Sequence alignment for CL0033

PF00651

BACH2_MOUSE/27-133LNDQRKKD..I-LCDVTLIVE......RKEFRAHRAVLAAC--S-EYFWQALVGQ................---------
BAT47_CAEEL/8-109FDKSMEK....-YTDVVLVVK......QERFYVSRAILSEH--C-TYFQSLFCGD................---------
ZBT17_MOUSE/14-114LNQQRQLG..L-LCDCTFVVD......GVDFKAHKAVLAAC--S-EYFKMLFVDQ................---------
Y2060_ARATH/201-303LGNFLESW..Q-LSDTVFLVGE....EEMDVPAHKVILQAS--G-NFPLRSSDGD................---------
Y2060_ARATH/341-455LVKLYSTG..E-YSDIKIYLSD....HSLTFQSHKVILSLW--S-VAFAKMFTNG................---------
O61795_CAEEL/46-153LGGLKNRD..V-LCDVTLICG......WKRINAHRVVLSAC--S-PYFLSMFTSQ................---------
O76610_CAEEL/10-114FDHQMEP....-YSDVVLVAS......QEWFHVSKAILCDH--S-PYFRCLLSNF..............PR---------
KELC_DROME/147-253MNEMRKQK..Q-LCDVILVADD......VEIHAHRMVLASC--S-PYFYAMFTSF................---------
KLH21_HUMAN/25-133LSQLRAER..K-FLDVTLEAAG.....GRDFPAHRAVLAAA--S-PYFRAMFAGQ................---------
O45927_CAEEL/141-251YIDFARPI.PI-FSDTIVLVD......GVKFHVNRMILSMA--S-PIFLEAFVTN................---------
BTBD2_HUMAN/112-217NNEVLC.....-..DVHFLVGKG..LSSQRIPAHRFVLAVG--S-AVFDAMFNGG...............M---------
O44818_CAEEL/140-244FERSNE....E-FSDVILAVGD......KKFFVLRKFLASH--S-TYFETLLLGN................---------
P91543_CAEEL/104-200FSESEDT....-..DAVLVVED......KRLHVNKEFLSLH--S-TYFAELFKKS................---------
Q18030_CAEEL/118-226FSQPFDS....-.SNVVLKVED......EEFHVHTFVLSMA--S-QYFKVLFNGSF.............IE---------
LZTR1_HUMAN/655-764MKAYLEGAGAE-FCDITLLLD......GHPRPAHKAILAAR--S-SYFEAMFRSF................---------
BAB1_DROME/117-222FDQLLQNE..C-FVDVTLACD......GRSMKAHKMVLSAC--S-PYFQTLLAET...............P---------
O17112_CAEEL/140-243FLPSEKN....-..DAFLVIGE......RKLHVNKAFLSYH--S-DYFQALFSSN..............FK---------
BACH1_MOUSE/24-130LNDQRKKD..V-LCDVTVLVE......GQRFRAHRSVLAAC--S-SYFHSRIVGQ...............T---------
BCL6_HUMAN/22-129LNRLRSRD..I-LTDVVIVVS......REQFRAHKTVLMAC--S-GLFYSIFTDQ...............L---------
BRC1_DROME/22-127FENLRDDE..A-FVDVTLACE......GRSIKAHRVVLSAC--S-PYFRELLKST...............P---------
CALI_BOVIN/18-128LNKQRKRK..E-YWDIALTVD......HHVFFAHRNVLAAV--S-PLVKNLISNHD.............MK---------
ENC1_HUMAN/36-144LNLLRQQR..L-FTDVLLHAGN......RTFPCHRAVLAAC--S-RYFEAMFSGGL.............KE---------
GAGA_DROME/24-129IQLLRCHG..D-LVDCTLAAG......GRSFPAHKIVLCAA--S-PFLLDLLKNT...............P---------
GCL_DROME/56-166YKALFKEE..K-NSDVAVMALD.......KVWHLHKVYLSQ--S-PYFYTMFNGT..............WR---------
ZBT48_HUMAN/16-119LNKQREKG..Q-YCDATLDVG......GLVFKAHWSVLACC--S-HFFQSLYGDG................---------
KBTBA_HUMAN/23-130LKDLLDEK..K-FIDCTLKAGD......KSLPCHRLILSAC--S-PYFREYFLSEI.............DE---------
LOLA2_DROME/22-127FDTLLENE..T-LVDCTLAAE......GKFLKAHKVVLSAC--S-PYFATLLQEQ...............Y---------
KAISO_HUMAN/22-125LNEQRGHG..L-FCDVTVIVED......RKFRAHKNILSAS--S-TYFHQLFSVA...............G---------
ZF161_HUMAN/26-132LNEQRLEG..E-FCDIAIVVE......DVKFRAHRCVLAAC--S-TYFKKLFKKL................---------
ABTB2_RAT/832-945LDPHFLNN.KE-MSDVTFLVEG......KLFYAHKVLLVTA--S-NRFKTLMTNK...............S---------
ZBTB5_HUMAN/14-123LNYQRLHG..Q-LCDCVIVVG......NRHFKAHRSVLAAC--S-THFRALFSVA..............EG---------
ZBT7B_HUMAN/24-145LNEQRQLG..H-LCDLTIRTQ......GLEYRTHRAVLAAC--S-HYFKKLFTEGGGGAVMGAGGSGTATG---------
ZBT22_HUMAN/47-151LNQQRLQG..Q-LCDVSIRVQ......GREFRAHRAVLAAS--S-PYFHDQVLLK................---------
O16313_CAEEL/54-165FDEIFTST..D-HSDVTLVLDD....G.TEFAAHRLILAVR--S-SFFRAMLYTG................---------
O16566_CAEEL/67-171FDESNE....E-FSDVVVAVGN....E.K.FYVLKVYLASH--S-TYFKTLFLGK..............FV---------
O16736_CAEEL/144-248FDESME....E-FSDVVLLVGE....K.K.FYVLRKYLAAQ--S-KYFKALLLGS..............FE---------
O16740_CAEEL/129-232FMPSQKT....-..DAILMIGG......EKLHVNKAFLSFH--S-DFFHELFSAS..............ST---------
O16741_CAEEL/157-256FAPSNRH....-..DAVLLIGE......KKLHVSKAFLSYH--S-DYFSDLFADK..............IN---------
O16744_CAEEL/132-231FSPSEQS....-..DAVLLVGD......KKLHVNKAFLSCH--S-TYFRSLFAKQ..............AD---------
O17197_CAEEL/70-174NLPSDKN....-..DAILLVEE......QQLHVNKAFLSFH--S-DYFSALFSSN..............FK---------
O17253_CAEEL/135-236FEPSRKH....-..DAVLLIGE......KKLHVNKAFLSYH--S-DYFCDLFAEK..............FD---------
O17297_CAEEL/141-242FDKSAE....E-FSDVVLEVGG....K.K.FYVLKKFLASH--S-TYFNALLLGK................---------
O18147_CAEEL/41-148FNELRSKC..Q-LCDVALLVE......NRKLSAHKVILAAT--I-PYFRGMFTLD................---------
BPM3_ARATH/184-303LKDLLDSE..V-GCDIAFQVG......DETYKAHKLILAAR--S-PVFRAQFFGP................---------
Y2045_ARATH/15-132KKLLNEQW...-QADVRLKAGDS..DETTSIFAHKLVLVAR--S-EVFKKILESD................---------
NACC1_RAT/20-124LNEQRLQG..L-YCDVSVVVK......GHAFKAHRAVLAAS--S-SYFRDLFNSS................---------
ZBT43_HUMAN/23-126LNQQRQQG..Q-LCDVSIVVQ......GHIFRAHKAVLAAS--S-PYFCDQVLLK................---------
O44815_CAEEL/142-246FEKSEE....Q-FSDVILAVED....E.T.FHVLKKFLASH--S-TYFNALLLGK..............FK---------
O44817_CAEEL/137-241FDKSNK....K-FSDVILAIED....E.K.FYVLKKFLASH--S-TYFKTLLLGK..............FE---------
O44905_CAEEL/112-216FNHPYKNL...-..GLVAFEYV......FCLHYNPRFLSFH--S-SYFRKLFSSN..............FK---------
O45594_CAEEL/135-238FLPSHEN....-..DAILVIGK......KKLHVCKAFLSYH--S-SFFRAIFSST..............FK---------
O61932_CAEEL/71-176LRDDYSGA.RE-LCDVTLRFDD......ESIPAHWVMLAAY--S-PAFAEKFRKP................---------
O72730_COWPX/30-136MHDLRKSG..K-FCDITFHTKD.....NKDISAHKVVVAGF--S-TYFADMLNND................---------
KBTB2_CWPXG/16-123ISNLLDDD..I-LCDVIITIGD....G.EEIKAHKTILAAG--S-TYFKTMFTTP................---------
B2RG49_HUMAN/24-131LNEQRHDG..L-LCDVLLVVQ......EQEYRTHRSVLAAC--S-KYFKKLFTAG..............TL---------
BTB1_SCHPO/608-735LTSYENYK.QS-FSDVTIYCG......TSMFHSHKFILCAR--S-SFLRKLLLQKKKSS......VSNIIY---------
O76568_CAEEL/144-248FEKSNE....E-FSDVVLAVGD....K.E.FFVLKQFLAYH--S-SYFKSLLLGK..............FA---------
O77168_APIME/26-132FHQLLQTE..A-FVDVTLACN......EASLKAHKVVLSAC--S-SYFQKLLLSN...............P---------
KEN_DROME/23-131IGAAFRGE..H-PADLTIVCEN.....KVKLHAHKLVLAAA--S-PLIRNLLEDT...............H---------
Y4409_ARATH/15-129LKVLKEQ....-QVDVRLMARDS..EKDAAISAHKRILSAR--S-EVFEEMFESD................---------
BCL6B_MOUSE/28-135LNELRLRG..I-LTDVTLLVG......GQPLRAHKAVLIAC--S-GFFYSIFRGR...............A---------
O89076_MOUSE/10-122MIEHRLSQ..Q-LCDVTLQVK.YEDIPAAQLMAHKVVLASS--S-PVFKAMFTNG................---------
ZBT7A_CHICK/24-131LNEQRNNG..L-LCDVVILVE......GQEFPTHRSVLAAC--S-QYFKKLFTSG..............LV---------
P90538_DICDI/34-143FKSLLGEF.KK-YTDIKIKCGG......QIFPTHRIILANS--S-EFFGRLLLSD................---------
ZN238_HUMAN/14-121LSEQRHQG..F-LCDCTVLVG......DAQFRAHRAVLASC--S-MYFHLFYKDQ...............L---------
ZBTB6_HUMAN/23-127MNLLRQQN..L-FCDVSIYIN......DTEFQGHKVILAAC--S-TFMRDQFLLT................---------
Q17523_CAEEL/126-230FIDFEKKS..K-WLDVLIRSED....GKKMIYANSGILALN--S-PILKQKLENN................---------
Q17782_CAEEL/193-300LENLYRSG..K-HADFTLVVEE......RELKAHKAILAAR--S-PVFAAMMEPH..............TA---------
Q19838_CAEEL/23-130LQAKRRAGDFS-TCDVKIQLKT......GFDMVHSVVICAH--S-DVFSETFDNQ................---------
Q20183_CAEEL/184-293CNETLA.....-..DVFFVVGIDD.SR.QRIPAHKFVLSIG--S-VVFDAMFNGGL.............TP---------
BAT38_CAEEL/220-325FGAMQTN....-ICDMTLVINK......QKLFVNKAYLALY--S-PVFYAMFFSN................---------
Q21899_CAEEL/143-245FDVLPEEE...-..NALLKVED......RLIRVNKRYLSMM--S-PFFKALFYGE..............LG---------
MMD4_DROME/22-128FHESLCRG..D-LVDVSLAAE......GQIVKAHRLVLSVC--S-PFFRKMFTQM..............PS---------
ABRU_DROME/93-198FRHLRDEE..D-FVDVTLACD......ERSFTAHKVVLSAC--S-PYFRRLLKAN...............P---------
Q24455_DROME/25-131FQQLREDL..S-FVDVTLSCE......HGSLKAHKVVLSAC--S-TYFQKLLLEN...............P---------
CP190_DROME/20-127LQNFFNKT..D-YCDLTLQFRD.....NSQLKVHRLVLSAC--T-DYFNVLEQTC................---------
HIC1_CHICK/53-160LNTQRTKG..F-LCDVIIVVQ......NALFRAHKNILAAS--S-AYLKSLVVHD................---------
MEL26_CAEEL/191-300YQRLFSQ....-..ELLCDFAIN..VNGKIIRAHKAVLAAR--S-PVFNAMLTHQ................---------
SPOP_HUMAN/190-297LGGLWEN...S-RFTDCCLCVA....G.QEFQAHKAILAAR--S-PVFSAMFEHE................---------
TTKB_DROME/23-127FDQLLHAE..T-FTDVTLAVE......GQHLKAHKMVLSAC--S-PYFNTLFVSH...............P---------
KBTB1_VACCW/11-118INGFRNSG..R-FCDISIVIND......ERINAHKLILSGA--S-EYFSILFSN.................---------
VC04_SWPVK/8-116LHDFFKHG..I-MCDIKIVSIE....NNKTISAHRLILSMY--S-KYFYNIFNSD...............F---------
VC13_SWPVK/16-119LNAVNLNR..S-YDEEIVFIMTV...G.GVVKVKKELLVSV--S-NYFKLITKNQ...............S---------
VF03_VACCC/18-120MTKKFK.....-..TIIDAIGG.......NIIVNSTILKKL--S-PYFRTHLRQKY.............TK---------
VMT8_MYXVL/6-112LYKLFLKG..K-LCDVEIVAE......GKSIRAHRLVLSAY--S-KYFYNLFNGN................---------
ZBT39_HUMAN/20-126LNKCRLSE..T-MCDVTIVVG......SRSFPAHKAVLACA--A-GYFQNLFLNT...............G---------
ZBT24_HUMAN/27-133FEDQRKKG..F-LCDITLIVEN......VHFRAHKALLAAS--S-EYFSMMFAEE................---------
BTB3_SCHPO/157-262LLSNSALH..F-TTDIVFAGQY....G..RVFAHKFYLAAR--S-SYFKSKFSKL...............G---------
BTB3_SCHPO/296-405LNQPSDQY..S-FHDAYLQSYT......HRYPVHRAIMCRC--E-YFLDMLAGPF..............LE---------
YIA1_YEAST/264-390VFSLMNCP..A-YPDVQLMVKNR..NGAIRIYPCHLAVLSR--A-EYFKVMFTNNFKE.........KVTY---------
BAT15_CAEEL/139-243FDESEK....R-FSDVILVVGD....E.K.FYVLKLFLASH--S-SYFNALFLGK..............FK---------
BAT42_CAEEL/208-319NNRSMWED.EL-FTDCVIHVGN......KHIKAHRCILGQN--S-PVFKSMFSSP..............NM---------
BAT43_CAEEL/255-368MYGLFDNKQFS-DFTLVCKSDLG..SPTQTFHIHKAILAAR--S-RVFSAMFEHH................---------
YR47_CAEEL/45-146FEETLSP....-..TVTLVLRN....N.EEVIFDRYLLSFY--S-NYFRVLFSSK..............FR---------
ZBT16_HUMAN/24-126ANQMRLAG..T-LCDVVIMVDS......QEFHAHRTVLACT--S-KMFEILFHRN..............SQ---------
ZBT25_HUMAN/14-119LNMQREFG..F-LCDCTVAIG......DVYFKAHRAVLAAF--S-NYFKMIFIHQ...............T---------

PF11822

Q29D48_DROPS/298-606---------------VVIHVCDEVKNTSRDFTCPQHLLVSK--M-GYFADVT............................
Q4Q8A2_LEIMA/20-417---------------VEITVQDPATHHERPFLCALGPLRTH--M-RYFEPLIQRQ.........................
Q0IFU1_AEDAE/236-536---------------VIIHVCDEVKGTSRDFSCPQKLLITK--M-GYFADVT............................
Q383Z9_TRYB2/26-376---------------VEVSVYDKQSNEMRVFRCDLHLLESS--M-TYFTPIIKCYLDEEERQKSREEKSLDRASST....
A4HGL7_LEIBR/10-407---------------AEITVQDPVTHNERTFLCALGPLRTH--M-RYFEPLIQRQ.........................
Q4RN30_TETNG/1-302---------------MVIHVCDETKNLKQDFTCPRDLLVKE--M-RYFAEYLSV..........................
A7S8V2_NEMVE/1-302---------------MVIHVCDESKNLKQDFTCPRDLLIRE--M-RYFAEYLSV..........................
Q4DXB1_TRYCC/30-401---------------VEVTVYDKLLNEVRTFRCHQHLLETS--M-AYFEPIIRRYLEEEAEEEKKRIRAEIEKGRDSISG
K1841_XENLA/146-448---------------MVIHVCDEAKNLKEDFVCPRDLLVSE--M-KYFAEYLST..........................

PF03931

SKP1_HUMAN/2-67-------------PSIKLQSSD-----GEIFEVDVEI-AKQ--S-VTIKTMLEDL-------------------------
O77430_DROME/2-66-------------PSIKLQSSD-----EEIFDTDIQI-AKC--S-GTIKTMLEDC-------------------------
ASK16_ARATH/4-64-------------NKIVLTSSD-----DESFEVEEAV-ARK--L-KVIAHMIDDD-------------------------
SKP1_EMENI/4-65-------------KMLVMTSND-----GKNIEVPRDV-AER--S-LLIKNMLEDL-------------------------
O75863_HUMAN/17-82-------------MDGKLVSSD-----DDDFIVKREH-TRA--S-GIRKAVLSGP-------------------------
SKP1A_ARATH/4-63-------------KKIVLKSSD-----GESFEVEEAV-ALE--S-QTIAHMVEDD-------------------------
ELOC_HUMAN/17-79-------------MYVKLISSD-----GHEFIVKREH-ALT--S-GTIKAMLSGP-------------------------
O82463_NICCL/2-61-------------KMIVLRSSD-----GETFEVEESV-ALE--S-QTIKHMIEDD-------------------------
Q21367_CAEEL/8-70-------------PVFKIQSCD-----GQVFAVEDWF-IQK--S-KCFSVVLAQM-------------------------
Q23153_CAEEL/69-131-------------KYVKLVSND-----DHEFIIKREV-AMT--S-KSLRELFANP-------------------------
ELOC_YEAST/4-66-------------DFVTLVSKD-----DKEYEISRSA-AMI--S-PTLKAMIEGP-------------------------
ASK19_ARATH/4-64-------------KKIVLTSSD-----GESFKVEEVV-ARK--L-QIVGHIIEDD-------------------------
ASK12_ARATH/4-64-------------KMIVLMSSD-----GQSFEVEEAV-AIQ--S-QTIAHMVEDD-------------------------
ASK14_ARATH/4-64-------------NKIVLSSSD-----GESFEVEEAV-ARK--L-KIVEHMIEDD-------------------------
SKP1B_ARATH/5-64-------------RKITLKSSD-----GENFEIDEAV-ALE--S-QTIKHMIEDD-------------------------
Q89374_PBCV1/1-61-------------MSIVFITSD-----FHRIEADKNV-LDQ--S-TVINDIVEDV-------------------------
SKP1A_DICDI/2-63-------------SLVKLESSD-----EKVFEIEKEI-ACM--S-VTIKNMIEDI-------------------------

PF02214

KCNA5_MOUSE/113-204---------------VLINIS------GLRFETQLGTLAQF.PN-TLLGDPVK..-------------------------
KCNAL_DROME/43-132---------------LLINVS------GRRFETWRNTLEKY.PD-TLLGSNER.E-------------------------
KCNS1_MOUSE/21-120---------------LRVNVG------GVRRLLSARALARF.PG-TRLGRLQAAA-------------------------
KCNS3_HUMAN/17-116---------------VNLNVG------GFKQSVDQSTLLRF.PH-TRLGKLLTCH-------------------------
Q18986_CAEEL/7-97---------------VKLDVG------GKIFKTTIFTLC.K.HD-SMLKTMFCTD-------------------------
KCNA7_MOUSE/47-138---------------LVLNVA------GLRFETRARTLGRF.PD-TLLGDPVR..-------------------------
O76266_HIRME/83-174---------------ILINVS------GQQFEISSELLDRH.PS-TLLGNQAS..-------------------------
P91557_CAEEL/6-93---------------IKLNVG------GKEFSTTEATLT..KFE-GYFKQKLKTR-------------------------
O17001_CAEEL/21-113---------------VNLNVG------GRIFATSCNTLTWI.PD-SFFTSLLSGR-------------------------
O16612_CAEEL/6-96---------------VKLNVG------GTVFETLKSTLT..KHD-GFFKALIETD-------------------------
O16709_CAEEL/9-96---------------IRLNIG------GKRFDTHKSTLM..KFD-GYFKKFLQTP-------------------------
Q26094_POLPE/45-136---------------IDINVG------GKRFQTYNKTLERF.PL-SLLGDTER..-------------------------
O16706_CAEEL/5-95---------------VQLDVG------GTIFKTSKSTLT..KFN-GFLKIMLESD-------------------------
KCNA2_CANFA/35-126---------------VVTNIS------GLRFETQLKTLAQF.PE-TLLGDPKK..-------------------------
KCNB1_HUMAN/33-132---------------VRLNVG------GLAHEVLWRTLDRL.PR-TRLGKLRDCN-------------------------
KCNC1_HUMAN/10-104---------------IVINVG------GTRHQTYRSTLRTL.PG-TRLAWLAE..-------------------------
P91564_CAEEL/5-95---------------IKLDVG------GTIFKTSKDTLT..KFH-SFFKTMLECK-------------------------
Q25376_LOLOP/42-133---------------VVINVS------GLRFETQTRTLSQF.PD-TLLGNPKK..-------------------------
KCNAW_DROME/12-102---------------VVLNVG------GIRHETYKATLKKI.PA-TRLSRLTE..-------------------------
KCNS2_MOUSE/19-118---------------IRINVG------GFKRRLRSHTLLRF.PE-TRLGRLLLCH-------------------------
O16613_CAEEL/8-96---------------VKLNVG------GTVFVTLKSTLT..KHH-GIFKALVKTE-------------------------
O97045_HALRO/72-171---------------VKLNVG------GVVHEARWIILDKL.PN-TRLGRLRHCS-------------------------
Q26095_POLPE/56-146---------------VIINVS------GKKFETYLTTLMKF.PD-SLLGDPKK..-------------------------
Q09658_CAEEL/92-183---------------VTINVS------GMRFQTFESTLSRY.PN-SLLGDRNK..-------------------------
KCA10_HUMAN/88-179---------------VIINIA------GLRFETQLRTLSQF.PE-TLLGDREK..-------------------------
O76889_DROME/24-115---------------VKLNVG------GTYFLTTKTTLS.RDPN-SFLSRLIQED-------------------------
KCND1_HUMAN/42-131---------------LVVNVS------GRRFETWKNTLDRY.PD-TLLGSSEK..-------------------------
KCNAS_DROME/99-190---------------VVINVS------GLRFETQLRTLNQF.PD-TLLGDPAR..-------------------------
KCND3_RAT/42-131---------------IVLNVS------GRRFQTWRTTLERY.PD-TLLGSTEK..-------------------------
Q20381_CAEEL/28-127---------------VFVNVG------GRRARLNSDIIIRRLAT-SRLAVFCEKS-------------------------
KCNG1_HUMAN/65-164---------------IIINVG------GIKYSLPWTTLDEF.PL-TRLGQLKACT-------------------------
Q26597_SCHMA/53-144---------------LVINVS------GLRFETQAQTVNQF.PD-TLLGNPNK..-------------------------
Q16976_APLCA/66-156---------------ILLNVG------GVRHETHVSTLRTV.PN-SRLSRLAET.-------------------------
P91784_POLPE/46-135---------------LTINVS------GRRYQTYSHTLRKF.KE-TLLGSQER..-------------------------
P91783_POLPE/39-128---------------LRLNVS------GFMYRLHESFLNRF.PD-TLLGSNEK..-------------------------
O16711_CAEEL/8-100---------------IRLNIG------GTIFETSKSTLT..KFD-GFFKTLLETD-------------------------
KCNV1_RAT/44-153---------------LTVNVG------GSRFVLSQQALSCF.PH-TRLGKLAVVV-------------------------
Q26344_APLSP/158-258---------------VILNVG------GVKHEVLWRTLERMRPH-TRLGKLRDCT-------------------------
Q18776_CAEEL/84-176---------------VRLNVG------GKVFQTTRSTLM.REPC-SFLYRLCQDE-------------------------
KCNAB_DROME/279-378---------------VSINVG------GVRHEVLWRTLERL.PH-TRLGRLRECT-------------------------
P91556_CAEEL/2-87---------------LRLNVG------GKEFVTSKATLT..KFD-GYFKNLPEIQ-------------------------
O16630_CAEEL/2-90---------------IRLDVG------GRKFSTNRSTLT..KFD-GYFRKLPKLK-------------------------
P91256_CAEEL/38-137---------------LKLNIG------GTSFMILIDAILRADTT-TFLSRFVQLT-------------------------
BACD2_MOUSE/30-120---------------VQLNVG------GSLYYTTVRALT..RHD-TMLKAMFSGR-------------------------
O16708_CAEEL/99-187---------------VNLNVG------GKPFATLKTTLQ..KFE-GNLKELPE..-------------------------
KCNG2_CHICK/59-158---------------VIINVG------GIKYKVPWTTLENC.PL-TRLGKLKSCN-------------------------

PF07707

KBTBC_MOUSE/131-233CIGIYYFAKQI.GAEDLSDQS------KKYLYQHFAEVSLH--G.EILD.IEAHQ-------------------------
Q7PXP7_ANOGA/170-272CLGFSLFAEQQ.GCTALLKLA------TAYTCQHFQQVWKN--Q.EFFM.LDAAQ-------------------------
KLHL8_MOUSE/178-280CLAVRAFAESH.NRIDLMDMA------DQYACEHFTEVVEC--E.DFVS.VSPQH-------------------------
O61795_CAEEL/158-260CLGIRAFADTH.SCKELLSSA------DEFALKNFSRVIGK--E.EFQM.LTVES-------------------------
KLHL6_MOUSE/172-274CIGILRLADTH.SLDSLKMQV------QSYIIQNFVQILNS--E.EFLE.LPVDT-------------------------
KLH18_HUMAN/140-242CLGVRQFAETM.MCAVLYDAA------NSFIHQHFVEVSMS--E.EFLA.LPLED-------------------------
KELC_DROME/258-360CLGIREFADIH.ACVELLNYA------ETYIEQHFNEVIQF--D.EFLN.LSHEQ-------------------------
BTBDH_XENLA/161-261VVSWYHYALRM.GDITLQESC------LKFLAWNLSTVMSS--N.EWVT.VSDNL-------------------------
KBTB3_HUMAN/150-252CLQLLSISDSY.GSTSLFDHA------LHFVQHHFSLLFKS--S.DFLE.MNFGV-------------------------
KELC_ANOST/201-303CLGIRDFADIH.GCIDLLNYA------ETYIEQHFSEVVQF--D.EFLN.LTSDQ-------------------------
GAN_MOUSE/134-236CIGIRDFALHY.CLHHVHYLA------TEYLETHFRDVSST--E.EFLE.LSPQK-------------------------
Q8JIM0_DANRE/160-262VIGISRFAEEI.GCTDLHLRT------REYINTHFNEVTKE--E.EFFS.LSHCQ-------------------------
Q7PMB5_ANOGA/179-281ALGILRFAEAH.NCRQLAEVA------ANFVHSNFPKVALE--D.ELLD.IPHTL-------------------------
Q7QHD7_ANOGA/175-277VLGIRQFADTL.GCSKLIVSA------DRYIHQHFSKVAAG--D.EFVA.LSYSE-------------------------
Q7QI84_ANOGA/148-248VCAILDAARLF.ALDGLTAVC------HSFMDRNAADILQH--E.SFRH.LSLDS-------------------------
KBTB8_HUMAN/152-254SIGVFIFADHY.GHQELGDRS------KEYIRKKFLCVTKE--Q.EFLQ.LTKDQ-------------------------
KLH12_XENLA/131-233CLGIRDFAETH.NCLELMQAA------EVYSQKHFPEVVQH--E.EFML.LHQEE-------------------------
Q7Q1T2_ANOGA/174-276CLGIRSFADAH.SCKELHSRS------HRYALQNFQQVVGT--E.EFLL.LGFNE-------------------------
KLH21_HUMAN/138-239CLDMQDFAEAF.SCSGLASAA------QRFILRHVGELG.A--E.QLER.LPLAR-------------------------
ENC1_HUMAN/149-251CLGMLLLSDAH.QCTKLYELS------WRMCLSNFQTIRKN--E.DFLQ.LPQDM-------------------------
O16313_CAEEL/170-270LCSIFNAAYFF.QFTDLIDYC------MQYSDKHADQLLED--P.SFNR.LSGDS-------------------------
O18147_CAEEL/153-255ALSIREFCKMMCVEEKITEMT------DDYIQKHFMAVSKD--E.DFKR.LSLED-------------------------
KBTBA_HUMAN/135-237CLAILRLGLLL.DCPRLAISA------REFVSDRFVQICKE--E.DFMQ.LSPQE-------------------------
KBTB1_CWPXG/123-222CIDFYIYADKY.NNKKIESAS------FNTILRNILRLIND--E.NFKY.LTEES-------------------------
O72746_COWPX/102-200CLEIYRITNIN.ALSYIYNDV------RNFILDNILLIYKD--P.DFIY.LPKYI-------------------------
KLHL2_HUMAN/158-260CLGIRAFADMH.ACTDLLNKA------NTYAEQHFADVVLS--E.EFLN.LGIEQ-------------------------
IPP_MOUSE/139-241CIGLFQFSEQI.ACHDLLEFT------ENYIHSIFLEVHTG--E.EFLG.LTKDQ-------------------------
KEAP1_RAT/184-286AIGIANFAEQI.GCTELHQRA------REYIYMHFGEVAKQ--E.EFFN.LSHCQ-------------------------
P87597_COWPX/101-204CLDIITYAAFY.NLEDLKIAA------INTTATNFTHVVKD--D.TFLS.LPFDI-------------------------
Q6DE07_XENLA/176-277CVEVGRIANTY.NLTEVDKYV------NNFILKNFPALLTT--G.EFVK.LPFDR-------------------------
KLH20_XENLA/165-267CLGIRAFADTH.SCRELLRIA------DKFTQHNFQEVMES--E.EFML.LPANQ-------------------------
ENC2_XENLA/149-251CLGMMILSDAH.QCQRLYELS------LRMCLSNFATLHNT--E.DFSS.LSKDM-------------------------
Q6DJ21_XENTR/98-200CLGISVLAECL.DCPELKATA------DDFIHQHFTEVYKT--D.EFLQ.LDVKR-------------------------
Q6GKZ1_DROME/195-298CVSIMGFARFR.FLEDLHLKA------RNYTLRYFTEVAYR--NIDILD.MSAED-------------------------
Q6GML3_DANRE/142-241VCLVFDVASLY.CLNGLAEAC------MAYMDRNAVEVLKS--D.GFLT.LSKSA-------------------------
Q6GNW3_XENLA/149-250CLNMMLISDAH.CCERLLELS------WRMCLSNFVELSNT--E.DFFR.LPKLK-------------------------
Q6GNZ5_XENLA/139-241CIGFFQFAEHL.ACHPLLEFT------ESYIHTHFTEVQTG--D.EFPT.LTKDQ-------------------------
KLH23_MOUSE/139-240CIGMHSFAEFH.VCSELEKES------RRILCSRFKEVWQQ--E.EFLE.ISLEK-------------------------
KLH30_XENLA/135-237CLGIWEFGETH.GCPEVAAKA------LSFLQENFEAVSQE--E.EFLL.LSPER-------------------------
Q6IQ87_DANRE/140-242CLGVRQFAETM.MCTTLYDAA------NSFVHQHFVEVSVS--E.EFLA.LRPEE-------------------------
Q6IR89_XENLA/133-234CVRLLSFADLF.SCEELKQSA------KRMVEHKFTTVYHQ--E.AFMQ.LSSEL-------------------------
Q6NRT8_XENLA/167-269CLGIQHFADTH.SLKTLFTKC------KSFAQQAFEDVVQH--E.EFLE.LGKAE-------------------------
KLH21_DANRE/140-242CLEIQDFAEAY.ACRELAASA------RRFVLKNIVELAKS--M.DFER.LSWKR-------------------------
Q6P4N4_XENTR/135-237CLAIFRLGLLL.DCPRLAVTA------RDYVCDRFMQICNE--E.DFLQ.LAPHE-------------------------
Q6PFE1_MOUSE/275-376CLGIRSFADAQ.GCTDLHKVA------HNYTMEHFMEVIRN--Q.EFVL.LPANE-------------------------
Q6PGA3_MOUSE/223-324CLGIRSFGDAQ.GCMELQNVA------HKYAMEHFIDVIKN--Q.EFLL.LPANE-------------------------
KLH31_DANRE/173-274CMYVVNIADTY.NLKETKEAA------QKFMRENFIEFSEM--E.QFLK.LTYEQ-------------------------
KLH17_MOUSE/192-294CLGIRGFADTH.SCSDLLKAA------HRYVLQHFVDVAKT--E.EFML.LPLKQ-------------------------
Q6TEQ2_DANRE/149-251CLGMMLLSDAH.QCQRLYELS------WRMCLANFANLYHT--E.DFLS.LPKDK-------------------------
Q7KSF5_DROME/192-294AIGIAHFAEQH.GCVELQKKA------NVFIERNFTQVCQE--E.EFLQ.LSAYQ-------------------------
Q7SYC4_DANRE/168-270CLGIQRFADAH.SLKQLASRC------RSYALQSFADVAQH--E.EFLD.LRKEE-------------------------
Q7SYD2_DANRE/136-238CLAVFRLGLVL.SVPRLAIAA------RDFIADRFETVSSE--E.EFLQ.LAPHE-------------------------
Q7ZVF7_DANRE/174-276CVAIHSLAHMY.TLDQLALRA------VDMIRRNFHKVIQD--E.EFYT.LPFRL-------------------------
KLH29_MOUSE/216-318CLGVLAMAEAM.QCSELYHMA------KAFALQIFPEVAAQ--E.EILS.ISKDD-------------------------
Q86BQ6_DROME/179-281CLGFAFFAEQQ.SCTTLLRLA------QAYTCQYFMQVCQN--Q.EFFQ.LNADQ-------------------------
Q8AW66_DANRE/167-269CVGILHLADVH.SLESLKTQV------HSYIVQNFSQVVDH--E.EILE.LPADV-------------------------
KLH26_MOUSE/156-257CLHIGQMATTF.SLTSLRESV------DAFTFRHFLQIAAE--E.DFLR.LPLER-------------------------
KLH38_MOUSE/136-237CLGLVRLAEIL.SCDSLKKKA------KEVALTYFPEVAAS--A.DLKE.LCAME-------------------------
KLH31_MOUSE/172-273CMYVVNIAETY.SLKNAKATA------QKFIRDNFIEFAES--E.QFMK.LTFEQ-------------------------
Q8C2V5_MOUSE/142-240VCMTFDVASLY.SLPKLTCMC------CMFMDRNAQEVLAS--D.GFLS.LSKTA-------------------------
Q8CCY1_MOUSE/317-418CLGIRAFADAQ.GCIELMKVA------HSYTMENIMEVIRN--Q.EFLL.LPAEE-------------------------
Q8IH95_DROME/224-325AAMLYFEAKIL.KLEVIHLQY------LERVSKFFLTLVAS--K.EFLR.LPLKS-------------------------
Q8IQ29_DROME/76-176CLAIAGMADIY.GIMDLSERA------YRYMCAHFEEFATT--S.DFKE.MKVDQ-------------------------
Q8JTM8_LSDV/120-221CIEIYKFSQYY.GYKKLSSYT------YDYIRCYIESIYNQ--N.EFTT.LTIND-------------------------
Q8JTN6_LSDV/122-221CLDACIFSEFY.NLKKLNKFT------YKFIRKNIRKIYLK--K.DFIY.LSFNV-------------------------
Q8JU17_LSDV/121-220CVDIFRRSYMY.GCYDVYDVA------DKYIKKRFMYIS..--N.DLTK.LRVNE-------------------------
Q8N4I8_HUMAN/152-254CLGIRAFADVH.TCTDLLQQA------NAYAEQHFPEVMLG--E.EFLS.LSLDQ-------------------------
KLH36_HUMAN/148-250YLYLQELASIY.SLKRLDAFI------DGFILNHFGTLSFT--P.DFLQNVSMQK-------------------------
ENC2_MOUSE/149-251CLGMMVLSDAH.QCRRLYEFS------CRMSLVHFETVRQS--E.DFNS.LSRDT-------------------------
Q8V3G0_SWPV1/125-224CLQVYMFSKVH.NLFRLMDVA------LSTIIMNITTIYKH--D.NFGL.LDEKD-------------------------
KLH28_MOUSE/137-239CIGISRFAETY.GCHDLYLAA------TKFICQNFESVCQT--E.EFFE.LTHAD-------------------------
BTBDH_MOUSE/169-269AVGWYHYAVST.GDEALRESC------LQFLAWNLSAVAGS--A.EWGA.VSPEL-------------------------
Q9DHH3_YLDV/126-228CLRMYYYAKKF.CRKELENVA------MEMIIKNILKIVSR--P.EFNS.ICISD-------------------------
Q9Q8G2_MYXVL/125-224CLHYYEFSKRY.NRRHIFNVV------ITTIIHNIVSVLRQ--P.NFKT.IELCD-------------------------
Q9VGE5_DROME/143-245VLGIRTFADSM.ICRQLIDAA------DKYIDQNFAKVSQS--E.EFLA.LDCEQ-------------------------
Q9VK21_DROME/187-289ALGILRFAEAH.NCESLAKSA------LNFVHANFPAVTLE--D.EFLE.TPQTL-------------------------
Q9W2S3_DROME/150-248VCMILDAARLY.NLEELTEVC------LMFMDRNAGDLLLH--N.SFNT.LSKES-------------------------
Q9W4L5_DROME/162-265AFQVYLRALKYPQLEELRKLM------LQRIGAAFLAVLGG--D.DFQR.MPLED-------------------------
Q9W4S3_DROME/306-407AFQAYIMAKDY.RCPEIMIVM------QSRLRKCFLPIVAS--W.EFLE.FDVNE-------------------------
Q9W6R2_TAKRU/75-177CIGIWQFSDIC.YCSQLQEKA------FEFILCNFDQVISS--K.EFHQ.LSVEE-------------------------
Q9W6R3_TAKRU/76-178CIDIYQLTKYN.FCTQLEQKA------YKFILNNFDLIESG--E.EFFQ.LDMEH-------------------------

PF00651

BACH2_MOUSE/27-133---------------------------------------TKDDLVV........SLP.EEVTAR..GFGPLLQFA..YT-
BAT47_CAEEL/8-109---------------------------------------...SNYQ........EHIISDVEPQ..DFQKFLEVV..HG-
ZBT17_MOUSE/14-114---------------------------------------.....KD........VVHLDISNAA..GLGQVLEFM..YT-
Y2060_ARATH/201-303---------------------------------------...............VIQLRGVSYP..ILHALLQYI..YT-
Y2060_ARATH/341-455---------------------------------------MSESHSS........TIYLTDVSPE..AFKAMMNFM..YS-
O61795_CAEEL/46-153---------------------------------------MAECYMR........EINMEEIEPP..TLEALIEFC..YT-
O76610_CAEEL/10-114---------------------------------------IDEKP..........VHLLKGVNPA..DFQKFLEVL..HG-
KELC_DROME/147-253---------------------------------------.EESRQA........RITLQSVDAR..ALELLIDYV..YT-
KLH21_HUMAN/25-133---------------------------------------LRESRAE........RVRLHGVPPD..MLQLLLDFS..YT-
O45927_CAEEL/141-251---------------------------------------FDERS...........LELCNISAP..DFRRILNII..YP-
BTBD2_HUMAN/112-217---------------------------------------ATTST..........EIELPDVEPA..AFLALLKFL..YS-
O44818_CAEEL/140-244---------------------------------------FAEADKS........EVKLQDINST..DFQNLMEVR..YG-
P91543_CAEEL/104-200---------------------------------------...............EITIEDLSYE..DFGLLMSNI..YP-
Q18030_CAEEL/118-226---------------------------------------SSDLTKP.........IELKGISSC..SFRNLLNCIYGYP-
LZTR1_HUMAN/655-764---------------------------------------MPEDGQV........NISIGEMVPSRQAFESMLRYI..YY-
BAB1_DROME/117-222---------------------------------------.CQHP..........IVIMRDVNWS..DLKAIVEFM..YR-
O17112_CAEEL/140-243---------------------------------------EDKQD..........EIELKDVVYE..DFGLLMSTI..YP-
BACH1_MOUSE/24-130---------------------------------------DAELTVT.........LP.EEVTVK..GFEPLIQFA..YT-
BCL6_HUMAN/22-129---------------------------------------KCNLSVI........NLD.PEINPE..GFCILLDFM..YT-
BRC1_DROME/22-127---------------------------------------.CKHPVI........LL..QDVNFM..DLHALVEFI..YH-
CALI_BOVIN/18-128---------------------------------------TTDELFI........TIDPNYLSPT..TVDQLLDYF..YS-
ENC1_HUMAN/36-144---------------------------------------SQDSEVN.........FD.NSIHPE..VLELLLDYA..YS-
GAGA_DROME/24-129---------------------------------------.CKHPVV........ML..AGVNAN..DLEALLEFV..YR-
GCL_DROME/56-166---------------------------------------EAQQNFIQ......ITILDDRITVA..SLDAVFGSM..YS-
ZBT48_HUMAN/16-119---------------------------------------.SGGS...........VVLPAGFAE..IFGLLLDFF..YT-
KBTBA_HUMAN/23-130---------------------------------------AKKKE...........VVLDNVDPA..ILDLIIKYL..YS-
LOLA2_DROME/22-127---------------------------------------.DKHPIF........IL..KDVKYQ..ELRAMMDYM..YR-
KAISO_HUMAN/22-125---------------------------------------..............QVVELSFIRAE..IFAEILNYI..YS-
ZF161_HUMAN/26-132---------------------------------------.EVDSSS........VIEIDFLRSD..IFEEVLNYM..YT-
ABTB2_RAT/832-945---------------------------------------EQDGDNS.......KTIEISDIKYH..IFQMLMQYL..YY-
ZBTB5_HUMAN/14-123---------------------------------------DQTMNMI........QLDSEVVTAE..AFAALIDMM..YT-
ZBT7B_HUMAN/24-145---------------------------------------GAGAGVC........EL..DFVGPE..ALGALLEFA..YT-
ZBT22_HUMAN/47-151---------------------------------------..GMTSI........SLP.SVMDPG..AFETVLASA..YT-
O16313_CAEEL/54-165---------------------------------------FQESHQQ........LVTLQETNSV..AFRAVLRYM..YT-
O16566_CAEEL/67-171---------------------------------------EADKS..........EVTLQDIDPT..DFQCLMEVI..HG-
O16736_CAEEL/144-248---------------------------------------EGKSS..........EVTLTSIDPN..DFQFFLEVL..YG-
O16740_CAEEL/129-232---------------------------------------ESEIP..........EIPIRDVSAE..DMGLLLSTI..YP-
O16741_CAEEL/157-256---------------------------------------EE..............IRLEDVSYE..DFGLLMSII..HP-
O16744_CAEEL/132-231---------------------------------------TG..............ILIEGVTYD..EFGLLMSTI..YP-
O17197_CAEEL/70-174---------------------------------------DGELD..........EIPLKDVTIE..EFGLVLSTI..HP-
O17253_CAEEL/135-236---------------------------------------EKN............GIPIENVTYE..NFGLLMSII..YP-
O17297_CAEEL/141-242---------------------------------------.PEMS..........EVTIQDTSSV..DFQNLLEVL..YG-
O18147_CAEEL/41-148---------------------------------------LMEANMK........EINIEDMNYE..TVDALLSFA..YT-
BPM3_ARATH/184-303---------------------------------------IGNNNVD........RIVIDDIEPS..IFKAMLSFI..YT-
Y2045_ARATH/15-132---------------------------------------EFKASSKQ.....METVTLSEMKHE..ELEAFVEFI..YR-
NACC1_RAT/20-124---------------------------------------..RSAVV........ELP.AAVQPQ..SFQQILTFC..YT-
ZBT43_HUMAN/23-126---------------------------------------..NSRRI........VLP.DVMNPR..VFENILLSS..YT-
O44815_CAEEL/142-246---------------------------------------EAEIS..........EVALKDIDST..DFQNLLEVL..YG-
O44817_CAEEL/137-241---------------------------------------EAERQ..........EVKLQDIDST..DFQNLMEVL..YG-
O44905_CAEEL/112-216---------------------------------------EAQLT..........EIPIRDVSYE..DFCLLLSTI..YP-
O45594_CAEEL/135-238---------------------------------------EGQMS..........EIPIKDVTYK..DFALMLSTI..YP-
O61932_CAEEL/71-176---------------------------------------.NK.CF.........VLEMQPLDKT..SVKRVLDYI..YF-
O72730_COWPX/30-136---------------------------------------.PDQK...........IFNIDYSGS..VLEMAIDFI..YT-
KBTB2_CWPXG/16-123---------------------------------------MIARDLV.......TRVNLQMFDKD..AVKNIVQYL..YN-
B2RG49_HUMAN/24-131---------------------------------------ASQPYVY........EI..DFVQPE..ALAAILEFA..YT-
BTB1_SCHPO/608-735---------------------------------------IEEITQSH......STIRVEDIPPL..AVAILLHYL..YT-
O76568_CAEEL/144-248---------------------------------------ESDQK..........EVTLQDIDPT..DFQNLLEVL..YG-
O77168_APIME/26-132---------------------------------------.CKHPTI........IMP.QDVCFN..DLKFIIEFV..YR-
KEN_DROME/23-131---------------------------------------LSDCSTT.........VYFPDVNAT..YFKFLLDFL..YS-
Y4409_ARATH/15-129---------------------------------------KYKASSKL......ETITLSEMKHE..VLEAFVDFT..Y.-
BCL6B_MOUSE/28-135---------------------------------------GLGVDVL........SLP.GGPEAR..GFAPLLDFM..YT-
O89076_MOUSE/10-122---------------------------------------LREQGME........VVSIEGIHPK..VMERLIEFA..YS-
ZBT7A_CHICK/24-131---------------------------------------VDQQNVY........EI..DFVSAD..ALSALLEFA..YT-
P90538_DICDI/34-143---------------------------------------FKESSQS.......VIELKQPDPFN..VFPMVLEFM..YD-
ZN238_HUMAN/14-121---------------------------------------.DKRDIV........HLNSDIVTAP..AFALLLEFM..YE-
ZBTB6_HUMAN/23-127---------------------------------------.QSKHVR.........IT.ILQSAE..VGRKLLLSC..YT-
Q17523_CAEEL/126-230---------------------------------------.KLA...........EIIMPFESFV..SMKKLMNFL..HP-
Q17782_CAEEL/193-300---------------------------------------EAQNS..........RAILRDIDYE..VVQAILYYI..YT-
Q19838_CAEEL/23-130---------------------------------------.RAPYQP.........FNMTDFDPD..SVRRVFDWM..YS-
Q20183_CAEEL/184-293---------------------------------------KNTEEAL........EIELPDVEPS..AFLALLKFL..YS-
BAT38_CAEEL/220-325---------------------------------------FQEREKT........QVELEDVVLE..EFRELLHVI..YP-
Q21899_CAEEL/143-245---------------------------------------.EDKE...........IYEMKEKFR..EIITFLRCI..YP-
MMD4_DROME/22-128---------------------------------------.NTHAIV........FL..NNVSHS..ALKDLIQFM..YC-
ABRU_DROME/93-198---------------------------------------.CEHPIV........IL..RDVRCD..DVENLLSFM..YN-
Q24455_DROME/25-131---------------------------------------.CKHPTI........ILP.ADIIFT..DLKTIIDFV..YR-
CP190_DROME/20-127---------------------------------------.EIVDDA........LIMPNEFQAD..VVVPIVNFM..YT-
HIC1_CHICK/53-160---------------------------------------....NLL........NLDHEMVSPG..IFRLILDFI..YT-
MEL26_CAEEL/191-300---------------------------------------DTDEAKS.......SMMYINDMDYD..VIYEMVYYI..YC-
SPOP_HUMAN/190-297---------------------------------------MEESKKN........RVEINDVEPE..VFKEMMCFI..YT-
TTKB_DROME/23-127---------------------------------------.EKHPIV........IL..KDVPYS..DMKSLLDFM..YR-
KBTB1_VACCW/11-118---------------------------------------NFIDSNE.......YEVNLSHLDYQ..SVNDLIDYI..YG-
VC04_SWPVK/8-116---------------------------------------IDKNN..........DEIYICADYD..ILYIILEFM..YT-
VC13_SWPVK/16-119---------------------------------------.NEIT..............VSFQYE..SFLDIIKYI..ET-
VF03_VACCC/18-120---------------------------------------NKDPV..........TRVCLDLDIH..SLTSIVIYS..YT-
VMT8_MYXVL/6-112---------------------------------------FLEKNVD.........VIDLEADYK..TVFDVIYYM..YT-
ZBT39_HUMAN/20-126---------------------------------------.LDAAR.........TYVVDFITPA..NFEKVLSFV..YT-
ZBT24_HUMAN/27-133---------------------------------------.GEIGQS........IYMLEGMVAD..TFGILLEFI..YT-
BTB3_SCHPO/157-262---------------------------------------..PSE..........HEIEVKHFAK..EFESILRYL..YL-
BTB3_SCHPO/296-405---------------------------------------.SNQELP.........VLSLPFSSS..VVEIVLKFL..YT-
YIA1_YEAST/264-390---------------------------------------IKAKHVTGKYNSIIPQLTLPNCEFE..VAEIILRYL..YA-
BAT15_CAEEL/139-243---------------------------------------EADQS..........EVTLQNIDPT..DFQSLLEVL..YG-
BAT42_CAEEL/208-319---------------------------------------IEAQKGE.........IHIEDAKYD..SVRAMVEFM..YT-
BAT43_CAEEL/255-368---------------------------------------MQESDTN........MTTVDDIEPE..VMRELLVYM..YT-
YR47_CAEEL/45-146---------------------------------------DSNST..........THRIRLISAS..DLHFLLT....IP-
ZBT16_HUMAN/24-126---------------------------------------...............HYTLDFLSPK..TFQQILEYA..YT-
ZBT25_HUMAN/14-119---------------------------------------SECIK...........IQPTDIQPD..IFSYLLHIM..YT-

PF11822

Q29D48_DROPS/298-606.......................................AGQRLEE..........MDISVHCDILIFDWLMKWI--KHS
Q4Q8A2_LEIMA/20-417.....................................INEAKVSPPPESSSSLAVAFTLRARCEHATFQWLINWI--SG.
Q0IFU1_AEDAE/236-536.......................................AGQRLED..........MDISVHCDLQIFEWLMKWV--KKD
Q383Z9_TRYB2/26-376.................GARSVKNSKTKAHEATKPLKRKGKEEKPP..........IPLHVNCDMSTFSWLMAYV--EG.
A4HGL7_LEIBR/10-407.....................................MSETTVWPPSASPSSSAVALTLRARCDHVTFQWLVNWM--SG.
Q4RN30_TETNG/1-302.......................................DTQRWEE..........VDISVHCDVQIFDWLMNYV--RRN
A7S8V2_NEMVE/1-302.......................................EAQRWEE..........VDISVHCDVQIFDWLMKYV--KKG
Q4DXB1_TRYCC/30-401ASAATNLETSIGVTDGSADRKAIIGTRGQGDVGPSSRISGNTPLPP..........IPIRVNCDLSIFSWLMAYI--QG.
K1841_XENLA/146-448.......................................DAQRCEE..........VDISVHCDVHIFDWLMRYV--KRS

PF03931

SKP1_HUMAN/2-67---------------------------------------GMDDEGD-----.DDPVPLPNVNAA--ILKKVIQWC-----
O77430_DROME/2-66---------------------------------------GMEDD.E-----NA.IVPLPNVNST--ILRKVLTWA-----
ASK16_ARATH/4-64---------------------------------------CADKA..-----....IPLENVTGN--ILALVIEYC-----
SKP1_EMENI/4-65---------------------------------------GDP...T-----EP..IPIPNVSEN--VLSKVLEWC-----
O75863_HUMAN/17-82---------------------------------------GQSAENE-----.TDQVNFREIPPR--CYPKHAKAC-----
SKP1A_ARATH/4-63---------------------------------------CVDNG..-----....VPLPNVTSK--ILAKVIEYC-----
ELOC_HUMAN/17-79---------------------------------------GQFAENE-----.TNEVNFREIPSH--VL...SKVC-----
O82463_NICCL/2-61---------------------------------------CADTS..-----....IPLPNVTSK--ILAKVIEYC-----
Q21367_CAEEL/8-70---------------------------------------NNLVQP.-----...HPLKTSICSF--VLVKIIEWC-----
Q23153_CAEEL/69-131---------------------------------------TVDLAAA-----.NNTVYFSDFQSH--ILQK...VC-----
ELOC_YEAST/4-66---------------------------------------FRESKG.-----...RIELKQFDSH--ILEKAVEYL-----
ASK19_ARATH/4-64---------------------------------------CATNK..-----....IPIPNVTGE--ILAKVIEYC-----
ASK12_ARATH/4-64---------------------------------------CVADG..-----....IPLANVESK--ILVKVIEYC-----
ASK14_ARATH/4-64---------------------------------------CVVTE..-----....VPLQNVTGK--ILSIVVEYC-----
SKP1B_ARATH/5-64---------------------------------------CTDNG..-----....IPLPNVTSK--ILSKVIEYC-----
Q89374_PBCV1/1-61---------------------------------------GDDEP..-----....IPLPTITAK--VLTKILEYC-----
SKP1A_DICDI/2-63---------------------------------------GESDS..-----...PIPLPNVTST--ILEKVLDYC-----

PF02214

KCNA5_MOUSE/113-204--------------------................R.LRYFDPLR--------NEYFFDRNRP--SFDGILYYY--QSG
KCNAL_DROME/43-132--------------------...................FFYDEDC--------KEYFFDRDPD--IFRHILNYY--RT.
KCNS1_MOUSE/21-120--------------------SEE..........QARRLCDDYDAAA--------HEFYFDRHPG--FFLGLLHFY--RT.
KCNS3_HUMAN/17-116--------------------SEE..........AILELCDDYSVAD--------KEYYFDRNPS--LFRYVLNFY--YT.
Q18986_CAEEL/7-97--------------------..................VPVTKNEE--------GSVFIDRDSK--HFRLILNFL--RDG
KCNA7_MOUSE/47-138--------------------................R.SRFYDGAR--------REYFFDRHRP--SFDAVLYYY--QSG
O76266_HIRME/83-174--------------------................R.SKFYDKRK--------KEYFFDRHRP--TFEIVFAYF--QYG
P91557_CAEEL/6-93--------------------..................GKIWQTT.--------..LFIDRSPT--HFEIILNFM--RDG
O17001_CAEEL/21-113--------------------..................MNSVKDPS--------GAIFIDRDPD--LFRVILNYL--RTK
O16612_CAEEL/6-96--------------------..................VPAEKDDS--------NCFFIDRSPK--HFETVLNYM--RSG
O16709_CAEEL/9-96--------------------..................GSSLVDP.--------..IFVDRSPT--YFDIVLNFM--RKG
Q26094_POLPE/45-136--------------------................R.NQFYNPNT--------GELFFDRHRP--TFESILYYY--QSG
O16706_CAEEL/5-95--------------------..................IGLKIDES--------GSIFIDRSPK--HFDLILNFM--RDG
KCNA2_CANFA/35-126--------------------................R.MRFFDPLR--------NEIFFVRNRP--SFDAILYYY--QSG
KCNB1_HUMAN/33-132--------------------THD..........SLLEVCDDYSLDD--------NEYFFDRHPG--AFTSILNFY--RT.
KCNC1_HUMAN/10-104--------------------P.............DAHSHFDYDPRA--------DEFFFDRHPG--VFAHILNYY--RT.
P91564_CAEEL/5-95--------------------..................TGPKIEKT--------GCIFIDRSPK--HFELILNLM--RDG
Q25376_LOLOP/42-133--------------------................R.NRYYDPYR--------NEYFFDGNRP--SFDAILYFY--HSG
KCNAW_DROME/12-102--------------------...............A..LANYDPIL--------NEYFFDRHPG--VFAQVLNYY--RT.
KCNS2_MOUSE/19-118--------------------SRE..........AILELCDDYDDVQ--------REFYFDRNPE--LFPYVLHFY--HT.
O16613_CAEEL/8-96--------------------..................MPAEDGDS--------..FFIDRSPK--HFETVLNYI--RSG
O97045_HALRO/72-171--------------------SVS..........TLMEFIDDFDEEK--------EEMFFDRHPG--AFTPVLNFY--RT.
Q26095_POLPE/56-146--------------------................R.NLFLNKQT--------GEYFFDRHRK--AFNGILYYY--QSN
Q09658_CAEEL/92-183--------------------................R.QHFFVSDT--------NEFFFDRHRT--TFESILYIY--QSG
KCA10_HUMAN/88-179--------------------................R.MQFFDSMR--------NEYFFDRNRP--SFDGILYYY--QSG
O76889_DROME/24-115--------------------................CDLISDRDET--------GAYLIDRDPK--YFAPVLNYL--RHG
KCND1_HUMAN/42-131--------------------...............E...FFYDADS--------GEYFFDRDPD--MFRHVLNFY--RT.
KCNAS_DROME/99-190--------------------................R.LRYFDPLR--------NEYFFDRSRP--SFDAILYYY--QSG
KCND3_RAT/42-131--------------------...............E...FFFNEDT--------KEYFFDRDPE--VFRCVLNFY--RT.
Q20381_CAEEL/28-127--------------------HV...........ERLTDCDAFFEST--------SEYYFERSPI--IFEYVIDFY--VT.
KCNG1_HUMAN/65-164--------------------NFD..........DILNVCDDYDVTC--------NEFFFDRNPG--AFGTILTFL--RA.
Q26597_SCHMA/53-144--------------------................R.NHYYDPLR--------NEYFFDRNRS--SFDGILYFY--QSG
Q16976_APLCA/66-156--------------------...............H...LENGGGR--------QEYFFDRHPS--VFNSIIDFY--RT.
P91784_POLPE/46-135--------------------...............D...YFYDESL--------EEYYFDRDPD--LFRHILNYY--RT.
P91783_POLPE/39-128--------------------...............D...FFYDEKL--------GEYFFDRDPH--IFRLILKFY--KT.
O16711_CAEEL/8-100--------------------..................IPIQKDDS--------NCIFIDRSPR--HFEKILNYL--RDG
KCNV1_RAT/44-153--------------------ASYRRLGALAAAPSPLELCDDANPVD--------NEYFFDRSSQ--AFRYVLHYY--RT.
Q26344_APLSP/158-258--------------------CHE..........ALMELCDDYNLGE--------NEFFFDRHPR--SFSSILNFY--RT.
Q18776_CAEEL/84-176--------------------................MGLPTDRDET--------GAYLIDRDPD--FFSPILNYL--RHG
KCNAB_DROME/279-378--------------------THE..........AIVELCDDYSLAD--------NEYFFDRHPK--SFSSILNFY--RT.
P91556_CAEEL/2-87--------------------..................QVNPTSP.--------..IFVDRSPK--HFETILNFM--RDG
O16630_CAEEL/2-90--------------------..................DESSTTTR--------..IVIDRSPK--HFETVLNFM--RDG
P91256_CAEEL/38-137--------------------HT...........ARLKVADAYISAD--------DAYYFQRSPT--SFEAVFQYY--AT.
BACD2_MOUSE/30-120--------------------..................MEVLTDKE--------GWILIDRCGK--HFGTILNYL--RDD
O16708_CAEEL/99-187--------------------..................IQGESLPT--------ARIFIDRPYK--HFETILNFL--RDG
KCNG2_CHICK/59-158--------------------NYD..........EIMNICDDYDVSC--------NEFFFDRNPS--AFRTIMTFL--TA.

PF07707

KBTBC_MOUSE/131-233---------------------------------------LLALIKS--------DDLNISREES--ILDLVLRWV--NH-
Q7PXP7_ANOGA/170-272---------------------------------------LANLLRS--------DDLNVPNEQE--VFHALMAWI--QY-
KLHL8_MOUSE/178-280---------------------------------------LHKLLSS--------SDLNIDSEKQ--VYSAAIKWL--LA-
O61795_CAEEL/158-260---------------------------------------LTTIIKS--------DKLNAASEEL--VFSAVIQWV--RH-
KLHL6_MOUSE/172-274---------------------------------------LYHILRS--------DDLCVTEEAQ--VFETVMSWV--RH-
KLH18_HUMAN/140-242---------------------------------------VLELVSR--------DELNVKSEEQ--VFEAALAWV--RY-
KELC_DROME/258-360---------------------------------------VISLIGN--------DRISVPNEER--VYECVIAWL--RY-
BTBDH_XENLA/161-261---------------------------------------MVSLLQR--------SDLVLQSELE--LFNAVEEWV--SK-
KBTB3_HUMAN/150-252---------------------------------------LQKCLES--------DELNVPEEEM--VLKVVLSWT--KH-
KELC_ANOST/201-303---------------------------------------VAHLIKS--------DRLSVPTEEK--VYECVITWI--QY-
GAN_MOUSE/134-236---------------------------------------LKEVISL--------EKLNVGNERY--VFEAVIRWI--AH-
Q8JIM0_DANRE/160-262---------------------------------------LLELISQ--------DSLKVLCESE--VYKACIDWV--RW-
Q7PMB5_ANOGA/179-281---------------------------------------LVKVIAS--------EALRVDSEYQ--VFNAALRWI--RH-
Q7QHD7_ANOGA/175-277---------------------------------------LIDVIGR--------DELNVKSEEC--IFEACMRWV--KH-
Q7QI84_ANOGA/148-248---------------------------------------LCSLLLR--------DSF.FAREVE--IFQAVFDWC--RC-
KBTB8_HUMAN/152-254---------------------------------------LISILDS--------DDLNVDREEH--VYESIIRWF--EH-
KLH12_XENLA/131-233---------------------------------------VEKLIHC--------DEIQINSEEP--VFEAVINWV--KH-
Q7Q1T2_ANOGA/174-276---------------------------------------VQDLISN--------SQLNICSEEK--VFMAVLNWV--KH-
KLH21_HUMAN/138-239---------------------------------------LLRYLRD--------DGLCVPKEEA--AYQLALRWV--RA-
ENC1_HUMAN/149-251---------------------------------------VVQLLSS--------EELETEDERL--VYESAINWI--SY-
O16313_CAEEL/170-270---------------------------------------LKELLAR--------DSF.FALELK--IFNAVRSWH--QN-
O18147_CAEEL/153-255---------------------------------------AIELLRN--------DHLYVDSEEQ--VYVAAMEWL--NC-
KBTBA_HUMAN/135-237---------------------------------------LISVISN--------DSLNVEKEEA--VFEAVMKWV--RT-
KBTB1_CWPXG/123-222---------------------------------------MIKILSD--------DMLNIKNEDF--APLILIKWL--ES-
O72746_COWPX/102-200---------------------------------------IIDLLSD--------DHLNVFNEDN--VIKIIYTYI--SS-
KLHL2_HUMAN/158-260---------------------------------------VCSLISS--------DKLTISSEEK--VFEAVIAWV--NH-
IPP_MOUSE/139-241---------------------------------------LIKILRS--------EELSIEDEYQ--VFLAAMQWI--LK-
KEAP1_RAT/184-286---------------------------------------LATLISR--------DDLNVRCESE--VFHACIDWV--KY-
P87597_COWPX/101-204---------------------------------------ISSIFEN--------DDLNTKSEDE--AMDALCIWM--KD-
Q6DE07_XENLA/176-277---------------------------------------LAFVLSS--------NSLKQCTELE--LFKAACRWL--RY-
KLH20_XENLA/165-267---------------------------------------LIDIISS--------DELNVRSEEQ--VFNAVMAWV--KY-
ENC2_XENLA/149-251---------------------------------------LLDLISS--------DELEIEDEQV--VFNAVLHWV--KE-
Q6DJ21_XENTR/98-200---------------------------------------VTHLLNQ--------DTLTVRAEDQ--VYDAAVRWL--KY-
Q6GKZ1_DROME/195-298---------------------------------------FYSIISD--------DELNTREEDH--VWKLCVKWI--DR-
Q6GML3_DANRE/142-241---------------------------------------LLTVVRR--------DSF.ASSERE--IFQALCHWC--HH-
Q6GNW3_XENLA/149-250---------------------------------------LMELVLS--------EELEVEDESL--VYEAVMGWI--KF-
Q6GNZ5_XENLA/139-241---------------------------------------LVQILQN--------EELCIEDEYQ--VFSAAMTWI--QK-
KLH23_MOUSE/139-240---------------------------------------FLFILSR--------KNLSVWKEEA--ILEPVIKWT--AH-
KLH30_XENLA/135-237---------------------------------------MLCYLGD--------PLLQVRDEQS--RAKAALHWV--KQ-
Q6IQ87_DANRE/140-242---------------------------------------VLELVGC--------DELNVQAEEQ--VFEAVLAWV--RH-
Q6IR89_XENLA/133-234---------------------------------------LIELVSS--------DNLNVEKEET--VREAAMSWL--DY-
Q6NRT8_XENLA/167-269---------------------------------------LIDYICT--------DELVVSKEEM--VFEAVMRWV--YH-
KLH21_DANRE/140-242---------------------------------------LLEFVSD--------DGLCVDKEET--AYQIAVRWV--KA-
Q6P4N4_XENTR/135-237---------------------------------------LIAVISS--------DGLNVEKEEL--VFEAVMKWV--QT-
Q6PFE1_MOUSE/275-376---------------------------------------IAKLLAS--------DDMNIPNEET--ILNALLTWV--RH-
Q6PGA3_MOUSE/223-324---------------------------------------ISKLLCS--------DDINVPDEET--IFHALMQWV--GH-
KLH31_DANRE/173-274---------------------------------------INEFLTD--------DSLQLPSELT--AFQIAVKWL--DF-
KLH17_MOUSE/192-294---------------------------------------VLELVSS--------DSLNVPSEED--VYRAVLSWV--KH-
Q6TEQ2_DANRE/149-251---------------------------------------VQELVFS--------EELEVEDESI--VYEAVIDWV--RA-
Q7KSF5_DROME/192-294---------------------------------------LIALIRR--------DELNVQEERE--VYNAVLKWV--KY-
Q7SYC4_DANRE/168-270---------------------------------------LEEYIAS--------DEMVIGKEET--VFEAVMRWV--YY-
Q7SYD2_DANRE/136-238---------------------------------------LSALIGG--------DMLNVEKEEV--VFESVMKWV--RN-
Q7ZVF7_DANRE/174-276---------------------------------------VRDWLSD--------AEITVDSEEV--LFDAVVKWV--QK-
KLH29_MOUSE/216-318---------------------------------------FIAYVSN--------DSLNTKAEEL--VYETVIKWI--KK-
Q86BQ6_DROME/179-281---------------------------------------LGKLLSS--------DDLNVPSEQD--VFHSLMSWV--RH-
Q8AW66_DANRE/167-269---------------------------------------LVSLIQH--------DDLGVTEEEQ--VFDTVIRWV--KA-
KLH26_MOUSE/156-257---------------------------------------LVFFLQS--------NRLQSCAEID--LFRAAVRWL--QH-
KLH38_MOUSE/136-237---------------------------------------LRDYLGD--------DRL.CGEEEK--VFEALMAWV--KH-
KLH31_MOUSE/172-273---------------------------------------INELLVD--------DDLQLPSELV--AFQIAMKWL--EF-
Q8C2V5_MOUSE/142-240---------------------------------------LLNIVLR--------DSF.AAPEKD--IFLALLNWC--KH-
Q8CCY1_MOUSE/317-418---------------------------------------LHKLLAS--------DDVNVPDEET--IFHALMMWV--KY-
Q8IH95_DROME/224-325---------------------------------------MLLLIQS--------DLIGVNTELE--VFMAAARWL--SH-
Q8IQ29_DROME/76-176---------------------------------------LRFILSS--------NYPIDVAEQD--LVRLVCSFA--IE-
Q8JTM8_LSDV/120-221---------------------------------------IMKLLSD--------RKTIVASENS--VVEILVSWL--TS-
Q8JTN6_LSDV/122-221---------------------------------------IDLLLRD--------KKTVFYNEDD--VLCIILQWL--NN-
Q8JU17_LSDV/121-220---------------------------------------LRPILKS--------SDLVVDTEDF--VLNFIIKWG--TV-
Q8N4I8_HUMAN/152-254---------------------------------------VCSLISS--------DKLTVSSEEK--VFEAVISWI--NY-
KLH36_HUMAN/148-250---------------------------------------LCVYLSS--------SEVQRECEHD--LLQAALQWL--TQ-
ENC2_MOUSE/149-251---------------------------------------LLDLISR--------DELETEDERV--VFEAILQWV--KH-
Q8V3G0_SWPV1/125-224---------------------------------------IELILGS--------DYLNIIDEDI--SVVILFNWL--RY-
KLH28_MOUSE/137-239---------------------------------------LDEIVSN--------DCLNVATEET--VFYALESWI--KY-
BTBDH_MOUSE/169-269---------------------------------------LAQLLQR--------SDLVLQDELE--LFHALEAWL--GR-
Q9DHH3_YLDV/126-228---------------------------------------LKIILSN--------EKLNVIDEDL--AAYILSKWL--NK-
Q9Q8G2_MYXVL/125-224---------------------------------------LQNILSS--------DDLNVIDEDV--CAVVLVTWL--KQ-
Q9VGE5_DROME/143-245---------------------------------------LLELMRR--------DELNVRTEEV--IFEACMKWV--KY-
Q9VK21_DROME/187-289---------------------------------------LSQLLNS--------ELLRVDSESQ--VFQAALRWI--KH-
Q9W2S3_DROME/150-248---------------------------------------LEEVLRR--------DCF.FAPEVQ--IFLAVWKWS--RF-
Q9W4L5_DROME/162-265---------------------------------------VITMLQQ--------DSLGVNSEME--VLVAIIRWL--NC-
Q9W4S3_DROME/306-407---------------------------------------VTTLLEQ--------DMLCVNSEDE--IFFAVFHWL--NY-
Q9W6R2_TAKRU/75-177---------------------------------------LCDIFDH--------DELNVKNESI--VFEAICKWI--SH-
Q9W6R3_TAKRU/76-178---------------------------------------FCSIIAS--------DHLCVSSEAV--VFRAVVRWI--NH-

PF00651

BACH2_MOUSE/27-133----------------AKLLL............SRENIREVIRCA.-EFLRM-HNL---EDSCFSFLQTQL---------
BAT47_CAEEL/8-109----------------EPAIF.............EATVQKILPLA.-QKFGS-KTV---LQKCERFLITIS---------
ZBT17_MOUSE/14-114----------------AKLSL............SPENVDDVLAVA.-SFLQM-QDI---VTACHTL..KSL---------
Y2060_ARATH/201-303----------------GRTQIL............ESELAPLRDLS.-SKFEV-MSL---VRQCEESIDHFK---------
Y2060_ARATH/341-455----------------GELNMEDT.......VNFGTELIHLLFLA.-DRFGV-VPL---HQECCKMLLECL---------
O61795_CAEEL/46-153----------------GAIAID............DSNVQDILPAA.-CLLQI-HEV---QTACCDYLKKQL---------
O76610_CAEEL/10-114----------------EPAIF.............ECTIYQILLLA.-VKFQT-YTV---IKKCEKFLIHTS---------
KELC_DROME/147-253----------------ATVEVN............EDNVQVLLTAA.-NLLQL-TDV---RDACCDFLQTQL---------
KLH21_HUMAN/25-133----------------GRVAVS............GDNAEPLLRAA.-DLLQF-PAV---KEACGAFLQQQL---------
O45927_CAEEL/141-251----------------PHLPPKQ........WIKESDLVEQFEHIQ-RILRI-GKS---LQISIVLEVADK---------
BTBD2_HUMAN/112-217----------------DEVQIG............PETVMTTLYTA.-KKYAV-PAL---EAHCVEFLKKNL---------
O44818_CAEEL/140-244----------------EYAID.............EETVDGILHLA.-HLYDM-PFP---IKRCEEFLVDSS---------
P91543_CAEEL/104-200----------------KVIFPN............DFTAEKILELA.-VRFKV-PAA---VALVENQLLHHS---------
Q18030_CAEEL/118-226----------------SVFRIT............RGNIVELLELS.-HFFDC-KNV---TMFCEYNLCNDT---------
LZTR1_HUMAN/655-764----------------GEVNMP............PEDSLYLFAAP.-YYYGF-YN.---.NRLQAYCKQNL---------
BAB1_DROME/117-222----------------GEINVSQ.........DQ...IGPLLRIA.-EMLKV-RGL---ADVTHMEAATAA---------
O17112_CAEEL/140-243----------------KTVFPC............DRTVEKILAMA.-DRFIV-QSA---IDHVEYHLLHNS---------
BACH1_MOUSE/24-130----------------AKLIL............SKDNVDEVCRCV.-EFLSV-HNI---EESCFQFLKFKF---------
BCL6_HUMAN/22-129----------------SRLNL............REGNIMAVMATA.-MYLQM-EHV---VDTCRKFIKASE---------
BRC1_DROME/22-127----------------GEVNVHQ.........KS...LQSFLKTA.-EVLRV-SGL---TQQQAEDTHSHL---------
CALI_BOVIN/18-128----------------GKVVI............SEQNVEELLRGA.-QYFNT-PRL---RIHCNDFLIKSI---------
ENC1_HUMAN/36-144----------------SRVIIN............EENAESLLEAG.-DMLEF-QDI---RDACAEFLEKNL---------
GAGA_DROME/24-129----------------GEVSVDH.........AQ...LPSLLQAA.-QCLNI-QGL---APQTVTKDDYTT---------
GCL_DROME/56-166----------------DEIEIE...........S.ADVISVLATA.-TLFHL-DGI---IDKCAEVMVDNI---------
ZBT48_HUMAN/16-119----------------GHLALT............SGNRDQVLLAA.-RELRV-PEA---VELCQSFKPKTS---------
KBTBA_HUMAN/23-130----------------ASIDLN............DGNVQDIFALA.-SRFQI-PSV---FTVCVSYLQKRL---------
LOLA2_DROME/22-127----------------GEVNISQ.........DQ...LAALLKAA.-ESLQI-KGL---SDNRTGGGVAPK---------
KAISO_HUMAN/22-125----------------SKIVRV...........RSDLLDELIKSG.-QLLGV-KFI---AELGVPLSQVKS---------
ZF161_HUMAN/26-132----------------AKISV............KKEDVNLMMSSG.-QILGI-RFL---DKLCSQKRDVSS---------
ABTB2_RAT/832-945----------------GGTESME.........IPTADILQLLSAA.-NLFQL-DAL---QRHCEILCSQTL---------
ZBTB5_HUMAN/14-123----------------STLMLG............ESNVMDVLLAA.-SHLHL-NSV---VKACKHYLTTRT---------
ZBT7B_HUMAN/24-145----------------ATLTT............SSANMPAVLQAA.-RLLEI-PCV---IAACMEILQGSG---------
ZBT22_HUMAN/47-151----------------GRLSM............AAADIVNFLTVG.-SVLQM-WHI---VDKCTELLREGR---------
O16313_CAEEL/54-165----------------SKIDFAG.........VELDILLEYLSLA.-HRYDL-IQL---MTAISEYFKEIL---------
O16566_CAEEL/67-171----------------ESAID.............DSTIDGVLQLA.-QMFDV-SLA---IRKSEEFLVEKS---------
O16736_CAEEL/144-248----------------DSAIN.............DLTVEGILHIA.-DMYDT-PMV---VRKCEEFLIKGT---------
O16740_CAEEL/129-232----------------DLVFPT............DKTAAKLLTLA.-NRFQM-RAV---TAQVEHHLLWHS---------
O16741_CAEEL/157-256----------------ETGFVN............DQNAEKLLHLG.-NRFKI-SCV---IHQVEHHFTRGT---------
O16744_CAEEL/132-231----------------EMVLST............DKTAELLLRLG.-DRFKM-PAV---MHHVETRLIEWT---------
O17197_CAEEL/70-174----------------ETVLPV...........NDKTVEKLLELA.-DRFII-PAV---LRLAETHLLTHS---------
O17253_CAEEL/135-236----------------EAAFSN............HQNAEVLLELG.-NRFKI-PAV---MRHVENQIIRDT---------
O17297_CAEEL/141-242----------------EPAID.............EDTIDGILTLA.-HKFTM-PLP---IQKCEEFLIEKS---------
O18147_CAEEL/41-148----------------GELRIT............TSNVQSIMLGA.-NFFQM-LEV---VQHCGNFLLTRL---------
BPM3_ARATH/184-303----------------DVLPNVHEITGSTSASSFTNMIQHLLAAA.-DLYDL-ARL---KILCEVLLCEKL---------
Y2045_ARATH/15-132----------------VDGSI.C........SASLKKHARSLFHAA-DKYEI-PHL---RDLCRNELISSL---------
NACC1_RAT/20-124----------------GRLSM............NMGDQFLLIYTA.-GFLQI-QEI---MEKGTEFFLKVS---------
ZBT43_HUMAN/23-126----------------GRLVM............PAPEIVSYLTAA.-SFLQM-WHV---VDKCTEVL.EGN---------
O44815_CAEEL/142-246----------------ESAID.............EDTIEGILHLA.-HMYDM-PFP---TRKCEEFLIDFS---------
O44817_CAEEL/137-241----------------ESAID.............DGTIKGILELA.-DMYDM-PFP---IRKCEEFLIDSS---------
O44905_CAEEL/112-216----------------NMIFPN............DETADKLLELA.-DRFLM-PAV---TNMVGFHLCHSD---------
O45594_CAEEL/135-238----------------DAVFPN............DRTAEKLLEMG.-DRFII-QSV---INHVEYHLLHNT---------
O61932_CAEEL/71-176----------------GKVTFR............LATLHEDLKAI.-SYFEI-VTL---QEDVEKRLVELA---------
O72730_COWPX/30-136----------------GGVMDD..........LELEDVVEMFDLA.-RFLDS-EIL---GHATVRSFHYMI---------
KBTB2_CWPXG/16-123----------------RHISSM...........N...VIDVLKCA.-DYLLI-DDL---VADCESYIKDYI---------
B2RG49_HUMAN/24-131----------------STLTI............TAGNVKHILNAA.-RMLEI-QCI---VNVCLEIMEPGG---------
BTB1_SCHPO/608-735----------------DTLLSPWH......LDSRFSPLKENLSKLA-NLLEL-PHL---AEVLPFSVSRQP---------
O76568_CAEEL/144-248----------------EPAID.............DETIDGILHLA.-HMYDM-SVP---LRKCEEFLINES---------
O77168_APIME/26-132----------------GEIDVSQ.........AE...LQSLLKTA.-DQLKI-KGL---CEVPESRDGPPS---------
KEN_DROME/23-131----------------GQTCIT.............SRDVNYLHDLL-LLLQI-KSD---SWKTTDSAYLSS---------
Y4409_ARATH/15-129----------------SDGSM.L........SEKAKQHAMSLYSAA-KDYEI-PRL---WCLCRKELIASL---------
BCL6B_MOUSE/28-135----------------SRLRL............SPATAPAVLAAA.-TYLQM-EHV---VQACHRFIQASY---------
O89076_MOUSE/10-122----------------ASISV............GEKCVLHVMNGA.-VMYQI-DSV---ERACSDFLVQQL---------
ZBT7A_CHICK/24-131----------------ATLTV............STSNVNDILNAA.-KLLEI-PAV---RDVCTDLLDRKI---------
P90538_DICDI/34-143----------------GIIYLS............PENVIPLLAMS.-DHYLI-RDL---QHLCLLFLDQNL---------
ZN238_HUMAN/14-121----------------GKLQF............KDLPIEDVLAAA.-SYLHM-YDI---VKVCKKKLKEKA---------
ZBTB6_HUMAN/23-127----------------GALEVK............RKELLKYLTAA.-SYLQM-VHI---VEKCTEALSKYL---------
Q17523_CAEEL/126-230----------------PFKME.............RENVEQVLDLA.-SKWEM-KSV---ITKYEQFLIKTR---------
Q17782_CAEEL/193-300----------------GTCTN............MGGNALDILAAA.-ERFAL-PGL---KNIAEVAMRNGL---------
Q19838_CAEEL/23-130----------------GEIDIP............ETTIADVLAVA.-SYLRV-TML---QRQIEQKILNHN---------
Q20183_CAEEL/184-293----------------DEVKIE............AESVMTTLYTA.-KKYAV-PAM---EKECVRFLKQRL---------
BAT38_CAEEL/220-325----------------CHKPIT............SDNVEYLLELG.-DKYEI-QYV---MDECERFLVGSE---------
Q21899_CAEEL/143-245----------------HRQPVT............KKSLDYLLQLA.-DRYQC-QPI---VDACEMFMCAHY---------
MMD4_DROME/22-128----------------GEVNVKQ.........DA...LPAFISTA.-ESLQI-KGL---TDNDPAPQPPQE---------
ABRU_DROME/93-198----------------GEVNVSH.........EQ...LPDFLKTA.-HLLQI-RGL---ADVNGGYPYSKA---------
Q24455_DROME/25-131----------------GEIDVTE.........SE...LQGLLRTA.-EQLKI-KGL---CETAENADDLND---------
CP190_DROME/20-127----------------GTLEFE............LKMYGKLLRTA.-KEMNM-TVL---LKLLEAHRRTME---------
HIC1_CHICK/53-160----------------GRLGE.CE.......PGGEQSLGAVLAAA.-SYLQI-PGL---VALCKKKLKRSG---------
MEL26_CAEEL/191-300----------------GR....C........NKDITDMATALLIAA-DKYRL-EEL---KSHCEKYLVENI---------
SPOP_HUMAN/190-297----------------G.....K........APNLDKMADDLLAAA-DKYAL-ERL---KVMCEDALCSNL---------
TTKB_DROME/23-127----------------GEVSVDQ.........ER...LTAFLRVA.-ESLRI-KGL---TEVNDDK.PSPA---------
KBTB1_VACCW/11-118----------------IPLSLT..........ND..NVKYILSTA.-DFLQI-GSA---ITECENYILKNL---------
VC04_SWPVK/8-116----------------GNIVLT............KDNIELVIQVC.-DYLCI-DSL---IKICEEYICGII---------
VC13_SWPVK/16-119----------------GIVTID............LDNVENIFSIS.-CSKAI-DFL---KNSCIDFMSKHI---------
VF03_VACCC/18-120----------------GKVYID............SHNVVNLLRAS.-ILTSV-EFI---IYTCINFILRDF---------
VMT8_MYXVL/6-112----------------ESIELH............KGNTESIFSLV.-HYLQI-KPL---IKKCIYEFNSIV---------
ZBT39_HUMAN/20-126----------------SELFTD............LINVGVIYEVA.-ERLGM-EDL---LQACHSTFPDLE---------
ZBT24_HUMAN/27-133----------------GYLHAS............EKSTEQILATA.-QFLKV-YDL---VKAYTDFQNNHS---------
BTB3_SCHPO/157-262----------------DTNAVF...........TKQYNNALLSIG.-KKFQL-NDF---IALYEKDREQLH---------
BTB3_SCHPO/296-405----------------DKTDIA...........PELALDVVYVADM-LSLDK-DRS---LKSLASIVITKQ---------
YIA1_YEAST/264-390----------------DNTDIP............WMYAVDVLLLA.-DILLE-DRL---KTIASTIITQSK---------
BAT15_CAEEL/139-243----------------EPAID.............DGTIDGVLLLA.-HMLDV-TLA---IRKCEEFLIEKS---------
BAT42_CAEEL/208-319----------------GATESL..........ESQGNIDEILAIA.-DKYEV-LML---KDQCERLIAQTI---------
BAT43_CAEEL/255-368----------------G.....Q........TKYIEQMAQSLIAAA-DKYQL-DRL---KVMCEQALCYQL---------
YR47_CAEEL/45-146----------------KAFEQG.............IKPNITLQKA.-IELLE-PAA---FLQMSIALDYIS---------
ZBT16_HUMAN/24-126----------------ATLQAK............AEDLDDLLYAA.-EILEI-EYL---EEQCLKMLETIQ---------
ZBT25_HUMAN/14-119----------------GKGPK.............QIVDHSRLEEGI-RFLHA-DYL---SHIATEMNQVFS---------

PF11822

Q29D48_DROPS/298-606AQSQDMPGPGQSSAAASGPQLD------------GNNVVPILVSA--SFLQM-EPL---LLECLAFCHAHLSEVVRTSTN
Q4Q8A2_LEIMA/20-417................KAPQIT------------NSNVVSICLSS--SFLQM-QEL---SDNALMYLSAHLKEIVSSSFD
Q0IFU1_AEDAE/236-536SMSQD...........DWPALD------------PSNVVPILVSA--SFLQM-EPL---LLDCLSFCHARLNEVVKASAN
Q383Z9_TRYB2/26-376................KQRSFT------------PKNAVSLALSS--NFLHM-TQL---VEMTLLYIKDHLVEVILSGVN
A4HGL7_LEIBR/10-407................KTQEIT------------KDNVVSICLSS--SFLQM-QEL---SDNALMYLGVHLSEIVSSSFD
Q4RN30_TETNG/1-302TAGEN..........KDKPRLE------------PSNVISILISS--EFLKM-DTL---VEECIQYCHKHMSAIVATPCN
A7S8V2_NEMVE/1-302LMEKGKK......VDEKPPKLE------------PNNVISILISS--DFLKM-DNL---VNDCISFCHENMSAIVSTPCN
Q4DXB1_TRYCC/30-401................KDRPFT------------PENAVSIALSS--NFLLM-TQL---VDLPLQYIKENLVQVMLSGVN
K1841_XENLA/146-448APENEN.........QEIPKLE------------PGNVISILISS--EFLKM-ESL---VEECIRYCHKNMSAIVATPCN

PF03931

SKP1_HUMAN/2-67-----------------------------------------------THHKD----------------------------
O77430_DROME/2-66-----------------------------------------------HYHKD----------------------------
ASK16_ARATH/4-64-----------------------------------------------KKHVL----------------------------
SKP1_EMENI/4-65-----------------------------------------------AHHRN----------------------------
O75863_HUMAN/17-82-----------------------------------------------IYFTY----------------------------
SKP1A_ARATH/4-63-----------------------------------------------KR.HV----------------------------
ELOC_HUMAN/17-79-----------------------------------------------MYFTY----------------------------
O82463_NICCL/2-61-----------------------------------------------KR.HV----------------------------
Q21367_CAEEL/8-70-----------------------------------------------YHHRN----------------------------
Q23153_CAEEL/69-131-----------------------------------------------HYLAY----------------------------
ELOC_YEAST/4-66-----------------------------------------------NYNLK----------------------------
ASK19_ARATH/4-64-----------------------------------------------KKHVE----------------------------
ASK12_ARATH/4-64-----------------------------------------------KKYHV----------------------------
ASK14_ARATH/4-64-----------------------------------------------KKHVV----------------------------
SKP1B_ARATH/5-64-----------------------------------------------.KRHV----------------------------
Q89374_PBCV1/1-61-----------------------------------------------SFYNV----------------------------
SKP1A_DICDI/2-63-----------------------------------------------RHHHQ----------------------------

PF02214

KCNA5_MOUSE/113-204..--------------GRLRRP-----------VNVSLDVFADEI--RFYQL-GDEA..MERF-----------------
KCNAL_DROME/43-132..--------------GKLHYP-----------KHECLTSYDEEL--AFFGI-MPDV..IGDC-----------------
KCNS1_MOUSE/21-120..--------------GHLHVL-----------DELCVFAFGQEA--DYWGL-GENA..LATC-----------------
KCNS3_HUMAN/17-116..--------------GKLHVM-----------EELCVFSFCQEI--EYWGI-NELF..IDSC-----------------
Q18986_CAEEL/7-97.Q--------------IALPDS-----------.DREVREVLAEA--SYFLL-DPL...IELC-----------------
KCNA7_MOUSE/47-138..--------------GRLRRP-----------AHVPLDVFLEEV--SFYGL-GAAA..LARL-----------------
O76266_HIRME/83-174..--------------GKLRRP-----------DYIPDDVFLNEI--EYYQL-EPEV..IEDY-----------------
P91557_CAEEL/6-93.K--------------VDLPET-----------.LKELMPIFRET--EYYTL-ASL...VEQC-----------------
O17001_CAEEL/21-113.Q--------------VDLCG.-----------..IKVDTLKHEA--LFFGL-TPLIRRLTLC-----------------
O16612_CAEEL/6-96.D--------------VVLPDS-----------.KKDMLELKKEA--EYYLL-SNL...AKLC-----------------
O16709_CAEEL/9-96.R--------------ADLPET-----------.LKDLKMLLGEA--EYYEL-TEL...CDDC-----------------
Q26094_POLPE/45-136..--------------GIMARP-----------PNIPIHIFVNEL--IFFDI-GDKL..IEKL-----------------
O16706_CAEEL/5-95.D--------------VVLPSC-----------.ELTVKELLAEA--QFYLL-DEL...IELC-----------------
KCNA2_CANFA/35-126..--------------GRLRRP-----------VNVPLDIFSEEI--RFYEL-GEEA..MEMF-----------------
KCNB1_HUMAN/33-132..--------------GRLHMM-----------EEMCALSFSQEL--DYWGI-DEIY..LESC-----------------
KCNC1_HUMAN/10-104..--------------GKLHCP-----------ADVCGPLYEEEL--AFWGI-DETD..VEPC-----------------
P91564_CAEEL/5-95.D--------------LPLPED-----------.ERELRELMAEA--QFYWL-DGL...VLMC-----------------
Q25376_LOLOP/42-133..--------------GRLRRP-----------QNVPLDIFLEEI--RFFEL-GEEV..IDKY-----------------
KCNAW_DROME/12-102..--------------GKLHYP-----------TDVCGPLFEEEL--EFWGL-DSNQ..VEPC-----------------
KCNS2_MOUSE/19-118..--------------GKLHVM-----------AELCVFSFSQEI--EYWGI-NEFF..IDSC-----------------
O16613_CAEEL/8-96.D--------------VDLPDS-----------.ENELKELKREA--EYYSL-EKL...ATLC-----------------
O97045_HALRO/72-171..--------------GKLHMP-----------EDICALAFSQEL--EYWGI-EDIY..IESC-----------------
Q26095_POLPE/56-146..--------------GVLECP-----------FGLSESIFIQEV--LFFEI-DNTA..LLE.-----------------
Q09658_CAEEL/92-183..--------------GRVKRP-----------EIVPIDIFLKEM--RFFQM-GDDL..LEEF-----------------
KCA10_HUMAN/88-179..--------------GKIRRP-----------ANVPIDIFADEI--SFYEL-GSEA..MDQF-----------------
O76889_DROME/24-115KL--------------VLDG..-----------..VSEEGVLEEA--EFYNV-TQL...IALL-----------------
KCND1_HUMAN/42-131..--------------GRLHCP-----------RQECIQAFDEEL--AFYGL-VPEL..VGDC-----------------
KCNAS_DROME/99-190..--------------GRLRRP-----------VNVPLDVFSEEI--KFYEL-GDQA..INKF-----------------
KCND3_RAT/42-131..--------------GKLHYP-----------RYECISAYDDEL--AFYGI-LPEI..IGDC-----------------
Q20381_CAEEL/28-127..--------------GKLHRP-----------MDICPIRLRYEL--DYWRI-PTPF..MSPC-----------------
KCNG1_HUMAN/65-164..--------------GKLRLL-----------REMCALSFQEEL--LYWGI-AEDH..LDGC-----------------
Q26597_SCHMA/53-144..--------------GRLRRP-----------VNVPIDVFNEEI--KFYEL-GEEA..LAKY-----------------
Q16976_APLCA/66-156..--------------RELHVP-----------LEVCGAVVKREL--DFWQI-NELE..IKAC-----------------
P91784_POLPE/46-135..--------------GKLHFP-----------KNECVSSFEDEL--TFFGI-KGFN..INNC-----------------
P91783_POLPE/39-128..--------------GQLHCS-----------DNDCHEAFADEL--MFFGI-MPED..VAAC-----------------
O16711_CAEEL/8-100AD--------------VDLLPE-----------SEKEVREILKEA--QFYLL-EGL...MELC-----------------
KCNV1_RAT/44-153..--------------GRLHVM-----------EQLCALSFLQEI--QYWGI-DELS..IDSC-----------------
Q26344_APLSP/158-258..--------------GRLHLV-----------EEMCVLSFSEDL--EYWGV-DELY..LESC-----------------
Q18776_CAEEL/84-176KL--------------IMNPG.-----------..LSEEGILAEA--DFYNL-PSL...SQLI-----------------
KCNAB_DROME/279-378..--------------GKLHIV-----------DEMCVLAFSDDL--EYWGV-DELY..LESC-----------------
P91556_CAEEL/2-87.D--------------VDLPQ.-----------..EYLNQLLREA--RFYGL-VKL...VRDC-----------------
O16630_CAEEL/2-90.S--------------VDLPES-----------.LKHLRQLLREA--IFYGL-EKL...IECC-----------------
P91256_CAEEL/38-137..--------------GVVHRP-----------SEICPASFLSEL--DFWRI-SHQH..VGSC-----------------
BACD2_MOUSE/30-120.T--------------ITLPQS-----------.RQEIQELMAEA--KYYLI-QGL...VSTC-----------------
O16708_CAEEL/99-187.D--------------VILPES-----------.MESLKELLHEA--ILYKL-SGL...SEKC-----------------
KCNG2_CHICK/59-158..--------------GKLRLL-----------REMCALSFQEEL--VYWGI-EEDH..LEWC-----------------

PF07707

KBTBC_MOUSE/131-233---------------------------------NQALRTEHLVELL.KQVRL.ELI---NASFLRQALR-----------
Q7PXP7_ANOGA/170-272---------------------------------DAEGRKRHIPELL.ALIKL.PLL---QPSFIVDHVE-----------
KLHL8_MOUSE/178-280---------------------------------NPQHHPKWLDETL.AQVRL.PLL---PVDFLMGVVA-----------
O61795_CAEEL/158-260---------------------------------DISKRKTHLSMLL.SHVRL.PLC---TPKFLVSVVS-----------
KLHL6_MOUSE/172-274---------------------------------KQSERLCLLPCVL.ENVRL.PLL---DPWYFVEMVE-----------
KLH18_HUMAN/140-242---------------------------------DREQRGPYLPELL.SNIRL.PLC---RPQFLSDRVQ-----------
KELC_DROME/258-360---------------------------------DVPMREQFTSLLM.EHVRL.PFL---SKEYITQRVD-----------
BTBDH_XENLA/161-261---------------------------------KNP.DVPVIEKVL.RAIRY.PMI---TPSQLFQ.IQ-----------
KBTB3_HUMAN/150-252---------------------------------NLESRQKYLPHLI.EKVRL.HQL---SEETLQDCLF-----------
KELC_ANOST/201-303---------------------------------DVNGRQHHLAELM.EHVRL.PLL---SQDYLVQYVE-----------
GAN_MOUSE/134-236---------------------------------DVEMRKVHMKDVM.SALWV.SGL---DSSYLREQML-----------
Q8JIM0_DANRE/160-262---------------------------------DAESRAQYFHALL.NAVHI.YAL---PPTFLKRQLQ-----------
Q7PMB5_ANOGA/179-281---------------------------------DVVPRRQYVFEIL.SHVRI.ALV---PVGLIDQAIA-----------
Q7QHD7_ANOGA/175-277---------------------------------EQETRSEYLPLIL.ANIRL.PLL---SPQFLADSVA-----------
Q7QI84_ANOGA/148-248---------------------------------NAD.TVPNVDVVV.GKVRF.ELM---SLEELLTVVR-----------
KBTB8_HUMAN/152-254---------------------------------EQNEREVHLPEIFAKCIRF.PLM---EDTFIEK.IP-----------
KLH12_XENLA/131-233---------------------------------NRHEREKSLPQLL.QYVRM.PLL---TPRYITDVID-----------
Q7Q1T2_ANOGA/174-276---------------------------------DLSERKKHISELM.SHVRL.PLV---SREFLMNCVE-----------
KLH21_HUMAN/138-239---------------------------------DPPRRAAHWPQLL.EAVRL.PFV---RRFYLLAHVE-----------
ENC1_HUMAN/149-251---------------------------------DLKKRYCYLPELL.QTVRL.ALL---PAIYLMENVA-----------
O16313_CAEEL/170-270---------------------------------NPT.MKEASKVLL.ELVRL.PLI---TQTELLNCVR-----------
O18147_CAEEL/153-255---------------------------------DVI.RHEQAAKIL.PCVRL.PLL---SPTYLSSIVA-----------
KBTBA_HUMAN/135-237---------------------------------DKENRVKNLSEVF.DCIRF.RLM---TEKYFKDHVE-----------
KBTB1_CWPXG/123-222---------------------------------T...QQSCTVELL.RCLRI.SLL---SPQVIKSLYS-----------
O72746_COWPX/102-200---------------------------------D...IYKDISDIL.PVIRW.NYL---SPEWLTD.ME-----------
KLHL2_HUMAN/158-260---------------------------------DKDVRQEFMARLM.EHVRL.PLL---PREYLVQRVE-----------
IPP_MOUSE/139-241---------------------------------DLGKRRKHVVEVL.DPVRF.PLL---PSQRLLKYIE-----------
KEAP1_RAT/184-286---------------------------------DCPQRRFYVQALL.RAVRC.HAL---TPRFLQTQLQ-----------
P87597_COWPX/101-204---------------------------------DAE.RINMVKENISKLIRVDELL---SKKYILNELG-----------
Q6DE07_XENLA/176-277---------------------------------EDT.RMDYAAKIM.KNIRF.PLM---TPQDLINHVQ-----------
KLH20_XENLA/165-267---------------------------------SIQERRPQLPQVL.QHVRL.PLL---SPKFLVGTVG-----------
ENC2_XENLA/149-251---------------------------------DLDKRKDYFPELL.RNVRL.ALL---PSELLKEAVV-----------
Q6DJ21_XENTR/98-200---------------------------------DEPNRQPYMVDIL.AKVRF.PLI---SKNFLSKTVQ-----------
Q6GKZ1_DROME/195-298---------------------------------NPESRKRHVAHLM.TGVRL.GLM---TPKCFMEEVK-----------
Q6GML3_DANRE/142-241---------------------------------NG..DGPEAKEVM.SAVRL.PLM---TLSEMLNVVR-----------
Q6GNW3_XENLA/149-250---------------------------------DLSIRLDDLPDLL.RYVRL.ALL---PDQYL.RCLA-----------
Q6GNZ5_XENLA/139-241---------------------------------DIVTRKRHVIEVL.EPVRF.SLL---PPKRLQKAIE-----------
KLH23_MOUSE/139-240---------------------------------DVENRIECIYNLL.SYINI.D.I---DPVYLKTALG-----------
KLH30_XENLA/135-237---------------------------------DKECRAQCLPQLL.SVAQL.SSL---TDQYLQELME-----------
Q6IQ87_DANRE/140-242---------------------------------ERDDRESRLPELL.SKIRL.PLC---RPQFLADRVQ-----------
Q6IR89_XENLA/133-234---------------------------------NTVSRSQYLSTVL.SHLRI.DAL---S.EVIQREWF-----------
Q6NRT8_XENLA/167-269---------------------------------HVDVRRPMLQELL.THVRL.PLL---HPNYFVQTVE-----------
KLH21_DANRE/140-242---------------------------------DLQHRLHYWPELL.QQVRL.PFV---RRFYLLAHVE-----------
Q6P4N4_XENTR/135-237---------------------------------DKENKTKSLSDVF.DCIRF.RLM---PEKYFTDKVE-----------
Q6PFE1_MOUSE/275-376---------------------------------DLEQRRKDLSRLL.AYIRL.PLL---APQFLAD.ME-----------
Q6PGA3_MOUSE/223-324---------------------------------DAQARQRDLAKLL.SYIRL.PLL---SPQLLAD.LE-----------
KLH31_DANRE/173-274---------------------------------DEK.RLKYAPDLL.SNIRF.GTI---TPQDLVSHVQ-----------
KLH17_MOUSE/192-294---------------------------------DVDTRRQHVPRLM.KCVRL.PLL---SRDFLLGHVD-----------
Q6TEQ2_DANRE/149-251---------------------------------DIGRRHLDLPDLL.RCVRL.ALL---PETYLLKTWH-----------
Q7KSF5_DROME/192-294---------------------------------DEDNRHCKMEHIL.GAVRC.QFL---TPNFLKEQMK-----------
Q7SYC4_DANRE/168-270---------------------------------DVDHRRIMLKDLL.NHVRL.PLL---HPNYFVQTVE-----------
Q7SYD2_DANRE/136-238---------------------------------DKANRVKSLAEAF.DCIRF.RLL---PEKYFREKVE-----------
Q7ZVF7_DANRE/174-276---------------------------------NSEERVKYFEELF.RLLRL.PQI---KPTYLTRVVK-----------
KLH29_MOUSE/216-318---------------------------------DPATRAQYAAELL.AAVRL.PFI---HPSYLLNVVD-----------
Q86BQ6_DROME/179-281---------------------------------DSAAREQHIPELL.ALVRL.PLL---QPAFIMDHVE-----------
Q8AW66_DANRE/167-269---------------------------------REDDRTALLPRVL.THVRL.PLL---DPWFFVERVE-----------
KLH26_MOUSE/156-257---------------------------------DPA.RRARASLVL.RHVRF.PLM---QPAELVDSVQ-----------
KLH38_MOUSE/136-237---------------------------------DLQARWRHMQELL.QQVRL.QYI---HPAFFHHFIA-----------
KLH31_MOUSE/172-273---------------------------------DQK.RVKHAADLL.SNIRF.GTI---SAQDLVNYVQ-----------
Q8C2V5_MOUSE/142-240---------------------------------N...AKENHAEIM.QAVRL.PLM---SLTELLNVVR-----------
Q8CCY1_MOUSE/317-418---------------------------------DMQRRCSDLSMLL.AFIRL.PLL---PPQILAD.LE-----------
Q8IH95_DROME/224-325---------------------------------HWPQREENVTDVV.SSIRF.GLI---PPWLLIR.LQ-----------
Q8IQ29_DROME/76-176---------------------------------QQL.NESALGDLL.RLIKW.QHI---SYKSVDE.LR-----------
Q8JTM8_LSDV/120-221---------------------------------QNSISCFEICKIL.KLIKI.PFV---TEEYFKK.LQ-----------
Q8JTN6_LSDV/122-221---------------------------------EA..NNKYFHDVL.KVIRF.SLL---SEECADK.LK-----------
Q8JU17_LSDV/121-220---------------------------------KKTNRLNTMKLVN.DSVRF.TFL---TEKG.KKRLR-----------
Q8N4I8_HUMAN/152-254---------------------------------EKETRLEHMAKLM.EHVRL.PLL---PRDYLVQTVE-----------
KLH36_HUMAN/148-250---------------------------------QPE.REAHARQVL.ENIHF.PLI---PKNDLLHRVK-----------
ENC2_MOUSE/149-251---------------------------------DLEQRKAHLPLLL.RNVRL.ALL---PSDCLKNAVS-----------
Q8V3G0_SWPV1/125-224---------------------------------N..NVTRCPLSIL.AKIRL.SLL---SNQ.VSKFIH-----------
KLH28_MOUSE/137-239---------------------------------DVQERQKYLAQLL.NSVRL.PLL---SVKFLTRLYE-----------
BTBDH_MOUSE/169-269---------------------------------ARP.PPTVAERAL.RAIRY.PMI---PPAQLFQ.LQ-----------
Q9DHH3_YLDV/126-228---------------------------------NKNTVKKCPLSLL.KTIKK.SLL---CEKMIELLLN-----------
Q9Q8G2_MYXVL/125-224---------------------------------N..NMEDCPSVLL.EQVRM.SLL---SMS.VKNLLL-----------
Q9VGE5_DROME/143-245---------------------------------AEDKRSELFPQVL.AAVRL.PLL---SPQFLADRVA-----------
Q9VK21_DROME/187-289---------------------------------DVTQRRCYVFDVL.SHVRM.ALV---PVKVIDKALK-----------
Q9W2S3_DROME/150-248---------------------------------NSN...VDFKSVV.SYVRL.PLM---NLEHLLQVVR-----------
Q9W4L5_DROME/162-265---------------------------------QSKCIDQATPLLM.DCLRL.TLL---PLPILKRFWR-----------
Q9W4S3_DROME/306-407---------------------------------SWTERKKHAVKVM.QKVRF.GLL---SP.WLRRSIC-----------
Q9W6R2_TAKRU/75-177---------------------------------NSERRKRHFAILL.PKVRL.ALL---SLEYIITNMV-----------
Q9W6R3_TAKRU/76-178---------------------------------AVADRKEFTAILF.SKVRL.CFL---SYEYIRLNML-----------

PF00651

BACH2_MOUSE/27-133--------------------------------------------------------------------------------
BAT47_CAEEL/8-109--------------------------------------------------------------------------------
ZBT17_MOUSE/14-114--------------------------------------------------------------------------------
Y2060_ARATH/201-303--------------------------------------------------------------------------------
Y2060_ARATH/341-455--------------------------------------------------------------------------------
O61795_CAEEL/46-153--------------------------------------------------------------------------------
O76610_CAEEL/10-114--------------------------------------------------------------------------------
KELC_DROME/147-253--------------------------------------------------------------------------------
KLH21_HUMAN/25-133--------------------------------------------------------------------------------
O45927_CAEEL/141-251--------------------------------------------------------------------------------
BTBD2_HUMAN/112-217--------------------------------------------------------------------------------
O44818_CAEEL/140-244--------------------------------------------------------------------------------
P91543_CAEEL/104-200--------------------------------------------------------------------------------
Q18030_CAEEL/118-226--------------------------------------------------------------------------------
LZTR1_HUMAN/655-764--------------------------------------------------------------------------------
BAB1_DROME/117-222--------------------------------------------------------------------------------
O17112_CAEEL/140-243--------------------------------------------------------------------------------
BACH1_MOUSE/24-130--------------------------------------------------------------------------------
BCL6_HUMAN/22-129--------------------------------------------------------------------------------
BRC1_DROME/22-127--------------------------------------------------------------------------------
CALI_BOVIN/18-128--------------------------------------------------------------------------------
ENC1_HUMAN/36-144--------------------------------------------------------------------------------
GAGA_DROME/24-129--------------------------------------------------------------------------------
GCL_DROME/56-166--------------------------------------------------------------------------------
ZBT48_HUMAN/16-119--------------------------------------------------------------------------------
KBTBA_HUMAN/23-130--------------------------------------------------------------------------------
LOLA2_DROME/22-127--------------------------------------------------------------------------------
KAISO_HUMAN/22-125--------------------------------------------------------------------------------
ZF161_HUMAN/26-132--------------------------------------------------------------------------------
ABTB2_RAT/832-945--------------------------------------------------------------------------------
ZBTB5_HUMAN/14-123--------------------------------------------------------------------------------
ZBT7B_HUMAN/24-145--------------------------------------------------------------------------------
ZBT22_HUMAN/47-151--------------------------------------------------------------------------------
O16313_CAEEL/54-165--------------------------------------------------------------------------------
O16566_CAEEL/67-171--------------------------------------------------------------------------------
O16736_CAEEL/144-248--------------------------------------------------------------------------------
O16740_CAEEL/129-232--------------------------------------------------------------------------------
O16741_CAEEL/157-256--------------------------------------------------------------------------------
O16744_CAEEL/132-231--------------------------------------------------------------------------------
O17197_CAEEL/70-174--------------------------------------------------------------------------------
O17253_CAEEL/135-236--------------------------------------------------------------------------------
O17297_CAEEL/141-242--------------------------------------------------------------------------------
O18147_CAEEL/41-148--------------------------------------------------------------------------------
BPM3_ARATH/184-303--------------------------------------------------------------------------------
Y2045_ARATH/15-132--------------------------------------------------------------------------------
NACC1_RAT/20-124--------------------------------------------------------------------------------
ZBT43_HUMAN/23-126--------------------------------------------------------------------------------
O44815_CAEEL/142-246--------------------------------------------------------------------------------
O44817_CAEEL/137-241--------------------------------------------------------------------------------
O44905_CAEEL/112-216--------------------------------------------------------------------------------
O45594_CAEEL/135-238--------------------------------------------------------------------------------
O61932_CAEEL/71-176--------------------------------------------------------------------------------
O72730_COWPX/30-136--------------------------------------------------------------------------------
KBTB2_CWPXG/16-123--------------------------------------------------------------------------------
B2RG49_HUMAN/24-131--------------------------------------------------------------------------------
BTB1_SCHPO/608-735--------------------------------------------------------------------------------
O76568_CAEEL/144-248--------------------------------------------------------------------------------
O77168_APIME/26-132--------------------------------------------------------------------------------
KEN_DROME/23-131--------------------------------------------------------------------------------
Y4409_ARATH/15-129--------------------------------------------------------------------------------
BCL6B_MOUSE/28-135--------------------------------------------------------------------------------
O89076_MOUSE/10-122--------------------------------------------------------------------------------
ZBT7A_CHICK/24-131--------------------------------------------------------------------------------
P90538_DICDI/34-143--------------------------------------------------------------------------------
ZN238_HUMAN/14-121--------------------------------------------------------------------------------
ZBTB6_HUMAN/23-127--------------------------------------------------------------------------------
Q17523_CAEEL/126-230--------------------------------------------------------------------------------
Q17782_CAEEL/193-300--------------------------------------------------------------------------------
Q19838_CAEEL/23-130--------------------------------------------------------------------------------
Q20183_CAEEL/184-293--------------------------------------------------------------------------------
BAT38_CAEEL/220-325--------------------------------------------------------------------------------
Q21899_CAEEL/143-245--------------------------------------------------------------------------------
MMD4_DROME/22-128--------------------------------------------------------------------------------
ABRU_DROME/93-198--------------------------------------------------------------------------------
Q24455_DROME/25-131--------------------------------------------------------------------------------
CP190_DROME/20-127--------------------------------------------------------------------------------
HIC1_CHICK/53-160--------------------------------------------------------------------------------
MEL26_CAEEL/191-300--------------------------------------------------------------------------------
SPOP_HUMAN/190-297--------------------------------------------------------------------------------
TTKB_DROME/23-127--------------------------------------------------------------------------------
KBTB1_VACCW/11-118--------------------------------------------------------------------------------
VC04_SWPVK/8-116--------------------------------------------------------------------------------
VC13_SWPVK/16-119--------------------------------------------------------------------------------
VF03_VACCC/18-120--------------------------------------------------------------------------------
VMT8_MYXVL/6-112--------------------------------------------------------------------------------
ZBT39_HUMAN/20-126--------------------------------------------------------------------------------
ZBT24_HUMAN/27-133--------------------------------------------------------------------------------
BTB3_SCHPO/157-262--------------------------------------------------------------------------------
BTB3_SCHPO/296-405--------------------------------------------------------------------------------
YIA1_YEAST/264-390--------------------------------------------------------------------------------
BAT15_CAEEL/139-243--------------------------------------------------------------------------------
BAT42_CAEEL/208-319--------------------------------------------------------------------------------
BAT43_CAEEL/255-368--------------------------------------------------------------------------------
YR47_CAEEL/45-146--------------------------------------------------------------------------------
ZBT16_HUMAN/24-126--------------------------------------------------------------------------------
ZBT25_HUMAN/14-119--------------------------------------------------------------------------------

PF11822

Q29D48_DROPS/298-606LSCLNDALVTRLAAMFTNLELEM....VRDKKERVTP..RLWTKLIQS.LCEPDPEA.......................
Q4Q8A2_LEIMA/20-417LTNLPTHLVLRLSHMVRDVDLAAALLRLHEERSANHPNRAFVASLLQHYVCHKVGVADGADVSSQTDAAAKASSDINGGA
Q0IFU1_AEDAE/236-536LACLNDSIITRLAAMFTNLELEM....VKDKKDRIAP..RLWTKLIQS.LCEIEPQA.......................
Q383Z9_TRYB2/26-376MDCFTGELLARLASMMSEGDVARAFLKLFDWHAEDSPNRRFLTALIRHMLCDRFGE........................
A4HGL7_LEIBR/10-407LTNLPTHLVLRLSHMVRDTDLAAALLRLHKEGSVNHQNRALVASLLQHYACHQLGVADGAEEPLPTDTEVVTRDSTDGSA
Q4RN30_TETNG/1-302MNCINSNLATRITDLFNHNEADD....VRDKKDKFKS..KLFQKKIER.LFDPGYQN.......................
A7S8V2_NEMVE/1-302MNCINDKLVTRISELFNHNELDE....VKDRKDKFKS..KLFCKKIEE.LFDPNKTT.......................
Q4DXB1_TRYCC/30-401MECLTGELLARLCTMLSEGDLARAFLRLYDWRTEYSSNRRFLTALLRHVVCDRLGE........................
K1841_XENLA/146-448MNCINANLLTRIANLFTHNEADD....VKDKKDKFKS..KIFCKKIER.LFDAECKN.......................

PF03931

SKP1_HUMAN/2-67--------------------------------------------------------------------------------
O77430_DROME/2-66--------------------------------------------------------------------------------
ASK16_ARATH/4-64--------------------------------------------------------------------------------
SKP1_EMENI/4-65--------------------------------------------------------------------------------
O75863_HUMAN/17-82--------------------------------------------------------------------------------
SKP1A_ARATH/4-63--------------------------------------------------------------------------------
ELOC_HUMAN/17-79--------------------------------------------------------------------------------
O82463_NICCL/2-61--------------------------------------------------------------------------------
Q21367_CAEEL/8-70--------------------------------------------------------------------------------
Q23153_CAEEL/69-131--------------------------------------------------------------------------------
ELOC_YEAST/4-66--------------------------------------------------------------------------------
ASK19_ARATH/4-64--------------------------------------------------------------------------------
ASK12_ARATH/4-64--------------------------------------------------------------------------------
ASK14_ARATH/4-64--------------------------------------------------------------------------------
SKP1B_ARATH/5-64--------------------------------------------------------------------------------
Q89374_PBCV1/1-61--------------------------------------------------------------------------------
SKP1A_DICDI/2-63--------------------------------------------------------------------------------

PF02214

KCNA5_MOUSE/113-204--------------------------------------------------------------------------------
KCNAL_DROME/43-132--------------------------------------------------------------------------------
KCNS1_MOUSE/21-120--------------------------------------------------------------------------------
KCNS3_HUMAN/17-116--------------------------------------------------------------------------------
Q18986_CAEEL/7-97--------------------------------------------------------------------------------
KCNA7_MOUSE/47-138--------------------------------------------------------------------------------
O76266_HIRME/83-174--------------------------------------------------------------------------------
P91557_CAEEL/6-93--------------------------------------------------------------------------------
O17001_CAEEL/21-113--------------------------------------------------------------------------------
O16612_CAEEL/6-96--------------------------------------------------------------------------------
O16709_CAEEL/9-96--------------------------------------------------------------------------------
Q26094_POLPE/45-136--------------------------------------------------------------------------------
O16706_CAEEL/5-95--------------------------------------------------------------------------------
KCNA2_CANFA/35-126--------------------------------------------------------------------------------
KCNB1_HUMAN/33-132--------------------------------------------------------------------------------
KCNC1_HUMAN/10-104--------------------------------------------------------------------------------
P91564_CAEEL/5-95--------------------------------------------------------------------------------
Q25376_LOLOP/42-133--------------------------------------------------------------------------------
KCNAW_DROME/12-102--------------------------------------------------------------------------------
KCNS2_MOUSE/19-118--------------------------------------------------------------------------------
O16613_CAEEL/8-96--------------------------------------------------------------------------------
O97045_HALRO/72-171--------------------------------------------------------------------------------
Q26095_POLPE/56-146--------------------------------------------------------------------------------
Q09658_CAEEL/92-183--------------------------------------------------------------------------------
KCA10_HUMAN/88-179--------------------------------------------------------------------------------
O76889_DROME/24-115--------------------------------------------------------------------------------
KCND1_HUMAN/42-131--------------------------------------------------------------------------------
KCNAS_DROME/99-190--------------------------------------------------------------------------------
KCND3_RAT/42-131--------------------------------------------------------------------------------
Q20381_CAEEL/28-127--------------------------------------------------------------------------------
KCNG1_HUMAN/65-164--------------------------------------------------------------------------------
Q26597_SCHMA/53-144--------------------------------------------------------------------------------
Q16976_APLCA/66-156--------------------------------------------------------------------------------
P91784_POLPE/46-135--------------------------------------------------------------------------------
P91783_POLPE/39-128--------------------------------------------------------------------------------
O16711_CAEEL/8-100--------------------------------------------------------------------------------
KCNV1_RAT/44-153--------------------------------------------------------------------------------
Q26344_APLSP/158-258--------------------------------------------------------------------------------
Q18776_CAEEL/84-176--------------------------------------------------------------------------------
KCNAB_DROME/279-378--------------------------------------------------------------------------------
P91556_CAEEL/2-87--------------------------------------------------------------------------------
O16630_CAEEL/2-90--------------------------------------------------------------------------------
P91256_CAEEL/38-137--------------------------------------------------------------------------------
BACD2_MOUSE/30-120--------------------------------------------------------------------------------
O16708_CAEEL/99-187--------------------------------------------------------------------------------
KCNG2_CHICK/59-158--------------------------------------------------------------------------------

PF07707

KBTBC_MOUSE/131-233--------------------------------------------------------------------------------
Q7PXP7_ANOGA/170-272--------------------------------------------------------------------------------
KLHL8_MOUSE/178-280--------------------------------------------------------------------------------
O61795_CAEEL/158-260--------------------------------------------------------------------------------
KLHL6_MOUSE/172-274--------------------------------------------------------------------------------
KLH18_HUMAN/140-242--------------------------------------------------------------------------------
KELC_DROME/258-360--------------------------------------------------------------------------------
BTBDH_XENLA/161-261--------------------------------------------------------------------------------
KBTB3_HUMAN/150-252--------------------------------------------------------------------------------
KELC_ANOST/201-303--------------------------------------------------------------------------------
GAN_MOUSE/134-236--------------------------------------------------------------------------------
Q8JIM0_DANRE/160-262--------------------------------------------------------------------------------
Q7PMB5_ANOGA/179-281--------------------------------------------------------------------------------
Q7QHD7_ANOGA/175-277--------------------------------------------------------------------------------
Q7QI84_ANOGA/148-248--------------------------------------------------------------------------------
KBTB8_HUMAN/152-254--------------------------------------------------------------------------------
KLH12_XENLA/131-233--------------------------------------------------------------------------------
Q7Q1T2_ANOGA/174-276--------------------------------------------------------------------------------
KLH21_HUMAN/138-239--------------------------------------------------------------------------------
ENC1_HUMAN/149-251--------------------------------------------------------------------------------
O16313_CAEEL/170-270--------------------------------------------------------------------------------
O18147_CAEEL/153-255--------------------------------------------------------------------------------
KBTBA_HUMAN/135-237--------------------------------------------------------------------------------
KBTB1_CWPXG/123-222--------------------------------------------------------------------------------
O72746_COWPX/102-200--------------------------------------------------------------------------------
KLHL2_HUMAN/158-260--------------------------------------------------------------------------------
IPP_MOUSE/139-241--------------------------------------------------------------------------------
KEAP1_RAT/184-286--------------------------------------------------------------------------------
P87597_COWPX/101-204--------------------------------------------------------------------------------
Q6DE07_XENLA/176-277--------------------------------------------------------------------------------
KLH20_XENLA/165-267--------------------------------------------------------------------------------
ENC2_XENLA/149-251--------------------------------------------------------------------------------
Q6DJ21_XENTR/98-200--------------------------------------------------------------------------------
Q6GKZ1_DROME/195-298--------------------------------------------------------------------------------
Q6GML3_DANRE/142-241--------------------------------------------------------------------------------
Q6GNW3_XENLA/149-250--------------------------------------------------------------------------------
Q6GNZ5_XENLA/139-241--------------------------------------------------------------------------------
KLH23_MOUSE/139-240--------------------------------------------------------------------------------
KLH30_XENLA/135-237--------------------------------------------------------------------------------
Q6IQ87_DANRE/140-242--------------------------------------------------------------------------------
Q6IR89_XENLA/133-234--------------------------------------------------------------------------------
Q6NRT8_XENLA/167-269--------------------------------------------------------------------------------
KLH21_DANRE/140-242--------------------------------------------------------------------------------
Q6P4N4_XENTR/135-237--------------------------------------------------------------------------------
Q6PFE1_MOUSE/275-376--------------------------------------------------------------------------------
Q6PGA3_MOUSE/223-324--------------------------------------------------------------------------------
KLH31_DANRE/173-274--------------------------------------------------------------------------------
KLH17_MOUSE/192-294--------------------------------------------------------------------------------
Q6TEQ2_DANRE/149-251--------------------------------------------------------------------------------
Q7KSF5_DROME/192-294--------------------------------------------------------------------------------
Q7SYC4_DANRE/168-270--------------------------------------------------------------------------------
Q7SYD2_DANRE/136-238--------------------------------------------------------------------------------
Q7ZVF7_DANRE/174-276--------------------------------------------------------------------------------
KLH29_MOUSE/216-318--------------------------------------------------------------------------------
Q86BQ6_DROME/179-281--------------------------------------------------------------------------------
Q8AW66_DANRE/167-269--------------------------------------------------------------------------------
KLH26_MOUSE/156-257--------------------------------------------------------------------------------
KLH38_MOUSE/136-237--------------------------------------------------------------------------------
KLH31_MOUSE/172-273--------------------------------------------------------------------------------
Q8C2V5_MOUSE/142-240--------------------------------------------------------------------------------
Q8CCY1_MOUSE/317-418--------------------------------------------------------------------------------
Q8IH95_DROME/224-325--------------------------------------------------------------------------------
Q8IQ29_DROME/76-176--------------------------------------------------------------------------------
Q8JTM8_LSDV/120-221--------------------------------------------------------------------------------
Q8JTN6_LSDV/122-221--------------------------------------------------------------------------------
Q8JU17_LSDV/121-220--------------------------------------------------------------------------------
Q8N4I8_HUMAN/152-254--------------------------------------------------------------------------------
KLH36_HUMAN/148-250--------------------------------------------------------------------------------
ENC2_MOUSE/149-251--------------------------------------------------------------------------------
Q8V3G0_SWPV1/125-224--------------------------------------------------------------------------------
KLH28_MOUSE/137-239--------------------------------------------------------------------------------
BTBDH_MOUSE/169-269--------------------------------------------------------------------------------
Q9DHH3_YLDV/126-228--------------------------------------------------------------------------------
Q9Q8G2_MYXVL/125-224--------------------------------------------------------------------------------
Q9VGE5_DROME/143-245--------------------------------------------------------------------------------
Q9VK21_DROME/187-289--------------------------------------------------------------------------------
Q9W2S3_DROME/150-248--------------------------------------------------------------------------------
Q9W4L5_DROME/162-265--------------------------------------------------------------------------------
Q9W4S3_DROME/306-407--------------------------------------------------------------------------------
Q9W6R2_TAKRU/75-177--------------------------------------------------------------------------------
Q9W6R3_TAKRU/76-178--------------------------------------------------------------------------------

PF00651

BACH2_MOUSE/27-133--------------------------------------------------------------------------------
BAT47_CAEEL/8-109--------------------------------------------------------------------------------
ZBT17_MOUSE/14-114--------------------------------------------------------------------------------
Y2060_ARATH/201-303--------------------------------------------------------------------------------
Y2060_ARATH/341-455--------------------------------------------------------------------------------
O61795_CAEEL/46-153--------------------------------------------------------------------------------
O76610_CAEEL/10-114--------------------------------------------------------------------------------
KELC_DROME/147-253--------------------------------------------------------------------------------
KLH21_HUMAN/25-133--------------------------------------------------------------------------------
O45927_CAEEL/141-251--------------------------------------------------------------------------------
BTBD2_HUMAN/112-217--------------------------------------------------------------------------------
O44818_CAEEL/140-244--------------------------------------------------------------------------------
P91543_CAEEL/104-200--------------------------------------------------------------------------------
Q18030_CAEEL/118-226--------------------------------------------------------------------------------
LZTR1_HUMAN/655-764--------------------------------------------------------------------------------
BAB1_DROME/117-222--------------------------------------------------------------------------------
O17112_CAEEL/140-243--------------------------------------------------------------------------------
BACH1_MOUSE/24-130--------------------------------------------------------------------------------
BCL6_HUMAN/22-129--------------------------------------------------------------------------------
BRC1_DROME/22-127--------------------------------------------------------------------------------
CALI_BOVIN/18-128--------------------------------------------------------------------------------
ENC1_HUMAN/36-144--------------------------------------------------------------------------------
GAGA_DROME/24-129--------------------------------------------------------------------------------
GCL_DROME/56-166--------------------------------------------------------------------------------
ZBT48_HUMAN/16-119--------------------------------------------------------------------------------
KBTBA_HUMAN/23-130--------------------------------------------------------------------------------
LOLA2_DROME/22-127--------------------------------------------------------------------------------
KAISO_HUMAN/22-125--------------------------------------------------------------------------------
ZF161_HUMAN/26-132--------------------------------------------------------------------------------
ABTB2_RAT/832-945--------------------------------------------------------------------------------
ZBTB5_HUMAN/14-123--------------------------------------------------------------------------------
ZBT7B_HUMAN/24-145--------------------------------------------------------------------------------
ZBT22_HUMAN/47-151--------------------------------------------------------------------------------
O16313_CAEEL/54-165--------------------------------------------------------------------------------
O16566_CAEEL/67-171--------------------------------------------------------------------------------
O16736_CAEEL/144-248--------------------------------------------------------------------------------
O16740_CAEEL/129-232--------------------------------------------------------------------------------
O16741_CAEEL/157-256--------------------------------------------------------------------------------
O16744_CAEEL/132-231--------------------------------------------------------------------------------
O17197_CAEEL/70-174--------------------------------------------------------------------------------
O17253_CAEEL/135-236--------------------------------------------------------------------------------
O17297_CAEEL/141-242--------------------------------------------------------------------------------
O18147_CAEEL/41-148--------------------------------------------------------------------------------
BPM3_ARATH/184-303--------------------------------------------------------------------------------
Y2045_ARATH/15-132--------------------------------------------------------------------------------
NACC1_RAT/20-124--------------------------------------------------------------------------------
ZBT43_HUMAN/23-126--------------------------------------------------------------------------------
O44815_CAEEL/142-246--------------------------------------------------------------------------------
O44817_CAEEL/137-241--------------------------------------------------------------------------------
O44905_CAEEL/112-216--------------------------------------------------------------------------------
O45594_CAEEL/135-238--------------------------------------------------------------------------------
O61932_CAEEL/71-176--------------------------------------------------------------------------------
O72730_COWPX/30-136--------------------------------------------------------------------------------
KBTB2_CWPXG/16-123--------------------------------------------------------------------------------
B2RG49_HUMAN/24-131--------------------------------------------------------------------------------
BTB1_SCHPO/608-735--------------------------------------------------------------------------------
O76568_CAEEL/144-248--------------------------------------------------------------------------------
O77168_APIME/26-132--------------------------------------------------------------------------------
KEN_DROME/23-131--------------------------------------------------------------------------------
Y4409_ARATH/15-129--------------------------------------------------------------------------------
BCL6B_MOUSE/28-135--------------------------------------------------------------------------------
O89076_MOUSE/10-122--------------------------------------------------------------------------------
ZBT7A_CHICK/24-131--------------------------------------------------------------------------------
P90538_DICDI/34-143--------------------------------------------------------------------------------
ZN238_HUMAN/14-121--------------------------------------------------------------------------------
ZBTB6_HUMAN/23-127--------------------------------------------------------------------------------
Q17523_CAEEL/126-230--------------------------------------------------------------------------------
Q17782_CAEEL/193-300--------------------------------------------------------------------------------
Q19838_CAEEL/23-130--------------------------------------------------------------------------------
Q20183_CAEEL/184-293--------------------------------------------------------------------------------
BAT38_CAEEL/220-325--------------------------------------------------------------------------------
Q21899_CAEEL/143-245--------------------------------------------------------------------------------
MMD4_DROME/22-128--------------------------------------------------------------------------------
ABRU_DROME/93-198--------------------------------------------------------------------------------
Q24455_DROME/25-131--------------------------------------------------------------------------------
CP190_DROME/20-127--------------------------------------------------------------------------------
HIC1_CHICK/53-160--------------------------------------------------------------------------------
MEL26_CAEEL/191-300--------------------------------------------------------------------------------
SPOP_HUMAN/190-297--------------------------------------------------------------------------------
TTKB_DROME/23-127--------------------------------------------------------------------------------
KBTB1_VACCW/11-118--------------------------------------------------------------------------------
VC04_SWPVK/8-116--------------------------------------------------------------------------------
VC13_SWPVK/16-119--------------------------------------------------------------------------------
VF03_VACCC/18-120--------------------------------------------------------------------------------
VMT8_MYXVL/6-112--------------------------------------------------------------------------------
ZBT39_HUMAN/20-126--------------------------------------------------------------------------------
ZBT24_HUMAN/27-133--------------------------------------------------------------------------------
BTB3_SCHPO/157-262--------------------------------------------------------------------------------
BTB3_SCHPO/296-405--------------------------------------------------------------------------------
YIA1_YEAST/264-390--------------------------------------------------------------------------------
BAT15_CAEEL/139-243--------------------------------------------------------------------------------
BAT42_CAEEL/208-319--------------------------------------------------------------------------------
BAT43_CAEEL/255-368--------------------------------------------------------------------------------
YR47_CAEEL/45-146--------------------------------------------------------------------------------
ZBT16_HUMAN/24-126--------------------------------------------------------------------------------
ZBT25_HUMAN/14-119--------------------------------------------------------------------------------

PF11822

Q29D48_DROPS/298-606......LRGHFYSM.....SGLFRCGRCFSCVTNTMKSYVSC.........VSS....................NIRLNR
Q4Q8A2_LEIMA/20-417WPPAGLPATHSGQLTLPLTCGLRWCRLCATLFDEGELDRLGRTSQL.SGPECPAQSGPTSHTGDKAHHASIAGRRWCVGP
Q0IFU1_AEDAE/236-536......LRGHYATL.....VGMFRCLRCGKFLTQTVSTFIHC.........VPQ....................NIRLNR
Q383Z9_TRYB2/26-376...........GRP.....SSLRWCGLCGALFDQQELQHIERRYKNVRLPVCPRV..................TKNSVGH
A4HGL7_LEIBR/10-407CASVGLPATHSGELTLSPTCSLRWCRLCATLFDEGEVYRLGRTSRL.SSPECPGQYMPSRPAGGGAHYAATAGPTLRVGP
Q4RN30_TETNG/1-302......RDSP.GNA.....STLYRCALCLKLLTKDTEKKISC.........VPG....................KINVDS
A7S8V2_NEMVE/1-302......ICSP.ASA.....CTMYRCSACHRLITQESQERLRC.........ALS....................RMTIDH
Q4DXB1_TRYCC/30-401...........RRA.....GGLRWCQYCGVLFDQHELLRLERSGKNVKPALCPRL..................TKSSIGT
K1841_XENLA/146-448......ADSP.ANA.....STLFRCCLCKRLLTKEAEKKIDC.........LPG....................RISIDQ

PF03931

SKP1_HUMAN/2-67--------------------------------------------------------------------------------
O77430_DROME/2-66--------------------------------------------------------------------------------
ASK16_ARATH/4-64--------------------------------------------------------------------------------
SKP1_EMENI/4-65--------------------------------------------------------------------------------
O75863_HUMAN/17-82--------------------------------------------------------------------------------
SKP1A_ARATH/4-63--------------------------------------------------------------------------------
ELOC_HUMAN/17-79--------------------------------------------------------------------------------
O82463_NICCL/2-61--------------------------------------------------------------------------------
Q21367_CAEEL/8-70--------------------------------------------------------------------------------
Q23153_CAEEL/69-131--------------------------------------------------------------------------------
ELOC_YEAST/4-66--------------------------------------------------------------------------------
ASK19_ARATH/4-64--------------------------------------------------------------------------------
ASK12_ARATH/4-64--------------------------------------------------------------------------------
ASK14_ARATH/4-64--------------------------------------------------------------------------------
SKP1B_ARATH/5-64--------------------------------------------------------------------------------
Q89374_PBCV1/1-61--------------------------------------------------------------------------------
SKP1A_DICDI/2-63--------------------------------------------------------------------------------

PF02214

KCNA5_MOUSE/113-204--------------------------------------------------------------------------------
KCNAL_DROME/43-132--------------------------------------------------------------------------------
KCNS1_MOUSE/21-120--------------------------------------------------------------------------------
KCNS3_HUMAN/17-116--------------------------------------------------------------------------------
Q18986_CAEEL/7-97--------------------------------------------------------------------------------
KCNA7_MOUSE/47-138--------------------------------------------------------------------------------
O76266_HIRME/83-174--------------------------------------------------------------------------------
P91557_CAEEL/6-93--------------------------------------------------------------------------------
O17001_CAEEL/21-113--------------------------------------------------------------------------------
O16612_CAEEL/6-96--------------------------------------------------------------------------------
O16709_CAEEL/9-96--------------------------------------------------------------------------------
Q26094_POLPE/45-136--------------------------------------------------------------------------------
O16706_CAEEL/5-95--------------------------------------------------------------------------------
KCNA2_CANFA/35-126--------------------------------------------------------------------------------
KCNB1_HUMAN/33-132--------------------------------------------------------------------------------
KCNC1_HUMAN/10-104--------------------------------------------------------------------------------
P91564_CAEEL/5-95--------------------------------------------------------------------------------
Q25376_LOLOP/42-133--------------------------------------------------------------------------------
KCNAW_DROME/12-102--------------------------------------------------------------------------------
KCNS2_MOUSE/19-118--------------------------------------------------------------------------------
O16613_CAEEL/8-96--------------------------------------------------------------------------------
O97045_HALRO/72-171--------------------------------------------------------------------------------
Q26095_POLPE/56-146--------------------------------------------------------------------------------
Q09658_CAEEL/92-183--------------------------------------------------------------------------------
KCA10_HUMAN/88-179--------------------------------------------------------------------------------
O76889_DROME/24-115--------------------------------------------------------------------------------
KCND1_HUMAN/42-131--------------------------------------------------------------------------------
KCNAS_DROME/99-190--------------------------------------------------------------------------------
KCND3_RAT/42-131--------------------------------------------------------------------------------
Q20381_CAEEL/28-127--------------------------------------------------------------------------------
KCNG1_HUMAN/65-164--------------------------------------------------------------------------------
Q26597_SCHMA/53-144--------------------------------------------------------------------------------
Q16976_APLCA/66-156--------------------------------------------------------------------------------
P91784_POLPE/46-135--------------------------------------------------------------------------------
P91783_POLPE/39-128--------------------------------------------------------------------------------
O16711_CAEEL/8-100--------------------------------------------------------------------------------
KCNV1_RAT/44-153--------------------------------------------------------------------------------
Q26344_APLSP/158-258--------------------------------------------------------------------------------
Q18776_CAEEL/84-176--------------------------------------------------------------------------------
KCNAB_DROME/279-378--------------------------------------------------------------------------------
P91556_CAEEL/2-87--------------------------------------------------------------------------------
O16630_CAEEL/2-90--------------------------------------------------------------------------------
P91256_CAEEL/38-137--------------------------------------------------------------------------------
BACD2_MOUSE/30-120--------------------------------------------------------------------------------
O16708_CAEEL/99-187--------------------------------------------------------------------------------
KCNG2_CHICK/59-158--------------------------------------------------------------------------------

PF07707

KBTBC_MOUSE/131-233--------------------------------------------------------------------------------
Q7PXP7_ANOGA/170-272--------------------------------------------------------------------------------
KLHL8_MOUSE/178-280--------------------------------------------------------------------------------
O61795_CAEEL/158-260--------------------------------------------------------------------------------
KLHL6_MOUSE/172-274--------------------------------------------------------------------------------
KLH18_HUMAN/140-242--------------------------------------------------------------------------------
KELC_DROME/258-360--------------------------------------------------------------------------------
BTBDH_XENLA/161-261--------------------------------------------------------------------------------
KBTB3_HUMAN/150-252--------------------------------------------------------------------------------
KELC_ANOST/201-303--------------------------------------------------------------------------------
GAN_MOUSE/134-236--------------------------------------------------------------------------------
Q8JIM0_DANRE/160-262--------------------------------------------------------------------------------
Q7PMB5_ANOGA/179-281--------------------------------------------------------------------------------
Q7QHD7_ANOGA/175-277--------------------------------------------------------------------------------
Q7QI84_ANOGA/148-248--------------------------------------------------------------------------------
KBTB8_HUMAN/152-254--------------------------------------------------------------------------------
KLH12_XENLA/131-233--------------------------------------------------------------------------------
Q7Q1T2_ANOGA/174-276--------------------------------------------------------------------------------
KLH21_HUMAN/138-239--------------------------------------------------------------------------------
ENC1_HUMAN/149-251--------------------------------------------------------------------------------
O16313_CAEEL/170-270--------------------------------------------------------------------------------
O18147_CAEEL/153-255--------------------------------------------------------------------------------
KBTBA_HUMAN/135-237--------------------------------------------------------------------------------
KBTB1_CWPXG/123-222--------------------------------------------------------------------------------
O72746_COWPX/102-200--------------------------------------------------------------------------------
KLHL2_HUMAN/158-260--------------------------------------------------------------------------------
IPP_MOUSE/139-241--------------------------------------------------------------------------------
KEAP1_RAT/184-286--------------------------------------------------------------------------------
P87597_COWPX/101-204--------------------------------------------------------------------------------
Q6DE07_XENLA/176-277--------------------------------------------------------------------------------
KLH20_XENLA/165-267--------------------------------------------------------------------------------
ENC2_XENLA/149-251--------------------------------------------------------------------------------
Q6DJ21_XENTR/98-200--------------------------------------------------------------------------------
Q6GKZ1_DROME/195-298--------------------------------------------------------------------------------
Q6GML3_DANRE/142-241--------------------------------------------------------------------------------
Q6GNW3_XENLA/149-250--------------------------------------------------------------------------------
Q6GNZ5_XENLA/139-241--------------------------------------------------------------------------------
KLH23_MOUSE/139-240--------------------------------------------------------------------------------
KLH30_XENLA/135-237--------------------------------------------------------------------------------
Q6IQ87_DANRE/140-242--------------------------------------------------------------------------------
Q6IR89_XENLA/133-234--------------------------------------------------------------------------------
Q6NRT8_XENLA/167-269--------------------------------------------------------------------------------
KLH21_DANRE/140-242--------------------------------------------------------------------------------
Q6P4N4_XENTR/135-237--------------------------------------------------------------------------------
Q6PFE1_MOUSE/275-376--------------------------------------------------------------------------------
Q6PGA3_MOUSE/223-324--------------------------------------------------------------------------------
KLH31_DANRE/173-274--------------------------------------------------------------------------------
KLH17_MOUSE/192-294--------------------------------------------------------------------------------
Q6TEQ2_DANRE/149-251--------------------------------------------------------------------------------
Q7KSF5_DROME/192-294--------------------------------------------------------------------------------
Q7SYC4_DANRE/168-270--------------------------------------------------------------------------------
Q7SYD2_DANRE/136-238--------------------------------------------------------------------------------
Q7ZVF7_DANRE/174-276--------------------------------------------------------------------------------
KLH29_MOUSE/216-318--------------------------------------------------------------------------------
Q86BQ6_DROME/179-281--------------------------------------------------------------------------------
Q8AW66_DANRE/167-269--------------------------------------------------------------------------------
KLH26_MOUSE/156-257--------------------------------------------------------------------------------
KLH38_MOUSE/136-237--------------------------------------------------------------------------------
KLH31_MOUSE/172-273--------------------------------------------------------------------------------
Q8C2V5_MOUSE/142-240--------------------------------------------------------------------------------
Q8CCY1_MOUSE/317-418--------------------------------------------------------------------------------
Q8IH95_DROME/224-325--------------------------------------------------------------------------------
Q8IQ29_DROME/76-176--------------------------------------------------------------------------------
Q8JTM8_LSDV/120-221--------------------------------------------------------------------------------
Q8JTN6_LSDV/122-221--------------------------------------------------------------------------------
Q8JU17_LSDV/121-220--------------------------------------------------------------------------------
Q8N4I8_HUMAN/152-254--------------------------------------------------------------------------------
KLH36_HUMAN/148-250--------------------------------------------------------------------------------
ENC2_MOUSE/149-251--------------------------------------------------------------------------------
Q8V3G0_SWPV1/125-224--------------------------------------------------------------------------------
KLH28_MOUSE/137-239--------------------------------------------------------------------------------
BTBDH_MOUSE/169-269--------------------------------------------------------------------------------
Q9DHH3_YLDV/126-228--------------------------------------------------------------------------------
Q9Q8G2_MYXVL/125-224--------------------------------------------------------------------------------
Q9VGE5_DROME/143-245--------------------------------------------------------------------------------
Q9VK21_DROME/187-289--------------------------------------------------------------------------------
Q9W2S3_DROME/150-248--------------------------------------------------------------------------------
Q9W4L5_DROME/162-265--------------------------------------------------------------------------------
Q9W4S3_DROME/306-407--------------------------------------------------------------------------------
Q9W6R2_TAKRU/75-177--------------------------------------------------------------------------------
Q9W6R3_TAKRU/76-178--------------------------------------------------------------------------------

PF00651

BACH2_MOUSE/27-133--------------------------------------------------------------------------------
BAT47_CAEEL/8-109--------------------------------------------------------------------------------
ZBT17_MOUSE/14-114--------------------------------------------------------------------------------
Y2060_ARATH/201-303--------------------------------------------------------------------------------
Y2060_ARATH/341-455--------------------------------------------------------------------------------
O61795_CAEEL/46-153--------------------------------------------------------------------------------
O76610_CAEEL/10-114--------------------------------------------------------------------------------
KELC_DROME/147-253--------------------------------------------------------------------------------
KLH21_HUMAN/25-133--------------------------------------------------------------------------------
O45927_CAEEL/141-251--------------------------------------------------------------------------------
BTBD2_HUMAN/112-217--------------------------------------------------------------------------------
O44818_CAEEL/140-244--------------------------------------------------------------------------------
P91543_CAEEL/104-200--------------------------------------------------------------------------------
Q18030_CAEEL/118-226--------------------------------------------------------------------------------
LZTR1_HUMAN/655-764--------------------------------------------------------------------------------
BAB1_DROME/117-222--------------------------------------------------------------------------------
O17112_CAEEL/140-243--------------------------------------------------------------------------------
BACH1_MOUSE/24-130--------------------------------------------------------------------------------
BCL6_HUMAN/22-129--------------------------------------------------------------------------------
BRC1_DROME/22-127--------------------------------------------------------------------------------
CALI_BOVIN/18-128--------------------------------------------------------------------------------
ENC1_HUMAN/36-144--------------------------------------------------------------------------------
GAGA_DROME/24-129--------------------------------------------------------------------------------
GCL_DROME/56-166--------------------------------------------------------------------------------
ZBT48_HUMAN/16-119--------------------------------------------------------------------------------
KBTBA_HUMAN/23-130--------------------------------------------------------------------------------
LOLA2_DROME/22-127--------------------------------------------------------------------------------
KAISO_HUMAN/22-125--------------------------------------------------------------------------------
ZF161_HUMAN/26-132--------------------------------------------------------------------------------
ABTB2_RAT/832-945--------------------------------------------------------------------------------
ZBTB5_HUMAN/14-123--------------------------------------------------------------------------------
ZBT7B_HUMAN/24-145--------------------------------------------------------------------------------
ZBT22_HUMAN/47-151--------------------------------------------------------------------------------
O16313_CAEEL/54-165--------------------------------------------------------------------------------
O16566_CAEEL/67-171--------------------------------------------------------------------------------
O16736_CAEEL/144-248--------------------------------------------------------------------------------
O16740_CAEEL/129-232--------------------------------------------------------------------------------
O16741_CAEEL/157-256--------------------------------------------------------------------------------
O16744_CAEEL/132-231--------------------------------------------------------------------------------
O17197_CAEEL/70-174--------------------------------------------------------------------------------
O17253_CAEEL/135-236--------------------------------------------------------------------------------
O17297_CAEEL/141-242--------------------------------------------------------------------------------
O18147_CAEEL/41-148--------------------------------------------------------------------------------
BPM3_ARATH/184-303--------------------------------------------------------------------------------
Y2045_ARATH/15-132--------------------------------------------------------------------------------
NACC1_RAT/20-124--------------------------------------------------------------------------------
ZBT43_HUMAN/23-126--------------------------------------------------------------------------------
O44815_CAEEL/142-246--------------------------------------------------------------------------------
O44817_CAEEL/137-241--------------------------------------------------------------------------------
O44905_CAEEL/112-216--------------------------------------------------------------------------------
O45594_CAEEL/135-238--------------------------------------------------------------------------------
O61932_CAEEL/71-176--------------------------------------------------------------------------------
O72730_COWPX/30-136--------------------------------------------------------------------------------
KBTB2_CWPXG/16-123--------------------------------------------------------------------------------
B2RG49_HUMAN/24-131--------------------------------------------------------------------------------
BTB1_SCHPO/608-735--------------------------------------------------------------------------------
O76568_CAEEL/144-248--------------------------------------------------------------------------------
O77168_APIME/26-132--------------------------------------------------------------------------------
KEN_DROME/23-131--------------------------------------------------------------------------------
Y4409_ARATH/15-129--------------------------------------------------------------------------------
BCL6B_MOUSE/28-135--------------------------------------------------------------------------------
O89076_MOUSE/10-122--------------------------------------------------------------------------------
ZBT7A_CHICK/24-131--------------------------------------------------------------------------------
P90538_DICDI/34-143--------------------------------------------------------------------------------
ZN238_HUMAN/14-121--------------------------------------------------------------------------------
ZBTB6_HUMAN/23-127--------------------------------------------------------------------------------
Q17523_CAEEL/126-230--------------------------------------------------------------------------------
Q17782_CAEEL/193-300--------------------------------------------------------------------------------
Q19838_CAEEL/23-130--------------------------------------------------------------------------------
Q20183_CAEEL/184-293--------------------------------------------------------------------------------
BAT38_CAEEL/220-325--------------------------------------------------------------------------------
Q21899_CAEEL/143-245--------------------------------------------------------------------------------
MMD4_DROME/22-128--------------------------------------------------------------------------------
ABRU_DROME/93-198--------------------------------------------------------------------------------
Q24455_DROME/25-131--------------------------------------------------------------------------------
CP190_DROME/20-127--------------------------------------------------------------------------------
HIC1_CHICK/53-160--------------------------------------------------------------------------------
MEL26_CAEEL/191-300--------------------------------------------------------------------------------
SPOP_HUMAN/190-297--------------------------------------------------------------------------------
TTKB_DROME/23-127--------------------------------------------------------------------------------
KBTB1_VACCW/11-118--------------------------------------------------------------------------------
VC04_SWPVK/8-116--------------------------------------------------------------------------------
VC13_SWPVK/16-119--------------------------------------------------------------------------------
VF03_VACCC/18-120--------------------------------------------------------------------------------
VMT8_MYXVL/6-112--------------------------------------------------------------------------------
ZBT39_HUMAN/20-126--------------------------------------------------------------------------------
ZBT24_HUMAN/27-133--------------------------------------------------------------------------------
BTB3_SCHPO/157-262--------------------------------------------------------------------------------
BTB3_SCHPO/296-405--------------------------------------------------------------------------------
YIA1_YEAST/264-390--------------------------------------------------------------------------------
BAT15_CAEEL/139-243--------------------------------------------------------------------------------
BAT42_CAEEL/208-319--------------------------------------------------------------------------------
BAT43_CAEEL/255-368--------------------------------------------------------------------------------
YR47_CAEEL/45-146--------------------------------------------------------------------------------
ZBT16_HUMAN/24-126--------------------------------------------------------------------------------
ZBT25_HUMAN/14-119--------------------------------------------------------------------------------

PF11822

Q29D48_DROPS/298-606WGQLMSHHVRDP..................NWDLNLY..IMQLFKELKSWRKVYWKLWGSCHYLYCCTCEAHFPVYQMN.
Q4Q8A2_LEIMA/20-417RGEVFTTHAAARHATPVILEAPPALKGSEVSASTLAAEAASPFTAELERWA...WRIIGAIRYVGCRRCFHLVSLLDVSK
Q0IFU1_AEDAE/236-536WGQLISSHMKDP..................SWNITSY..VASLHKELRSWRKVYWRLWGHCHFLYCAICDTHFAVYQML.
Q383Z9_TRYB2/26-376RGELLKTHVASK..................QEANIKFPPLSWHEKEVEAWA...WRVVGSLYLFVCRRCNCCVSLTNTTC
A4HGL7_LEIBR/10-407RGEVFTTHSAARHAMPIVLEAPPRLKSGGTSASTTAAEAASPFTAELERWA...WRIIGASRYVGCRRCLHLVSLLDVSQ
Q4RN30_TETNG/1-302RGEIIYTHNRQK..................CWDVHEY..ITGLYEELKSWVLVYWRIWGTINYLTCSRCQQVFMCTELT.
A7S8V2_NEMVE/1-302RGRVTFSHVRDP..................NWDVNEY..IQGLREKFKSWRDVYWRLWGSVNILYCYRCGEYFPCCELG.
Q4DXB1_TRYCC/30-401RGEILITHVASK..................QPANLAFPSISWGDEHVERWA...WRIIGATYFFLCRQCNHLVSLTDTTT
K1841_XENLA/146-448HGNIVYLHIRDK..................SWDVHEY..LISLFEELKSWRDVYWRLWGTINWLTCSRCKQSFLCNESS.

PF03931

SKP1_HUMAN/2-67--------------------------------------------------------------------------------
O77430_DROME/2-66--------------------------------------------------------------------------------
ASK16_ARATH/4-64--------------------------------------------------------------------------------
SKP1_EMENI/4-65--------------------------------------------------------------------------------
O75863_HUMAN/17-82--------------------------------------------------------------------------------
SKP1A_ARATH/4-63--------------------------------------------------------------------------------
ELOC_HUMAN/17-79--------------------------------------------------------------------------------
O82463_NICCL/2-61--------------------------------------------------------------------------------
Q21367_CAEEL/8-70--------------------------------------------------------------------------------
Q23153_CAEEL/69-131--------------------------------------------------------------------------------
ELOC_YEAST/4-66--------------------------------------------------------------------------------
ASK19_ARATH/4-64--------------------------------------------------------------------------------
ASK12_ARATH/4-64--------------------------------------------------------------------------------
ASK14_ARATH/4-64--------------------------------------------------------------------------------
SKP1B_ARATH/5-64--------------------------------------------------------------------------------
Q89374_PBCV1/1-61--------------------------------------------------------------------------------
SKP1A_DICDI/2-63--------------------------------------------------------------------------------

PF02214

KCNA5_MOUSE/113-204--------------------------------------------------------------------------------
KCNAL_DROME/43-132--------------------------------------------------------------------------------
KCNS1_MOUSE/21-120--------------------------------------------------------------------------------
KCNS3_HUMAN/17-116--------------------------------------------------------------------------------
Q18986_CAEEL/7-97--------------------------------------------------------------------------------
KCNA7_MOUSE/47-138--------------------------------------------------------------------------------
O76266_HIRME/83-174--------------------------------------------------------------------------------
P91557_CAEEL/6-93--------------------------------------------------------------------------------
O17001_CAEEL/21-113--------------------------------------------------------------------------------
O16612_CAEEL/6-96--------------------------------------------------------------------------------
O16709_CAEEL/9-96--------------------------------------------------------------------------------
Q26094_POLPE/45-136--------------------------------------------------------------------------------
O16706_CAEEL/5-95--------------------------------------------------------------------------------
KCNA2_CANFA/35-126--------------------------------------------------------------------------------
KCNB1_HUMAN/33-132--------------------------------------------------------------------------------
KCNC1_HUMAN/10-104--------------------------------------------------------------------------------
P91564_CAEEL/5-95--------------------------------------------------------------------------------
Q25376_LOLOP/42-133--------------------------------------------------------------------------------
KCNAW_DROME/12-102--------------------------------------------------------------------------------
KCNS2_MOUSE/19-118--------------------------------------------------------------------------------
O16613_CAEEL/8-96--------------------------------------------------------------------------------
O97045_HALRO/72-171--------------------------------------------------------------------------------
Q26095_POLPE/56-146--------------------------------------------------------------------------------
Q09658_CAEEL/92-183--------------------------------------------------------------------------------
KCA10_HUMAN/88-179--------------------------------------------------------------------------------
O76889_DROME/24-115--------------------------------------------------------------------------------
KCND1_HUMAN/42-131--------------------------------------------------------------------------------
KCNAS_DROME/99-190--------------------------------------------------------------------------------
KCND3_RAT/42-131--------------------------------------------------------------------------------
Q20381_CAEEL/28-127--------------------------------------------------------------------------------
KCNG1_HUMAN/65-164--------------------------------------------------------------------------------
Q26597_SCHMA/53-144--------------------------------------------------------------------------------
Q16976_APLCA/66-156--------------------------------------------------------------------------------
P91784_POLPE/46-135--------------------------------------------------------------------------------
P91783_POLPE/39-128--------------------------------------------------------------------------------
O16711_CAEEL/8-100--------------------------------------------------------------------------------
KCNV1_RAT/44-153--------------------------------------------------------------------------------
Q26344_APLSP/158-258--------------------------------------------------------------------------------
Q18776_CAEEL/84-176--------------------------------------------------------------------------------
KCNAB_DROME/279-378--------------------------------------------------------------------------------
P91556_CAEEL/2-87--------------------------------------------------------------------------------
O16630_CAEEL/2-90--------------------------------------------------------------------------------
P91256_CAEEL/38-137--------------------------------------------------------------------------------
BACD2_MOUSE/30-120--------------------------------------------------------------------------------
O16708_CAEEL/99-187--------------------------------------------------------------------------------
KCNG2_CHICK/59-158--------------------------------------------------------------------------------

PF07707

KBTBC_MOUSE/131-233--------------------------------------------------------------------------------
Q7PXP7_ANOGA/170-272--------------------------------------------------------------------------------
KLHL8_MOUSE/178-280--------------------------------------------------------------------------------
O61795_CAEEL/158-260--------------------------------------------------------------------------------
KLHL6_MOUSE/172-274--------------------------------------------------------------------------------
KLH18_HUMAN/140-242--------------------------------------------------------------------------------
KELC_DROME/258-360--------------------------------------------------------------------------------
BTBDH_XENLA/161-261--------------------------------------------------------------------------------
KBTB3_HUMAN/150-252--------------------------------------------------------------------------------
KELC_ANOST/201-303--------------------------------------------------------------------------------
GAN_MOUSE/134-236--------------------------------------------------------------------------------
Q8JIM0_DANRE/160-262--------------------------------------------------------------------------------
Q7PMB5_ANOGA/179-281--------------------------------------------------------------------------------
Q7QHD7_ANOGA/175-277--------------------------------------------------------------------------------
Q7QI84_ANOGA/148-248--------------------------------------------------------------------------------
KBTB8_HUMAN/152-254--------------------------------------------------------------------------------
KLH12_XENLA/131-233--------------------------------------------------------------------------------
Q7Q1T2_ANOGA/174-276--------------------------------------------------------------------------------
KLH21_HUMAN/138-239--------------------------------------------------------------------------------
ENC1_HUMAN/149-251--------------------------------------------------------------------------------
O16313_CAEEL/170-270--------------------------------------------------------------------------------
O18147_CAEEL/153-255--------------------------------------------------------------------------------
KBTBA_HUMAN/135-237--------------------------------------------------------------------------------
KBTB1_CWPXG/123-222--------------------------------------------------------------------------------
O72746_COWPX/102-200--------------------------------------------------------------------------------
KLHL2_HUMAN/158-260--------------------------------------------------------------------------------
IPP_MOUSE/139-241--------------------------------------------------------------------------------
KEAP1_RAT/184-286--------------------------------------------------------------------------------
P87597_COWPX/101-204--------------------------------------------------------------------------------
Q6DE07_XENLA/176-277--------------------------------------------------------------------------------
KLH20_XENLA/165-267--------------------------------------------------------------------------------
ENC2_XENLA/149-251--------------------------------------------------------------------------------
Q6DJ21_XENTR/98-200--------------------------------------------------------------------------------
Q6GKZ1_DROME/195-298--------------------------------------------------------------------------------
Q6GML3_DANRE/142-241--------------------------------------------------------------------------------
Q6GNW3_XENLA/149-250--------------------------------------------------------------------------------
Q6GNZ5_XENLA/139-241--------------------------------------------------------------------------------
KLH23_MOUSE/139-240--------------------------------------------------------------------------------
KLH30_XENLA/135-237--------------------------------------------------------------------------------
Q6IQ87_DANRE/140-242--------------------------------------------------------------------------------
Q6IR89_XENLA/133-234--------------------------------------------------------------------------------
Q6NRT8_XENLA/167-269--------------------------------------------------------------------------------
KLH21_DANRE/140-242--------------------------------------------------------------------------------
Q6P4N4_XENTR/135-237--------------------------------------------------------------------------------
Q6PFE1_MOUSE/275-376--------------------------------------------------------------------------------
Q6PGA3_MOUSE/223-324--------------------------------------------------------------------------------
KLH31_DANRE/173-274--------------------------------------------------------------------------------
KLH17_MOUSE/192-294--------------------------------------------------------------------------------
Q6TEQ2_DANRE/149-251--------------------------------------------------------------------------------
Q7KSF5_DROME/192-294--------------------------------------------------------------------------------
Q7SYC4_DANRE/168-270--------------------------------------------------------------------------------
Q7SYD2_DANRE/136-238--------------------------------------------------------------------------------
Q7ZVF7_DANRE/174-276--------------------------------------------------------------------------------
KLH29_MOUSE/216-318--------------------------------------------------------------------------------
Q86BQ6_DROME/179-281--------------------------------------------------------------------------------
Q8AW66_DANRE/167-269--------------------------------------------------------------------------------
KLH26_MOUSE/156-257--------------------------------------------------------------------------------
KLH38_MOUSE/136-237--------------------------------------------------------------------------------
KLH31_MOUSE/172-273--------------------------------------------------------------------------------
Q8C2V5_MOUSE/142-240--------------------------------------------------------------------------------
Q8CCY1_MOUSE/317-418--------------------------------------------------------------------------------
Q8IH95_DROME/224-325--------------------------------------------------------------------------------
Q8IQ29_DROME/76-176--------------------------------------------------------------------------------
Q8JTM8_LSDV/120-221--------------------------------------------------------------------------------
Q8JTN6_LSDV/122-221--------------------------------------------------------------------------------
Q8JU17_LSDV/121-220--------------------------------------------------------------------------------
Q8N4I8_HUMAN/152-254--------------------------------------------------------------------------------
KLH36_HUMAN/148-250--------------------------------------------------------------------------------
ENC2_MOUSE/149-251--------------------------------------------------------------------------------
Q8V3G0_SWPV1/125-224--------------------------------------------------------------------------------
KLH28_MOUSE/137-239--------------------------------------------------------------------------------
BTBDH_MOUSE/169-269--------------------------------------------------------------------------------
Q9DHH3_YLDV/126-228--------------------------------------------------------------------------------
Q9Q8G2_MYXVL/125-224--------------------------------------------------------------------------------
Q9VGE5_DROME/143-245--------------------------------------------------------------------------------
Q9VK21_DROME/187-289--------------------------------------------------------------------------------
Q9W2S3_DROME/150-248--------------------------------------------------------------------------------
Q9W4L5_DROME/162-265--------------------------------------------------------------------------------
Q9W4S3_DROME/306-407--------------------------------------------------------------------------------
Q9W6R2_TAKRU/75-177--------------------------------------------------------------------------------
Q9W6R3_TAKRU/76-178--------------------------------------------------------------------------------

PF00651

BACH2_MOUSE/27-133----------------------------------------
BAT47_CAEEL/8-109----------------------------------------
ZBT17_MOUSE/14-114----------------------------------------
Y2060_ARATH/201-303----------------------------------------
Y2060_ARATH/341-455----------------------------------------
O61795_CAEEL/46-153----------------------------------------
O76610_CAEEL/10-114----------------------------------------
KELC_DROME/147-253----------------------------------------
KLH21_HUMAN/25-133----------------------------------------
O45927_CAEEL/141-251----------------------------------------
BTBD2_HUMAN/112-217----------------------------------------
O44818_CAEEL/140-244----------------------------------------
P91543_CAEEL/104-200----------------------------------------
Q18030_CAEEL/118-226----------------------------------------
LZTR1_HUMAN/655-764----------------------------------------
BAB1_DROME/117-222----------------------------------------
O17112_CAEEL/140-243----------------------------------------
BACH1_MOUSE/24-130----------------------------------------
BCL6_HUMAN/22-129----------------------------------------
BRC1_DROME/22-127----------------------------------------
CALI_BOVIN/18-128----------------------------------------
ENC1_HUMAN/36-144----------------------------------------
GAGA_DROME/24-129----------------------------------------
GCL_DROME/56-166----------------------------------------
ZBT48_HUMAN/16-119----------------------------------------
KBTBA_HUMAN/23-130----------------------------------------
LOLA2_DROME/22-127----------------------------------------
KAISO_HUMAN/22-125----------------------------------------
ZF161_HUMAN/26-132----------------------------------------
ABTB2_RAT/832-945----------------------------------------
ZBTB5_HUMAN/14-123----------------------------------------
ZBT7B_HUMAN/24-145----------------------------------------
ZBT22_HUMAN/47-151----------------------------------------
O16313_CAEEL/54-165----------------------------------------
O16566_CAEEL/67-171----------------------------------------
O16736_CAEEL/144-248----------------------------------------
O16740_CAEEL/129-232----------------------------------------
O16741_CAEEL/157-256----------------------------------------
O16744_CAEEL/132-231----------------------------------------
O17197_CAEEL/70-174----------------------------------------
O17253_CAEEL/135-236----------------------------------------
O17297_CAEEL/141-242----------------------------------------
O18147_CAEEL/41-148----------------------------------------
BPM3_ARATH/184-303----------------------------------------
Y2045_ARATH/15-132----------------------------------------
NACC1_RAT/20-124----------------------------------------
ZBT43_HUMAN/23-126----------------------------------------
O44815_CAEEL/142-246----------------------------------------
O44817_CAEEL/137-241----------------------------------------
O44905_CAEEL/112-216----------------------------------------
O45594_CAEEL/135-238----------------------------------------
O61932_CAEEL/71-176----------------------------------------
O72730_COWPX/30-136----------------------------------------
KBTB2_CWPXG/16-123----------------------------------------
B2RG49_HUMAN/24-131----------------------------------------
BTB1_SCHPO/608-735----------------------------------------
O76568_CAEEL/144-248----------------------------------------
O77168_APIME/26-132----------------------------------------
KEN_DROME/23-131----------------------------------------
Y4409_ARATH/15-129----------------------------------------
BCL6B_MOUSE/28-135----------------------------------------
O89076_MOUSE/10-122----------------------------------------
ZBT7A_CHICK/24-131----------------------------------------
P90538_DICDI/34-143----------------------------------------
ZN238_HUMAN/14-121----------------------------------------
ZBTB6_HUMAN/23-127----------------------------------------
Q17523_CAEEL/126-230----------------------------------------
Q17782_CAEEL/193-300----------------------------------------
Q19838_CAEEL/23-130----------------------------------------
Q20183_CAEEL/184-293----------------------------------------
BAT38_CAEEL/220-325----------------------------------------
Q21899_CAEEL/143-245----------------------------------------
MMD4_DROME/22-128----------------------------------------
ABRU_DROME/93-198----------------------------------------
Q24455_DROME/25-131----------------------------------------
CP190_DROME/20-127----------------------------------------
HIC1_CHICK/53-160----------------------------------------
MEL26_CAEEL/191-300----------------------------------------
SPOP_HUMAN/190-297----------------------------------------
TTKB_DROME/23-127----------------------------------------
KBTB1_VACCW/11-118----------------------------------------
VC04_SWPVK/8-116----------------------------------------
VC13_SWPVK/16-119----------------------------------------
VF03_VACCC/18-120----------------------------------------
VMT8_MYXVL/6-112----------------------------------------
ZBT39_HUMAN/20-126----------------------------------------
ZBT24_HUMAN/27-133----------------------------------------
BTB3_SCHPO/157-262----------------------------------------
BTB3_SCHPO/296-405----------------------------------------
YIA1_YEAST/264-390----------------------------------------
BAT15_CAEEL/139-243----------------------------------------
BAT42_CAEEL/208-319----------------------------------------
BAT43_CAEEL/255-368----------------------------------------
YR47_CAEEL/45-146----------------------------------------
ZBT16_HUMAN/24-126----------------------------------------
ZBT25_HUMAN/14-119----------------------------------------

PF11822

Q29D48_DROPS/298-606.WCRFHPGAPQFLGPV...DTAGPSGRFACC.GQQAFRYE
Q4Q8A2_LEIMA/20-417HRCSELPKKFSFPDNVAE.DVKYLFLWFDYCAEHNVYERE
Q0IFU1_AEDAE/236-536.WCQYHPEQPQFLGPAAEGRVAGPAGRYPCC.GKQAYRYE
Q383Z9_TRYB2/26-376HSCPGGTANFSRAEGVSSEDADALLAWFDLA....KNLYP
A4HGL7_LEIBR/10-407HRCSELPKKYSSPDNESE.DVSYLVRWFDYCAEHHVYERE
Q4RN30_TETNG/1-302.HCKYHPVSVSYPGMGTDRGWHG.AGLYPCC.NQRALRFD
A7S8V2_NEMVE/1-302.HCRYHTSSADFGSHKGTI.....VGVYPCC.QQRVLPFD
Q4DXB1_TRYCC/30-401HGCSGGVAAFSCVEGGNRADSEALLAWYDYS....KYLYV
K1841_XENLA/146-448.HCQYHPEPAVYPGAASSLDSPG.TGIYPCC.NQKVLRFD

PF03931

SKP1_HUMAN/2-67----------------------------------------
O77430_DROME/2-66----------------------------------------
ASK16_ARATH/4-64----------------------------------------
SKP1_EMENI/4-65----------------------------------------
O75863_HUMAN/17-82----------------------------------------
SKP1A_ARATH/4-63----------------------------------------
ELOC_HUMAN/17-79----------------------------------------
O82463_NICCL/2-61----------------------------------------
Q21367_CAEEL/8-70----------------------------------------
Q23153_CAEEL/69-131----------------------------------------
ELOC_YEAST/4-66----------------------------------------
ASK19_ARATH/4-64----------------------------------------
ASK12_ARATH/4-64----------------------------------------
ASK14_ARATH/4-64----------------------------------------
SKP1B_ARATH/5-64----------------------------------------
Q89374_PBCV1/1-61----------------------------------------
SKP1A_DICDI/2-63----------------------------------------

PF02214

KCNA5_MOUSE/113-204----------------------------------------
KCNAL_DROME/43-132----------------------------------------
KCNS1_MOUSE/21-120----------------------------------------
KCNS3_HUMAN/17-116----------------------------------------
Q18986_CAEEL/7-97----------------------------------------
KCNA7_MOUSE/47-138----------------------------------------
O76266_HIRME/83-174----------------------------------------
P91557_CAEEL/6-93----------------------------------------
O17001_CAEEL/21-113----------------------------------------
O16612_CAEEL/6-96----------------------------------------
O16709_CAEEL/9-96----------------------------------------
Q26094_POLPE/45-136----------------------------------------
O16706_CAEEL/5-95----------------------------------------
KCNA2_CANFA/35-126----------------------------------------
KCNB1_HUMAN/33-132----------------------------------------
KCNC1_HUMAN/10-104----------------------------------------
P91564_CAEEL/5-95----------------------------------------
Q25376_LOLOP/42-133----------------------------------------
KCNAW_DROME/12-102----------------------------------------
KCNS2_MOUSE/19-118----------------------------------------
O16613_CAEEL/8-96----------------------------------------
O97045_HALRO/72-171----------------------------------------
Q26095_POLPE/56-146----------------------------------------
Q09658_CAEEL/92-183----------------------------------------
KCA10_HUMAN/88-179----------------------------------------
O76889_DROME/24-115----------------------------------------
KCND1_HUMAN/42-131----------------------------------------
KCNAS_DROME/99-190----------------------------------------
KCND3_RAT/42-131----------------------------------------
Q20381_CAEEL/28-127----------------------------------------
KCNG1_HUMAN/65-164----------------------------------------
Q26597_SCHMA/53-144----------------------------------------
Q16976_APLCA/66-156----------------------------------------
P91784_POLPE/46-135----------------------------------------
P91783_POLPE/39-128----------------------------------------
O16711_CAEEL/8-100----------------------------------------
KCNV1_RAT/44-153----------------------------------------
Q26344_APLSP/158-258----------------------------------------
Q18776_CAEEL/84-176----------------------------------------
KCNAB_DROME/279-378----------------------------------------
P91556_CAEEL/2-87----------------------------------------
O16630_CAEEL/2-90----------------------------------------
P91256_CAEEL/38-137----------------------------------------
BACD2_MOUSE/30-120----------------------------------------
O16708_CAEEL/99-187----------------------------------------
KCNG2_CHICK/59-158----------------------------------------

PF07707

KBTBC_MOUSE/131-233----------------------------------------
Q7PXP7_ANOGA/170-272----------------------------------------
KLHL8_MOUSE/178-280----------------------------------------
O61795_CAEEL/158-260----------------------------------------
KLHL6_MOUSE/172-274----------------------------------------
KLH18_HUMAN/140-242----------------------------------------
KELC_DROME/258-360----------------------------------------
BTBDH_XENLA/161-261----------------------------------------
KBTB3_HUMAN/150-252----------------------------------------
KELC_ANOST/201-303----------------------------------------
GAN_MOUSE/134-236----------------------------------------
Q8JIM0_DANRE/160-262----------------------------------------
Q7PMB5_ANOGA/179-281----------------------------------------
Q7QHD7_ANOGA/175-277----------------------------------------
Q7QI84_ANOGA/148-248----------------------------------------
KBTB8_HUMAN/152-254----------------------------------------
KLH12_XENLA/131-233----------------------------------------
Q7Q1T2_ANOGA/174-276----------------------------------------
KLH21_HUMAN/138-239----------------------------------------
ENC1_HUMAN/149-251----------------------------------------
O16313_CAEEL/170-270----------------------------------------
O18147_CAEEL/153-255----------------------------------------
KBTBA_HUMAN/135-237----------------------------------------
KBTB1_CWPXG/123-222----------------------------------------
O72746_COWPX/102-200----------------------------------------
KLHL2_HUMAN/158-260----------------------------------------
IPP_MOUSE/139-241----------------------------------------
KEAP1_RAT/184-286----------------------------------------
P87597_COWPX/101-204----------------------------------------
Q6DE07_XENLA/176-277----------------------------------------
KLH20_XENLA/165-267----------------------------------------
ENC2_XENLA/149-251----------------------------------------
Q6DJ21_XENTR/98-200----------------------------------------
Q6GKZ1_DROME/195-298----------------------------------------
Q6GML3_DANRE/142-241----------------------------------------
Q6GNW3_XENLA/149-250----------------------------------------
Q6GNZ5_XENLA/139-241----------------------------------------
KLH23_MOUSE/139-240----------------------------------------
KLH30_XENLA/135-237----------------------------------------
Q6IQ87_DANRE/140-242----------------------------------------
Q6IR89_XENLA/133-234----------------------------------------
Q6NRT8_XENLA/167-269----------------------------------------
KLH21_DANRE/140-242----------------------------------------
Q6P4N4_XENTR/135-237----------------------------------------
Q6PFE1_MOUSE/275-376----------------------------------------
Q6PGA3_MOUSE/223-324----------------------------------------
KLH31_DANRE/173-274----------------------------------------
KLH17_MOUSE/192-294----------------------------------------
Q6TEQ2_DANRE/149-251----------------------------------------
Q7KSF5_DROME/192-294----------------------------------------
Q7SYC4_DANRE/168-270----------------------------------------
Q7SYD2_DANRE/136-238----------------------------------------
Q7ZVF7_DANRE/174-276----------------------------------------
KLH29_MOUSE/216-318----------------------------------------
Q86BQ6_DROME/179-281----------------------------------------
Q8AW66_DANRE/167-269----------------------------------------
KLH26_MOUSE/156-257----------------------------------------
KLH38_MOUSE/136-237----------------------------------------
KLH31_MOUSE/172-273----------------------------------------
Q8C2V5_MOUSE/142-240----------------------------------------
Q8CCY1_MOUSE/317-418----------------------------------------
Q8IH95_DROME/224-325----------------------------------------
Q8IQ29_DROME/76-176----------------------------------------
Q8JTM8_LSDV/120-221----------------------------------------
Q8JTN6_LSDV/122-221----------------------------------------
Q8JU17_LSDV/121-220----------------------------------------
Q8N4I8_HUMAN/152-254----------------------------------------
KLH36_HUMAN/148-250----------------------------------------
ENC2_MOUSE/149-251----------------------------------------
Q8V3G0_SWPV1/125-224----------------------------------------
KLH28_MOUSE/137-239----------------------------------------
BTBDH_MOUSE/169-269----------------------------------------
Q9DHH3_YLDV/126-228----------------------------------------
Q9Q8G2_MYXVL/125-224----------------------------------------
Q9VGE5_DROME/143-245----------------------------------------
Q9VK21_DROME/187-289----------------------------------------
Q9W2S3_DROME/150-248----------------------------------------
Q9W4L5_DROME/162-265----------------------------------------
Q9W4S3_DROME/306-407----------------------------------------
Q9W6R2_TAKRU/75-177----------------------------------------
Q9W6R3_TAKRU/76-178----------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window