RHAM_YERPE/2-104--------------------------------------------------------------------------------
Q8A896_BACTN/18-128--------------------------------------------------------------------------------
RHAM_CLOPH/2-104--------------------------------------------------------------------------------
A0NP38_9RHOB/2-104--------------------------------------------------------------------------------
Q017X5_OSTTA/19-126--------------------------------------------------------------------------------
A0RPU5_CAMFF/262-367--------------------------------------------------------------------------------
A1WK61_VEREI/2-109--------------------------------------------------------------------------------
RHAM_ERWCT/2-104--------------------------------------------------------------------------------
RHAM_BURPP/2-104--------------------------------------------------------------------------------
A0K063_ARTS2/1-107--------------------------------------------------------------------------------
A1RAY8_ARTAT/1-104--------------------------------------------------------------------------------
RHAM_FLAJ1/5-107--------------------------------------------------------------------------------
RHAM_LACS1/3-108--------------------------------------------------------------------------------
Q0PB25_CAMJE/2-105--------------------------------------------------------------------------------
RHAM_BACSK/2-104--------------------------------------------------------------------------------
Q1GLV0_SILST/2-109--------------------------------------------------------------------------------
Q986Z5_RHILO/2-109--------------------------------------------------------------------------------
Q0G1U8_9RHIZ/12-114--------------------------------------------------------------------------------
Q0C0B4_HYPNA/2-109--------------------------------------------------------------------------------
A0QQ10_MYCS2/2-106--------------------------------------------------------------------------------
Q9RJV5_STRCO/8-113--------------------------------------------------------------------------------
Q826A8_STRAW/1-104--------------------------------------------------------------------------------
RHAM_LACPL/2-104--------------------------------------------------------------------------------
RHAM_JANSC/2-104--------------------------------------------------------------------------------
RHAM_AGRT5/5-107--------------------------------------------------------------------------------
RHAM_BURCH/2-104--------------------------------------------------------------------------------
RHAM_ACICJ/2-104--------------------------------------------------------------------------------

PF05949

A4XI07_CALS8/93-243--------------------------------------------------------------------------------
YLXW_BACSU/89-226--------------------------------------------------------------------------------
YLXX_BACSU/83-233--------------------------------------------------------------------------------
A0LU92_ACIC1/145-295--------------------------------------------------------------------------------
A3TKX2_9MICO/127-287--------------------------------------------------------------------------------
A1SK85_NOCSJ/127-266--------------------------------------------------------------------------------
A6WCM5_KINRD/131-288--------------------------------------------------------------------------------
A0QGP0_MYCA1/147-305--------------------------------------------------------------------------------
A1KJN5_MYCBP/147-305--------------------------------------------------------------------------------
A0QYG6_MYCS2/148-306--------------------------------------------------------------------------------
A1T9U1_MYCVP/136-294--------------------------------------------------------------------------------
Q1B829_MYCSS/143-301--------------------------------------------------------------------------------
Q0SI94_RHOSR/127-284--------------------------------------------------------------------------------
Q8G9N0_RHOFA/126-281--------------------------------------------------------------------------------
A8KY04_FRASN/136-295--------------------------------------------------------------------------------
A7BCD9_9ACTO/130-277--------------------------------------------------------------------------------
Q6A8T9_PROAC/110-254--------------------------------------------------------------------------------
A7A5S8_BIFAD/121-280--------------------------------------------------------------------------------
Q8G697_BIFLO/165-324--------------------------------------------------------------------------------
A0LQT1_ACIC1/85-241--------------------------------------------------------------------------------
A8LWH0_SALAI/110-266--------------------------------------------------------------------------------
Q0RB08_FRAAA/88-247--------------------------------------------------------------------------------
Q2J4K8_FRASC/167-328--------------------------------------------------------------------------------
A8LCG0_FRASN/122-286--------------------------------------------------------------------------------
A6W3X9_KINRD/92-247--------------------------------------------------------------------------------
A3TN20_9MICO/92-247--------------------------------------------------------------------------------
Q82FC4_STRAW/110-269--------------------------------------------------------------------------------
Q6ABC5_PROAC/122-276--------------------------------------------------------------------------------
A0PKC5_MYCUA/85-242--------------------------------------------------------------------------------
A4KN44_MYCTU/100-257--------------------------------------------------------------------------------
Q1BG49_MYCSS/116-273--------------------------------------------------------------------------------
A0ZZD3_BIFAA/87-247--------------------------------------------------------------------------------
Q8G6P6_BIFLO/94-254--------------------------------------------------------------------------------
A1SCN6_NOCSJ/110-267--------------------------------------------------------------------------------
Q251Q0_DESHY/89-241--------------------------------------------------------------------------------
A9AXV7_HERA2/93-248--------------------------------------------------------------------------------
A4J2B7_DESRM/82-226--------------------------------------------------------------------------------
A5D137_PELTS/88-234--------------------------------------------------------------------------------
Q3AAF2_CARHZ/83-228--------------------------------------------------------------------------------
Q67L65_SYMTH/79-224--------------------------------------------------------------------------------
A6P1Q7_9FIRM/94-243--------------------------------------------------------------------------------
Q2RGA3_MOOTA/82-238--------------------------------------------------------------------------------
A6CTV4_9BACI/94-231--------------------------------------------------------------------------------
Q2B4P0_9BACI/100-237--------------------------------------------------------------------------------
Q65JX7_BACLD/88-225--------------------------------------------------------------------------------
Q5L0X4_GEOKA/92-229--------------------------------------------------------------------------------
Q9K9T3_BACHD/98-239--------------------------------------------------------------------------------
A0Q065_CLONN/89-243--------------------------------------------------------------------------------
A5N7F2_CLOK5/89-240--------------------------------------------------------------------------------
A7FQ29_CLOB1/87-241--------------------------------------------------------------------------------
Q894C4_CLOTE/87-241--------------------------------------------------------------------------------
Q97H91_CLOAB/88-246--------------------------------------------------------------------------------
Q0SRW9_CLOPS/87-241--------------------------------------------------------------------------------
A6LTT1_CLOB8/87-240--------------------------------------------------------------------------------
B8I727_CLOCE/90-232--------------------------------------------------------------------------------
A3DEC8_CLOTH/87-233--------------------------------------------------------------------------------
A3DEC9_CLOTH/87-236--------------------------------------------------------------------------------
A4IM11_GEOTN/83-232--------------------------------------------------------------------------------
A6CTV5_9BACI/80-233--------------------------------------------------------------------------------
Q2B4N9_9BACI/85-238--------------------------------------------------------------------------------
Q9K9T4_BACHD/82-232--------------------------------------------------------------------------------
A8FCY5_BACP2/83-233--------------------------------------------------------------------------------
Q65JX6_BACLD/83-233--------------------------------------------------------------------------------
A6TMJ2_ALKMQ/87-232--------------------------------------------------------------------------------
A8MIM5_ALKOO/74-221--------------------------------------------------------------------------------
Q180E1_CLOD6/78-226--------------------------------------------------------------------------------
A6TKZ4_ALKMQ/88-242--------------------------------------------------------------------------------
A6TS58_ALKMQ/88-242--------------------------------------------------------------------------------
Q182Y3_CLOD6/85-232--------------------------------------------------------------------------------
Q251P9_DESHY/84-225--------------------------------------------------------------------------------
A1HU46_9FIRM/75-225--------------------------------------------------------------------------------
B0KDA6_THEP3/93-243--------------------------------------------------------------------------------
Q8R9G9_THETN/86-236--------------------------------------------------------------------------------
A4J2B6_DESRM/80-231--------------------------------------------------------------------------------
A5D138_PELTS/79-229--------------------------------------------------------------------------------
Q3AAF1_CARHZ/87-236--------------------------------------------------------------------------------
Q67Q42_SYMTH/86-236--------------------------------------------------------------------------------
Q0AYQ4_SYNWW/82-232--------------------------------------------------------------------------------
A6TS57_ALKMQ/86-237--------------------------------------------------------------------------------
A0Q063_CLONN/87-239--------------------------------------------------------------------------------
A5N7F0_CLOK5/88-236--------------------------------------------------------------------------------
A7GDF0_CLOBL/87-234--------------------------------------------------------------------------------
Q894C2_CLOTE/87-233--------------------------------------------------------------------------------
Q97H89_CLOAB/87-241--------------------------------------------------------------------------------
A6LTS9_CLOB8/88-240--------------------------------------------------------------------------------
Q0TPA0_CLOP1/87-237--------------------------------------------------------------------------------
Q2RGA2_MOOTA/88-230--------------------------------------------------------------------------------
A3KKU2_STRAM/149-288--------------------------------------------------------------------------------
A3TKX4_9MICO/129-268--------------------------------------------------------------------------------
A6WCM3_KINRD/104-249--------------------------------------------------------------------------------
Q0RNH1_FRAAA/108-249--------------------------------------------------------------------------------
A8KY02_FRASN/141-282--------------------------------------------------------------------------------
C1APA2_MYCBT/148-291--------------------------------------------------------------------------------
A3Q0H9_MYCSJ/122-269--------------------------------------------------------------------------------
A4TA87_MYCGI/105-253--------------------------------------------------------------------------------
Q0SI96_RHOSR/103-247--------------------------------------------------------------------------------
Q8G9M8_RHOFA/99-242--------------------------------------------------------------------------------
A1SK83_NOCSJ/101-242--------------------------------------------------------------------------------
Q6A8T7_PROAC/107-249--------------------------------------------------------------------------------
A7A5S6_BIFAD/132-273--------------------------------------------------------------------------------
Q8G699_BIFLO/131-272--------------------------------------------------------------------------------
A7BCD7_9ACTO/127-266--------------------------------------------------------------------------------
A9AXV6_HERA2/92-230--------------------------------------------------------------------------------

PF03795

YJPA_BACSU/6-82----------------------------------------------E----------------------KRLKM---F..
Q9I3Z5_PSEAE/1-116----------------------------------------------A----------------------GHYIA---SHA
Q98EG6_RHILO/1-116----------------------------------------------E----------------------GKLII---AQA
Q9AB44_CAUCR/10-125----------------------------------------------Q----------------------GVLRG---GQG
Q9I3Z0_PSEAE/1-123----------------------------------------------A----------------------GVMLA---GEG
Q98I36_RHILO/1-116----------------------------------------------A----------------------GVLLA---LDG
Q98DP4_RHILO/1-116----------------------------------------------S----------------------GAWLA---GER
Q98HH2_RHILO/1-118----------------------------------------------A----------------------GRLGP---VAR
Q98H82_RHILO/1-116----------------------------------------------E----------------------GTLGP---SAR
Q984U5_RHILO/1-115----------------------------------------------S----------------------GHFVT---AEA
P73587_SYNY3/2-86----------------------------------------------S----------------------GVLVT---I..
Q983T6_RHILO/165-255----------------------------------------------D----------------------GGVIL---F..
Q9RVF8_DEIRA/6-88----------------------------------------------S----------------------GVFLT---S..
Q97TR0_CLOAB/1-82----------------------------------------------L----------------------GKFIC---S..
Q9X7N1_STRCO/1-82----------------------------------------------Q----------------------GVFLA---S..
Q98H68_RHILO/7-87----------------------------------------------E----------------------GIFVA---S..
Q9ZNA3_9RHOB/1-86----------------------------------------------V----------------------QQA..---...
Q9AJZ7_STRCO/1-88----------------------------------------------E----------------------..MIA---R..
Q45075_BURCE/1-92----------------------------------------------.----------------------.KIQV---G..
Q98EI5_RHILO/1-89----------------------------------------------D----------------------KKLAF---A..
Q9AC00_CAUCR/2-87----------------------------------------------T----------------------GLKLA---...
Q9F188_CUPNE/1-88----------------------------------------------K----------------------DLLLA---C..
Y828_HAEIN/1-95----------------------------------------------E----------------------NRLLT---A..
Q9KRE0_VIBCH/1-95----------------------------------------------E----------------------GRLLT---A..
YCII_SHIFL/1-95----------------------------------------------E----------------------GRLLT---A..
Q9HZ38_PSEAE/1-95----------------------------------------------E----------------------GRLVL---A..

PF07045

Q89BY8_BRAJA/78-142----------------------------------------------K----------------------.LVAR...R--
A4T848_MYCGI/15-77----------------------------------------------K----------------------.VLAF...G--
Q1MHU6_RHIL3/14-77----------------------------------------------R----------------------.LIAL...D--
A1B208_PARDP/14-78----------------------------------------------R----------------------.LVTA...H--
Q98DD6_RHILO/15-78----------------------------------------------K----------------------.FLAR...G--
A6VTU1_MARMS/14-77----------------------------------------------R----------------------.FIAK....--
Q0C268_HYPNA/14-78----------------------------------------------C----------------------.LLAA...D--
Q1GHA0_SILST/14-77----------------------------------------------E----------------------.FIAR...G--
B1KC06_BURCC/15-78----------------------------------------------K----------------------.VLAA...Y--
Q391P0_BURS3/15-78----------------------------------------------H----------------------.FVIH...G--
Q28QV7_JANSC/15-78----------------------------------------------C----------------------.FLAR...G--
A1K1N9_AZOSB/14-77----------------------------------------------R----------------------.FLAR...V--
Q7VAI4_PROMA/19-83----------------------------------------------E----------------------.VFAK...D--
Q6SHS9_9BACT/17-82----------------------------------------------E----------------------.FVTY...D--
Q3JLQ5_BURP1/14-78----------------------------------------------R----------------------.FLTR...G--
Q1GFX6_SILST/15-78----------------------------------------------R----------------------.FLVR...G--
Q07UT1_RHOP5/15-78----------------------------------------------R----------------------.FLVR...A--
Q0FAX8_9RHOB/16-79----------------------------------------------K----------------------.FIAR...G--
A5V7J9_SPHWW/14-78----------------------------------------------E----------------------.TLAR...S--
Q2BPT9_9GAMM/14-76----------------------------------------------E----------------------.IVV....G--
Q0KCE3_CUPNH/15-79----------------------------------------------E----------------------.VLVR...G--
A6UK15_SINMW/14-77----------------------------------------------R----------------------.LIAL...D--
Q6NCX9_RHOPA/15-79----------------------------------------------K----------------------.FLTR...G--
Q7WD74_BORBR/14-77----------------------------------------------K----------------------.VLVR...G--
Q28UH1_JANSC/39-104----------------------------------------------E----------------------.VLVG...T--
Q89JB1_BRAJA/26-90----------------------------------------------R----------------------.YLAR...G--
A7HSS3_PARL1/14-78----------------------------------------------R----------------------.LLAA...E--
Q5NR08_ZYMMO/14-78----------------------------------------------R----------------------.YLSR...G--
Q28SX7_JANSC/15-78----------------------------------------------R----------------------.PIVR...G--
Q742V7_MYCPA/18-80----------------------------------------------T----------------------.VLAV...D--
Q1I972_PSEE4/14-78----------------------------------------------R----------------------.FLAR...G--
A9AQ60_BURM1/15-78----------------------------------------------R----------------------.FAIH...G--
Q8TNJ5_METAC/3-67----------------------------------------------R----------------------.YLIR...G--
Q16DN6_ROSDO/15-78----------------------------------------------K----------------------.FLAR...G--
A6VY75_MARMS/14-79----------------------------------------------K----------------------.LLSR...G--
Q0FH20_9RHOB/10-73----------------------------------------------R----------------------.FLVK...G--
Q0RQX9_FRAAA/15-78----------------------------------------------T----------------------.FVAR...G--
A0P3L8_9RHOB/15-78----------------------------------------------N----------------------.FLAR...G--
Q8FXW8_BRUSU/15-78----------------------------------------------N----------------------.FIAR...G--
B2JPM5_BURP8/16-79----------------------------------------------K----------------------.FIVR...G--
Q1QS87_NITHX/15-78----------------------------------------------N----------------------.FIVG...G--
Q11E97_MESSB/14-79----------------------------------------------R----------------------TTLVR...G--
A9BN41_DELAS/15-79----------------------------------------------E----------------------.VCVR...G--
Q98G06_RHILO/36-99----------------------------------------------R----------------------.FLVH...G--
A1TLS8_ACIAC/15-79----------------------------------------------E----------------------.VCVR...G--
Q28KV2_JANSC/15-79----------------------------------------------H----------------------.YVTK...A--
A5FY88_ACICJ/15-78----------------------------------------------R----------------------.FLVR...G--
Q46FP8_METBF/16-80----------------------------------------------E----------------------.YLAR...S--
A4XXX9_PSEMY/29-93----------------------------------------------R----------------------.LLAR...G--
A7IC73_XANP2/126-189----------------------------------------------W----------------------.FLVR...G--
Q0C4G1_HYPNA/15-78----------------------------------------------T----------------------.PLAF...Y--
B2TDH4_BURPP/15-78----------------------------------------------H----------------------.FIVH...G--
Q0FEP2_9RHOB/15-78----------------------------------------------K----------------------.VLAR...G--
Q2KDF1_RHIEC/15-78----------------------------------------------N----------------------.FLAR...G--
A5E903_BRASB/8-72----------------------------------------------R----------------------.LPAA...D--
Q128E5_POLSJ/15-79----------------------------------------------E----------------------.VCVR...G--
Q65SN3_MANSM/36-100----------------------------------------------R----------------------.FIVR...G--
Q1BE44_MYCSS/14-78----------------------------------------------T----------------------.LLAA...D--
A9ATA2_BURM1/14-77----------------------------------------------V----------------------.FLAR...G--
A0PQ06_MYCUA/14-78----------------------------------------------T----------------------.LLAA...D--
A8L5T2_FRASN/24-88----------------------------------------------K----------------------.VLAV...D--
Q484V4_COLP3/14-77----------------------------------------------E----------------------.VLVK....--
Q98JP1_RHILO/57-122----------------------------------------------K----------------------.YLSR...S--
A0YH96_9GAMM/14-79----------------------------------------------I----------------------.YRVR...G--
A0YGY6_9GAMM/14-78----------------------------------------------K----------------------.MLSV...D--
Q47EX6_DECAR/15-79----------------------------------------------E----------------------.LVFR...G--
B2SY97_BURPP/15-78----------------------------------------------M----------------------.MLAS...H--
B2U9C2_RALPJ/15-79----------------------------------------------E----------------------.PLVR...G--
Q6F9F1_ACIAD/14-77----------------------------------------------K----------------------.FLAR...G--
B2TES1_BURPP/15-78----------------------------------------------T----------------------.VLAA...Y--
Q39MC4_BURS3/15-78----------------------------------------------K----------------------.VLAA...Y--
Q0FH19_9RHOB/14-77----------------------------------------------Q----------------------.FIAR...A--
Q05S93_9SYNE/15-78----------------------------------------------R----------------------.FLCR...D--
Q0FAW6_9RHOB/16-82----------------------------------------------K----------------------.VIAMAKVG--
A0YEI5_9GAMM/17-82----------------------------------------------E----------------------.FVTF...D--
A6UFC5_SINMW/15-78----------------------------------------------S----------------------.FLAR...G--
A0Y8B3_9GAMM/7-71----------------------------------------------T----------------------.MLSV...D--
Q28P24_JANSC/18-83----------------------------------------------E----------------------.VLAA...T--
Q7V2V4_PROMP/19-83----------------------------------------------E----------------------.VFAK...D--
Q1YYX4_PHOPR/14-77----------------------------------------------I----------------------.LLAR...G--
A1B8D1_PARDP/15-78----------------------------------------------R----------------------.FLVR...G--
A0Y900_9GAMM/14-78----------------------------------------------K----------------------.MLAV...D--
A0QZT5_MYCS2/14-78----------------------------------------------R----------------------.FLAR...G--
Q127Z9_POLSJ/14-78----------------------------------------------R----------------------.FLVR...G--
Q89X32_BRAJA/34-98----------------------------------------------R----------------------.LLAA...D--
Q0RXH4_RHOSR/14-78----------------------------------------------R----------------------.YLVR...G--
A4XTJ7_PSEMY/15-78----------------------------------------------V----------------------.YRIH...G--
A1AZL7_PARDP/14-77----------------------------------------------A----------------------.FLAR...G--
Q9LCS9_BRAJP/15-78----------------------------------------------R----------------------.FVVR...G--
O85836_SPHAR/14-79----------------------------------------------E----------------------.MVCR...S--
A1BAV2_PARDP/15-78----------------------------------------------R----------------------.FVIH...G--
Q98CT4_RHILO/21-84----------------------------------------------R----------------------.YLVR...G--
A8KZG9_FRASN/14-78----------------------------------------------R----------------------.YLVA...G--
A2BXC0_PROM5/33-96----------------------------------------------S----------------------.LVMK...D--
Q68E53_AERPU/15-78----------------------------------------------T----------------------.FLAA...Y--
B1KGZ1_SHEWM/14-79----------------------------------------------K----------------------.YLSR...S--
A6WA35_KINRD/26-89----------------------------------------------R----------------------.FVVL...G--
A1B124_PARDP/15-78----------------------------------------------R----------------------.VLAR...G--
Q215U7_RHOPB/14-78----------------------------------------------K----------------------.YLAR...G--
Q3KB77_PSEPF/14-78----------------------------------------------R----------------------.FLAR...G--
Q984S8_RHILO/14-78----------------------------------------------R----------------------.YLVR...G--
Q165U6_ROSDO/14-77----------------------------------------------H----------------------.FIAR...G--
Q1V0T9_PELUQ/15-78----------------------------------------------K----------------------.PLVR...G--
A4X3R6_SALTO/15-79----------------------------------------------G----------------------.FVIR...N--
Q2VZK5_MAGSA/14-79----------------------------------------------E----------------------.YLAR...G--
Q2BJZ2_9GAMM/14-79----------------------------------------------R----------------------.YLAR...T--
Q0B1J7_BURCM/14-78----------------------------------------------R----------------------.FLSR...G--
Q2BHP1_9GAMM/14-77----------------------------------------------R----------------------.FIAK....--
Q48IM5_PSE14/14-78----------------------------------------------K----------------------.FLAR...G--
A0NLT0_9RHOB/14-79----------------------------------------------S----------------------.VIAA...D--
Q11KJ1_MESSB/15-78----------------------------------------------R----------------------.FLAR...G--
Q3J0R2_RHOS4/15-78----------------------------------------------V----------------------.FLAR...G--
Q0FAQ5_9RHOB/14-77----------------------------------------------E----------------------.FLAR...G--
Q87W43_PSESM/18-82----------------------------------------------R----------------------.FISR...G--
A0NQZ0_9RHOB/15-78----------------------------------------------H----------------------.FIIH...G--
B2JHP1_BURP8/15-78----------------------------------------------H----------------------.FVLH...G--
Q15VR2_PSEA6/41-104----------------------------------------------H----------------------.YIAM....--
Q1D8Q3_MYXXD/14-78----------------------------------------------R----------------------.YLVK...G--
A5V7D8_SPHWW/14-79----------------------------------------------R----------------------.YLVK...G--
Q21DJ6_SACD2/14-78----------------------------------------------N----------------------.RLVK....--
Q1YE00_MOBAS/23-86----------------------------------------------R----------------------.FLIH...G--
Q65QR7_MANSM/32-95----------------------------------------------E----------------------.ILVA...N--
Q5YTA0_NOCFA/14-78----------------------------------------------T----------------------.LLAA...D--
Q3AME8_SYNSC/24-88----------------------------------------------R----------------------.VIAF...T--
A8LJW3_DINSH/15-78----------------------------------------------R----------------------.VLAR...D--
Q129N1_POLSJ/23-84----------------------------------------------T----------------------.FIVR...A--
Q0I7X2_SYNS3/15-78----------------------------------------------R----------------------.LLIR...D--
A8LL19_DINSH/14-77----------------------------------------------Q----------------------.FLAR...G--
Q1GHQ7_SILST/14-79----------------------------------------------R----------------------.FLVR...G--
Q46KM6_PROMT/19-83----------------------------------------------K----------------------.VFAK...D--
Q2C9X6_9RHOB/15-78----------------------------------------------V----------------------.FLAR...G--
Q0C383_HYPNA/14-80----------------------------------------------E----------------------.YVVR...A--
A7IC73_XANP2/15-78----------------------------------------------R----------------------.FIVR...G--
A0R1N9_MYCS2/15-77----------------------------------------------T----------------------.ILAV...D--
Q5FU37_GLUOX/15-78----------------------------------------------K----------------------.ILAA...Y--
Q1LPI6_RALME/15-79----------------------------------------------E----------------------.VLVR...G--

PF07110

Q98J67_RHILO/10-91--------------------------------------------..L----------------------HRYEI---S--
YTH4_RHOER/10-90--------------------------------------------...----------------------VKRFA---A--
Q89V09_BRAJA/21-102--------------------------------------------..L----------------------KKYAV---S--
Q93EX2_9NOCA/10-91--------------------------------------------..L----------------------VDYIT---V--
Q9KGB0_BACHD/16-96--------------------------------------------...----------------------LRDMK---V--
Q884M0_PSESM/10-93--------------------------------------------YCK----------------------GYSVD---R--
Q2N8F2_ERYLH/12-112--------------------------------------------NHP----------------------LVGPS---A--
D0J371_COMT2/26-114--------------------------------------------VKA----------------------VAQCS---R--
Q2UH77_ASPOR/43-139--------------------------------------------.GM----------------------IPPTA---M--
C9S7C3_VERA1/40-151--------------------------------------------RRQ----------------------DPATV---A--
Q0UAA8_PHANO/20-125--------------------------------------------PST----------------------ASAPN---A--
B6QRR3_PENMQ/18-114--------------------------------------------TPE----------------------AKATL---D--
C9SY64_VERA1/65-158--------------------------------------------.HS----------------------TPEFR---D--
B8MSU2_TALSN/18-112--------------------------------------------HPL----------------------RSEQG---H--
A5VH99_SPHWW/138-221--------------------------------------------KKR----------------------IHNIP---T--
A5V521_SPHWW/98-177--------------------------------------------...----------------------..SGY---R--
B9K152_AGRVS/13-109--------------------------------------------.HA----------------------FDGVY---F--
B2W3U7_PYRTR/13-127--------------------------------------------TQK----------------------RADPD---A--
Q0U4N6_PHANO/13-123--------------------------------------------LPR----------------------HSDGA---A--
B2WDV2_PYRTR/13-120--------------------------------------------GGP----------------------ANPDR---P--
Q0U5I6_PHANO/13-111--------------------------------------------AKA----------------------DPKGL---K--
A2QB94_ASPNC/13-115--------------------------------------------TPS----------------------SEGTY---P--
A2QVN7_ASPNC/13-122--------------------------------------------..A----------------------RNATT---P--
B8MPG2_TALSN/43-154--------------------------------------------TTA----------------------RNPTT---P--
A6RYK8_BOTFB/14-123--------------------------------------------DKS----------------------NSNYK---A--
Q2UT25_ASPOR/23-122--------------------------------------------..D----------------------GPPDF---P--
C9Z9Q5_STRSW/12-103--------------------------------------------.HV----------------------FDASF---G--
A2R8B5_ASPNC/14-111--------------------------------------------.TA----------------------YHPDP---A--
A5VH99_SPHWW/12-106--------------------------------------------NRT----------------------MLPED---N--
Q396J2_BURS3/130-221--------------------------------------------..N----------------------FLYVQ---N--
A6GBX1_9DELT/12-106--------------------------------------------STT----------------------LAVQD---N--
C9Z9Q5_STRSW/139-234--------------------------------------------HVR----------------------VPGAE---Q--
B5HPI7_9ACTO/138-233--------------------------------------------HGQ----------------------TPGAE---N--
A8L3R3_FRASN/10-95--------------------------------------------.VR----------------------PSRVT---A--
A5V7F6_SPHWW/12-99--------------------------------------------DYR----------------------RSYVV---P--
A5V7F6_SPHWW/139-229--------------------------------------------HPV----------------------FADYR---R--
A4XEJ1_NOVAD/13-101--------------------------------------------...----------------------...RK---H--
C7Z3Q5_NECH7/37-130--------------------------------------------..H----------------------QTPEM---K--
Q140F8_BURXL/125-207--------------------------------------------...----------------------...AN---P--
C8ND54_9GAMM/12-105--------------------------------------------...----------------------LPLCH---D--
C2M2M0_CAPGI/12-107--------------------------------------------.FP----------------------FFPTD---E--
Q93AB2_YERPE/18-98--------------------------------------------...----------------------.....---.--
B8MF02_TALSN/21-117--------------------------------------------AKP----------------------MNLLP---R--
C8VQ65_EMENI/29-132--------------------------------------------TET----------------------RELMY---E--
C5FQT1_ARTOC/22-118--------------------------------------------LST----------------------RSLMG---R--
Q2GSS6_CHAGB/53-131--------------------------------------------...----------------------.....---.--
B8NJL1_ASPFN/19-113--------------------------------------------DNF----------------------SAARP---H--
C8VTL3_EMENI/15-109--------------------------------------------DQF----------------------STFTP---H--
Q0UIY9_PHANO/18-106--------------------------------------------...----------------------...IE---N--
A2QH37_ASPNC/566-663--------------------------------------------SET----------------------KEMMK---R--
B6QDA9_PENMQ/20-117--------------------------------------------TMN----------------------EPLKE---A--
A2QDU1_ASPNC/19-117--------------------------------------------TKS----------------------LITDK---I--
B0YAX3_ASPFC/21-118--------------------------------------------SFR----------------------DFTSE---L--
B2WLL6_PYRTR/30-124--------------------------------------------HLE----------------------RDRKV---V--
Q4P1P8_USTMA/29-132--------------------------------------------PLT----------------------SMFGP---D--
C7Z0I7_NECH7/17-115--------------------------------------------YAE----------------------EFKEK---I--
Q9F3V8_9PSEU/12-93--------------------------------------------..L----------------------RYYAQ---T--

PF09448

O51799_CUPNE/2-113----------------------------------------------------------------------RLVA------
Q471R3_CUPPJ/2-113----------------------------------------------------------------------RLVA------
Q7WWV7_CUPNH/2-112----------------------------------------------------------------------RLVA------

PF03927

C6BCZ8_RALP1/19-97--------------------------------------------IAG----------------------SEIHAA-----
Q5E3J5_VIBF1/8-86--------------------------------------------LPN----------------------TEIYGE-----
A0KIM0_AERHH/3-81--------------------------------------------LEG----------------------AEIHAV-----
A8GHJ5_SERP5/4-83--------------------------------------------IAD----------------------TEIPAQ-----
Q1Z7G7_PHOPR/4-82--------------------------------------------MPN----------------------TEIPGD-----
A4NJ35_HAEIF/12-91--------------------------------------------IEH----------------------TEIPTF-----
A8H5B1_SHEPA/3-80--------------------------------------------MEN----------------------AEL.SV-----
A8FUK0_SHESH/4-82--------------------------------------------FEE----------------------AEIYGV-----
A1S9X8_SHEAM/3-81--------------------------------------------LPG----------------------AEVHAT-----
A4WZM9_RHOS5/4-81--------------------------------------------VAG----------------------CEVAIA-----
A8G0D7_SHESH/3-81--------------------------------------------LVG----------------------ADIHAV-----
A4BGQ8_9GAMM/12-90--------------------------------------------LTG----------------------VEIVAD-----
Q3HS06_PSEST/3-81--------------------------------------------LPG----------------------LELHQE-----
Q21PN2_SACD2/9-87--------------------------------------------NPD----------------------IEICQT-----
A1K384_AZOSB/5-83--------------------------------------------FPE----------------------AEVCAV-----
A3EIL2_VIBCL/16-94--------------------------------------------LRD----------------------VEIYGE-----
Q93HX4_MAGMG/16-95--------------------------------------------IPG----------------------VEVHTM-----
Q6D5Z1_ERWCT/3-82--------------------------------------------LPN----------------------VEVAAS-----
Q7VPJ8_HAEDU/8-87--------------------------------------------IPH----------------------AEIHGE-----
Q9Z3W5_9RHIZ/4-81--------------------------------------------IEG----------------------VEVHAT-----
Q080B9_SHEFN/3-80--------------------------------------------IKN----------------------AEL.SA-----
A7ZP29_ECO24/3-82--------------------------------------------FPG----------------------CEVAVS-----
Q1LFZ4_RALME/17-95--------------------------------------------MTG----------------------MEIHAI-----
A5ED22_BRASB/28-106--------------------------------------------LAG----------------------CEIHGR-----
Q7WIQ2_BORBR/20-98--------------------------------------------LPG----------------------AEIHAV-----
A6WJJ0_SHEB8/3-81--------------------------------------------LMG----------------------ADIHAV-----
A6UJX6_SINMW/6-83--------------------------------------------IPN----------------------VEVYAH-----
A6FC51_9GAMM/4-82--------------------------------------------IPD----------------------AEIYGD-----
Q9Z3V0_RHOSP/37-115--------------------------------------------FAG----------------------CEVFAR-----
E6XM26_SHEP2/3-80--------------------------------------------IEN----------------------AEL.SV-----
Q12P45_SHEDO/3-80--------------------------------------------NKR----------------------AEL.SV-----
A6CVN7_9VIBR/4-82--------------------------------------------FDN----------------------AEIYGD-----
Q0I5G8_HAES1/75-153--------------------------------------------IPH----------------------TEIPAE-----
Q9CKL9_PASMU/11-90--------------------------------------------IPY----------------------TEIPAL-----
A6VQY8_ACTSZ/8-87--------------------------------------------IPH----------------------AEIHGE-----
Q7WXC4_CUPNH/17-95--------------------------------------------ITG----------------------AEIHAV-----
A9CGL4_AGRT5/6-83--------------------------------------------LDN----------------------VEVHGE-----
A1SWQ1_PSYIN/4-82--------------------------------------------LDG----------------------AELITM-----
A0NZM7_9RHOB/3-81--------------------------------------------IDG----------------------AEIAHS-----
Q487G3_COLP3/9-87--------------------------------------------VEG----------------------AEIHAV-----
A3USH4_VIBSP/4-82--------------------------------------------FDN----------------------AEIYGS-----
Q13I16_BURXL/16-97--------------------------------------------LPG----------------------AEIHAI-----
A4XWL9_PSEMY/3-81--------------------------------------------LEG----------------------LELHQE-----
Q9F5L4_BRAJP/32-110--------------------------------------------LAG----------------------CEIHGR-----
B1KH53_SHEWM/3-81--------------------------------------------LDG----------------------ADIHAV-----
A4U4X6_9PROT/17-95--------------------------------------------LPG----------------------VEVHTM-----
Q5P545_AROAE/97-175--------------------------------------------VPE----------------------LDICTI-----
Q1ZGB7_9GAMM/4-82--------------------------------------------FCG----------------------AEVVSI-----
A7JS88_PASHA/9-88--------------------------------------------IPH----------------------TEIHGE-----
A7N7J4_VIBHB/4-82--------------------------------------------YEN----------------------AEIYGD-----
NAPD_PARPN/28-105--------------------------------------------LPG----------------------TEVHAV-----
A7M679_9PSED/3-81--------------------------------------------LPG----------------------TELHQE-----
A3QHX3_SHELP/3-81--------------------------------------------LAG----------------------ADIHAV-----
Q02IZ5_PSEAB/3-81--------------------------------------------LDG----------------------LEIYQE-----
O86475_RHOSH/4-81--------------------------------------------VPG----------------------CEVAAA-----
A1JL25_YERE8/4-83--------------------------------------------IPG----------------------TEIPTS-----
A8H065_SHEPA/3-81--------------------------------------------LEG----------------------TEIHAV-----
Q2SGV8_HAHCH/3-81--------------------------------------------PPT----------------------QEVTHS-----
Q47A86_DECAR/2-80--------------------------------------------MPG----------------------VEIHAR-----

PF01037

GRP_ZYMMO/71-144----------------------------------------....SPE----------------------VIEFYR-----
ZRP_ZYMMO/68-141----------------------------------------....IPE----------------------IVEVHR-----
Q92MD2_RHIME/86-156----------------------------------------....FSS----------------------VRRVFS-----
Q7D0A6_AGRT5/69-139----------------------------------------....IKE----------------------VTTLHS-----
Q8XUT3_RALSO/72-151----------------------------------------....WPE----------------------VVTCYA-----
Q6FBR8_ACIAD/74-148----------------------------------------....YPE----------------------IVECHM-----
Q5UYW6_HALMA/69-139----------------------------------------....HKQ----------------------MISVYE-----
O28651_ARCFU/68-142----------------------------------------....FSE----------------------VHAVRL-----
Q97KE2_CLOAB/74-146----------------------------------------....IKE----------------------IVELYY-----
Q6LFY1_PHOPR/75-149----------------------------------------....NRS----------------------VQQCYY-----
Q9KKN4_VIBCH/69-143----------------------------------------....IPE----------------------IEACYS-----
Q88Q35_PSEPK/72-143----------------------------------------....IPE----------------------VIQCEV-----
LRPB_BACSU/69-136----------------------------------------....RNE----------------------ISEAHR-----
Q8ELF6_OCEIH/69-140----------------------------------------....HPQ----------------------VASIYQ-----
Q7P0K6_CHRVO/67-134----------------------------------------....TPE----------------------VIECAS-----
Q5LQ65_SILPO/71-144----------------------------------------....RPE----------------------VQEAHR-----
Q6NDU4_RHOPA/81-154----------------------------------------....MPE----------------------VIEFYR-----
Q8XS36_RALSO/102-176----------------------------------------....VPG----------------------CLECHV-----
Q6N2H6_RHOPA/71-144----------------------------------------....EPL----------------------VRECWM-----
REG3_PYRHO/78-149----------------------------------------....FPE----------------------VDVLGI-----
Q9RT71_DEIRA/109-183----------------------------------------....RPE----------------------VLECYL-----
Q8KJG4_RHILI/76-150----------------------------------------....FPE----------------------ILDCWA-----
PUTR_RHIRD/76-150----------------------------------------....IKE----------------------VEECHM-----
Q87GT1_VIBPA/66-140----------------------------------------....IDG----------------------VKWCHA-----
Q6LY54_METMP/67-138----------------------------------------....FEE----------------------VKKVFT-----
Q6L2L7_PICTO/21-92----------------------------------------....ISN----------------------VEEVFV-----
Q5V2Q8_HALMA/69-143----------------------------------------....FPE----------------------VTSLRL-----
Q9HQ13_HALSA/69-140----------------------------------------....IEG----------------------VREVNL-----
Q8E9E7_SHEON/75-150----------------------------------------....YEE----------------------VQECAL-----
Q7WKQ4_BORBR/91-161----------------------------------------....IPE----------------------VEEISS-----
Q7WFA6_BORBR/67-141----------------------------------------....APE----------------------ILECYA-----
Q8PJL5_XANAC/72-142----------------------------------------....IPE----------------------VRLLHS-----
Q97C07_THEVO/6-77----------------------------------------....ING----------------------VVEAHP-----
A9CFY0_AGRT5/67-137----------------------------------------....FPE----------------------ISEIHT-----
Q8D573_VIBVU/77-150----------------------------------------....TDW----------------------ILMCHC-----
Q63VD1_BURPS/71-145----------------------------------------....QPE----------------------VTQCYR-----
Q8XQA9_RALSO/69-143----------------------------------------....LPE----------------------VVECHL-----
Q64MN4_BACFR/70-142----------------------------------------....IPE----------------------IVECHF-----
Q6A8E6_PROAC/82-152----------------------------------------....FPE----------------------VRGCHS-----
Q9L101_STRCO/68-139----------------------------------------....YQE----------------------VVAAST-----
Q7TXW4_MYCBO/98-164----------------------------------------....KRQ----------------------......-----
Q5YPF7_NOCFA/74-144----------------------------------------....IPG----------------------VLEAYA-----
Q98D73_RHILO/70-144----------------------------------------....MDE----------------------VSSCWT-----
Q98F66_RHILO/68-135----------------------------------------....IAE----------------------FGECDK-----
Q9A2I8_CAUCR/74-148----------------------------------------....VRE----------------------VAECYL-----
Q9AAL7_CAUCR/79-153----------------------------------------....LPE----------------------VIEAAQ-----
Q649E6_9ARCH/43-117----------------------------------------....YPE----------------------VQSVRL-----
Q5LQ72_SILPO/75-142------