Sequence alignment for CL0033

PF00651

BAT47_CAEEL/8-109--------------------------------------------FDKSMEK....YTDVVLVVK.....QERFYVSRAIL
ZBT17_MOUSE/14-114--------------------------------------------LNQQRQLG..LLCDCTFVVD.....GVDFKAHKAVL
Y2060_ARATH/201-303--------------------------------------------LGNFLESW..QLSDTVFLVGE...EEMDVPAHKVIL
Y2060_ARATH/341-455--------------------------------------------LVKLYSTG..EYSDIKIYLSD...HSLTFQSHKVIL
O61795_CAEEL/46-153--------------------------------------------LGGLKNRD..VLCDVTLICG.....WKRINAHRVVL
O76610_CAEEL/10-114--------------------------------------------FDHQMEP....YSDVVLVAS.....QEWFHVSKAIL
KELC_DROME/147-253--------------------------------------------MNEMRKQK..QLCDVILVADD.....VEIHAHRMVL
KLH21_HUMAN/25-133--------------------------------------------LSQLRAER..KFLDVTLEAAG....GRDFPAHRAVL
O45927_CAEEL/141-251--------------------------------------------YIDFARPI.PIFSDTIVLVD.....GVKFHVNRMIL
BTBD2_HUMAN/112-217--------------------------------------------NNEVLC.......DVHFLVGKG.LSSQRIPAHRFVL
O44818_CAEEL/140-244--------------------------------------------FERSNE....EFSDVILAVGD.....KKFFVLRKFL
Q18030_CAEEL/118-226--------------------------------------------FSQPFDS.....SNVVLKVED.....EEFHVHTFVL
LZTR1_HUMAN/655-764--------------------------------------------MKAYLEGAGAEFCDITLLLD.....GHPRPAHKAIL
BAB1_DROME/117-222--------------------------------------------FDQLLQNE..CFVDVTLACD.....GRSMKAHKMVL
O17112_CAEEL/140-243--------------------------------------------FLPSEKN......DAFLVIGE.....RKLHVNKAFL
BACH1_MOUSE/24-130--------------------------------------------LNDQRKKD..VLCDVTVLVE.....GQRFRAHRSVL
BCL6_HUMAN/22-129--------------------------------------------LNRLRSRD..ILTDVVIVVS.....REQFRAHKTVL
BRC1_DROME/22-127--------------------------------------------FENLRDDE..AFVDVTLACE.....GRSIKAHRVVL
CALI_BOVIN/18-128--------------------------------------------LNKQRKRK..EYWDIALTVD.....HHVFFAHRNVL
ENC1_HUMAN/36-144--------------------------------------------LNLLRQQR..LFTDVLLHAGN.....RTFPCHRAVL
GAGA_DROME/24-129--------------------------------------------IQLLRCHG..DLVDCTLAAG.....GRSFPAHKIVL
GCL_DROME/56-166--------------------------------------------YKALFKEE..KNSDVAVMALD......KVWHLHKVY
ZBT48_HUMAN/16-119--------------------------------------------LNKQREKG..QYCDATLDVG.....GLVFKAHWSVL
KLH41_HUMAN/23-130--------------------------------------------LKDLLDEK..KFIDCTLKAGD.....KSLPCHRLIL
LOLA2_DROME/22-127--------------------------------------------FDTLLENE..TLVDCTLAAE.....GKFLKAHKVVL
KAISO_HUMAN/22-125--------------------------------------------LNEQRGHG..LFCDVTVIVED.....RKFRAHKNIL
ZBT14_HUMAN/26-132--------------------------------------------LNEQRLEG..EFCDIAIVVE.....DVKFRAHRCVL
ABTB2_RAT/832-945--------------------------------------------LDPHFLNN.KEMSDVTFLVEG.....KLFYAHKVLL
ZBTB5_HUMAN/14-123--------------------------------------------LNYQRLHG..QLCDCVIVVG.....NRHFKAHRSVL
ZBT7B_HUMAN/24-145--------------------------------------------LNEQRQLG..HLCDLTIRTQ.....GLEYRTHRAVL
ZBT22_HUMAN/47-151--------------------------------------------LNQQRLQG..QLCDVSIRVQ.....GREFRAHRAVL
O16313_CAEEL/54-165--------------------------------------------FDEIFTST..DHSDVTLVLDD...G.TEFAAHRLIL
O16566_CAEEL/67-171--------------------------------------------FDESNE....EFSDVVVAVGN...E.K.FYVLKVYL
O16736_CAEEL/144-248--------------------------------------------FDESME....EFSDVVLLVGE...K.K.FYVLRKYL
O16740_CAEEL/129-232--------------------------------------------FMPSQKT......DAILMIGG.....EKLHVNKAFL
O17197_CAEEL/70-174--------------------------------------------NLPSDKN......DAILLVEE.....QQLHVNKAFL
O17253_CAEEL/135-236--------------------------------------------FEPSRKH......DAVLLIGE.....KKLHVNKAFL
O17297_CAEEL/141-242--------------------------------------------FDKSAE....EFSDVVLEVGG...K.K.FYVLKKFL
O18147_CAEEL/41-148--------------------------------------------FNELRSKC..QLCDVALLVE.....NRKLSAHKVIL
BPM3_ARATH/184-303--------------------------------------------LKDLLDSE..VGCDIAFQVG.....DETYKAHKLIL
Y2045_ARATH/15-132--------------------------------------------KKLLNEQW...QADVRLKAGDS.DETTSIFAHKLVL
NACC1_RAT/20-124--------------------------------------------LNEQRLQG..LYCDVSVVVK.....GHAFKAHRAVL
ZBT43_HUMAN/23-126--------------------------------------------LNQQRQQG..QLCDVSIVVQ.....GHIFRAHKAVL
O44815_CAEEL/142-246--------------------------------------------FEKSEE....QFSDVILAVED...E.T.FHVLKKFL
O44817_CAEEL/137-241--------------------------------------------FDKSNK....KFSDVILAIED...E.K.FYVLKKFL
O44905_CAEEL/112-216--------------------------------------------FNHPYKNL.....GLVAFEYV.....FCLHYNPRFL
O45594_CAEEL/135-238--------------------------------------------FLPSHEN......DAILVIGK.....KKLHVCKAFL
O61932_CAEEL/71-176--------------------------------------------LRDDYSGA.RELCDVTLRFDD.....ESIPAHWVML
BTB1_SCHPO/608-735--------------------------------------------LTSYENYK.QSFSDVTIYCG.....TSMFHSHKFIL
O76568_CAEEL/144-248--------------------------------------------FEKSNE....EFSDVVLAVGD...K.E.FFVLKQFL
KEN_DROME/23-131--------------------------------------------IGAAFRGE..HPADLTIVCEN....KVKLHAHKLVL
Y4409_ARATH/15-129--------------------------------------------LKVLKEQ....QVDVRLMARDS.EKDAAISAHKRIL
BCL6B_MOUSE/28-135--------------------------------------------LNELRLRG..ILTDVTLLVG.....GQPLRAHKAVL
ZBT7A_CHICK/24-131--------------------------------------------LNEQRNNG..LLCDVVILVE.....GQEFPTHRSVL
ZBT18_HUMAN/14-121--------------------------------------------LSEQRHQG..FLCDCTVLVG.....DAQFRAHRAVL
ZBTB6_HUMAN/23-127--------------------------------------------MNLLRQQN..LFCDVSIYIN.....DTEFQGHKVIL
Q17523_CAEEL/126-230--------------------------------------------FIDFEKKS..KWLDVLIRSED...GKKMIYANSGIL
Q17782_CAEEL/193-300--------------------------------------------LENLYRSG..KHADFTLVVEE.....RELKAHKAIL
Q19838_CAEEL/23-130--------------------------------------------LQAKRRAGDFSTCDVKIQLKT.....GFDMVHSVVI
Q20183_CAEEL/184-293--------------------------------------------CNETLA.......DVFFVVGIDDSR.QRIPAHKFVL
BAT38_CAEEL/220-325--------------------------------------------FGAMQTN....ICDMTLVINK.....QKLFVNKAYL
Q21899_CAEEL/143-245--------------------------------------------FDVLPEEE.....NALLKVED.....RLIRVNKRYL
MMD4_DROME/22-128--------------------------------------------FHESLCRG..DLVDVSLAAE.....GQIVKAHRLVL
ABRU_DROME/93-198--------------------------------------------FRHLRDEE..DFVDVTLACD.....ERSFTAHKVVL
CP190_DROME/20-127--------------------------------------------LQNFFNKT..DYCDLTLQFRD....NSQLKVHRLVL
HIC1_CHICK/53-160--------------------------------------------LNTQRTKG..FLCDVIIVVQ.....NALFRAHKNIL
MEL26_CAEEL/191-300--------------------------------------------YQRLFSQ......ELLCDFAIN.VNGKIIRAHKAVL
SPOP_HUMAN/190-297--------------------------------------------LGGLWEN...SRFTDCCLCVA...G.QEFQAHKAIL
TTKB_DROME/23-127--------------------------------------------FDQLLHAE..TFTDVTLAVE.....GQHLKAHKMVL
KBTB1_VACCW/11-118--------------------------------------------INGFRNSG..RFCDISIVIND.....ERINAHKLIL
VMT8_MYXVL/6-112--------------------------------------------LYKLFLKG..KLCDVEIVAE.....GKSIRAHRLVL
ZBT39_HUMAN/20-126--------------------------------------------LNKCRLSE..TMCDVTIVVG.....SRSFPAHKAVL
ZBT24_HUMAN/27-133--------------------------------------------FEDQRKKG..FLCDITLIVEN.....VHFRAHKALL
BTB3_SCHPO/157-262--------------------------------------------LLSNSALH..FTTDIVFAGQY...G..RVFAHKFYL
BTB3_SCHPO/296-405--------------------------------------------LNQPSDQY..SFHDAYLQSYT.....HRYPVHRAIM
YIA1_YEAST/264-390--------------------------------------------VFSLMNCP..AYPDVQLMVKNR.NGAIRIYPCHLAV
BAT15_CAEEL/139-243--------------------------------------------FDESEK....RFSDVILVVGD...E.K.FYVLKLFL
BAT42_CAEEL/208-319--------------------------------------------NNRSMWED.ELFTDCVIHVGN.....KHIKAHRCIL
BAT43_CAEEL/255-368--------------------------------------------MYGLFDNKQFSDFTLVCKSDLG.SPTQTFHIHKAIL
YR47_CAEEL/45-146--------------------------------------------FEETLSP......TVTLVLRN...N.EEVIFDRYLL
ZBT16_HUMAN/24-126--------------------------------------------ANQMRLAG..TLCDVVIMVDS.....QEFHAHRTVL
ZBT25_HUMAN/14-119--------------------------------------------LNMQREFG..FLCDCTVAIG.....DVYFKAHRAVL
A1Z8A5_DROME/25-125--------------------------------------------FQQLREDL..SFVDVTLSCE.....HGSLKAHKVVL
F7A721_CALJA/24-127--------------------------------------------LNEQRHDG..LLCDVLLVVQ.....EQEYRTHRSVL
K7EJ49_HUMAN/67-178--------------------------------------------MNELRLSQ..QLCDVTLQVKYQDAPAAQFMAHKVVL
BACH2_MOUSE/27-132--------------------------------------------LNDQRKKD..ILCDVTLIVE.....RKEFRAHRAVL
Q54RA9_DICDI/42-142--------------------------------------------.......K..KYTDIKIKCG.....GQIFPTHRIIL
Q8V3S6_SWPV1/8-114--------------------------------------------LHDFFKHG..IMCDIKIVSIE...NNKTISAHRLIL

PF03931

Q21367_CAEEL/8-70--------------------------------------------------------PVFKIQSCD----GQVFAVEDWF-
SKP1_HUMAN/2-67--------------------------------------------------------PSIKLQSSD----GEIFEVDVEI-
O77430_DROME/2-66--------------------------------------------------------PSIKLQSSD----EEIFDTDIQI-
ASK16_ARATH/4-64--------------------------------------------------------NKIVLTSSD----DESFEVEEAV-
ASK14_ARATH/4-64--------------------------------------------------------NKIVLSSSD----GESFEVEEAV-
ASK19_ARATH/4-64--------------------------------------------------------KKIVLTSSD----GESFKVEEVV-
SKP1A_ARATH/4-63--------------------------------------------------------KKIVLKSSD----GESFEVEEAV-
SKP1B_ARATH/5-64--------------------------------------------------------RKITLKSSD----GENFEIDEAV-
ASK12_ARATH/4-64--------------------------------------------------------KMIVLMSSD----GQSFEVEEAV-
Q89374_PBCV1/1-61--------------------------------------------------------MSIVFITSD----FHRIEADKNV-
ELOC_YEAST/4-66--------------------------------------------------------DFVTLVSKD----DKEYEISRSA-
SKP1A_DICDI/2-63--------------------------------------------------------SLVKLESSD----EKVFEIEKEI-
SKP1_EMENI/4-65--------------------------------------------------------KMLVMTSND----GKNIEVPRDV-

PF11822

Q29D48_DROPS/298-606---------------------------------------------------------VVIHVCDEVKNTSRDFTCPQHLL
Q4Q8A2_LEIMA/20-417---------------------------------------------------------VEITVQDPATHHERPFLCALGPL
Q0IFU1_AEDAE/236-536---------------------------------------------------------VIIHVCDEVKGTSRDFSCPQKLL
Q383Z9_TRYB2/26-376---------------------------------------------------------VEVSVYDKQSNEMRVFRCDLHLL
A4HGL7_LEIBR/10-407---------------------------------------------------------AEITVQDPVTHNERTFLCALGPL
A7S8V2_NEMVE/1-302---------------------------------------------------------MVIHVCDESKNLKQDFTCPRDLL
Q4DXB1_TRYCC/30-401---------------------------------------------------------VEVTVYDKLLNEVRTFRCHQHLL
F7EPV1_XENTR/146-448---------------------------------------------------------MVIHVCDEAKNLKEDFVCPRDLL
H3DIA0_TETNG/1-303---------------------------------------------------------MVIHVCDETKNLKQDFTCPRDLL

PF02214

KCNSK_CAEEL/135-238----------------------------------------------------------VTINVS-----GMRFQTFESTL
KCNA5_MOUSE/113-204----------------------------------------------------------VLINIS-----GLRFETQLGTL
KCNAL_DROME/43-132----------------------------------------------------------LLINVS-----GRRFETWRNTL
KCNS1_MOUSE/21-120----------------------------------------------------------LRVNVG-----GVRRLLSARAL
KCNS3_HUMAN/17-116----------------------------------------------------------VNLNVG-----GFKQSVDQSTL
Q18986_CAEEL/7-97----------------------------------------------------------VKLDVG-----GKIFKTTIFTL
KCNA7_MOUSE/47-138----------------------------------------------------------LVLNVA-----GLRFETRARTL
P91557_CAEEL/6-93----------------------------------------------------------IKLNVG-----GKEFSTTEATL
O17001_CAEEL/21-113----------------------------------------------------------VNLNVG-----GRIFATSCNTL
O16612_CAEEL/6-96----------------------------------------------------------VKLNVG-----GTVFETLKSTL
O16709_CAEEL/9-96----------------------------------------------------------IRLNIG-----GKRFDTHKSTL
O16706_CAEEL/5-95----------------------------------------------------------VQLDVG-----GTIFKTSKSTL
KCNB1_HUMAN/33-132----------------------------------------------------------VRLNVG-----GLAHEVLWRTL
KCNC1_HUMAN/10-104----------------------------------------------------------IVINVG-----GTRHQTYRSTL
P91564_CAEEL/5-95----------------------------------------------------------IKLDVG-----GTIFKTSKDTL
KCNAW_DROME/12-102----------------------------------------------------------VVLNVG-----GIRHETYKATL
KCNS2_MOUSE/19-118----------------------------------------------------------IRINVG-----GFKRRLRSHTL
O16613_CAEEL/8-96----------------------------------------------------------VKLNVG-----GTVFVTLKSTL
KCA10_HUMAN/88-179----------------------------------------------------------VIINIA-----GLRFETQLRTL
KCND1_HUMAN/42-131----------------------------------------------------------LVVNVS-----GRRFETWKNTL
KCND3_RAT/42-131----------------------------------------------------------IVLNVS-----GRRFQTWRTTL
Q20381_CAEEL/28-127----------------------------------------------------------VFVNVG-----GRRARLNSDII
KCNG1_HUMAN/65-164----------------------------------------------------------IIINVG-----GIKYSLPWTTL
Q26597_SCHMA/53-144----------------------------------------------------------LVINVS-----GLRFETQAQTV
O16711_CAEEL/8-100----------------------------------------------------------IRLNIG-----GTIFETSKSTL
KCNV1_RAT/44-153----------------------------------------------------------LTVNVG-----GSRFVLSQQAL
Q18776_CAEEL/84-176----------------------------------------------------------VRLNVG-----GKVFQTTRSTL
KCNAB_DROME/279-378----------------------------------------------------------VSINVG-----GVRHEVLWRTL
O16630_CAEEL/2-90----------------------------------------------------------IRLDVG-----GRKFSTNRSTL
P91256_CAEEL/38-137----------------------------------------------------------LKLNIG-----GTSFMILIDAI
BACD2_MOUSE/30-120----------------------------------------------------------VQLNVG-----GSLYYTTVRAL
O16708_CAEEL/99-187----------------------------------------------------------VNLNVG-----GKPFATLKTTL
KCNG2_CHICK/59-158----------------------------------------------------------VIINVG-----GIKYKVPWTTL
B4L763_DROMO/24-111----------------------------------------------------------VKLNVG-----GTYFLTTKTTL

PF16017

E7F994_DANRE/70-299RQHSFTRPNTKGEYEIAEGIGASIFRIILDFYRVGILHCPEGVSLAELREACDYLCINFDYNTVRCRDLSALLHELSNDG
G3W7V3_SARHA/151-380REYNFTRPNEKGEFEIAEGISATVFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFDFNTIKCQDLIYLLFRLSQLL
W4ZCZ0_STRPU/50-279VDHTMTRPNDKGEYEVAHGISAEIFSSILDFYKVGCIRCPPSVSIQDLREACDYLLIPFTEDTIKCKNLRCLLHEISNDG
E9JD94_SOLIN/154-383SGVEYAQPNERGEYEVAEGISAMVFRAILEYYKGGVIRCPPTVSVQELREACDYLLVPFDASTVKCQNLRGLLHELSNEG
A9UPC4_MONBE/63-292.RNETVQPNEDGDYVIDHNVSSEAFAAILDFYRHGRIQCPPTVSVSELHAACDFFCIPFSEASVHCEDVAKFLHELSNEG
E4XC39_OIKDI/75-305PGAVSVQLNEHGEYVFTENISAPVFKAILDYYTGGIIQCPPGISLAELRETCDYFLIPFNSETVQCENLADMMHELSNLG
F7AXE7_CIOIN/162-392DDRGWTKPNADGEYEIRELVSAYVFKALLEYYTNGVVKCPPGVSVRDLRTACEYFLIPFNYQTIKCNNLGTFMHEISNDG
T1L0V7_TETUR/82-310.ASSITRPNDKGEFEVAEGITSHCFRAILEYYKSGVIHCPPSVPITELREACDYLLIPFDATTIKCQNLGGLLHEISNEG
W5KS29_ASTMX/198-429REHNFTRPNEKGEYEVAEGISSTVFRAILDYYKSGIIRCPDGISIPELREACDYLCISFDYSTIKCRDLNILLHLIGPYL
E9BXQ6_CAPO3/355-585SAFDMCKTNTTGEYEIEQPVSPAIFRAVLDYYATGLIVCPENEHVGDLREACDYFLLPFDMSTVRVQDLGELMHEMSNIG
K1QX87_CRAGI/168-393MENNLIRPNERGEYEVADGISACVFRAILDYYKSGMIRCPPSVTVRELREACDYLLIPFDANTVKCQNLRGLLHELSNEG
H2KQY4_CLOSI/945-1176EQSQLLRHPPDILLAQNSNISAQLFRAILDYYLLGYMLCPPGVSVQELKETCDYFMIPFNHRTVRCSNLRAFLHELSNDG
A7S9A9_NEMVE/133-363SNNDYTTRNDKGEVEVAQGISASVFKCILDFYKKGIINCPPSVSIPELREACDYLLIPFNATNVKCQNLRELLHELSNEG
H3FGC5_PRIPA/9-239EGADMVTPNANDEFEVAEGLSANCFRAVLEYYTSGVMRCPPSVSVAELREACDYLLIPFNAETVKSHNLRALLHELSNEG
B3SBZ6_TRIAD/36-264.ESSITKSNENGEYEVSKGVSSVVFKSILGFYKYGYISCPPSVSIKELKEACDYFLIPFDFKTIKCQNLKDLLHELSNDG
F2U9A9_SALR5/300-529SSLERSRVNERGDYVIDCPVSADAFSAIIKYYRTGKVECPATTPVSELHEACNFFLIPFNHTSIDCDNVGKLLHELSNKG
G3HKB9_CRIGR/153-382REYNFTRPNEKGEYEIAEGISAAVFRTVLDYYKTGVINCPDGISIPDLRDTCDYLCINFDSNTIRCQDLSALLHELSNDG
F6TDG6_XENTR/196-425REHNFTRPNDKGEYEVAEGISSTVFRAILDYYKTGIIRCPDGISIPELREACDYLCISFDYSTIKCRDLSALMHELSNDG
T1G141_HELRO/46-274.ENNLTRMNERGEYRVADGISSTIFRAVLDYYKTGTIRCPPSVSIQELKEACDYLLLPFNAASIKCQNLRGLLHELSNDG
I1FT20_AMPQE/71-291....EIKPNDSGEYRILNGISSHIFRAVLDYYRTGVLPCPSSESVHEVREACDYLLIPFNEKTVKTNNLRDFLNELSNDG
E5SRV9_TRISP/693-924RDHNLVKPNEHGEYIVADGISAGCFRAILDYFKKGIMHCPPNVSVAELREACDYLLVPFTAENVDCVDLRGLLHELSNEG

PF07707

IPP_MOUSE/139-241-------------------------------------------------CIGLFQFSEQI.ACHDLLEFTENYIHVHFLE
KBTBC_MOUSE/131-233-------------------------------------------------CIGIYYFAKQI.GAEDLSDQSKKYLYQHFAE
Q7PXP7_ANOGA/170-272-------------------------------------------------CLGFSLFAEQQ.GCTALLKLATAYTCQHFQQ
KLHL8_MOUSE/178-280-------------------------------------------------CLAVRAFAESH.NRIDLMDMADQYACEHFTE
O61795_CAEEL/158-260-------------------------------------------------CLGIRAFADTH.SCKELLSSADEFALKNFSR
KLHL6_MOUSE/172-274-------------------------------------------------CIGILRLADTH.SLDSLKMQVQSYIIQNFVQ
KLH18_HUMAN/140-242-------------------------------------------------CLGVRQFAETM.MCAVLYDAANSFIHQHFVE
KELC_DROME/258-360-------------------------------------------------CLGIREFADIH.ACVELLNYAETYIEQHFNE
KBTB3_HUMAN/150-252-------------------------------------------------CLQLLSISDSY.GSTSLFDHALHFVQHHFSL
GAN_MOUSE/134-236-------------------------------------------------CIGIRDFALHY.CLHHVHYLATEYLETHFRD
Q7PMB5_ANOGA/179-281-------------------------------------------------ALGILRFAEAH.NCRQLAEVAANFVHSNFPK
Q7QHD7_ANOGA/175-277-------------------------------------------------VLGIRQFADTL.GCSKLIVSADRYIHQHFSK
Q7QI84_ANOGA/148-248-------------------------------------------------VCAILDAARLF.ALDGLTAVCHSFMDRNAAD
KBTB8_HUMAN/152-254-------------------------------------------------SIGVFIFADHY.GHQELGDRSKEYIRKKFLC
Q7Q1T2_ANOGA/174-276-------------------------------------------------CLGIRSFADAH.SCKELHSRSHRYALQNFQQ
KLH21_HUMAN/138-239-------------------------------------------------CLDMQDFAEAF.SCSGLASAAQRFILRHVGE
ENC1_HUMAN/149-251-------------------------------------------------CLGMLLLSDAH.QCTKLYELSWRMCLSNFQT
O16313_CAEEL/170-270-------------------------------------------------LCSIFNAAYFF.QFTDLIDYCMQYSDKHADQ
O18147_CAEEL/153-255-------------------------------------------------ALSIREFCKMMCVEEKITEMTDDYIQKHFMA
KLH41_HUMAN/135-237-------------------------------------------------CLAILRLGLLL.DCPRLAISAREFVSDRFVQ
KLHL2_HUMAN/158-260-------------------------------------------------CLGIRAFADMH.ACTDLLNKANTYAEQHFAD
KEAP1_RAT/184-286-------------------------------------------------AIGIANFAEQI.GCTELHQRAREYIYMHFGE
Q6DJ21_XENTR/98-200-------------------------------------------------CLGISVLAECL.DCPELKATADDFIHQHFTE
Q6GKZ1_DROME/195-298-------------------------------------------------CVSIMGFARFR.FLEDLHLKARNYTLRYFTE
KLH23_MOUSE/139-240-------------------------------------------------CIGMHSFAEFH.VCSELEKESRRILCSRFKE
KLH21_DANRE/140-242-------------------------------------------------CLEIQDFAEAY.ACRELAASARRFVLKNIVE
Q6PFE1_MOUSE/275-376-------------------------------------------------CLGIRSFADAQ.GCTDLHKVAHNYTMEHFME
KLH31_DANRE/173-274-------------------------------------------------CMYVVNIADTY.NLKETKEAAQKFMRENFIE
KLH17_MOUSE/192-294-------------------------------------------------CLGIRGFADTH.SCSDLLKAAHRYVLQHFVD
Q6TEQ2_DANRE/149-251-------------------------------------------------CLGMMLLSDAH.QCQRLYELSWRMCLANFAN
Q7KSF5_DROME/192-294-------------------------------------------------AIGIAHFAEQH.GCVELQKKANVFIERNFTQ
Q7SYC4_DANRE/168-270-------------------------------------------------CLGIQRFADAH.SLKQLASRCRSYALQSFAD
Q86BQ6_DROME/179-281-------------------------------------------------CLGFAFFAEQQ.SCTTLLRLAQAYTCQYFMQ
KLH26_MOUSE/156-257-------------------------------------------------CLHIGQMATTF.SLTSLRESVDAFTFRHFLQ
KLH38_MOUSE/136-237-------------------------------------------------CLGLVRLAEIL.SCDSLKKKAKEVALTYFPE
KLH31_MOUSE/172-273-------------------------------------------------CMYVVNIAETY.SLKNAKATAQKFIRDNFIE
Q8N4I8_HUMAN/152-254-------------------------------------------------CLGIRAFADVH.TCTDLLQQANAYAEQHFPE
KLH36_HUMAN/148-250-------------------------------------------------YLYLQELASIY.SLKRLDAFIDGFILNHFGT
KLH25_MOUSE/149-251-------------------------------------------------CLGMMVLSDAH.QCRRLYEFSCRMSLVHFET
Q8V3G0_SWPV1/125-224-------------------------------------------------CLQVYMFSKVH.NLFRLMDVALSTIIMNITT
KLH28_MOUSE/137-239-------------------------------------------------CIGISRFAETY.GCHDLYLAATKFICQNFES
BTBDH_MOUSE/169-269-------------------------------------------------AVGWYHYAVST.GDEALRESCLQFLAWNLSA
Q9Q8G2_MYXVL/125-224-------------------------------------------------CLHYYEFSKRY.NRRHIFNVVITTIIHNIVS
Q9VGE5_DROME/143-245-------------------------------------------------VLGIRTFADSM.ICRQLIDAADKYIDQNFAK
Q9VK21_DROME/187-289-------------------------------------------------ALGILRFAEAH.NCESLAKSALNFVHANFPA
Q9W2S3_DROME/150-248-------------------------------------------------VCMILDAARLY.NLEELTEVCLMFMDRNAGD
Q9W4L5_DROME/162-265-------------------------------------------------AFQVYLRALKYPQLEELRKLMLQRIGAAFLA
Q9W4S3_DROME/306-407-------------------------------------------------AFQAYIMAKDY.RCPEIMIVMQSRLRKCFLP
A1Z7I5_DROME/227-323-------------------------------------------------...LYFEAKIL.KLEVIHLQYLERVSKFFLT
A9JSR2_XENTR/131-232-------------------------------------------------CLGIRDFAETH.NCLDLMQAAEVYSQKHFPE
A9ULG0_XENTR/113-214-------------------------------------------------CIGFFQFAEHL.SCQPLLEYTESYIHTHFTE
B8JJT0_DANRE/167-269-------------------------------------------------CVGILHLADVH.SLESLKTQVHSYIVQNFSQ
E7FB71_DANRE/142-244-------------------------------------------------CLGVRQFAETM.MCTTLYDAANSFVHQHFVE
F1Q6J6_DANRE/201-302-------------------------------------------------CVAIHSLAHMY.TLDQLALRAADMIRRNFHK
F1QEG2_DANRE/136-238-------------------------------------------------CLAVFRLGLVL.SVPRLAIAARDFIADRFET
F1QLH3_DANRE/143-240-------------------------------------------------.CLVFDVASLY.CLNGLAEACMAYMDRNAVE
F6S3C9_XENTR/135-236-------------------------------------------------CLGIWEFGETH.GCPEVAAKALSFLQENFEA
F6VL93_XENTR/137-231-------------------------------------------------CVRLLSFADLF.SCEELKQSAKRMVEHKFTT
F7AJ67_XENTR/158-260-------------------------------------------------CLAIFRLGLLL.DCPRLAVTARDYVCDRFMQ
F7FRL0_MACMU/216-317-------------------------------------------------CLGVLAMAEAM.QCSELYHMAKAFALQIFPE
H2V3E3_TAKRU/76-175-------------------------------------------------CIDIYQLTKYN.FCTQLEQKAYKFILNNFDL
H2V3E4_TAKRU/116-216-------------------------------------------------CIGIWQFSDIC.YCSQLQEKAFEFILCNFDQ
KBTB1_VACCW/123-219-------------------------------------------------CIDFYIYADKY.NNKKIESASFNTILQNILR
KLH25_XENTR/149-250-------------------------------------------------CLGMMILSDAH.QCQRLYELSLRTCLSNFAT
Q0V9R8_XENTR/168-270-------------------------------------------------CLGIQHFADTH.SLKTLFTKCKSFAQQAFED
Q1ECZ2_DANRE/160-262-------------------------------------------------VIGISRFAEEI.GCTDLHLRTREYINTHFNE
Q66IL9_XENTR/176-277-------------------------------------------------CVEVGRIANTY.NLTEVDKYVNNYILKNFPA
Q66JH7_XENTR/149-248-------------------------------------------------CLNMMLISDAH.CCERLLELSWRMCLTNFVE
BTBDH_XENTR/160-257-------------------------------------------------.VSWYHYALRM.GDINLQESCLKFLAWNLST
Q7PNH6_ANOGA/201-303-------------------------------------------------CLGIRDFADIH.GCIDLLNYAETYIEQHFSE
Q8BUX1_MOUSE/155-254-------------------------------------------------CLGIRSFGDAQ.GCMELQNVAHKYAMEHFID
BTBD9_MOUSE/143-239-------------------------------------------------.CMTFDVASLY.SLPKLTCMCCMFMDRNAQE
KLHL1_MOUSE/317-416-------------------------------------------------CLGIRAFADAQ.GCIELMKVAHSYTMENIME
Q9VRA7_DROME/151-248-------------------------------------------------CLAIAGMADIY.GIMDLSERAYRYMCAHFEE
W5MS53_LEPOC/170-271-------------------------------------------------CLGIRAFADTH.SCRELLRIADKFTQHNFQE

PF00651

BAT47_CAEEL/8-109SEH--CTYFQSLFCGD...............-------------------------------------------------
ZBT17_MOUSE/14-114AAC--SEYFKMLFVDQ...............-------------------------------------------------
Y2060_ARATH/201-303QAS--GNFPLRSSDGD...............-------------------------------------------------
Y2060_ARATH/341-455SLW--SVAFAKMFTNG...............-------------------------------------------------
O61795_CAEEL/46-153SAC--SPYFLSMFTSQ...............-------------------------------------------------
O76610_CAEEL/10-114CDH--SPYFRCLLSNF..............P-------------------------------------------------
KELC_DROME/147-253ASC--SPYFYAMFTSF...............-------------------------------------------------
KLH21_HUMAN/25-133AAA--SPYFRAMFAGQ...............-------------------------------------------------
O45927_CAEEL/141-251SMA--SPIFLEAFVTN...............-------------------------------------------------
BTBD2_HUMAN/112-217AVG--SAVFDAMFNGG...............-------------------------------------------------
O44818_CAEEL/140-244ASH--STYFETLLLGN...............-------------------------------------------------
Q18030_CAEEL/118-226SMA--SQYFKVLFNGSF.............I-------------------------------------------------
LZTR1_HUMAN/655-764AAR--SSYFEAMFRSF...............-------------------------------------------------
BAB1_DROME/117-222SAC--SPYFQTLLAET...............-------------------------------------------------
O17112_CAEEL/140-243SYH--SDYFQALFSSN..............F-------------------------------------------------
BACH1_MOUSE/24-130AAC--SSYFHSRIVGQ...............-------------------------------------------------
BCL6_HUMAN/22-129MAC--SGLFYSIFTDQ...............-------------------------------------------------
BRC1_DROME/22-127SAC--SPYFRELLKST...............-------------------------------------------------
CALI_BOVIN/18-128AAV--SPLVKNLISNHD.............M-------------------------------------------------
ENC1_HUMAN/36-144AAC--SRYFEAMFSGGL.............K-------------------------------------------------
GAGA_DROME/24-129CAA--SPFLLDLLKNT...............-------------------------------------------------
GCL_DROME/56-166LSQ--SPYFYTMFNGT..............W-------------------------------------------------
ZBT48_HUMAN/16-119ACC--SHFFQSLYGDG...............-------------------------------------------------
KLH41_HUMAN/23-130SAC--SPYFREYFLSEI.............D-------------------------------------------------
LOLA2_DROME/22-127SAC--SPYFATLLQEQ...............-------------------------------------------------
KAISO_HUMAN/22-125SAS--STYFHQLFSVA...............-------------------------------------------------
ZBT14_HUMAN/26-132AAC--STYFKKLFKKL...............-------------------------------------------------
ABTB2_RAT/832-945VTA--SNRFKTLMTNK...............-------------------------------------------------
ZBTB5_HUMAN/14-123AAC--STHFRALFSVA..............E-------------------------------------------------
ZBT7B_HUMAN/24-145AAC--SHYFKKLFTEGGGGAVMGAGGSGTAT-------------------------------------------------
ZBT22_HUMAN/47-151AAS--SPYFHDQVLLK...............-------------------------------------------------
O16313_CAEEL/54-165AVR--SSFFRAMLYTG...............-------------------------------------------------
O16566_CAEEL/67-171ASH--STYFKTLFLGK..............F-------------------------------------------------
O16736_CAEEL/144-248AAQ--SKYFKALLLGS..............F-------------------------------------------------
O16740_CAEEL/129-232SFH--SDFFHELFSAS..............S-------------------------------------------------
O17197_CAEEL/70-174SFH--SDYFSALFSSN..............F-------------------------------------------------
O17253_CAEEL/135-236SYH--SDYFCDLFAEK..............F-------------------------------------------------
O17297_CAEEL/141-242ASH--STYFNALLLGK...............-------------------------------------------------
O18147_CAEEL/41-148AAT--IPYFRGMFTLD...............-------------------------------------------------
BPM3_ARATH/184-303AAR--SPVFRAQFFGP...............-------------------------------------------------
Y2045_ARATH/15-132VAR--SEVFKKILESD...............-------------------------------------------------
NACC1_RAT/20-124AAS--SSYFRDLFNSS...............-------------------------------------------------
ZBT43_HUMAN/23-126AAS--SPYFCDQVLLK...............-------------------------------------------------
O44815_CAEEL/142-246ASH--STYFNALLLGK..............F-------------------------------------------------
O44817_CAEEL/137-241ASH--STYFKTLLLGK..............F-------------------------------------------------
O44905_CAEEL/112-216SFH--SSYFRKLFSSN..............F-------------------------------------------------
O45594_CAEEL/135-238SYH--SSFFRAIFSST..............F-------------------------------------------------
O61932_CAEEL/71-176AAY--SPAFAEKFRKP...............-------------------------------------------------
BTB1_SCHPO/608-735CAR--SSFLRKLLLQKKKSS......VSNII-------------------------------------------------
O76568_CAEEL/144-248AYH--SSYFKSLLLGK..............F-------------------------------------------------
KEN_DROME/23-131AAA--SPLIRNLLEDT...............-------------------------------------------------
Y4409_ARATH/15-129SAR--SEVFEEMFESD...............-------------------------------------------------
BCL6B_MOUSE/28-135IAC--SGFFYSIFRGR...............-------------------------------------------------
ZBT7A_CHICK/24-131AAC--SQYFKKLFTSG..............L-------------------------------------------------
ZBT18_HUMAN/14-121ASC--SMYFHLFYKDQ...............-------------------------------------------------
ZBTB6_HUMAN/23-127AAC--STFMRDQFLLT...............-------------------------------------------------
Q17523_CAEEL/126-230ALN--SPILKQKLENN...............-------------------------------------------------
Q17782_CAEEL/193-300AAR--SPVFAAMMEPH..............T-------------------------------------------------
Q19838_CAEEL/23-130CAH--SDVFSETFDNQ...............-------------------------------------------------
Q20183_CAEEL/184-293SIG--SVVFDAMFNGGL.............T-------------------------------------------------
BAT38_CAEEL/220-325ALY--SPVFYAMFFSN...............-------------------------------------------------
Q21899_CAEEL/143-245SMM--SPFFKALFYGE..............L-------------------------------------------------
MMD4_DROME/22-128SVC--SPFFRKMFTQM..............P-------------------------------------------------
ABRU_DROME/93-198SAC--SPYFRRLLKAN...............-------------------------------------------------
CP190_DROME/20-127SAC--TDYFNVLEQTC...............-------------------------------------------------
HIC1_CHICK/53-160AAS--SAYLKSLVVHD...............-------------------------------------------------
MEL26_CAEEL/191-300AAR--SPVFNAMLTHQ...............-------------------------------------------------
SPOP_HUMAN/190-297AAR--SPVFSAMFEHE...............-------------------------------------------------
TTKB_DROME/23-127SAC--SPYFNTLFVSH...............-------------------------------------------------
KBTB1_VACCW/11-118SGA--SEYFSILFSN................-------------------------------------------------
VMT8_MYXVL/6-112SAY--SKYFYNLFNGN...............-------------------------------------------------
ZBT39_HUMAN/20-126ACA--AGYFQNLFLNT...............-------------------------------------------------
ZBT24_HUMAN/27-133AAS--SEYFSMMFAEE...............-------------------------------------------------
BTB3_SCHPO/157-262AAR--SSYFKSKFSKL...............-------------------------------------------------
BTB3_SCHPO/296-405CRC--EYFLDMLAGPF..............L-------------------------------------------------
YIA1_YEAST/264-390LSR--AEYFKVMFTNNFKE.........KVT-------------------------------------------------
BAT15_CAEEL/139-243ASH--SSYFNALFLGK..............F-------------------------------------------------
BAT42_CAEEL/208-319GQN--SPVFKSMFSSP..............N-------------------------------------------------
BAT43_CAEEL/255-368AAR--SRVFSAMFEHH...............-------------------------------------------------
YR47_CAEEL/45-146SFY--SNYFRVLFSSK..............F-------------------------------------------------
ZBT16_HUMAN/24-126ACT--SKMFEILFHRN..............S-------------------------------------------------
ZBT25_HUMAN/14-119AAF--SNYFKMIFIHQ...............-------------------------------------------------
A1Z8A5_DROME/25-125SAC--STYFQKLLLEN...............-------------------------------------------------
F7A721_CALJA/24-127AAC--SKYFKKLFTAG...............-------------------------------------------------
K7EJ49_HUMAN/67-178ASS--SPVFKAMFTNG...............-------------------------------------------------
BACH2_MOUSE/27-132AAC--SEYFWQALVGQ...............-------------------------------------------------
Q54RA9_DICDI/42-142ANS--SEFFGRLLLSD...............-------------------------------------------------
Q8V3S6_SWPV1/8-114SMY--SKYFYNIFNSD...............-------------------------------------------------

PF03931

Q21367_CAEEL/8-70IQK--SKCFSVVLAQM--------------N-------------------------------------------------
SKP1_HUMAN/2-67AKQ--SVTIKTMLEDL--------------G-------------------------------------------------
O77430_DROME/2-66AKC--SGTIKTMLEDC--------------G-------------------------------------------------
ASK16_ARATH/4-64ARK--LKVIAHMIDDD--------------C-------------------------------------------------
ASK14_ARATH/4-64ARK--LKIVEHMIEDD--------------C-------------------------------------------------
ASK19_ARATH/4-64ARK--LQIVGHIIEDD--------------C-------------------------------------------------
SKP1A_ARATH/4-63ALE--SQTIAHMVEDD--------------C-------------------------------------------------
SKP1B_ARATH/5-64ALE--SQTIKHMIEDD--------------C-------------------------------------------------
ASK12_ARATH/4-64AIQ--SQTIAHMVEDD--------------C-------------------------------------------------
Q89374_PBCV1/1-61LDQ--STVINDIVEDV--------------G-------------------------------------------------
ELOC_YEAST/4-66AMI--SPTLKAMIEGP--------------F-------------------------------------------------
SKP1A_DICDI/2-63ACM--SVTIKNMIEDI--------------G-------------------------------------------------
SKP1_EMENI/4-65AER--SLLIKNMLEDL--------------G-------------------------------------------------

PF11822

Q29D48_DROPS/298-606VSK--MGYFADVT...................................................................
Q4Q8A2_LEIMA/20-417RTH--MRYFEPLIQRQ..............................................................IN
Q0IFU1_AEDAE/236-536ITK--MGYFADVT...................................................................
Q383Z9_TRYB2/26-376ESS--MTYFTPIIKCYLDEEERQKSREEKSLDRASS.....................TGARSVKNSKTKAHEATKPLKRK
A4HGL7_LEIBR/10-407RTH--MRYFEPLIQRQ..............................................................MS
A7S8V2_NEMVE/1-302IRE--MRYFAEYLSV.................................................................
Q4DXB1_TRYCC/30-401ETS--MAYFEPIIRRYLEEEAEEEKKRIRAEIEKGRDSISGASAATNLETSIGVTDGSADRKAIIGTRGQGDVGPSSRIS
F7EPV1_XENTR/146-448VSE--MKYFAEYLST.................................................................
H3DIA0_TETNG/1-303VKE--MRYFAEYLSV.................................................................

PF02214

KCNSK_CAEEL/135-238SRY.PNSLLGDRNK..------------------------------------------------................
KCNA5_MOUSE/113-204AQF.PNTLLGDPVK..------------------------------------------------................
KCNAL_DROME/43-132EKY.PDTLLGSNER.E------------------------------------------------................
KCNS1_MOUSE/21-120ARF.PGTRLGRLQAAA------------------------------------------------SEE..........QAR
KCNS3_HUMAN/17-116LRF.PHTRLGKLLTCH------------------------------------------------SEE..........AIL
Q18986_CAEEL/7-97C.K.HDSMLKTMFCTD------------------------------------------------................
KCNA7_MOUSE/47-138GRF.PDTLLGDPVR..------------------------------------------------................
P91557_CAEEL/6-93T..KFEGYFKQKLKTR------------------------------------------------................
O17001_CAEEL/21-113TWI.PDSFFTSLLSGR------------------------------------------------................
O16612_CAEEL/6-96T..KHDGFFKALIETD------------------------------------------------................
O16709_CAEEL/9-96M..KFDGYFKKFLQTP------------------------------------------------................
O16706_CAEEL/5-95T..KFNGFLKIMLESD------------------------------------------------................
KCNB1_HUMAN/33-132DRL.PRTRLGKLRDCN------------------------------------------------THD..........SLL
KCNC1_HUMAN/10-104RTL.PGTRLAWLAE..------------------------------------------------P.............DA
P91564_CAEEL/5-95T..KFHSFFKTMLECK------------------------------------------------................
KCNAW_DROME/12-102KKI.PATRLSRLTE..------------------------------------------------...............A
KCNS2_MOUSE/19-118LRF.PETRLGRLLLCH------------------------------------------------SRE..........AIL
O16613_CAEEL/8-96T..KHHGIFKALVKTE------------------------------------------------................
KCA10_HUMAN/88-179SQF.PETLLGDREK..------------------------------------------------................
KCND1_HUMAN/42-131DRY.PDTLLGSSEK..------------------------------------------------...............E
KCND3_RAT/42-131ERY.PDTLLGSTEK..------------------------------------------------...............E
Q20381_CAEEL/28-127IRRLATSRLAVFCEKS------------------------------------------------HV...........ERL
KCNG1_HUMAN/65-164DEF.PLTRLGQLKACT------------------------------------------------NFD..........DIL
Q26597_SCHMA/53-144NQF.PDTLLGNPNK..------------------------------------------------................
O16711_CAEEL/8-100T..KFDGFFKTLLETD------------------------------------------------................
KCNV1_RAT/44-153SCF.PHTRLGKLAVVV------------------------------------------------ASYRRLGALAAAPSPL
Q18776_CAEEL/84-176M.REPCSFLYRLCQDE------------------------------------------------................
KCNAB_DROME/279-378ERL.PHTRLGRLRECT------------------------------------------------THE..........AIV
O16630_CAEEL/2-90T..KFDGYFRKLPKLK------------------------------------------------................
P91256_CAEEL/38-137LRADTTTFLSRFVQLT------------------------------------------------HT...........ARL
BACD2_MOUSE/30-120T..RHDTMLKAMFSGR------------------------------------------------................
O16708_CAEEL/99-187Q..KFEGNLKELPE..------------------------------------------------................
KCNG2_CHICK/59-158ENC.PLTRLGKLKSCN------------------------------------------------NYD..........EIM
B4L763_DROMO/24-111SRD.PNSFLSRLIQED------------------------------------------------................

PF16017

E7F994_DANRE/70-299ARRQFEVFLEELLLPA----------------------------------------------------------------
G3W7V3_SARHA/151-380NPYKIQHFLHEFYYYL----------------------------------------------------------------
W4ZCZ0_STRPU/50-279ARQEFEKHLEAALLPE----------------------------------------------------------------
E9JD94_SOLIN/154-383ARCQFEVFLEDLILPL----------------------------------------------------------------
A9UPC4_MONBE/63-292ARKQFEMFLRLALMPA----------------------------------------------------------------
E4XC39_OIKDI/75-305ARDEFTKLLKTLIIPK----------------------------------------------------------------
F7AXE7_CIOIN/162-392AKQQFIRFLEKDILPL----------------------------------------------------------------
T1L0V7_TETUR/82-310AKCQFEYFLEQHIFPA----------------------------------------------------------------
W5KS29_ASTMX/198-429FKRFFFYYIK.IAMPR----------------------------------------------------------------
E9BXQ6_CAPO3/355-585ARKRFESFLTNLIMPA----------------------------------------------------------------
K1QX87_CRAGI/168-393ARQQFDAFLEELLLPQ----------------------------------------------------------------
H2KQY4_CLOSI/945-1176AHTIFERFLEAHILSL----------------------------------------------------------------
A7S9A9_NEMVE/133-363AREQFQEFLEKYILPV----------------------------------------------------------------
H3FGC5_PRIPA/9-239ARQQFSRFLEDVILPQ----------------------------------------------------------------
B3SBZ6_TRIAD/36-264ARKQFEKFLEDHILPA----------------------------------------------------------------
F2U9A9_SALR5/300-529AIRQFEAFLKHSLLPA----------------------------------------------------------------
G3HKB9_CRIGR/153-382AHKQFDHYLEELILPI----------------------------------------------------------------
F6TDG6_XENTR/196-425ARRQFEFYLEEMILPL----------------------------------------------------------------
T1G141_HELRO/46-274ARQQFNIFLEEMILPE----------------------------------------------------------------
I1FT20_AMPQE/71-291AKQQFREYLEPLIIPA----------------------------------------------------------------
E5SRV9_TRISP/693-924AKERFNFFLNKIILPQ----------------------------------------------------------------

PF07707

IPP_MOUSE/139-241VHTGE.EFLG.LTKDQ----------------------------------------------------------------
KBTBC_MOUSE/131-233VSLHG.EILD.IEAHQ----------------------------------------------------------------
Q7PXP7_ANOGA/170-272VWKNQ.EFFM.LDAAQ----------------------------------------------------------------
KLHL8_MOUSE/178-280VVECE.DFVS.VSPQH----------------------------------------------------------------
O61795_CAEEL/158-260VIGKE.EFQM.LTVES----------------------------------------------------------------
KLHL6_MOUSE/172-274ILNSE.EFLE.LPVDT----------------------------------------------------------------
KLH18_HUMAN/140-242VSMSE.EFLA.LPLED----------------------------------------------------------------
KELC_DROME/258-360VIQFD.EFLN.LSHEQ----------------------------------------------------------------
KBTB3_HUMAN/150-252LFKSS.DFLE.MNFGV----------------------------------------------------------------
GAN_MOUSE/134-236VSSTE.EFLE.LSPQK----------------------------------------------------------------
Q7PMB5_ANOGA/179-281VALED.ELLD.IPHTL----------------------------------------------------------------
Q7QHD7_ANOGA/175-277VAAGD.EFVA.LSYSE----------------------------------------------------------------
Q7QI84_ANOGA/148-248ILQHE.SFRH.LSLDS----------------------------------------------------------------
KBTB8_HUMAN/152-254VTKEQ.EFLQ.LTKDQ----------------------------------------------------------------
Q7Q1T2_ANOGA/174-276VVGTE.EFLL.LGFNE----------------------------------------------------------------
KLH21_HUMAN/138-239LG.AE.QLER.LPLAR----------------------------------------------------------------
ENC1_HUMAN/149-251IRKNE.DFLQ.LPQDM----------------------------------------------------------------
O16313_CAEEL/170-270LLEDP.SFNR.LSGDS----------------------------------------------------------------
O18147_CAEEL/153-255VSKDE.DFKR.LSLED----------------------------------------------------------------
KLH41_HUMAN/135-237ICKEE.DFMQ.LSPQE----------------------------------------------------------------
KLHL2_HUMAN/158-260VVLSE.EFLN.LGIEQ----------------------------------------------------------------
KEAP1_RAT/184-286VAKQE.EFFN.LSHCQ----------------------------------------------------------------
Q6DJ21_XENTR/98-200VYKTD.EFLQ.LDVKR----------------------------------------------------------------
Q6GKZ1_DROME/195-298VAYRNIDILD.MSAED----------------------------------------------------------------
KLH23_MOUSE/139-240VWQQE.EFLE.ISLEK----------------------------------------------------------------
KLH21_DANRE/140-242LAKSM.DFER.LSWKR----------------------------------------------------------------
Q6PFE1_MOUSE/275-376VIRNQ.EFVL.LPANE----------------------------------------------------------------
KLH31_DANRE/173-274FSEME.QFLK.LTYEQ----------------------------------------------------------------
KLH17_MOUSE/192-294VAKTE.EFML.LPLKQ----------------------------------------------------------------
Q6TEQ2_DANRE/149-251LYHTE.DFLS.LPKDK----------------------------------------------------------------
Q7KSF5_DROME/192-294VCQEE.EFLQ.LSAYQ----------------------------------------------------------------
Q7SYC4_DANRE/168-270VAQHE.EFLD.LRKEE----------------------------------------------------------------
Q86BQ6_DROME/179-281VCQNQ.EFFQ.LNADQ----------------------------------------------------------------
KLH26_MOUSE/156-257IAAEE.DFLR.LPLER----------------------------------------------------------------
KLH38_MOUSE/136-237VAASA.DLKE.LCAME----------------------------------------------------------------
KLH31_MOUSE/172-273FAESE.QFMK.LTFEQ----------------------------------------------------------------
Q8N4I8_HUMAN/152-254VMLGE.EFLS.LSLDQ----------------------------------------------------------------
KLH36_HUMAN/148-250LSFTP.DFLQNVSMQK----------------------------------------------------------------
KLH25_MOUSE/149-251VRQSE.DFNS.LSRDT----------------------------------------------------------------
Q8V3G0_SWPV1/125-224IYKHD.NFGL.LDEKD----------------------------------------------------------------
KLH28_MOUSE/137-239VCQTE.EFFE.LTHAD----------------------------------------------------------------
BTBDH_MOUSE/169-269VAGSA.EWGA.VSPEL----------------------------------------------------------------
Q9Q8G2_MYXVL/125-224VLRQP.NFKT.IELCD----------------------------------------------------------------
Q9VGE5_DROME/143-245VSQSE.EFLA.LDCEQ----------------------------------------------------------------
Q9VK21_DROME/187-289VTLED.EFLE.TPQTL----------------------------------------------------------------
Q9W2S3_DROME/150-248LLLHN.SFNT.LSKES----------------------------------------------------------------
Q9W4L5_DROME/162-265VLGGD.DFQR.MPLED----------------------------------------------------------------
Q9W4S3_DROME/306-407IVASW.EFLE.FDVNE----------------------------------------------------------------
A1Z7I5_DROME/227-323LVASK.EFLR.LPLKS----------------------------------------------------------------
A9JSR2_XENTR/131-232VVQHE.EFML.LHQEE----------------------------------------------------------------
A9ULG0_XENTR/113-214VQIGD.EFPT.LTKDQ----------------------------------------------------------------
B8JJT0_DANRE/167-269VVDHE.EILE.LPADV----------------------------------------------------------------
E7FB71_DANRE/142-244VSVSE.EFLA.LRPEE----------------------------------------------------------------
F1Q6J6_DANRE/201-302VIQDE.EFYT.LPFHL----------------------------------------------------------------
F1QEG2_DANRE/136-238VSSEE.EFLQ.LAPHE----------------------------------------------------------------
F1QLH3_DANRE/143-240VLKSD.GFLT.LSKSA----------------------------------------------------------------
F6S3C9_XENTR/135-236VSQEE.EFLL.LSPER----------------------------------------------------------------
F6VL93_XENTR/137-231VYHQE.AFMQ.LSSEL----------------------------------------------------------------
F7AJ67_XENTR/158-260ICNEE.DFLQ.LAPHE----------------------------------------------------------------
F7FRL0_MACMU/216-317VAAQE.EILS.ISKDD----------------------------------------------------------------
H2V3E3_TAKRU/76-175IESGE.EFFQ.LDMEH----------------------------------------------------------------
H2V3E4_TAKRU/116-216VISSK.EFHQ.LSVEE----------------------------------------------------------------
KBTB1_VACCW/123-219LINDE.NFKY.LTEES----------------------------------------------------------------
KLH25_XENTR/149-250LHNTE.DFCS.LSKDM----------------------------------------------------------------
Q0V9R8_XENTR/168-270VVQHE.EFLE.LGKAE----------------------------------------------------------------
Q1ECZ2_DANRE/160-262VTKEE.EFFS.LSHCQ----------------------------------------------------------------
Q66IL9_XENTR/176-277LLTTG.EFVK.LPFDR----------------------------------------------------------------
Q66JH7_XENTR/149-248LSKTE.DFLR.LPKLK----------------------------------------------------------------
BTBDH_XENTR/160-257IMSSN.EWVT.VSDKL----------------------------------------------------------------
Q7PNH6_ANOGA/201-303VVQFD.EFLN.LTSDQ----------------------------------------------------------------
Q8BUX1_MOUSE/155-254VIKNQ.EFLL.LPANE----------------------------------------------------------------
BTBD9_MOUSE/143-239VLASD.GFLS.LSKTA----------------------------------------------------------------
KLHL1_MOUSE/317-416VIRNQ.EFLL.LPAEE----------------------------------------------------------------
Q9VRA7_DROME/151-248FATTS.DFKE.MKVDQ----------------------------------------------------------------
W5MS53_LEPOC/170-271VMESE.EFML.LPANQ----------------------------------------------------------------

PF00651

BAT47_CAEEL/8-109....SNYQ........EH-IISDVEP.Q..-------------------DFQKFLEVV..HG-----------------E
ZBT17_MOUSE/14-114......KD........VV-HLDISNA.A..-------------------GLGQVLEFM..YT-----------------A
Y2060_ARATH/201-303................VI-QLRGVSY.P..-------------------ILHALLQYI..YT-----------------G
Y2060_ARATH/341-455.MSESHSS........TI-YLTDVSP.E..-------------------AFKAMMNFM..YS-----------------G
O61795_CAEEL/46-153.MAECYMR........EI-NMEEIEP.P..-------------------TLEALIEFC..YT-----------------G
O76610_CAEEL/10-114RIDEKP..........VH-LLKGVNP.A..-------------------DFQKFLEVL..HG-----------------E
KELC_DROME/147-253..EESRQA........RI-TLQSVDA.R..-------------------ALELLIDYV..YT-----------------A
KLH21_HUMAN/25-133.LRESRAE........RV-RLHGVPP.D..-------------------MLQLLLDFS..YT-----------------G
O45927_CAEEL/141-251.FDERS...........L-ELCNISA.P..-------------------DFRRILNII..YP-----------------P
BTBD2_HUMAN/112-217MATTST..........EI-ELPDVEP.A..-------------------AFLALLKFL..YS-----------------D
O44818_CAEEL/140-244.FAEADKS........EV-KLQDINS.T..-------------------DFQNLMEVR..YG-----------------E
Q18030_CAEEL/118-226ESSDLTKP.........I-ELKGISS.C..-------------------SFRNLLNCIYGYP-----------------S
LZTR1_HUMAN/655-764.MPEDGQV........NI-SIGEMVP.SRQ-------------------AFESMLRYI..YY-----------------G
BAB1_DROME/117-222P.CQHP..........IV-IMRDVNW.S..-------------------DLKAIVEFM..YR-----------------G
O17112_CAEEL/140-243KEDKQD..........EI-ELKDVVY.E..-------------------DFGLLMSTI..YP-----------------K
BACH1_MOUSE/24-130TDAELTVT.........L-P.EEVTV.K..-------------------GFEPLIQFA..YT-----------------A
BCL6_HUMAN/22-129LKCNLSVI........NL-D.PEINP.E..-------------------GFCILLDFM..YT-----------------S
BRC1_DROME/22-127P.CKHPVI........LL-..QDVNF.M..-------------------DLHALVEFI..YH-----------------G
CALI_BOVIN/18-128KTTDELFI........TI-DPNYLSP.T..-------------------TVDQLLDYF..YS-----------------G
ENC1_HUMAN/36-144ESQDSEVN.........F-D.NSIHP.E..-------------------VLELLLDYA..YS-----------------S
GAGA_DROME/24-129P.CKHPVV........ML-..AGVNA.N..-------------------DLEALLEFV..YR-----------------G
GCL_DROME/56-166REAQQNFIQ......ITI-LDDRITV.A..-------------------SLDAVFGSM..YS-----------------D
ZBT48_HUMAN/16-119..SGGS...........V-VLPAGFA.E..-------------------IFGLLLDFF..YT-----------------G
KLH41_HUMAN/23-130EAKKKE...........V-VLDNVDP.A..-------------------ILDLIIKYL..YS-----------------A
LOLA2_DROME/22-127Y.DKHPIF........IL-..KDVKY.Q..-------------------ELRAMMDYM..YR-----------------G
KAISO_HUMAN/22-125G..............QVV-ELSFIRA.E..-------------------IFAEILNYI..YS-----------------S
ZBT14_HUMAN/26-132..EVDSSS........VI-EIDFLRS.D..-------------------IFEEVLNYM..YT-----------------A
ABTB2_RAT/832-945SEQDGDNS.......KTI-EISDIKY.H..-------------------IFQMLMQYL..YY-----------------G
ZBTB5_HUMAN/14-123GDQTMNMI........QL-DSEVVTA.E..-------------------AFAALIDMM..YT-----------------S
ZBT7B_HUMAN/24-145GGAGAGVC........EL-..DFVGP.E..-------------------ALGALLEFA..YT-----------------A
ZBT22_HUMAN/47-151...GMTSI........SL-P.SVMDP.G..-------------------AFETVLASA..YT-----------------G
O16313_CAEEL/54-165.FQESHQQ........LV-TLQETNS.V..-------------------AFRAVLRYM..YT-----------------S
O16566_CAEEL/67-171VEADKS..........EV-TLQDIDP.T..-------------------DFQCLMEVI..HG-----------------E
O16736_CAEEL/144-248EEGKSS..........EV-TLTSIDP.N..-------------------DFQFFLEVL..YG-----------------D
O16740_CAEEL/129-232TESEIP..........EI-PIRDVSA.E..-------------------DMGLLLSTI..YP-----------------D
O17197_CAEEL/70-174KDGELD..........EI-PLKDVTI.E..-------------------EFGLVLSTI..HP-----------------E
O17253_CAEEL/135-236DEKN............GI-PIENVTY.E..-------------------NFGLLMSII..YP-----------------E
O17297_CAEEL/141-242..PEMS..........EV-TIQDTSS.V..-------------------DFQNLLEVL..YG-----------------E
O18147_CAEEL/41-148.LMEANMK........EI-NIEDMNY.E..-------------------TVDALLSFA..YT-----------------G
BPM3_ARATH/184-303.IGNNNVD........RI-VIDDIEP.S..-------------------IFKAMLSFI..YT-----------------D
Y2045_ARATH/15-132.EFKASSKQ.....METV-TLSEMKH.E..-------------------ELEAFVEFI..YR-----------------V
NACC1_RAT/20-124...RSAVV........EL-P.AAVQP.Q..-------------------SFQQILTFC..YT-----------------G
ZBT43_HUMAN/23-126...NSRRI........VL-P.DVMNP.R..-------------------VFENILLSS..YT-----------------G
O44815_CAEEL/142-246KEAEIS..........EV-ALKDIDS.T..-------------------DFQNLLEVL..YG-----------------E
O44817_CAEEL/137-241EEAERQ..........EV-KLQDIDS.T..-------------------DFQNLMEVL..YG-----------------E
O44905_CAEEL/112-216KEAQLT..........EI-PIRDVSY.E..-------------------DFCLLLSTI..YP-----------------N
O45594_CAEEL/135-238KEGQMS..........EI-PIKDVTY.K..-------------------DFALMLSTI..YP-----------------D
O61932_CAEEL/71-176..NK.CF.........VL-EMQPLDK.T..-------------------SVKRVLDYI..YF-----------------G
BTB1_SCHPO/608-735YIEEITQSH......STI-RVEDIPP.L..-------------------AVAILLHYL..YT-----------------D
O76568_CAEEL/144-248AESDQK..........EV-TLQDIDP.T..-------------------DFQNLLEVL..YG-----------------E
KEN_DROME/23-131HLSDCSTT.........V-YFPDVNA.T..-------------------YFKFLLDFL..YS-----------------G
Y4409_ARATH/15-129.KYKASSKL......ETI-TLSEMKH.E..-------------------VLEAFVDFT..Y.-----------------S
BCL6B_MOUSE/28-135AGLGVDVL........SL-P.GGPEA.R..-------------------GFAPLLDFM..YT-----------------S
ZBT7A_CHICK/24-131VVDQQNVY........EI-..DFVSA.D..-------------------ALSALLEFA..YT-----------------A
ZBT18_HUMAN/14-121L.DKRDIV........HL-NSDIVTA.P..-------------------AFALLLEFM..YE-----------------G
ZBTB6_HUMAN/23-127..QSKHVR.........I-T.ILQSA.E..-------------------VGRKLLLSC..YT-----------------G
Q17523_CAEEL/126-230..KLA...........EI-IMPFESF.V..-------------------SMKKLMNFL..HP-----------------P
Q17782_CAEEL/193-300AEAQNS..........RA-ILRDIDY.E..-------------------VVQAILYYI..YT-----------------G
Q19838_CAEEL/23-130..RAPYQP.........F-NMTDFDP.D..-------------------SVRRVFDWM..YS-----------------G
Q20183_CAEEL/184-293PKNTEEAL........EI-ELPDVEP.S..-------------------AFLALLKFL..YS-----------------D
BAT38_CAEEL/220-325.FQEREKT........QV-ELEDVVL.E..-------------------EFRELLHVI..YP-----------------C
Q21899_CAEEL/143-245G.EDKE...........I-YEMKEKF.R..-------------------EIITFLRCI..YP-----------------H
MMD4_DROME/22-128S.NTHAIV........FL-..NNVSH.S..-------------------ALKDLIQFM..YC-----------------G
ABRU_DROME/93-198P.CEHPIV........IL-..RDVRC.D..-------------------DVENLLSFM..YN-----------------G
CP190_DROME/20-127..EIVDDA........LI-MPNEFQA.D..-------------------VVVPIVNFM..YT-----------------G
HIC1_CHICK/53-160.....NLL........NL-DHEMVSP.G..-------------------IFRLILDFI..YT-----------------G
MEL26_CAEEL/191-300.DTDEAKS.......SMM-YINDMDY.D..-------------------VIYEMVYYI..YC-----------------G
SPOP_HUMAN/190-297.MEESKKN........RV-EINDVEP.E..-------------------VFKEMMCFI..YT-----------------G
TTKB_DROME/23-127P.EKHPIV........IL-..KDVPY.S..-------------------DMKSLLDFM..YR-----------------G
KBTB1_VACCW/11-118.NFIDSNE.......YEV-NLSHLDY.Q..-------------------SVNDLIDYI..YG-----------------I
VMT8_MYXVL/6-112.FLEKNVD.........V-IDLEADY.K..-------------------TVFDVIYYM..YT-----------------E
ZBT39_HUMAN/20-126G.LDAAR.........TY-VVDFITP.A..-------------------NFEKVLSFV..YT-----------------S
ZBT24_HUMAN/27-133..GEIGQS........IY-MLEGMVA.D..-------------------TFGILLEFI..YT-----------------G
BTB3_SCHPO/157-262G..PSE..........HE-IEVKHFA.K..-------------------EFESILRYL..YL-----------------D
BTB3_SCHPO/296-405E.SNQELP.........V-LSLPFSS.S..-------------------VVEIVLKFL..YT-----------------D
YIA1_YEAST/264-390YIKAKHVTGKYNSIIPQL-TLPNCEF.E..-------------------VAEIILRYL..YA-----------------D
BAT15_CAEEL/139-243KEADQS..........EV-TLQNIDP.T..-------------------DFQSLLEVL..YG-----------------E
BAT42_CAEEL/208-319MIEAQKGE.........I-HIEDAKY.D..-------------------SVRAMVEFM..YT-----------------G
BAT43_CAEEL/255-368.MQESDTN........MT-TVDDIEP.E..-------------------VMRELLVYM..YT-----------------G
YR47_CAEEL/45-146RDSNST..........TH-RIRLISA.S..-------------------DLHFLLT....IP-----------------K
ZBT16_HUMAN/24-126Q...............HY-TLDFLSP.K..-------------------TFQQILEYA..YT-----------------A
ZBT25_HUMAN/14-119TSECIK...........I-QPTDIQP.D..-------------------IFSYLLHIM..YT-----------------G
A1Z8A5_DROME/25-125.PCKHPTI.........I-LPADIIF.T..-------------------DLKTIIDFV..YR-----------------G
F7A721_CALJA/24-127TLASQPY.........VY-EIDFVQP.E..-------------------ALAAILEFA..YT-----------------S
K7EJ49_HUMAN/67-178.LREQGME........VV-SIEGIHP.K..-------------------VMERLIEFA..YT-----------------A
BACH2_MOUSE/27-132.TKDDLVV........SL-P.EEVTA.R..-------------------GFGPLLQFA..YT-----------------A
Q54RA9_DICDI/42-142.FKESSQS........VI-ELKQPDPFN..-------------------VFPMVLEFM..YD-----------------G
Q8V3S6_SWPV1/8-114.FIDKNND........EI-Y.ICADY.D..-------------------ILYIILEFM..YT-----------------G

PF03931

Q21367_CAEEL/8-70NLVQ...P--------HP-LKTSICS-F---------------------VLVKIIEWC----------------------
SKP1_HUMAN/2-67MDDEGDDD--------PV-PLPNVNA-A---------------------ILKKVIQWC----------------------
O77430_DROME/2-66MEDDE.NA--------IV-PLPNVNS-T---------------------ILRKVLTWA----------------------
ASK16_ARATH/4-64ADKA....--------.I-PLENVTG-N---------------------ILALVIEYC----------------------
ASK14_ARATH/4-64VVTE....--------.V-PLQNVTG-K---------------------ILSIVVEYC----------------------
ASK19_ARATH/4-64ATNK....--------.I-PIPNVTG-E---------------------ILAKVIEYC----------------------
SKP1A_ARATH/4-63VDNG....--------.V-PLPNVTS-K---------------------ILAKVIEYC----------------------
SKP1B_ARATH/5-64TDNG....--------.I-PLPNVTS-K---------------------ILSKVIEYC----------------------
ASK12_ARATH/4-64VADG....--------.I-PLANVES-K---------------------ILVKVIEYC----------------------
Q89374_PBCV1/1-61DDEP....--------.I-PLPTITA-K---------------------VLTKILEYC----------------------
ELOC_YEAST/4-66RESK...G--------RI-ELKQFDS-H---------------------ILEKAVEYL----------------------
SKP1A_DICDI/2-63ESDS....--------PI-PLPNVTS-T---------------------ILEKVLDYC----------------------
SKP1_EMENI/4-65DP..T.EP--------.I-PIPNVSE-N---------------------VLSKVLEWC----------------------

PF11822

Q29D48_DROPS/298-606AGQRLEE..........M-DISVHCDIL---------------------IFDWLMKWI--KHSAQSQDMPGPGQSSAAAS
Q4Q8A2_LEIMA/20-417EAKVSPPPESSSSLAVAF-TLRARCEHA---------------------TFQWLINWI--SG.................K
Q0IFU1_AEDAE/236-536AGQRLED..........M-DISVHCDLQ---------------------IFEWLMKWV--KKDSM...........SQDD
Q383Z9_TRYB2/26-376GKEEKPP..........I-PLHVNCDMS---------------------TFSWLMAYV--EG.................K
A4HGL7_LEIBR/10-407ETTVWPPSASPSSSAVAL-TLRARCDHV---------------------TFQWLVNWM--SG.................K
A7S8V2_NEMVE/1-302EAQRWEE..........V-DISVHCDVQ---------------------IFDWLMKYV--KKGLMEK......GKKVDEK
Q4DXB1_TRYCC/30-401GNTPLPP..........I-PIRVNCDLS---------------------IFSWLMAYI--QG.................K
F7EPV1_XENTR/146-448DAQRWEE..........V-DISVHCDVH---------------------IFDWLMRYV--KRSAPE.........NENQE
H3DIA0_TETNG/1-303DTQRWEE..........V-DISVHCDVQ---------------------IFDWLMNYV--RRNTA..........GENKD

PF02214

KCNSK_CAEEL/135-238R.QHFFVS--------DT-NEFFFDR-HRTTSSSFTFE-------IRNYLFESILYIY--QSG..--------------G
KCNA5_MOUSE/113-204R.LRYFDP--------LR-NEYFFDR-NRP........-------....SFDGILYYY--QSG..--------------G
KCNAL_DROME/43-132...FFYDE--------DC-KEYFFDR-DPD........-------....IFRHILNYY--RT...--------------G
KCNS1_MOUSE/21-120RLCDDYDA--------AA-HEFYFDR-HPG........-------....FFLGLLHFY--RT...--------------G
KCNS3_HUMAN/17-116ELCDDYSV--------AD-KEYYFDR-NPS........-------....LFRYVLNFY--YT...--------------G
Q18986_CAEEL/7-97..VPVTKN--------EE-GSVFIDR-DSK........-------....HFRLILNFL--RDG.Q--------------I
KCNA7_MOUSE/47-138R.SRFYDG--------AR-REYFFDR-HRP........-------....SFDAVLYYY--QSG..--------------G
P91557_CAEEL/6-93..GKIWQT--------T.-..LFIDR-SPT........-------....HFEIILNFM--RDG.K--------------V
O17001_CAEEL/21-113..MNSVKD--------PS-GAIFIDR-DPD........-------....LFRVILNYL--RTK.Q--------------V
O16612_CAEEL/6-96..VPAEKD--------DS-NCFFIDR-SPK........-------....HFETVLNYM--RSG.D--------------V
O16709_CAEEL/9-96..GSSLVD--------P.-..IFVDR-SPT........-------....YFDIVLNFM--RKG.R--------------A
O16706_CAEEL/5-95..IGLKID--------ES-GSIFIDR-SPK........-------....HFDLILNFM--RDG.D--------------V
KCNB1_HUMAN/33-132EVCDDYSL--------DD-NEYFFDR-HPG........-------....AFTSILNFY--RT...--------------G
KCNC1_HUMAN/10-104HSHFDYDP--------RA-DEFFFDR-HPG........-------....VFAHILNYY--RT...--------------G
P91564_CAEEL/5-95..TGPKIE--------KT-GCIFIDR-SPK........-------....HFELILNLM--RDG.D--------------L
KCNAW_DROME/12-102..LANYDP--------IL-NEYFFDR-HPG........-------....VFAQVLNYY--RT...--------------G
KCNS2_MOUSE/19-118ELCDDYDD--------VQ-REFYFDR-NPE........-------....LFPYVLHFY--HT...--------------G
O16613_CAEEL/8-96..MPAEDG--------DS-..FFIDR-SPK........-------....HFETVLNYI--RSG.D--------------V
KCA10_HUMAN/88-179R.MQFFDS--------MR-NEYFFDR-NRP........-------....SFDGILYYY--QSG..--------------G
KCND1_HUMAN/42-131...FFYDA--------DS-GEYFFDR-DPD........-------....MFRHVLNFY--RT...--------------G
KCND3_RAT/42-131...FFFNE--------DT-KEYFFDR-DPE........-------....VFRCVLNFY--RT...--------------G
Q20381_CAEEL/28-127TDCDAFFE--------ST-SEYYFER-SPI........-------....IFEYVIDFY--VT...--------------G
KCNG1_HUMAN/65-164NVCDDYDV--------TC-NEFFFDR-NPG........-------....AFGTILTFL--RA...--------------G
Q26597_SCHMA/53-144R.NHYYDP--------LR-NEYFFDR-NRS........-------....SFDGILYFY--QSG..--------------G
O16711_CAEEL/8-100..IPIQKD--------DS-NCIFIDR-SPR........-------....HFEKILNYL--RDGAD--------------V
KCNV1_RAT/44-153ELCDDANP--------VD-NEYFFDR-SSQ........-------....AFRYVLHYY--RT...--------------G
Q18776_CAEEL/84-176MGLPTDRD--------ET-GAYLIDR-DPD........-------....FFSPILNYL--RHGKL--------------I
KCNAB_DROME/279-378ELCDDYSL--------AD-NEYFFDR-HPK........-------....SFSSILNFY--RT...--------------G
O16630_CAEEL/2-90..DESSTT--------TR-..IVIDR-SPK........-------....HFETVLNFM--RDG.S--------------V
P91256_CAEEL/38-137KVADAYIS--------AD-DAYYFQR-SPT........-------....SFEAVFQYY--AT...--------------G
BACD2_MOUSE/30-120..MEVLTD--------KE-GWILIDR-CGK........-------....HFGTILNYL--RDD.T--------------I
O16708_CAEEL/99-187..IQGESL--------PT-ARIFIDR-PYK........-------....HFETILNFL--RDG.D--------------V
KCNG2_CHICK/59-158NICDDYDV--------SC-NEFFFDR-NPS........-------....AFRTIMTFL--TA...--------------G
B4L763_DROMO/24-111CDLISDRD--------ET-GAYLIDR-DPK........-------....YFAPVLNYL--RH...--------------G

PF16017

E7F994_DANRE/70-299MVSSAQEGERECHIVVLT.DDDTVDWDHDNPPP.MGEE..HSQI.IYSTKLYRFFKFIENRDVAKAHLKERGLKNIR.IG
G3W7V3_SARHA/151-380LVILPSRGESSAYIIRMP.EVLSLQWIENRLER.EIEN..LNKI.LYSSKLYRFFKYIENRDVAKTVLKERGLKNIR.IG
W4ZCZ0_STRPU/50-279MVNCAQKGERECHIVILL.EDDVVEWDPDYPPA.MGEE..NCQV.IYSTSLYRFFKYIENRDVAKSVLKDRGLKKIR.LG
E9JD94_SOLIN/154-383MVNSARRGDRECHIVVLL.EDDVVDWDEEYPPQ.MGEE..YSQT.VNSTAMYRFFKYIENRDVAKQVMKERGLKKIR.LG
A9UPC4_MONBE/63-292MARCADLGERQCHVVILA.DSDTVEWDDDLPPQ.LGEQ..YAKV.VHNSSLLRFLYHYENRTIAKRILKEKGLKKIK.LG
E4XC39_OIKDI/75-305LVEASAVGDREIRLVVLH.DEDIIDWDKDFPPL.SEEERQSLYT.VVSSKLSRFAKYIENREVAKQVLVDRGFKKIR.LG
F7AXE7_CIOIN/162-392MVNVAQRGDRECHIVILM.EEDNVDWDPDFPPQ.MGEE..YTET.VRSTPLHRFFRYIENREVAKLVLKERMLKKIR.LG
T1L0V7_TETUR/82-310MVASAQRGERECHIAVLT.DDDVVDWDDEFPPQ.TGQE..HCQI.IYNSALYRFFKYIENRDVAKQILRDRGLKKIR.LG
W5KS29_ASTMX/198-429ALSSALCTRRSCMAKRLEFPSSTLEISAEMPPQ.VGFS..TQKVCLVPTLVFKLFRYSKNRKLTAPQIRKSHLNVSQILF
E9BXQ6_CAPO3/355-585MAVSAEAGDRECYMVVLT.DTDTIDWDDEDPPG.VGEE..HAQI.IRSSALYRFLRFNENRALVKEVLKEKGLKKIV.LG
K1QX87_CRAGI/168-393M.....NGDRECHIVVLT.DEDILDWDNDYPPQTLGEE..YSQI.VYSTHLYRFFKYIENRDVAKQLLKERGLKKIR.LG
H2KQY4_CLOSI/945-1176LVKCAQLGERECHVVIVT.DEETIDWDPDYPPQ.MPENELHSHI.IYSTQMFRFLKYIENREVAKQVLLERGLKKIR.IG
A7S9A9_NEMVE/133-363MVTAAKKGNRECHIVVLS.DEDIVEWDEEYPP..MGED..YTQI.VYSTPLYRFFKYFENRDVAKDVLKDRGLKKIR.LG
H3FGC5_PRIPA/9-239MVASTEHGERECHIVVLL.DDDVVDWDDEYPPQ.MGEE..TTHV.VYSTHLYRFFKYAENRDCAKQVLKERGLKKIR.LG
B3SBZ6_TRIAD/36-264MATCAETGIRECHVVILD.EDDYINWDEEYPPR..NEE..RAQL.IFNSEMYRFFKFVENRDVVKEVLKEKGLKKIR.LG
F2U9A9_SALR5/300-529MAKCAEIGDRKCHIVVLR.SEQTVEWDEDLPPS.LGEQ..LAKV.VYDTALNRFLFSYENRNIARQLLKDKGLKKIK.LG
G3HKB9_CRIGR/153-382MVGCAKKGERECHIVVLT.DEDSVDWDEDHPPP.MGEE..YSQI.LYSSKLYRFFKYIENRDVAKTLLKERGLKNIR.IG
F6TDG6_XENTR/196-425MVASAQSGERECHIVVLT.DDDVVDWDEEYPPQ.MGEE..YSQI.IYSTKLYRFFKYIENRDVAKSVLKERGLKKIR.LG
T1G141_HELRO/46-274MVVSAQRGDRECHIVILT.DEDVVDWDGDYPPH.LGDE..CPQV.IHSTHMYRFFKYIENRDVAKQVLRDRGLKKIR.LG
I1FT20_AMPQE/71-291MVMCARKGERECQIVVLM.EDDVIEWDDEYPPA.VGEE..HIQR.VHSNDLCRFFKYFENRDIAKDLLREKGLKKIR.IG
E5SRV9_TRISP/693-924MVKSARDGERECHIVVLL.DDDIVDWDENYPLQ.IGED..LPLA.VYSSQLYRFFKYIENRDVAKQLLKDRGLKKIR.LG

PF07707

IPP_MOUSE/139-241LIKILRSE-----------ELSIEDEYQ---------------------VFLAAMQWI--LK------------------
KBTBC_MOUSE/131-233LLALIKSD-----------DLNISREES---------------------ILDLVLRWV--NH------------------
Q7PXP7_ANOGA/170-272LANLLRSD-----------DLNVPNEQE---------------------VFHALMAWI--QY------------------
KLHL8_MOUSE/178-280LHKLLSSS-----------DLNIDSEKQ---------------------VYSAAIKWL--LA------------------
O61795_CAEEL/158-260LTTIIKSD-----------KLNAASEEL---------------------VFSAVIQWV--RH------------------
KLHL6_MOUSE/172-274LYHILRSD-----------DLCVTEEAQ---------------------VFETVMSWV--RH------------------
KLH18_HUMAN/140-242VLELVSRD-----------ELNVKSEEQ---------------------VFEAALAWV--RY------------------
KELC_DROME/258-360VISLIGND-----------RISVPNEER---------------------VYECVIAWL--RY------------------
KBTB3_HUMAN/150-252LQKCLESD-----------ELNVPEEEM---------------------VLKVVLSWT--KH------------------
GAN_MOUSE/134-236LKEVISLE-----------KLNVGNERY---------------------VFEAVIRWI--AH------------------
Q7PMB5_ANOGA/179-281LVKVIASE-----------ALRVDSEYQ---------------------VFNAALRWI--RH------------------
Q7QHD7_ANOGA/175-277LIDVIGRD-----------ELNVKSEEC---------------------IFEACMRWV--KH------------------
Q7QI84_ANOGA/148-248LCSLLLRD-----------SF.FAREVE---------------------IFQAVFDWC--RC------------------
KBTB8_HUMAN/152-254LISILDSD-----------DLNVDREEH---------------------VYESIIRWF--EH------------------
Q7Q1T2_ANOGA/174-276VQDLISNS-----------QLNICSEEK---------------------VFMAVLNWV--KH------------------
KLH21_HUMAN/138-239LLRYLRDD-----------GLCVPKEEA---------------------AYQLALRWV--RA------------------
ENC1_HUMAN/149-251VVQLLSSE-----------ELETEDERL---------------------VYESAINWI--SY------------------
O16313_CAEEL/170-270LKELLARD-----------SF.FALELK---------------------IFNAVRSWH--QN------------------
O18147_CAEEL/153-255AIELLRND-----------HLYVDSEEQ---------------------VYVAAMEWL--NC------------------
KLH41_HUMAN/135-237LISVISND-----------SLNVEKEEA---------------------VFEAVMKWV--RT------------------
KLHL2_HUMAN/158-260VCSLISSD-----------KLTISSEEK---------------------VFEAVIAWV--NH------------------
KEAP1_RAT/184-286LATLISRD-----------DLNVRCESE---------------------VFHACIDWV--KY------------------
Q6DJ21_XENTR/98-200VTHLLNQD-----------TLTVRAEDQ---------------------VYDAAVRWL--KY------------------
Q6GKZ1_DROME/195-298FYSIISDD-----------ELNTREEDH---------------------VWKLCVKWI--DR------------------
KLH23_MOUSE/139-240FLFILSRK-----------NLSVWKEEA---------------------ILEPVIKWT--AH------------------
KLH21_DANRE/140-242LLEFVSDD-----------GLCVDKEET---------------------AYQIAVRWV--KA------------------
Q6PFE1_MOUSE/275-376IAKLLASD-----------DMNIPNEET---------------------ILNALLTWV--RH------------------
KLH31_DANRE/173-274INEFLTDD-----------SLQLPSELT---------------------AFQIAVKWL--DF------------------
KLH17_MOUSE/192-294VLELVSSD-----------SLNVPSEED---------------------VYRAVLSWV--KH------------------
Q6TEQ2_DANRE/149-251VQELVFSE-----------ELEVEDESI---------------------VYEAVIDWV--RA------------------
Q7KSF5_DROME/192-294LIALIRRD-----------ELNVQEERE---------------------VYNAVLKWV--KY------------------
Q7SYC4_DANRE/168-270LEEYIASD-----------EMVIGKEET---------------------VFEAVMRWV--YY------------------
Q86BQ6_DROME/179-281LGKLLSSD-----------DLNVPSEQD---------------------VFHSLMSWV--RH------------------
KLH26_MOUSE/156-257LVFFLQSN-----------RLQSCAEID---------------------LFRAAVRWL--QH------------------
KLH38_MOUSE/136-237LRDYLGDD-----------RL.CGEEEK---------------------VFEALMAWV--KH------------------
KLH31_MOUSE/172-273INELLVDD-----------DLQLPSELV---------------------AFQIAMKWL--EF------------------
Q8N4I8_HUMAN/152-254VCSLISSD-----------KLTVSSEEK---------------------VFEAVISWI--NY------------------
KLH36_HUMAN/148-250LCVYLSSS-----------EVQRECEHD---------------------LLQAALQWL--TQ------------------
KLH25_MOUSE/149-251LLDLISRD-----------ELETEDERV---------------------VFEAILQWV--KH------------------
Q8V3G0_SWPV1/125-224IELILGSD-----------YLNIIDEDI---------------------SVVILFNWL--RY------------------
KLH28_MOUSE/137-239LDEIVSND-----------CLNVATEET---------------------VFYALESWI--KY------------------
BTBDH_MOUSE/169-269LAQLLQRS-----------DLVLQDELE---------------------LFHALEAWL--GR------------------
Q9Q8G2_MYXVL/125-224LQNILSSD-----------DLNVIDEDV---------------------CAVVLVTWL--KQ------------------
Q9VGE5_DROME/143-245LLELMRRD-----------ELNVRTEEV---------------------IFEACMKWV--KY------------------
Q9VK21_DROME/187-289LSQLLNSE-----------LLRVDSESQ---------------------VFQAALRWI--KH------------------
Q9W2S3_DROME/150-248LEEVLRRD-----------CF.FAPEVQ---------------------IFLAVWKWS--RF------------------
Q9W4L5_DROME/162-265VITMLQQD-----------SLGVNSEME---------------------VLVAIIRWL--NC------------------
Q9W4S3_DROME/306-407VTTLLEQD-----------MLCVNSEDE---------------------IFFAVFHWL--NY------------------
A1Z7I5_DROME/227-323MLLLIQSD-----------LIGVNTELE---------------------VFMAAARWL--SH------------------
A9JSR2_XENTR/131-232VEKLIHCD-----------EIQINSEEP---------------------VFEAVINWV--KH------------------
A9ULG0_XENTR/113-214LVQILQSE-----------ELSIEDEYQ---------------------VFSAAMIWI--QK------------------
B8JJT0_DANRE/167-269LVSLIQHD-----------DLGVTEEEQ---------------------VFDTVIRWV--KA------------------
E7FB71_DANRE/142-244VLELVGCD-----------ELNVQAEEQ---------------------VFEAVLAWV--RH------------------
F1Q6J6_DANRE/201-302VRDWLSDA-----------EITVDSEEV---------------------LFDAVVKWV--QK------------------
F1QEG2_DANRE/136-238LLALIGGD-----------MLNVEKEEV---------------------VFESVMKWV--RN------------------
F1QLH3_DANRE/143-240LLTVVRRD-----------SF.ASSERE---------------------IFQALCHWC--HH------------------
F6S3C9_XENTR/135-236LLCYLGDP-----------LLQVRDEES---------------------RTKAALHWV--KQ------------------
F6VL93_XENTR/137-231LIELVSSD-----------NLNVEKEET---------------------VREAAMSWL--DY------------------
F7AJ67_XENTR/158-260LIAVISSD-----------GLNVEKEEL---------------------VFEAIMKWV--QT------------------
F7FRL0_MACMU/216-317FIAYVSND-----------SLNTKAEEL---------------------VYETVIKWI--KK------------------
H2V3E3_TAKRU/76-175FCSIIASD-----------HLCVSSEAV---------------------VFRAVVRWI--NH------------------
H2V3E4_TAKRU/116-216LCDIFDHD-----------ELNVKNESI---------------------VFEAICKWI--SH------------------
KBTB1_VACCW/123-219MIKILSDD-----------MLNIKNEDF---------------------APLILIKWL--ES------------------
KLH25_XENTR/149-250VLDLISSD-----------ELEIEDEQV---------------------VFNSVLHWV--KE------------------
Q0V9R8_XENTR/168-270LIDYVSTD-----------ELVVSKEEL---------------------VFEAVMRWV--YH------------------
Q1ECZ2_DANRE/160-262LLELISQD-----------SLKVLCESE---------------------VYKACIDWV--RW------------------
Q66IL9_XENTR/176-277LAFVLSSN-----------SLKQCTELE---------------------LFKAACRWL--RY------------------
Q66JH7_XENTR/149-248LMELVLSE-----------ELEVEDESL---------------------VYEAVMGWI--KF------------------
BTBDH_XENTR/160-257MVSLLQRS-----------DLVLQSELE---------------------LFSAVEEWI--SK------------------
Q7PNH6_ANOGA/201-303VAHLIKSD-----------RLSVPTEEK---------------------VYECVITWI--QY------------------
Q8BUX1_MOUSE/155-254ISKLLCSD-----------DINVPDEET---------------------IFHALMQWV--GH------------------
BTBD9_MOUSE/143-239LLNIVLRD-----------SF.AAPEKD---------------------IFLALLNWC--KH------------------
KLHL1_MOUSE/317-416LHKLLASD-----------DVNVPDEET---------------------IFHALMMWV--KY------------------
Q9VRA7_DROME/151-248LRFILSSN-----------YPIDVAEQD---------------------LVRLVCSFA--IE------------------
W5MS53_LEPOC/170-271LIDIISSD-----------ELNVRSEEQ---------------------VFNAVMAWV--KY------------------

PF00651

BAT47_CAEEL/8-109PAIF.............EATVQKILPLA.-QKFGSKTV---LQKCERFLITIS---------------------------
ZBT17_MOUSE/14-114KLSL............SPENVDDVLAVA.-SFLQMQDI---VTACHTL..KSL---------------------------
Y2060_ARATH/201-303RTQIL............ESELAPLRDLS.-SKFEVMSL---VRQCEESIDHFK---------------------------
Y2060_ARATH/341-455ELNMEDT.......VNFGTELIHLLFLA.-DRFGVVPL---HQECCKMLLECL---------------------------
O61795_CAEEL/46-153AIAID............DSNVQDILPAA.-CLLQIHEV---QTACCDYLKKQL---------------------------
O76610_CAEEL/10-114PAIF.............ECTIYQILLLA.-VKFQTYTV---IKKCEKFLIHTS---------------------------
KELC_DROME/147-253TVEVN............EDNVQVLLTAA.-NLLQLTDV---RDACCDFLQTQL---------------------------
KLH21_HUMAN/25-133RVAVS............GDNAEPLLRAA.-DLLQFPAV---KEACGAFLQQQL---------------------------
O45927_CAEEL/141-251HLPPKQ........WIKESDLVEQFEHIQ-RILRIGKS---LQISIVLEVADK---------------------------
BTBD2_HUMAN/112-217EVQIG............PETVMTTLYTA.-KKYAVPAL---EAHCVEFLKKNL---------------------------
O44818_CAEEL/140-244YAID.............EETVDGILHLA.-HLYDMPFP---IKRCEEFLVDSS---------------------------
Q18030_CAEEL/118-226VFRIT............RGNIVELLELS.-HFFDCKNV---TMFCEYNLCNDT---------------------------
LZTR1_HUMAN/655-764EVNMP............PEDSLYLFAAP.-YYYGFYN.---.NRLQAYCKQNL---------------------------
BAB1_DROME/117-222EINVSQ.........DQ...IGPLLRIA.-EMLKVRGL---ADVTHMEAATAA---------------------------
O17112_CAEEL/140-243TVFPC............DRTVEKILAMA.-DRFIVQSA---IDHVEYHLLHNS---------------------------
BACH1_MOUSE/24-130KLIL............SKDNVDEVCRCV.-EFLSVHNI---EESCFQFLKFKF---------------------------
BCL6_HUMAN/22-129RLNL............REGNIMAVMATA.-MYLQMEHV---VDTCRKFIKASE---------------------------
BRC1_DROME/22-127EVNVHQ.........KS...LQSFLKTA.-EVLRVSGL---TQQQAEDTHSHL---------------------------
CALI_BOVIN/18-128KVVI............SEQNVEELLRGA.-QYFNTPRL---RIHCNDFLIKSI---------------------------
ENC1_HUMAN/36-144RVIIN............EENAESLLEAG.-DMLEFQDI---RDACAEFLEKNL---------------------------
GAGA_DROME/24-129EVSVDH.........AQ...LPSLLQAA.-QCLNIQGL---APQTVTKDDYTT---------------------------
GCL_DROME/56-166EIEIE...........S.ADVISVLATA.-TLFHLDGI---IDKCAEVMVDNI---------------------------
ZBT48_HUMAN/16-119HLALT............SGNRDQVLLAA.-RELRVPEA---VELCQSFKPKTS---------------------------
KLH41_HUMAN/23-130SIDLN............DGNVQDIFALA.-SRFQIPSV---FTVCVSYLQKRL---------------------------
LOLA2_DROME/22-127EVNISQ.........DQ...LAALLKAA.-ESLQIKGL---SDNRTGGGVAPK---------------------------
KAISO_HUMAN/22-125KIVRV...........RSDLLDELIKSG.-QLLGVKFI---AELGVPLSQVKS---------------------------
ZBT14_HUMAN/26-132KISV............KKEDVNLMMSSG.-QILGIRFL---DKLCSQKRDVSS---------------------------
ABTB2_RAT/832-945GTESME.........IPTADILQLLSAA.-NLFQLDAL---QRHCEILCSQTL---------------------------
ZBTB5_HUMAN/14-123TLMLG............ESNVMDVLLAA.-SHLHLNSV---VKACKHYLTTRT---------------------------
ZBT7B_HUMAN/24-145TLTT............SSANMPAVLQAA.-RLLEIPCV---IAACMEILQGSG---------------------------
ZBT22_HUMAN/47-151RLSM............AAADIVNFLTVG.-SVLQMWHI---VDKCTELLREGR---------------------------
O16313_CAEEL/54-165KIDFAG.........VELDILLEYLSLA.-HRYDLIQL---MTAISEYFKEIL---------------------------
O16566_CAEEL/67-171SAID.............DSTIDGVLQLA.-QMFDVSLA---IRKSEEFLVEKS---------------------------
O16736_CAEEL/144-248SAIN.............DLTVEGILHIA.-DMYDTPMV---VRKCEEFLIKGT---------------------------
O16740_CAEEL/129-232LVFPT............DKTAAKLLTLA.-NRFQMRAV---TAQVEHHLLWHS---------------------------
O17197_CAEEL/70-174TVLPV...........NDKTVEKLLELA.-DRFIIPAV---LRLAETHLLTHS---------------------------
O17253_CAEEL/135-236AAFSN............HQNAEVLLELG.-NRFKIPAV---MRHVENQIIRDT---------------------------
O17297_CAEEL/141-242PAID.............EDTIDGILTLA.-HKFTMPLP---IQKCEEFLIEKS---------------------------
O18147_CAEEL/41-148ELRIT............TSNVQSIMLGA.-NFFQMLEV---VQHCGNFLLTRL---------------------------
BPM3_ARATH/184-303VLPNVHEITGSTSASSFTNMIQHLLAAA.-DLYDLARL---KILCEVLLCEKL---------------------------
Y2045_ARATH/15-132DGSI.C........SASLKKHARSLFHAA-DKYEIPHL---RDLCRNELISSL---------------------------
NACC1_RAT/20-124RLSM............NMGDQFLLIYTA.-GFLQIQEI---MEKGTEFFLKVS---------------------------
ZBT43_HUMAN/23-126RLVM............PAPEIVSYLTAA.-SFLQMWHV---VDKCTEVL.EGN---------------------------
O44815_CAEEL/142-246SAID.............EDTIEGILHLA.-HMYDMPFP---TRKCEEFLIDFS---------------------------
O44817_CAEEL/137-241SAID.............DGTIKGILELA.-DMYDMPFP---IRKCEEFLIDSS---------------------------
O44905_CAEEL/112-216MIFPN............DETADKLLELA.-DRFLMPAV---TNMVGFHLCHSD---------------------------
O45594_CAEEL/135-238AVFPN............DRTAEKLLEMG.-DRFIIQSV---INHVEYHLLHNT---------------------------
O61932_CAEEL/71-176KVTFR............LATLHEDLKAI.-SYFEIVTL---QEDVEKRLVELA---------------------------
BTB1_SCHPO/608-735TLLSPWH......LDSRFSPLKENLSKLA-NLLELPHL---AEVLPFSVSRQP---------------------------
O76568_CAEEL/144-248PAID.............DETIDGILHLA.-HMYDMSVP---LRKCEEFLINES---------------------------
KEN_DROME/23-131QTCIT.............SRDVNYLHDLL-LLLQIKSD---SWKTTDSAYLSS---------------------------
Y4409_ARATH/15-129DGSM.L........SEKAKQHAMSLYSAA-KDYEIPRL---WCLCRKELIASL---------------------------
BCL6B_MOUSE/28-135RLRL............SPATAPAVLAAA.-TYLQMEHV---VQACHRFIQASY---------------------------
ZBT7A_CHICK/24-131TLTV............STSNVNDILNAA.-KLLEIPAV---RDVCTDLLDRKI---------------------------
ZBT18_HUMAN/14-121KLQF............KDLPIEDVLAAA.-SYLHMYDI---VKVCKKKLKEKA---------------------------
ZBTB6_HUMAN/23-127ALEVK............RKELLKYLTAA.-SYLQMVHI---VEKCTEALSKYL---------------------------
Q17523_CAEEL/126-230FKME.............RENVEQVLDLA.-SKWEMKSV---ITKYEQFLIKTR---------------------------
Q17782_CAEEL/193-300TCTN............MGGNALDILAAA.-ERFALPGL---KNIAEVAMRNGL---------------------------
Q19838_CAEEL/23-130EIDIP............ETTIADVLAVA.-SYLRVTML---QRQIEQKILNHN---------------------------
Q20183_CAEEL/184-293EVKIE............AESVMTTLYTA.-KKYAVPAM---EKECVRFLKQRL---------------------------
BAT38_CAEEL/220-325HKPIT............SDNVEYLLELG.-DKYEIQYV---MDECERFLVGSE---------------------------
Q21899_CAEEL/143-245RQPVT............KKSLDYLLQLA.-DRYQCQPI---VDACEMFMCAHY---------------------------
MMD4_DROME/22-128EVNVKQ.........DA...LPAFISTA.-ESLQIKGL---TDNDPAPQPPQE---------------------------
ABRU_DROME/93-198EVNVSH.........EQ...LPDFLKTA.-HLLQIRGL---ADVNGGYPYSKA---------------------------
CP190_DROME/20-127TLEFE............LKMYGKLLRTA.-KEMNMTVL---LKLLEAHRRTME---------------------------
HIC1_CHICK/53-160RLGE.CE.......PGGEQSLGAVLAAA.-SYLQIPGL---VALCKKKLKRSG---------------------------
MEL26_CAEEL/191-300R....C........NKDITDMATALLIAA-DKYRLEEL---KSHCEKYLVENI---------------------------
SPOP_HUMAN/190-297.....K........APNLDKMADDLLAAA-DKYALERL---KVMCEDALCSNL---------------------------
TTKB_DROME/23-127EVSVDQ.........ER...LTAFLRVA.-ESLRIKGL---TEVNDDK.PSPA---------------------------
KBTB1_VACCW/11-118PLSLT..........ND..NVKYILSTA.-DFLQIGSA---ITECENYILKNL---------------------------
VMT8_MYXVL/6-112SIELH............KGNTESIFSLV.-HYLQIKPL---IKKCIYEFNSIV---------------------------
ZBT39_HUMAN/20-126ELFTD............LINVGVIYEVA.-ERLGMEDL---LQACHSTFPDLE---------------------------
ZBT24_HUMAN/27-133YLHAS............EKSTEQILATA.-QFLKVYDL---VKAYTDFQNNHS---------------------------
BTB3_SCHPO/157-262TNAVF...........TKQYNNALLSIG.-KKFQLNDF---IALYEKDREQLH---------------------------
BTB3_SCHPO/296-405KTDIA...........PELALDVVYVADM-LSLDKDRS---LKSLASIVITKQ---------------------------
YIA1_YEAST/264-390NTDIP............WMYAVDVLLLA.-DILLEDRL---KTIASTIITQSK---------------------------
BAT15_CAEEL/139-243PAID.............DGTIDGVLLLA.-HMLDVTLA---IRKCEEFLIEKS---------------------------
BAT42_CAEEL/208-319ATESL..........ESQGNIDEILAIA.-DKYEVLML---KDQCERLIAQTI---------------------------
BAT43_CAEEL/255-368.....Q........TKYIEQMAQSLIAAA-DKYQLDRL---KVMCEQALCYQL---------------------------
YR47_CAEEL/45-146AFEQG.............IKPNITLQKA.-IELLEPAA---FLQMSIALDYIS---------------------------
ZBT16_HUMAN/24-126TLQAK............AEDLDDLLYAA.-EILEIEYL---EEQCLKMLETIQ---------------------------
ZBT25_HUMAN/14-119KGPK.............QIVDHSRLEEGI-RFLHADYL---SHIATEMNQVFS---------------------------
A1Z8A5_DROME/25-125EIDVT............ESELQGLLRTA.-EQLKIKGL---CETAEN......---------------------------
F7A721_CALJA/24-127TLTIT............AGNVKHILNAA.-RMLEIQCI---VNVCLEIM....---------------------------
K7EJ49_HUMAN/67-178SISMG............EKCVLHVMNGA.-VMYQIDSV---VRACSDFLVQQ.---------------------------
BACH2_MOUSE/27-132KLLLS............RENIREVIRCA.-EFLRMHNL---EDSCFSFLQTQ.---------------------------
Q54RA9_DICDI/42-142IIYLS............PENVIPLLAMS.-DHYLIRDL---QHLCLLFLDQN.---------------------------
Q8V3S6_SWPV1/8-114NIVLT............KDNIELVIQVC.-DYLCIDSL---IKICEEYICG..---------------------------

PF03931

Q21367_CAEEL/8-70------------------------------YHHRN---------------------------------------------
SKP1_HUMAN/2-67------------------------------THHKD---------------------------------------------
O77430_DROME/2-66------------------------------HYHKD---------------------------------------------
ASK16_ARATH/4-64------------------------------KKHVL---------------------------------------------
ASK14_ARATH/4-64------------------------------KKHVV---------------------------------------------
ASK19_ARATH/4-64------------------------------KKHVE---------------------------------------------
SKP1A_ARATH/4-63------------------------------KR.HV---------------------------------------------
SKP1B_ARATH/5-64------------------------------.KRHV---------------------------------------------
ASK12_ARATH/4-64------------------------------KKYHV---------------------------------------------
Q89374_PBCV1/1-61------------------------------SFYNV---------------------------------------------
ELOC_YEAST/4-66------------------------------NYNLK---------------------------------------------
SKP1A_DICDI/2-63------------------------------RHHHQ---------------------------------------------
SKP1_EMENI/4-65------------------------------AHHRN---------------------------------------------

PF11822

Q29D48_DROPS/298-606GPQLD------------GNNVVPILVSA--SFLQMEPL---LLECLAFCHAHLSEVVRTSTNLSCLNDALVTRLAAMFTN
Q4Q8A2_LEIMA/20-417APQIT------------NSNVVSICLSS--SFLQMQEL---SDNALMYLSAHLKEIVSSSFDLTNLPTHLVLRLSHMVRD
Q0IFU1_AEDAE/236-536WPALD------------PSNVVPILVSA--SFLQMEPL---LLDCLSFCHARLNEVVKASANLACLNDSIITRLAAMFTN
Q383Z9_TRYB2/26-376QRSFT------------PKNAVSLALSS--NFLHMTQL---VEMTLLYIKDHLVEVILSGVNMDCFTGELLARLASMMSE
A4HGL7_LEIBR/10-407TQEIT------------KDNVVSICLSS--SFLQMQEL---SDNALMYLGVHLSEIVSSSFDLTNLPTHLVLRLSHMVRD
A7S8V2_NEMVE/1-302PPKLE------------PNNVISILISS--DFLKMDNL---VNDCISFCHENMSAIVSTPCNMNCINDKLVTRISELFNH
Q4DXB1_TRYCC/30-401DRPFT------------PENAVSIALSS--NFLLMTQL---VDLPLQYIKENLVQVMLSGVNMECLTGELLARLCTMLSE
F7EPV1_XENTR/146-448APKLE------------PGNVISILISS--EFLKMDSL---VDKCIHYCHKNMSAIVATPCNMNCINANLLTRIADLFTH
H3DIA0_TETNG/1-303KPRLE------------PSNVISILISS--EFLKMDTL---VEECIQYCHKHMSAIVATPCNMNCINSNLATRITDLFNH

PF02214

KCNSK_CAEEL/135-238RVKRP-----------EIVPIDIFLKEM--RFFQMGDDL..LEEF-----------------------------------
KCNA5_MOUSE/113-204RLRRP-----------VNVSLDVFADEI--RFYQLGDEA..MERF-----------------------------------
KCNAL_DROME/43-132KLHYP-----------KHECLTSYDEEL--AFFGIMPDV..IGDC-----------------------------------
KCNS1_MOUSE/21-120HLHVL-----------DELCVFAFGQEA--DYWGLGENA..LATC-----------------------------------
KCNS3_HUMAN/17-116KLHVM-----------EELCVFSFCQEI--EYWGINELF..IDSC-----------------------------------
Q18986_CAEEL/7-97ALPDS-----------.DREVREVLAEA--SYFLLDPL...IELC-----------------------------------
KCNA7_MOUSE/47-138RLRRP-----------AHVPLDVFLEEV--SFYGLGAAA..LARL-----------------------------------
P91557_CAEEL/6-93DLPET-----------.LKELMPIFRET--EYYTLASL...VEQC-----------------------------------
O17001_CAEEL/21-113DLCG.-----------..IKVDTLKHEA--LFFGLTPLIRRLTLC-----------------------------------
O16612_CAEEL/6-96VLPDS-----------.KKDMLELKKEA--EYYLLSNL...AKLC-----------------------------------
O16709_CAEEL/9-96DLPET-----------.LKDLKMLLGEA--EYYELTEL...CDDC-----------------------------------
O16706_CAEEL/5-95VLPSC-----------.ELTVKELLAEA--QFYLLDEL...IELC-----------------------------------
KCNB1_HUMAN/33-132RLHMM-----------EEMCALSFSQEL--DYWGIDEIY..LESC-----------------------------------
KCNC1_HUMAN/10-104KLHCP-----------ADVCGPLYEEEL--AFWGIDETD..VEPC-----------------------------------
P91564_CAEEL/5-95PLPED-----------.ERELRELMAEA--QFYWLDGL...VLMC-----------------------------------
KCNAW_DROME/12-102KLHYP-----------TDVCGPLFEEEL--EFWGLDSNQ..VEPC-----------------------------------
KCNS2_MOUSE/19-118KLHVM-----------AELCVFSFSQEI--EYWGINEFF..IDSC-----------------------------------
O16613_CAEEL/8-96DLPDS-----------.ENELKELKREA--EYYSLEKL...ATLC-----------------------------------
KCA10_HUMAN/88-179KIRRP-----------ANVPIDIFADEI--SFYELGSEA..MDQF-----------------------------------
KCND1_HUMAN/42-131RLHCP-----------RQECIQAFDEEL--AFYGLVPEL..VGDC-----------------------------------
KCND3_RAT/42-131KLHYP-----------RYECISAYDDEL--AFYGILPEI..IGDC-----------------------------------
Q20381_CAEEL/28-127KLHRP-----------MDICPIRLRYEL--DYWRIPTPF..MSPC-----------------------------------
KCNG1_HUMAN/65-164KLRLL-----------REMCALSFQEEL--LYWGIAEDH..LDGC-----------------------------------
Q26597_SCHMA/53-144RLRRP-----------VNVPIDVFNEEI--KFYELGEEA..LAKY-----------------------------------
O16711_CAEEL/8-100DLLPE-----------SEKEVREILKEA--QFYLLEGL...MELC-----------------------------------
KCNV1_RAT/44-153RLHVM-----------EQLCALSFLQEI--QYWGIDELS..IDSC-----------------------------------
Q18776_CAEEL/84-176MNPG.-----------..LSEEGILAEA--DFYNLPSL...SQLI-----------------------------------
KCNAB_DROME/279-378KLHIV-----------DEMCVLAFSDDL--EYWGVDELY..LESC-----------------------------------
O16630_CAEEL/2-90DLPES-----------.LKHLRQLLREA--IFYGLEKL...IECC-----------------------------------
P91256_CAEEL/38-137VVHRP-----------SEICPASFLSEL--DFWRISHQH..VGSC-----------------------------------
BACD2_MOUSE/30-120TLPQS-----------.RQEIQELMAEA--KYYLIQGL...VSTC-----------------------------------
O16708_CAEEL/99-187ILPES-----------.MESLKELLHEA--ILYKLSGL...SEKC-----------------------------------
KCNG2_CHICK/59-158KLRLL-----------REMCALSFQEEL--VYWGIEEDH..LEWC-----------------------------------
B4L763_DROMO/24-111KLVL.-----------DGVSEEGVLEEA--EFYNVTQL.......-----------------------------------

PF16017

E7F994_DANRE/70-299IEGYPTCKEKVKRRP.GGKSEVIYSYLQR-PFIQLSWE---KEEGKSRHVDFQC..VRSRS.VPNLIT------------
G3W7V3_SARHA/151-380IEGYPTCKEKIKRRP.GGRSEVIYNYVQR-PFIQMSWE---KEEGKSRHVDFQC..VRSKS.LTNLVA------------
W4ZCZ0_STRPU/50-279IEGYPTYKEKIKQRP.GGKPEVIYNYVQR-PFLRMSWE---KEEHKSRHVDFQC..VRSRS.IPNLAS------------
E9JD94_SOLIN/154-383IEGYPTYKEKVKKRA.GGRAEVIYNYVQR-PFIHMSWE---KEEAKSRHVDFQC..VKSKS.VTNLAE------------
A9UPC4_MONBE/63-292IEGFPTFAKRIRRNAAGAKVEVEYHYDLR-PYVKASWE---KEEQKSRHVDFQY..VRTST.TTNVLS------------
E4XC39_OIKDI/75-305IEGYPTTKERVKQRR..GKSHVSYNFVQR-SFITLSWE---KEEHRSRHVDFQC..VKSKS.SSNLPE------------
F7AXE7_CIOIN/162-392IEGYPISMDQVKRRS.GGRQEAIYDYVQR-SFIAMSWE---KEESKSRHVDFQC.VAKSKS.ITNLVA------------
T1L0V7_TETUR/82-310IEGFPTHEEKRRRRP.GARPEVIYNYVQR-PFVRMSWE---KEEAKSRHVDFQC..VKSKS.ITNLAN------------
W5KS29_ASTMX/198-429FPGYPTYKEKVKKRP.GGRPEVIYNYVQR-PFIRMSWE---KEEGKSRHVDFQC..VKSKS.ITNLAA------------
E9BXQ6_CAPO3/355-585IEGFPTCKEKIKLSSQRGRREVVYIYEQR-PFIRTSWI---KEEHKSRHVDFQM..VRTRSRESSIG.------------
K1QX87_CRAGI/168-393IEGYPTNKEKVRKRP.GGRPEVIYNYVQR-PFIRMSWE---KEEAKSRHVDFQC..VKSKS.LSNLSS------------
H2KQY4_CLOSI/945-1176IEGYPTCKDRVKFRP.GVRPEAIYNYVQC-PFLRMSWE---EEENKSRHVDFQC..VKSKS.VSDLTS------------
A7S9A9_NEMVE/133-363IEGYPTYKEKVKQRPNGGRPEVIYNYVQR-PFVRMSWE---KEESKSRHVDFQC..VKQKTGTPGLVE------------
H3FGC5_PRIPA/9-239MEGYPTHKEKVKRRF..NKAEVIYNYVQR-PFVHCSWE---KEEARSRHVDFACPIVKSKS.NPSLAA------------
B3SBZ6_TRIAD/36-264IEGCPTYMDKVKHRGSGARPEVIYNYIQR-PFLHASWE---SEDARGRHVDFQC..VRSKS.SNNLLS------------
F2U9A9_SALR5/300-529IEGFPTFVERTRIGSNDEKLEVEYFYDQS-PFIKASWE---KEEHKSRHVDFQY..VRTNT.SANVL.------------
G3HKB9_CRIGR/153-382IEGYPTCKEKIKRRP.GGRSEVIYNYVQR-PFIQMSWE---KEEGKSRHVDFQC..VRSKS.LTNLVA------------
F6TDG6_XENTR/196-425IEGYPTYKEKVKKRP.GGRPEVIYNYVQR-PFIRMSWE---KEEGKSRHVDFQC..VKSKS.ITNLAA------------
T1G141_HELRO/46-274IEGYPTYKEKIKRRP.GGRQEVIYNYVQR-PFLHMSWE---KEEAKSRHVDFQC..VKSKS.VTNLLE------------
I1FT20_AMPQE/71-291IEGFPTTKEKVKVRPTTGRMEVVYNYIQR-PFVRMSWE---KDEAKSRHVDFTC..VKIKT.......------------
E5SRV9_TRISP/693-924IEGYPTCKEKVRRRP.DGKSEVVYSYVQR-PFIHMSWE---KEEAKSRHVDFACPIVKSKS.NPSLAS------------

PF07707

IPP_MOUSE/139-241----------------DLGKRRKHVVEVL.DPVRFPLL---PSQRLLKYIE-----------------------------
KBTBC_MOUSE/131-233----------------NQALRTEHLVELL.KQVRLELI---NASFLRQALR-----------------------------
Q7PXP7_ANOGA/170-272----------------DAEGRKRHIPELL.ALIKLPLL---QPSFIVDHVE-----------------------------
KLHL8_MOUSE/178-280----------------NPQHHPKWLDETL.AQVRLPLL---PVDFLMGVVA-----------------------------
O61795_CAEEL/158-260----------------DISKRKTHLSMLL.SHVRLPLC---TPKFLVSVVS-----------------------------
KLHL6_MOUSE/172-274----------------KQSERLCLLPCVL.ENVRLPLL---DPWYFVEMVE-----------------------------
KLH18_HUMAN/140-242----------------DREQRGPYLPELL.SNIRLPLC---RPQFLSDRVQ-----------------------------
KELC_DROME/258-360----------------DVPMREQFTSLLM.EHVRLPFL---SKEYITQRVD-----------------------------
KBTB3_HUMAN/150-252----------------NLESRQKYLPHLI.EKVRLHQL---SEETLQDCLF-----------------------------
GAN_MOUSE/134-236----------------DVEMRKVHMKDVM.SALWVSGL---DSSYLREQML-----------------------------
Q7PMB5_ANOGA/179-281----------------DVVPRRQYVFEIL.SHVRIALV---PVGLIDQAIA-----------------------------
Q7QHD7_ANOGA/175-277----------------EQETRSEYLPLIL.ANIRLPLL---SPQFLADSVA-----------------------------
Q7QI84_ANOGA/148-248----------------NAD.TVPNVDVVV.GKVRFELM---SLEELLTVVR-----------------------------
KBTB8_HUMAN/152-254----------------EQNEREVHLPEIFAKCIRFPLM---EDTFIEK.IP-----------------------------
Q7Q1T2_ANOGA/174-276----------------DLSERKKHISELM.SHVRLPLV---SREFLMNCVE-----------------------------
KLH21_HUMAN/138-239----------------DPPRRAAHWPQLL.EAVRLPFV---RRFYLLAHVE-----------------------------
ENC1_HUMAN/149-251----------------DLKKRYCYLPELL.QTVRLALL---PAIYLMENVA-----------------------------
O16313_CAEEL/170-270----------------NPT.MKEASKVLL.ELVRLPLI---TQTELLNCVR-----------------------------
O18147_CAEEL/153-255----------------DVI.RHEQAAKIL.PCVRLPLL---SPTYLSSIVA-----------------------------
KLH41_HUMAN/135-237----------------DKENRVKNLSEVF.DCIRFRLM---TEKYFKDHVE-----------------------------
KLHL2_HUMAN/158-260----------------DKDVRQEFMARLM.EHVRLPLL---PREYLVQRVE-----------------------------
KEAP1_RAT/184-286----------------DCPQRRFYVQALL.RAVRCHAL---TPRFLQTQLQ-----------------------------
Q6DJ21_XENTR/98-200----------------DEPNRQPYMVDIL.AKVRFPLI---SKNFLSKTVQ-----------------------------
Q6GKZ1_DROME/195-298----------------NPESRKRHVAHLM.TGVRLGLM---TPKCFMEEVK-----------------------------
KLH23_MOUSE/139-240----------------DVENRIECIYNLL.SYINID.I---DPVYLKTALG-----------------------------
KLH21_DANRE/140-242----------------DLQHRLHYWPELL.QQVRLPFV---RRFYLLAHVE-----------------------------
Q6PFE1_MOUSE/275-376----------------DLEQRRKDLSRLL.AYIRLPLL---APQFLAD.ME-----------------------------
KLH31_DANRE/173-274----------------DEK.RLKYAPDLL.SNIRFGTI---TPQDLVSHVQ-----------------------------
KLH17_MOUSE/192-294----------------DVDTRRQHVPRLM.KCVRLPLL---SRDFLLGHVD-----------------------------
Q6TEQ2_DANRE/149-251----------------DIGRRHLDLPDLL.RCVRLALL---PETYLLKTWH-----------------------------
Q7KSF5_DROME/192-294----------------DEDNRHCKMEHIL.GAVRCQFL---TPNFLKEQMK-----------------------------
Q7SYC4_DANRE/168-270----------------DVDHRRIMLKDLL.NHVRLPLL---HPNYFVQTVE-----------------------------
Q86BQ6_DROME/179-281----------------DSAAREQHIPELL.ALVRLPLL---QPAFIMDHVE-----------------------------
KLH26_MOUSE/156-257----------------DPA.RRARASLVL.RHVRFPLM---QPAELVDSVQ-----------------------------
KLH38_MOUSE/136-237----------------DLQARWRHMQELL.QQVRLQYI---HPAFFHHFIA-----------------------------
KLH31_MOUSE/172-273----------------DQK.RVKHAADLL.SNIRFGTI---SAQDLVNYVQ-----------------------------
Q8N4I8_HUMAN/152-254----------------EKETRLEHMAKLM.EHVRLPLL---PRDYLVQTVE-----------------------------
KLH36_HUMAN/148-250----------------QPE.REAHARQVL.ENIHFPLI---PKNDLLHRVK-----------------------------
KLH25_MOUSE/149-251----------------DLEQRKAHLPLLL.RNVRLALL---PSDCLKNAVS-----------------------------
Q8V3G0_SWPV1/125-224----------------N..NVTRCPLSIL.AKIRLSLL---SNQ.VSKFIH-----------------------------
KLH28_MOUSE/137-239----------------DVQERQKYLAQLL.NSVRLPLL---SVKFLTRLYE-----------------------------
BTBDH_MOUSE/169-269----------------ARP.PPTVAERAL.RAIRYPMI---PPAQLFQ.LQ-----------------------------
Q9Q8G2_MYXVL/125-224----------------N..NMEDCPSVLL.EQVRMSLL---SMS.VKNLLL-----------------------------
Q9VGE5_DROME/143-245----------------AEDKRSELFPQVL.AAVRLPLL---SPQFLADRVA-----------------------------
Q9VK21_DROME/187-289----------------DVTQRRCYVFDVL.SHVRMALV---PVKVIDKALK-----------------------------
Q9W2S3_DROME/150-248----------------NSN...VDFKSVV.SYVRLPLM---NLEHLLQVVR-----------------------------
Q9W4L5_DROME/162-265----------------QSKCIDQATPLLM.DCLRLTLL---PLPILKRFWR-----------------------------
Q9W4S3_DROME/306-407----------------SWTERKKHAVKVM.QKVRFGLL---SP.WLRRSIC-----------------------------
A1Z7I5_DROME/227-323----------------HWPQREENVTDVV.SSIRFGLI---PPWLLIR...-----------------------------
A9JSR2_XENTR/131-232----------------NKNEREKSLPQLL.QYVRMPLL---TPRYITDVI.-----------------------------
A9ULG0_XENTR/113-214----------------DIVTRKRHVIEVL.EPVRFSLL---PPKRLHKAI.-----------------------------
B8JJT0_DANRE/167-269----------------REDDRTALLPRVL.THVRLPLL---DPWFFVERVE-----------------------------
E7FB71_DANRE/142-244----------------ERDDRESRLPELL.SKIRLPLC---RPQFLADRVQ-----------------------------
F1Q6J6_DANRE/201-302----------------NSEERVKYFEELF.RLLRLPQI---KPTYLTRVV.-----------------------------
F1QEG2_DANRE/136-238----------------DKANRVKSLAEAF.DCIRFRLL---PEKYFREKVE-----------------------------
F1QLH3_DANRE/143-240----------------NGD..GPEAKEVM.SAVRLPLM---TLFEMLNVV.-----------------------------
F6S3C9_XENTR/135-236----------------DEEGRAHCLPQLL.NVARLSSL---TDQYLQELM.-----------------------------
F6VL93_XENTR/137-231----------------NTVSRSQYLSTVL.SHLRIDAL---SE........-----------------------------
F7AJ67_XENTR/158-260----------------DKENKTKSLSDVF.DCIRFRLM---PEKYFTDKVE-----------------------------
F7FRL0_MACMU/216-317----------------DPATRTQYAAELL.AVVRLPFI---HPSYLLNVV.-----------------------------
H2V3E3_TAKRU/76-175----------------AVADRKEFTAILF.SKVRLCFL---SYEYIRL...-----------------------------
H2V3E4_TAKRU/116-216----------------NSERRKRHFAILL.PKVRLALL---SLEYIITN..-----------------------------
KBTB1_VACCW/123-219----------------TQQ...SCTVELL.RCLRISLL---SPQVIKS...-----------------------------
KLH25_XENTR/149-250----------------DLDKRKDYFPELL.RKVRLALL---PSELLKEAV.-----------------------------
Q0V9R8_XENTR/168-270----------------HVDVRRPMLQELL.THVRLPLL---HPNYFVQTVE-----------------------------
Q1ECZ2_DANRE/160-262----------------DAESRAQYFHALL.NAVHIYAL---PPTFLKRQLQ-----------------------------
Q66IL9_XENTR/176-277----------------EDA.RMEYAAKIM.KNIRFPLM---TPQDLINHVQ-----------------------------
Q66JH7_XENTR/149-248----------------DLSIRLDDLPDLL.RYVRLALL---PDQYLRS...-----------------------------
BTBDH_XENTR/160-257----------------NKP.DAPVIEKVL.RSIRYPMI---SPSQLFQ...-----------------------------
Q7PNH6_ANOGA/201-303----------------DVSGRQHHLADLM.EHVRLPLL---SQDYLVQYVE-----------------------------
Q8BUX1_MOUSE/155-254----------------DAQARQRDLAKLL.SYIRLPLL---SPQLLAD...-----------------------------
BTBD9_MOUSE/143-239----------------NA...KENHAEIM.QAVRLPLM---SLTELLNVV.-----------------------------
KLHL1_MOUSE/317-416----------------DMQRRCSDLSMLL.AFIRLPLL---PPQILAD...-----------------------------
Q9VRA7_DROME/151-248----------------QQL.NESALGDLL.RLIKWQHI---SYKSVD....-----------------------------
W5MS53_LEPOC/170-271----------------SIQERRPQLPQVL.QHVRLPLL---SPKFLVGTV.-----------------------------

PF00651

BAT47_CAEEL/8-109--------------------------------------------------------------------------------
ZBT17_MOUSE/14-114--------------------------------------------------------------------------------
Y2060_ARATH/201-303--------------------------------------------------------------------------------
Y2060_ARATH/341-455--------------------------------------------------------------------------------
O61795_CAEEL/46-153--------------------------------------------------------------------------------
O76610_CAEEL/10-114--------------------------------------------------------------------------------
KELC_DROME/147-253--------------------------------------------------------------------------------
KLH21_HUMAN/25-133--------------------------------------------------------------------------------
O45927_CAEEL/141-251--------------------------------------------------------------------------------
BTBD2_HUMAN/112-217--------------------------------------------------------------------------------
O44818_CAEEL/140-244--------------------------------------------------------------------------------
Q18030_CAEEL/118-226--------------------------------------------------------------------------------
LZTR1_HUMAN/655-764--------------------------------------------------------------------------------
BAB1_DROME/117-222--------------------------------------------------------------------------------
O17112_CAEEL/140-243--------------------------------------------------------------------------------
BACH1_MOUSE/24-130--------------------------------------------------------------------------------
BCL6_HUMAN/22-129--------------------------------------------------------------------------------
BRC1_DROME/22-127--------------------------------------------------------------------------------
CALI_BOVIN/18-128--------------------------------------------------------------------------------
ENC1_HUMAN/36-144--------------------------------------------------------------------------------
GAGA_DROME/24-129--------------------------------------------------------------------------------
GCL_DROME/56-166--------------------------------------------------------------------------------
ZBT48_HUMAN/16-119--------------------------------------------------------------------------------
KLH41_HUMAN/23-130--------------------------------------------------------------------------------
LOLA2_DROME/22-127--------------------------------------------------------------------------------
KAISO_HUMAN/22-125--------------------------------------------------------------------------------
ZBT14_HUMAN/26-132--------------------------------------------------------------------------------
ABTB2_RAT/832-945--------------------------------------------------------------------------------
ZBTB5_HUMAN/14-123--------------------------------------------------------------------------------
ZBT7B_HUMAN/24-145--------------------------------------------------------------------------------
ZBT22_HUMAN/47-151--------------------------------------------------------------------------------
O16313_CAEEL/54-165--------------------------------------------------------------------------------
O16566_CAEEL/67-171--------------------------------------------------------------------------------
O16736_CAEEL/144-248--------------------------------------------------------------------------------
O16740_CAEEL/129-232--------------------------------------------------------------------------------
O17197_CAEEL/70-174--------------------------------------------------------------------------------
O17253_CAEEL/135-236--------------------------------------------------------------------------------
O17297_CAEEL/141-242--------------------------------------------------------------------------------
O18147_CAEEL/41-148--------------------------------------------------------------------------------
BPM3_ARATH/184-303--------------------------------------------------------------------------------
Y2045_ARATH/15-132--------------------------------------------------------------------------------
NACC1_RAT/20-124--------------------------------------------------------------------------------
ZBT43_HUMAN/23-126--------------------------------------------------------------------------------
O44815_CAEEL/142-246--------------------------------------------------------------------------------
O44817_CAEEL/137-241--------------------------------------------------------------------------------
O44905_CAEEL/112-216--------------------------------------------------------------------------------
O45594_CAEEL/135-238--------------------------------------------------------------------------------
O61932_CAEEL/71-176--------------------------------------------------------------------------------
BTB1_SCHPO/608-735--------------------------------------------------------------------------------
O76568_CAEEL/144-248--------------------------------------------------------------------------------
KEN_DROME/23-131--------------------------------------------------------------------------------
Y4409_ARATH/15-129--------------------------------------------------------------------------------
BCL6B_MOUSE/28-135--------------------------------------------------------------------------------
ZBT7A_CHICK/24-131--------------------------------------------------------------------------------
ZBT18_HUMAN/14-121--------------------------------------------------------------------------------
ZBTB6_HUMAN/23-127--------------------------------------------------------------------------------
Q17523_CAEEL/126-230--------------------------------------------------------------------------------
Q17782_CAEEL/193-300--------------------------------------------------------------------------------
Q19838_CAEEL/23-130--------------------------------------------------------------------------------
Q20183_CAEEL/184-293--------------------------------------------------------------------------------
BAT38_CAEEL/220-325--------------------------------------------------------------------------------
Q21899_CAEEL/143-245--------------------------------------------------------------------------------
MMD4_DROME/22-128--------------------------------------------------------------------------------
ABRU_DROME/93-198--------------------------------------------------------------------------------
CP190_DROME/20-127--------------------------------------------------------------------------------
HIC1_CHICK/53-160--------------------------------------------------------------------------------
MEL26_CAEEL/191-300--------------------------------------------------------------------------------
SPOP_HUMAN/190-297--------------------------------------------------------------------------------
TTKB_DROME/23-127--------------------------------------------------------------------------------
KBTB1_VACCW/11-118--------------------------------------------------------------------------------
VMT8_MYXVL/6-112--------------------------------------------------------------------------------
ZBT39_HUMAN/20-126--------------------------------------------------------------------------------
ZBT24_HUMAN/27-133--------------------------------------------------------------------------------
BTB3_SCHPO/157-262--------------------------------------------------------------------------------
BTB3_SCHPO/296-405--------------------------------------------------------------------------------
YIA1_YEAST/264-390--------------------------------------------------------------------------------
BAT15_CAEEL/139-243--------------------------------------------------------------------------------
BAT42_CAEEL/208-319--------------------------------------------------------------------------------
BAT43_CAEEL/255-368--------------------------------------------------------------------------------
YR47_CAEEL/45-146--------------------------------------------------------------------------------
ZBT16_HUMAN/24-126--------------------------------------------------------------------------------
ZBT25_HUMAN/14-119--------------------------------------------------------------------------------
A1Z8A5_DROME/25-125--------------------------------------------------------------------------------
F7A721_CALJA/24-127--------------------------------------------------------------------------------
K7EJ49_HUMAN/67-178--------------------------------------------------------------------------------
BACH2_MOUSE/27-132--------------------------------------------------------------------------------
Q54RA9_DICDI/42-142--------------------------------------------------------------------------------
Q8V3S6_SWPV1/8-114--------------------------------------------------------------------------------

PF03931

Q21367_CAEEL/8-70--------------------------------------------------------------------------------
SKP1_HUMAN/2-67--------------------------------------------------------------------------------
O77430_DROME/2-66--------------------------------------------------------------------------------
ASK16_ARATH/4-64--------------------------------------------------------------------------------
ASK14_ARATH/4-64--------------------------------------------------------------------------------
ASK19_ARATH/4-64--------------------------------------------------------------------------------
SKP1A_ARATH/4-63--------------------------------------------------------------------------------
SKP1B_ARATH/5-64--------------------------------------------------------------------------------
ASK12_ARATH/4-64--------------------------------------------------------------------------------
Q89374_PBCV1/1-61--------------------------------------------------------------------------------
ELOC_YEAST/4-66--------------------------------------------------------------------------------
SKP1A_DICDI/2-63--------------------------------------------------------------------------------
SKP1_EMENI/4-65--------------------------------------------------------------------------------

PF11822

Q29D48_DROPS/298-606LELEM....VRDKKERVTP..RLWTKLIQS.LCEPDPEA.............................LRGHFYSM....
Q4Q8A2_LEIMA/20-417VDLAAALLRLHEERSANHPNRAFVASLLQHYVCHKVGVADGADVSSQTDAAAKASSDINGGAWPPAGLPATHSGQLTLPL
Q0IFU1_AEDAE/236-536LELEM....VKDKKDRIAP..RLWTKLIQS.LCEIEPQA.............................LRGHYATL....
Q383Z9_TRYB2/26-376GDVARAFLKLFDWHAEDSPNRRFLTALIRHMLCDRFGE...................................GRP....
A4HGL7_LEIBR/10-407TDLAAALLRLHKEGSVNHQNRALVASLLQHYACHQLGVADGAEEPLPTDTEVVTRDSTDGSACASVGLPATHSGELTLSP
A7S8V2_NEMVE/1-302NELDE....VKDRKDKFKS..KLFCKKIEE.LFDPNKTT.............................ICSP.ASA....
Q4DXB1_TRYCC/30-401GDLARAFLRLYDWRTEYSSNRRFLTALLRHVVCDRLGE...................................RRA....
F7EPV1_XENTR/146-448NEADD....VKDKKDKIKS..KIFCKKIER.LFDAECKN.............................ADSP.ANA....
H3DIA0_TETNG/1-303NEADD....VRDKKDKFKS..KLFQKKIER.LFDPGYQN.............................RDSP.GNA....

PF02214

KCNSK_CAEEL/135-238--------------------------------------------------------------------------------
KCNA5_MOUSE/113-204--------------------------------------------------------------------------------
KCNAL_DROME/43-132--------------------------------------------------------------------------------
KCNS1_MOUSE/21-120--------------------------------------------------------------------------------
KCNS3_HUMAN/17-116--------------------------------------------------------------------------------
Q18986_CAEEL/7-97--------------------------------------------------------------------------------
KCNA7_MOUSE/47-138--------------------------------------------------------------------------------
P91557_CAEEL/6-93--------------------------------------------------------------------------------
O17001_CAEEL/21-113--------------------------------------------------------------------------------
O16612_CAEEL/6-96--------------------------------------------------------------------------------
O16709_CAEEL/9-96--------------------------------------------------------------------------------
O16706_CAEEL/5-95--------------------------------------------------------------------------------
KCNB1_HUMAN/33-132--------------------------------------------------------------------------------
KCNC1_HUMAN/10-104--------------------------------------------------------------------------------
P91564_CAEEL/5-95--------------------------------------------------------------------------------
KCNAW_DROME/12-102--------------------------------------------------------------------------------
KCNS2_MOUSE/19-118--------------------------------------------------------------------------------
O16613_CAEEL/8-96--------------------------------------------------------------------------------
KCA10_HUMAN/88-179--------------------------------------------------------------------------------
KCND1_HUMAN/42-131--------------------------------------------------------------------------------
KCND3_RAT/42-131--------------------------------------------------------------------------------
Q20381_CAEEL/28-127--------------------------------------------------------------------------------
KCNG1_HUMAN/65-164--------------------------------------------------------------------------------
Q26597_SCHMA/53-144--------------------------------------------------------------------------------
O16711_CAEEL/8-100--------------------------------------------------------------------------------
KCNV1_RAT/44-153--------------------------------------------------------------------------------
Q18776_CAEEL/84-176--------------------------------------------------------------------------------
KCNAB_DROME/279-378--------------------------------------------------------------------------------
O16630_CAEEL/2-90--------------------------------------------------------------------------------
P91256_CAEEL/38-137--------------------------------------------------------------------------------
BACD2_MOUSE/30-120--------------------------------------------------------------------------------
O16708_CAEEL/99-187--------------------------------------------------------------------------------
KCNG2_CHICK/59-158--------------------------------------------------------------------------------
B4L763_DROMO/24-111--------------------------------------------------------------------------------

PF16017

E7F994_DANRE/70-299--------------------------------------------------------------------------------
G3W7V3_SARHA/151-380--------------------------------------------------------------------------------
W4ZCZ0_STRPU/50-279--------------------------------------------------------------------------------
E9JD94_SOLIN/154-383--------------------------------------------------------------------------------
A9UPC4_MONBE/63-292--------------------------------------------------------------------------------
E4XC39_OIKDI/75-305--------------------------------------------------------------------------------
F7AXE7_CIOIN/162-392--------------------------------------------------------------------------------
T1L0V7_TETUR/82-310--------------------------------------------------------------------------------
W5KS29_ASTMX/198-429--------------------------------------------------------------------------------
E9BXQ6_CAPO3/355-585--------------------------------------------------------------------------------
K1QX87_CRAGI/168-393--------------------------------------------------------------------------------
H2KQY4_CLOSI/945-1176--------------------------------------------------------------------------------
A7S9A9_NEMVE/133-363--------------------------------------------------------------------------------
H3FGC5_PRIPA/9-239--------------------------------------------------------------------------------
B3SBZ6_TRIAD/36-264--------------------------------------------------------------------------------
F2U9A9_SALR5/300-529--------------------------------------------------------------------------------
G3HKB9_CRIGR/153-382--------------------------------------------------------------------------------
F6TDG6_XENTR/196-425--------------------------------------------------------------------------------
T1G141_HELRO/46-274--------------------------------------------------------------------------------
I1FT20_AMPQE/71-291--------------------------------------------------------------------------------
E5SRV9_TRISP/693-924--------------------------------------------------------------------------------

PF07707

IPP_MOUSE/139-241--------------------------------------------------------------------------------
KBTBC_MOUSE/131-233--------------------------------------------------------------------------------
Q7PXP7_ANOGA/170-272--------------------------------------------------------------------------------
KLHL8_MOUSE/178-280--------------------------------------------------------------------------------
O61795_CAEEL/158-260--------------------------------------------------------------------------------
KLHL6_MOUSE/172-274--------------------------------------------------------------------------------
KLH18_HUMAN/140-242--------------------------------------------------------------------------------
KELC_DROME/258-360--------------------------------------------------------------------------------
KBTB3_HUMAN/150-252--------------------------------------------------------------------------------
GAN_MOUSE/134-236--------------------------------------------------------------------------------
Q7PMB5_ANOGA/179-281--------------------------------------------------------------------------------
Q7QHD7_ANOGA/175-277--------------------------------------------------------------------------------
Q7QI84_ANOGA/148-248--------------------------------------------------------------------------------
KBTB8_HUMAN/152-254--------------------------------------------------------------------------------
Q7Q1T2_ANOGA/174-276--------------------------------------------------------------------------------
KLH21_HUMAN/138-239--------------------------------------------------------------------------------
ENC1_HUMAN/149-251--------------------------------------------------------------------------------
O16313_CAEEL/170-270--------------------------------------------------------------------------------
O18147_CAEEL/153-255--------------------------------------------------------------------------------
KLH41_HUMAN/135-237--------------------------------------------------------------------------------
KLHL2_HUMAN/158-260--------------------------------------------------------------------------------
KEAP1_RAT/184-286--------------------------------------------------------------------------------
Q6DJ21_XENTR/98-200--------------------------------------------------------------------------------
Q6GKZ1_DROME/195-298--------------------------------------------------------------------------------
KLH23_MOUSE/139-240--------------------------------------------------------------------------------
KLH21_DANRE/140-242--------------------------------------------------------------------------------
Q6PFE1_MOUSE/275-376--------------------------------------------------------------------------------
KLH31_DANRE/173-274--------------------------------------------------------------------------------
KLH17_MOUSE/192-294--------------------------------------------------------------------------------
Q6TEQ2_DANRE/149-251--------------------------------------------------------------------------------
Q7KSF5_DROME/192-294--------------------------------------------------------------------------------
Q7SYC4_DANRE/168-270--------------------------------------------------------------------------------
Q86BQ6_DROME/179-281--------------------------------------------------------------------------------
KLH26_MOUSE/156-257--------------------------------------------------------------------------------
KLH38_MOUSE/136-237--------------------------------------------------------------------------------
KLH31_MOUSE/172-273--------------------------------------------------------------------------------
Q8N4I8_HUMAN/152-254--------------------------------------------------------------------------------
KLH36_HUMAN/148-250--------------------------------------------------------------------------------
KLH25_MOUSE/149-251--------------------------------------------------------------------------------
Q8V3G0_SWPV1/125-224--------------------------------------------------------------------------------
KLH28_MOUSE/137-239--------------------------------------------------------------------------------
BTBDH_MOUSE/169-269--------------------------------------------------------------------------------
Q9Q8G2_MYXVL/125-224--------------------------------------------------------------------------------
Q9VGE5_DROME/143-245--------------------------------------------------------------------------------
Q9VK21_DROME/187-289--------------------------------------------------------------------------------
Q9W2S3_DROME/150-248--------------------------------------------------------------------------------
Q9W4L5_DROME/162-265--------------------------------------------------------------------------------
Q9W4S3_DROME/306-407--------------------------------------------------------------------------------
A1Z7I5_DROME/227-323--------------------------------------------------------------------------------
A9JSR2_XENTR/131-232--------------------------------------------------------------------------------
A9ULG0_XENTR/113-214--------------------------------------------------------------------------------
B8JJT0_DANRE/167-269--------------------------------------------------------------------------------
E7FB71_DANRE/142-244--------------------------------------------------------------------------------
F1Q6J6_DANRE/201-302--------------------------------------------------------------------------------
F1QEG2_DANRE/136-238--------------------------------------------------------------------------------
F1QLH3_DANRE/143-240--------------------------------------------------------------------------------
F6S3C9_XENTR/135-236--------------------------------------------------------------------------------
F6VL93_XENTR/137-231--------------------------------------------------------------------------------
F7AJ67_XENTR/158-260--------------------------------------------------------------------------------
F7FRL0_MACMU/216-317--------------------------------------------------------------------------------
H2V3E3_TAKRU/76-175--------------------------------------------------------------------------------
H2V3E4_TAKRU/116-216--------------------------------------------------------------------------------
KBTB1_VACCW/123-219--------------------------------------------------------------------------------
KLH25_XENTR/149-250--------------------------------------------------------------------------------
Q0V9R8_XENTR/168-270--------------------------------------------------------------------------------
Q1ECZ2_DANRE/160-262--------------------------------------------------------------------------------
Q66IL9_XENTR/176-277--------------------------------------------------------------------------------
Q66JH7_XENTR/149-248--------------------------------------------------------------------------------
BTBDH_XENTR/160-257--------------------------------------------------------------------------------
Q7PNH6_ANOGA/201-303--------------------------------------------------------------------------------
Q8BUX1_MOUSE/155-254--------------------------------------------------------------------------------
BTBD9_MOUSE/143-239--------------------------------------------------------------------------------
KLHL1_MOUSE/317-416--------------------------------------------------------------------------------
Q9VRA7_DROME/151-248--------------------------------------------------------------------------------
W5MS53_LEPOC/170-271--------------------------------------------------------------------------------

PF00651

BAT47_CAEEL/8-109--------------------------------------------------------------------------------
ZBT17_MOUSE/14-114--------------------------------------------------------------------------------
Y2060_ARATH/201-303--------------------------------------------------------------------------------
Y2060_ARATH/341-455--------------------------------------------------------------------------------
O61795_CAEEL/46-153--------------------------------------------------------------------------------
O76610_CAEEL/10-114--------------------------------------------------------------------------------
KELC_DROME/147-253--------------------------------------------------------------------------------
KLH21_HUMAN/25-133--------------------------------------------------------------------------------
O45927_CAEEL/141-251--------------------------------------------------------------------------------
BTBD2_HUMAN/112-217--------------------------------------------------------------------------------
O44818_CAEEL/140-244--------------------------------------------------------------------------------
Q18030_CAEEL/118-226--------------------------------------------------------------------------------
LZTR1_HUMAN/655-764--------------------------------------------------------------------------------
BAB1_DROME/117-222--------------------------------------------------------------------------------
O17112_CAEEL/140-243--------------------------------------------------------------------------------
BACH1_MOUSE/24-130--------------------------------------------------------------------------------
BCL6_HUMAN/22-129--------------------------------------------------------------------------------
BRC1_DROME/22-127--------------------------------------------------------------------------------
CALI_BOVIN/18-128--------------------------------------------------------------------------------
ENC1_HUMAN/36-144--------------------------------------------------------------------------------
GAGA_DROME/24-129--------------------------------------------------------------------------------
GCL_DROME/56-166--------------------------------------------------------------------------------
ZBT48_HUMAN/16-119--------------------------------------------------------------------------------
KLH41_HUMAN/23-130--------------------------------------------------------------------------------
LOLA2_DROME/22-127--------------------------------------------------------------------------------
KAISO_HUMAN/22-125--------------------------------------------------------------------------------
ZBT14_HUMAN/26-132--------------------------------------------------------------------------------
ABTB2_RAT/832-945--------------------------------------------------------------------------------
ZBTB5_HUMAN/14-123--------------------------------------------------------------------------------
ZBT7B_HUMAN/24-145--------------------------------------------------------------------------------
ZBT22_HUMAN/47-151--------------------------------------------------------------------------------
O16313_CAEEL/54-165--------------------------------------------------------------------------------
O16566_CAEEL/67-171--------------------------------------------------------------------------------
O16736_CAEEL/144-248--------------------------------------------------------------------------------
O16740_CAEEL/129-232--------------------------------------------------------------------------------
O17197_CAEEL/70-174--------------------------------------------------------------------------------
O17253_CAEEL/135-236--------------------------------------------------------------------------------
O17297_CAEEL/141-242--------------------------------------------------------------------------------
O18147_CAEEL/41-148--------------------------------------------------------------------------------
BPM3_ARATH/184-303--------------------------------------------------------------------------------
Y2045_ARATH/15-132--------------------------------------------------------------------------------
NACC1_RAT/20-124--------------------------------------------------------------------------------
ZBT43_HUMAN/23-126--------------------------------------------------------------------------------
O44815_CAEEL/142-246--------------------------------------------------------------------------------
O44817_CAEEL/137-241--------------------------------------------------------------------------------
O44905_CAEEL/112-216--------------------------------------------------------------------------------
O45594_CAEEL/135-238--------------------------------------------------------------------------------
O61932_CAEEL/71-176--------------------------------------------------------------------------------
BTB1_SCHPO/608-735--------------------------------------------------------------------------------
O76568_CAEEL/144-248--------------------------------------------------------------------------------
KEN_DROME/23-131--------------------------------------------------------------------------------
Y4409_ARATH/15-129--------------------------------------------------------------------------------
BCL6B_MOUSE/28-135--------------------------------------------------------------------------------
ZBT7A_CHICK/24-131--------------------------------------------------------------------------------
ZBT18_HUMAN/14-121--------------------------------------------------------------------------------
ZBTB6_HUMAN/23-127--------------------------------------------------------------------------------
Q17523_CAEEL/126-230--------------------------------------------------------------------------------
Q17782_CAEEL/193-300--------------------------------------------------------------------------------
Q19838_CAEEL/23-130--------------------------------------------------------------------------------
Q20183_CAEEL/184-293--------------------------------------------------------------------------------
BAT38_CAEEL/220-325--------------------------------------------------------------------------------
Q21899_CAEEL/143-245--------------------------------------------------------------------------------
MMD4_DROME/22-128--------------------------------------------------------------------------------
ABRU_DROME/93-198--------------------------------------------------------------------------------
CP190_DROME/20-127--------------------------------------------------------------------------------
HIC1_CHICK/53-160--------------------------------------------------------------------------------
MEL26_CAEEL/191-300--------------------------------------------------------------------------------
SPOP_HUMAN/190-297--------------------------------------------------------------------------------
TTKB_DROME/23-127--------------------------------------------------------------------------------
KBTB1_VACCW/11-118--------------------------------------------------------------------------------
VMT8_MYXVL/6-112--------------------------------------------------------------------------------
ZBT39_HUMAN/20-126--------------------------------------------------------------------------------
ZBT24_HUMAN/27-133--------------------------------------------------------------------------------
BTB3_SCHPO/157-262--------------------------------------------------------------------------------
BTB3_SCHPO/296-405--------------------------------------------------------------------------------
YIA1_YEAST/264-390--------------------------------------------------------------------------------
BAT15_CAEEL/139-243--------------------------------------------------------------------------------
BAT42_CAEEL/208-319--------------------------------------------------------------------------------
BAT43_CAEEL/255-368--------------------------------------------------------------------------------
YR47_CAEEL/45-146--------------------------------------------------------------------------------
ZBT16_HUMAN/24-126--------------------------------------------------------------------------------
ZBT25_HUMAN/14-119--------------------------------------------------------------------------------
A1Z8A5_DROME/25-125--------------------------------------------------------------------------------
F7A721_CALJA/24-127--------------------------------------------------------------------------------
K7EJ49_HUMAN/67-178--------------------------------------------------------------------------------
BACH2_MOUSE/27-132--------------------------------------------------------------------------------
Q54RA9_DICDI/42-142--------------------------------------------------------------------------------
Q8V3S6_SWPV1/8-114--------------------------------------------------------------------------------

PF03931

Q21367_CAEEL/8-70--------------------------------------------------------------------------------
SKP1_HUMAN/2-67--------------------------------------------------------------------------------
O77430_DROME/2-66--------------------------------------------------------------------------------
ASK16_ARATH/4-64--------------------------------------------------------------------------------
ASK14_ARATH/4-64--------------------------------------------------------------------------------
ASK19_ARATH/4-64--------------------------------------------------------------------------------
SKP1A_ARATH/4-63--------------------------------------------------------------------------------
SKP1B_ARATH/5-64--------------------------------------------------------------------------------
ASK12_ARATH/4-64--------------------------------------------------------------------------------
Q89374_PBCV1/1-61--------------------------------------------------------------------------------
ELOC_YEAST/4-66--------------------------------------------------------------------------------
SKP1A_DICDI/2-63--------------------------------------------------------------------------------
SKP1_EMENI/4-65--------------------------------------------------------------------------------

PF11822

Q29D48_DROPS/298-606.SGLFRCGRCFSCVTNTMKSYVSC.........VSS....................NIRLNRWGQLMSHHV.RDP.....
Q4Q8A2_LEIMA/20-417TCGLRWCRLCATLFDEGELDRLGRTSQL.SGPECPAQSGPTSHTGDKAHHASIAGRRWCVGPRGEVFTTHA.AARHATPV
Q0IFU1_AEDAE/236-536.VGMFRCLRCGKFLTQTVSTFIHC.........VPQ....................NIRLNRWGQLISSHM.KDP.....
Q383Z9_TRYB2/26-376.SSLRWCGLCGALFDQQELQHIERRYKNVRLPVCPRV..................TKNSVGHRGELLKTHV.ASK.....
A4HGL7_LEIBR/10-407TCSLRWCRLCATLFDEGEVYRLGRTSRL.SSPECPGQYMPSRPAGGGAHYAATAGPTLRVGPRGEVFTTHS.AARHAMPI
A7S8V2_NEMVE/1-302.CTMYRCSACHRLITQESQERLRC.........ALS....................RMTIDHRGRVTFSHV.RDP.....
Q4DXB1_TRYCC/30-401.GGLRWCQYCGVLFDQHELLRLERSGKNVKPALCPRL..................TKSSIGTRGEILITHV.ASK.....
F7EPV1_XENTR/146-448.STLFRCCLCKRLLTKEAEKKIAC.........LPG....................KISIDQHGNIVYFHM.RDK.....
H3DIA0_TETNG/1-303.STLYRCALCLKLLTKDTEKKISC.........VPG....................KINVDSRGEIIYTHNSRQK.....

PF02214

KCNSK_CAEEL/135-238--------------------------------------------------------------------------------
KCNA5_MOUSE/113-204--------------------------------------------------------------------------------
KCNAL_DROME/43-132--------------------------------------------------------------------------------
KCNS1_MOUSE/21-120--------------------------------------------------------------------------------
KCNS3_HUMAN/17-116--------------------------------------------------------------------------------
Q18986_CAEEL/7-97--------------------------------------------------------------------------------
KCNA7_MOUSE/47-138--------------------------------------------------------------------------------
P91557_CAEEL/6-93--------------------------------------------------------------------------------
O17001_CAEEL/21-113--------------------------------------------------------------------------------
O16612_CAEEL/6-96--------------------------------------------------------------------------------
O16709_CAEEL/9-96--------------------------------------------------------------------------------
O16706_CAEEL/5-95--------------------------------------------------------------------------------
KCNB1_HUMAN/33-132--------------------------------------------------------------------------------
KCNC1_HUMAN/10-104--------------------------------------------------------------------------------
P91564_CAEEL/5-95--------------------------------------------------------------------------------
KCNAW_DROME/12-102--------------------------------------------------------------------------------
KCNS2_MOUSE/19-118--------------------------------------------------------------------------------
O16613_CAEEL/8-96--------------------------------------------------------------------------------
KCA10_HUMAN/88-179--------------------------------------------------------------------------------
KCND1_HUMAN/42-131--------------------------------------------------------------------------------
KCND3_RAT/42-131--------------------------------------------------------------------------------
Q20381_CAEEL/28-127--------------------------------------------------------------------------------
KCNG1_HUMAN/65-164--------------------------------------------------------------------------------
Q26597_SCHMA/53-144--------------------------------------------------------------------------------
O16711_CAEEL/8-100--------------------------------------------------------------------------------
KCNV1_RAT/44-153--------------------------------------------------------------------------------
Q18776_CAEEL/84-176--------------------------------------------------------------------------------
KCNAB_DROME/279-378--------------------------------------------------------------------------------
O16630_CAEEL/2-90--------------------------------------------------------------------------------
P91256_CAEEL/38-137--------------------------------------------------------------------------------
BACD2_MOUSE/30-120--------------------------------------------------------------------------------
O16708_CAEEL/99-187--------------------------------------------------------------------------------
KCNG2_CHICK/59-158--------------------------------------------------------------------------------
B4L763_DROMO/24-111--------------------------------------------------------------------------------

PF16017

E7F994_DANRE/70-299--------------------------------------------------------------------------------
G3W7V3_SARHA/151-380--------------------------------------------------------------------------------
W4ZCZ0_STRPU/50-279--------------------------------------------------------------------------------
E9JD94_SOLIN/154-383--------------------------------------------------------------------------------
A9UPC4_MONBE/63-292--------------------------------------------------------------------------------
E4XC39_OIKDI/75-305--------------------------------------------------------------------------------
F7AXE7_CIOIN/162-392--------------------------------------------------------------------------------
T1L0V7_TETUR/82-310--------------------------------------------------------------------------------
W5KS29_ASTMX/198-429--------------------------------------------------------------------------------
E9BXQ6_CAPO3/355-585--------------------------------------------------------------------------------
K1QX87_CRAGI/168-393--------------------------------------------------------------------------------
H2KQY4_CLOSI/945-1176--------------------------------------------------------------------------------
A7S9A9_NEMVE/133-363--------------------------------------------------------------------------------
H3FGC5_PRIPA/9-239--------------------------------------------------------------------------------
B3SBZ6_TRIAD/36-264--------------------------------------------------------------------------------
F2U9A9_SALR5/300-529--------------------------------------------------------------------------------
G3HKB9_CRIGR/153-382--------------------------------------------------------------------------------
F6TDG6_XENTR/196-425--------------------------------------------------------------------------------
T1G141_HELRO/46-274--------------------------------------------------------------------------------
I1FT20_AMPQE/71-291--------------------------------------------------------------------------------
E5SRV9_TRISP/693-924--------------------------------------------------------------------------------

PF07707

IPP_MOUSE/139-241--------------------------------------------------------------------------------
KBTBC_MOUSE/131-233--------------------------------------------------------------------------------
Q7PXP7_ANOGA/170-272--------------------------------------------------------------------------------
KLHL8_MOUSE/178-280--------------------------------------------------------------------------------
O61795_CAEEL/158-260--------------------------------------------------------------------------------
KLHL6_MOUSE/172-274--------------------------------------------------------------------------------
KLH18_HUMAN/140-242--------------------------------------------------------------------------------
KELC_DROME/258-360--------------------------------------------------------------------------------
KBTB3_HUMAN/150-252--------------------------------------------------------------------------------
GAN_MOUSE/134-236--------------------------------------------------------------------------------
Q7PMB5_ANOGA/179-281--------------------------------------------------------------------------------
Q7QHD7_ANOGA/175-277--------------------------------------------------------------------------------
Q7QI84_ANOGA/148-248--------------------------------------------------------------------------------
KBTB8_HUMAN/152-254--------------------------------------------------------------------------------
Q7Q1T2_ANOGA/174-276--------------------------------------------------------------------------------
KLH21_HUMAN/138-239--------------------------------------------------------------------------------
ENC1_HUMAN/149-251--------------------------------------------------------------------------------
O16313_CAEEL/170-270--------------------------------------------------------------------------------
O18147_CAEEL/153-255--------------------------------------------------------------------------------
KLH41_HUMAN/135-237--------------------------------------------------------------------------------
KLHL2_HUMAN/158-260--------------------------------------------------------------------------------
KEAP1_RAT/184-286--------------------------------------------------------------------------------
Q6DJ21_XENTR/98-200--------------------------------------------------------------------------------
Q6GKZ1_DROME/195-298--------------------------------------------------------------------------------
KLH23_MOUSE/139-240--------------------------------------------------------------------------------
KLH21_DANRE/140-242--------------------------------------------------------------------------------
Q6PFE1_MOUSE/275-376--------------------------------------------------------------------------------
KLH31_DANRE/173-274--------------------------------------------------------------------------------
KLH17_MOUSE/192-294--------------------------------------------------------------------------------
Q6TEQ2_DANRE/149-251--------------------------------------------------------------------------------
Q7KSF5_DROME/192-294--------------------------------------------------------------------------------
Q7SYC4_DANRE/168-270--------------------------------------------------------------------------------
Q86BQ6_DROME/179-281--------------------------------------------------------------------------------
KLH26_MOUSE/156-257--------------------------------------------------------------------------------
KLH38_MOUSE/136-237--------------------------------------------------------------------------------
KLH31_MOUSE/172-273--------------------------------------------------------------------------------
Q8N4I8_HUMAN/152-254--------------------------------------------------------------------------------
KLH36_HUMAN/148-250--------------------------------------------------------------------------------
KLH25_MOUSE/149-251--------------------------------------------------------------------------------
Q8V3G0_SWPV1/125-224--------------------------------------------------------------------------------
KLH28_MOUSE/137-239--------------------------------------------------------------------------------
BTBDH_MOUSE/169-269--------------------------------------------------------------------------------
Q9Q8G2_MYXVL/125-224--------------------------------------------------------------------------------
Q9VGE5_DROME/143-245--------------------------------------------------------------------------------
Q9VK21_DROME/187-289--------------------------------------------------------------------------------
Q9W2S3_DROME/150-248--------------------------------------------------------------------------------
Q9W4L5_DROME/162-265--------------------------------------------------------------------------------
Q9W4S3_DROME/306-407--------------------------------------------------------------------------------
A1Z7I5_DROME/227-323--------------------------------------------------------------------------------
A9JSR2_XENTR/131-232--------------------------------------------------------------------------------
A9ULG0_XENTR/113-214--------------------------------------------------------------------------------
B8JJT0_DANRE/167-269--------------------------------------------------------------------------------
E7FB71_DANRE/142-244--------------------------------------------------------------------------------
F1Q6J6_DANRE/201-302--------------------------------------------------------------------------------
F1QEG2_DANRE/136-238--------------------------------------------------------------------------------
F1QLH3_DANRE/143-240--------------------------------------------------------------------------------
F6S3C9_XENTR/135-236--------------------------------------------------------------------------------
F6VL93_XENTR/137-231--------------------------------------------------------------------------------
F7AJ67_XENTR/158-260--------------------------------------------------------------------------------
F7FRL0_MACMU/216-317--------------------------------------------------------------------------------
H2V3E3_TAKRU/76-175--------------------------------------------------------------------------------
H2V3E4_TAKRU/116-216--------------------------------------------------------------------------------
KBTB1_VACCW/123-219--------------------------------------------------------------------------------
KLH25_XENTR/149-250--------------------------------------------------------------------------------
Q0V9R8_XENTR/168-270--------------------------------------------------------------------------------
Q1ECZ2_DANRE/160-262--------------------------------------------------------------------------------
Q66IL9_XENTR/176-277--------------------------------------------------------------------------------
Q66JH7_XENTR/149-248--------------------------------------------------------------------------------
BTBDH_XENTR/160-257--------------------------------------------------------------------------------
Q7PNH6_ANOGA/201-303--------------------------------------------------------------------------------
Q8BUX1_MOUSE/155-254--------------------------------------------------------------------------------
BTBD9_MOUSE/143-239--------------------------------------------------------------------------------
KLHL1_MOUSE/317-416--------------------------------------------------------------------------------
Q9VRA7_DROME/151-248--------------------------------------------------------------------------------
W5MS53_LEPOC/170-271--------------------------------------------------------------------------------

PF00651

BAT47_CAEEL/8-109--------------------------------------------------------------------------------
ZBT17_MOUSE/14-114--------------------------------------------------------------------------------
Y2060_ARATH/201-303--------------------------------------------------------------------------------
Y2060_ARATH/341-455--------------------------------------------------------------------------------
O61795_CAEEL/46-153--------------------------------------------------------------------------------
O76610_CAEEL/10-114--------------------------------------------------------------------------------
KELC_DROME/147-253--------------------------------------------------------------------------------
KLH21_HUMAN/25-133--------------------------------------------------------------------------------
O45927_CAEEL/141-251--------------------------------------------------------------------------------
BTBD2_HUMAN/112-217--------------------------------------------------------------------------------
O44818_CAEEL/140-244--------------------------------------------------------------------------------
Q18030_CAEEL/118-226--------------------------------------------------------------------------------
LZTR1_HUMAN/655-764--------------------------------------------------------------------------------
BAB1_DROME/117-222--------------------------------------------------------------------------------
O17112_CAEEL/140-243--------------------------------------------------------------------------------
BACH1_MOUSE/24-130--------------------------------------------------------------------------------
BCL6_HUMAN/22-129--------------------------------------------------------------------------------
BRC1_DROME/22-127--------------------------------------------------------------------------------
CALI_BOVIN/18-128--------------------------------------------------------------------------------
ENC1_HUMAN/36-144--------------------------------------------------------------------------------
GAGA_DROME/24-129--------------------------------------------------------------------------------
GCL_DROME/56-166--------------------------------------------------------------------------------
ZBT48_HUMAN/16-119--------------------------------------------------------------------------------
KLH41_HUMAN/23-130--------------------------------------------------------------------------------
LOLA2_DROME/22-127--------------------------------------------------------------------------------
KAISO_HUMAN/22-125--------------------------------------------------------------------------------
ZBT14_HUMAN/26-132--------------------------------------------------------------------------------
ABTB2_RAT/832-945--------------------------------------------------------------------------------
ZBTB5_HUMAN/14-123--------------------------------------------------------------------------------
ZBT7B_HUMAN/24-145--------------------------------------------------------------------------------
ZBT22_HUMAN/47-151--------------------------------------------------------------------------------
O16313_CAEEL/54-165--------------------------------------------------------------------------------
O16566_CAEEL/67-171--------------------------------------------------------------------------------
O16736_CAEEL/144-248--------------------------------------------------------------------------------
O16740_CAEEL/129-232--------------------------------------------------------------------------------
O17197_CAEEL/70-174--------------------------------------------------------------------------------
O17253_CAEEL/135-236--------------------------------------------------------------------------------
O17297_CAEEL/141-242--------------------------------------------------------------------------------
O18147_CAEEL/41-148--------------------------------------------------------------------------------
BPM3_ARATH/184-303--------------------------------------------------------------------------------
Y2045_ARATH/15-132--------------------------------------------------------------------------------
NACC1_RAT/20-124--------------------------------------------------------------------------------
ZBT43_HUMAN/23-126--------------------------------------------------------------------------------
O44815_CAEEL/142-246--------------------------------------------------------------------------------
O44817_CAEEL/137-241--------------------------------------------------------------------------------
O44905_CAEEL/112-216--------------------------------------------------------------------------------
O45594_CAEEL/135-238--------------------------------------------------------------------------------
O61932_CAEEL/71-176--------------------------------------------------------------------------------
BTB1_SCHPO/608-735--------------------------------------------------------------------------------
O76568_CAEEL/144-248--------------------------------------------------------------------------------
KEN_DROME/23-131--------------------------------------------------------------------------------
Y4409_ARATH/15-129--------------------------------------------------------------------------------
BCL6B_MOUSE/28-135--------------------------------------------------------------------------------
ZBT7A_CHICK/24-131--------------------------------------------------------------------------------
ZBT18_HUMAN/14-121--------------------------------------------------------------------------------
ZBTB6_HUMAN/23-127--------------------------------------------------------------------------------
Q17523_CAEEL/126-230--------------------------------------------------------------------------------
Q17782_CAEEL/193-300--------------------------------------------------------------------------------
Q19838_CAEEL/23-130--------------------------------------------------------------------------------
Q20183_CAEEL/184-293--------------------------------------------------------------------------------
BAT38_CAEEL/220-325--------------------------------------------------------------------------------
Q21899_CAEEL/143-245--------------------------------------------------------------------------------
MMD4_DROME/22-128--------------------------------------------------------------------------------
ABRU_DROME/93-198--------------------------------------------------------------------------------
CP190_DROME/20-127--------------------------------------------------------------------------------
HIC1_CHICK/53-160--------------------------------------------------------------------------------
MEL26_CAEEL/191-300--------------------------------------------------------------------------------
SPOP_HUMAN/190-297--------------------------------------------------------------------------------
TTKB_DROME/23-127--------------------------------------------------------------------------------
KBTB1_VACCW/11-118--------------------------------------------------------------------------------
VMT8_MYXVL/6-112--------------------------------------------------------------------------------
ZBT39_HUMAN/20-126--------------------------------------------------------------------------------
ZBT24_HUMAN/27-133--------------------------------------------------------------------------------
BTB3_SCHPO/157-262--------------------------------------------------------------------------------
BTB3_SCHPO/296-405--------------------------------------------------------------------------------
YIA1_YEAST/264-390--------------------------------------------------------------------------------
BAT15_CAEEL/139-243--------------------------------------------------------------------------------
BAT42_CAEEL/208-319--------------------------------------------------------------------------------
BAT43_CAEEL/255-368--------------------------------------------------------------------------------
YR47_CAEEL/45-146--------------------------------------------------------------------------------
ZBT16_HUMAN/24-126--------------------------------------------------------------------------------
ZBT25_HUMAN/14-119--------------------------------------------------------------------------------
A1Z8A5_DROME/25-125--------------------------------------------------------------------------------
F7A721_CALJA/24-127--------------------------------------------------------------------------------
K7EJ49_HUMAN/67-178--------------------------------------------------------------------------------
BACH2_MOUSE/27-132--------------------------------------------------------------------------------
Q54RA9_DICDI/42-142--------------------------------------------------------------------------------
Q8V3S6_SWPV1/8-114--------------------------------------------------------------------------------

PF03931

Q21367_CAEEL/8-70--------------------------------------------------------------------------------
SKP1_HUMAN/2-67--------------------------------------------------------------------------------
O77430_DROME/2-66--------------------------------------------------------------------------------
ASK16_ARATH/4-64--------------------------------------------------------------------------------
ASK14_ARATH/4-64--------------------------------------------------------------------------------
ASK19_ARATH/4-64--------------------------------------------------------------------------------
SKP1A_ARATH/4-63--------------------------------------------------------------------------------
SKP1B_ARATH/5-64--------------------------------------------------------------------------------
ASK12_ARATH/4-64--------------------------------------------------------------------------------
Q89374_PBCV1/1-61--------------------------------------------------------------------------------
ELOC_YEAST/4-66--------------------------------------------------------------------------------
SKP1A_DICDI/2-63--------------------------------------------------------------------------------
SKP1_EMENI/4-65--------------------------------------------------------------------------------

PF11822

Q29D48_DROPS/298-606.............NWDLNLY..IMQLFKELKSWRKVYWKLWGSCHYLYCCTCEAHFPVYQMN..WCRFHPGAPQFLGPV.
Q4Q8A2_LEIMA/20-417ILEAPPALKGSEVSASTLAAEAASPFTAELERWA...WRIIGAIRYVGCRRCFHLVSLLDVSKHRCSELPKKFSFPDNVA
Q0IFU1_AEDAE/236-536.............SWNITSY..VASLHKELRSWRKVYWRLWGHCHFLYCAICDTHFAVYQML..WCQYHPEQPQFLGPAA
Q383Z9_TRYB2/26-376.............QEANIKFPPLSWHEKEVEAWA...WRVVGSLYLFVCRRCNCCVSLTNTTCHSCPGGTANFSRAEGVS
A4HGL7_LEIBR/10-407VLEAPPRLKSGGTSASTTAAEAASPFTAELERWA...WRIIGASRYVGCRRCLHLVSLLDVSQHRCSELPKKYSSPDNES
A7S8V2_NEMVE/1-302.............NWDVNEY..IQGLREKFKSWRDVYWRLWGSVNILYCYRCGEYFPCCELG..HCRYHTSSADFGSHKG
Q4DXB1_TRYCC/30-401.............QPANLAFPSISWGDEHVERWA...WRIIGATYFFLCRQCNHLVSLTDTTTHGCSGGVAAFSCVEGGN
F7EPV1_XENTR/146-448.............MWDVHEY..LISLFEELKSWRDVYWRLWGAINWLTCARCKQSFLCNELS..HCQYHPEIAVYPGAAS
H3DIA0_TETNG/1-303.............CWDVHEY..ITGLYEELKSWVLVYWRIWGTINYLTCSRCQQVFMCTELT..HCKYHPVSVSYPGMGT

PF02214

KCNSK_CAEEL/135-238--------------------------------------------------------------------------------
KCNA5_MOUSE/113-204--------------------------------------------------------------------------------
KCNAL_DROME/43-132--------------------------------------------------------------------------------
KCNS1_MOUSE/21-120--------------------------------------------------------------------------------
KCNS3_HUMAN/17-116--------------------------------------------------------------------------------
Q18986_CAEEL/7-97--------------------------------------------------------------------------------
KCNA7_MOUSE/47-138--------------------------------------------------------------------------------
P91557_CAEEL/6-93--------------------------------------------------------------------------------
O17001_CAEEL/21-113--------------------------------------------------------------------------------
O16612_CAEEL/6-96--------------------------------------------------------------------------------
O16709_CAEEL/9-96--------------------------------------------------------------------------------
O16706_CAEEL/5-95--------------------------------------------------------------------------------
KCNB1_HUMAN/33-132--------------------------------------------------------------------------------
KCNC1_HUMAN/10-104--------------------------------------------------------------------------------
P91564_CAEEL/5-95--------------------------------------------------------------------------------
KCNAW_DROME/12-102--------------------------------------------------------------------------------
KCNS2_MOUSE/19-118--------------------------------------------------------------------------------
O16613_CAEEL/8-96--------------------------------------------------------------------------------
KCA10_HUMAN/88-179--------------------------------------------------------------------------------
KCND1_HUMAN/42-131--------------------------------------------------------------------------------
KCND3_RAT/42-131--------------------------------------------------------------------------------
Q20381_CAEEL/28-127--------------------------------------------------------------------------------
KCNG1_HUMAN/65-164--------------------------------------------------------------------------------
Q26597_SCHMA/53-144--------------------------------------------------------------------------------
O16711_CAEEL/8-100--------------------------------------------------------------------------------
KCNV1_RAT/44-153--------------------------------------------------------------------------------
Q18776_CAEEL/84-176--------------------------------------------------------------------------------
KCNAB_DROME/279-378--------------------------------------------------------------------------------
O16630_CAEEL/2-90--------------------------------------------------------------------------------
P91256_CAEEL/38-137--------------------------------------------------------------------------------
BACD2_MOUSE/30-120--------------------------------------------------------------------------------
O16708_CAEEL/99-187--------------------------------------------------------------------------------
KCNG2_CHICK/59-158--------------------------------------------------------------------------------
B4L763_DROMO/24-111--------------------------------------------------------------------------------

PF16017

E7F994_DANRE/70-299--------------------------------------------------------------------------------
G3W7V3_SARHA/151-380--------------------------------------------------------------------------------
W4ZCZ0_STRPU/50-279--------------------------------------------------------------------------------
E9JD94_SOLIN/154-383--------------------------------------------------------------------------------
A9UPC4_MONBE/63-292--------------------------------------------------------------------------------
E4XC39_OIKDI/75-305--------------------------------------------------------------------------------
F7AXE7_CIOIN/162-392--------------------------------------------------------------------------------
T1L0V7_TETUR/82-310--------------------------------------------------------------------------------
W5KS29_ASTMX/198-429--------------------------------------------------------------------------------
E9BXQ6_CAPO3/355-585--------------------------------------------------------------------------------
K1QX87_CRAGI/168-393--------------------------------------------------------------------------------
H2KQY4_CLOSI/945-1176--------------------------------------------------------------------------------
A7S9A9_NEMVE/133-363--------------------------------------------------------------------------------
H3FGC5_PRIPA/9-239--------------------------------------------------------------------------------
B3SBZ6_TRIAD/36-264--------------------------------------------------------------------------------
F2U9A9_SALR5/300-529--------------------------------------------------------------------------------
G3HKB9_CRIGR/153-382--------------------------------------------------------------------------------
F6TDG6_XENTR/196-425--------------------------------------------------------------------------------
T1G141_HELRO/46-274--------------------------------------------------------------------------------
I1FT20_AMPQE/71-291--------------------------------------------------------------------------------
E5SRV9_TRISP/693-924--------------------------------------------------------------------------------

PF07707

IPP_MOUSE/139-241--------------------------------------------------------------------------------
KBTBC_MOUSE/131-233--------------------------------------------------------------------------------
Q7PXP7_ANOGA/170-272--------------------------------------------------------------------------------
KLHL8_MOUSE/178-280--------------------------------------------------------------------------------
O61795_CAEEL/158-260--------------------------------------------------------------------------------
KLHL6_MOUSE/172-274--------------------------------------------------------------------------------
KLH18_HUMAN/140-242--------------------------------------------------------------------------------
KELC_DROME/258-360--------------------------------------------------------------------------------
KBTB3_HUMAN/150-252--------------------------------------------------------------------------------
GAN_MOUSE/134-236--------------------------------------------------------------------------------
Q7PMB5_ANOGA/179-281--------------------------------------------------------------------------------
Q7QHD7_ANOGA/175-277--------------------------------------------------------------------------------
Q7QI84_ANOGA/148-248--------------------------------------------------------------------------------
KBTB8_HUMAN/152-254--------------------------------------------------------------------------------
Q7Q1T2_ANOGA/174-276--------------------------------------------------------------------------------
KLH21_HUMAN/138-239--------------------------------------------------------------------------------
ENC1_HUMAN/149-251--------------------------------------------------------------------------------
O16313_CAEEL/170-270--------------------------------------------------------------------------------
O18147_CAEEL/153-255--------------------------------------------------------------------------------
KLH41_HUMAN/135-237--------------------------------------------------------------------------------
KLHL2_HUMAN/158-260--------------------------------------------------------------------------------
KEAP1_RAT/184-286--------------------------------------------------------------------------------
Q6DJ21_XENTR/98-200--------------------------------------------------------------------------------
Q6GKZ1_DROME/195-298--------------------------------------------------------------------------------
KLH23_MOUSE/139-240--------------------------------------------------------------------------------
KLH21_DANRE/140-242--------------------------------------------------------------------------------
Q6PFE1_MOUSE/275-376--------------------------------------------------------------------------------
KLH31_DANRE/173-274--------------------------------------------------------------------------------
KLH17_MOUSE/192-294--------------------------------------------------------------------------------
Q6TEQ2_DANRE/149-251--------------------------------------------------------------------------------
Q7KSF5_DROME/192-294--------------------------------------------------------------------------------
Q7SYC4_DANRE/168-270--------------------------------------------------------------------------------
Q86BQ6_DROME/179-281--------------------------------------------------------------------------------
KLH26_MOUSE/156-257--------------------------------------------------------------------------------
KLH38_MOUSE/136-237--------------------------------------------------------------------------------
KLH31_MOUSE/172-273--------------------------------------------------------------------------------
Q8N4I8_HUMAN/152-254--------------------------------------------------------------------------------
KLH36_HUMAN/148-250--------------------------------------------------------------------------------
KLH25_MOUSE/149-251--------------------------------------------------------------------------------
Q8V3G0_SWPV1/125-224--------------------------------------------------------------------------------
KLH28_MOUSE/137-239--------------------------------------------------------------------------------
BTBDH_MOUSE/169-269--------------------------------------------------------------------------------
Q9Q8G2_MYXVL/125-224--------------------------------------------------------------------------------
Q9VGE5_DROME/143-245--------------------------------------------------------------------------------
Q9VK21_DROME/187-289--------------------------------------------------------------------------------
Q9W2S3_DROME/150-248--------------------------------------------------------------------------------
Q9W4L5_DROME/162-265--------------------------------------------------------------------------------
Q9W4S3_DROME/306-407--------------------------------------------------------------------------------
A1Z7I5_DROME/227-323--------------------------------------------------------------------------------
A9JSR2_XENTR/131-232--------------------------------------------------------------------------------
A9ULG0_XENTR/113-214--------------------------------------------------------------------------------
B8JJT0_DANRE/167-269--------------------------------------------------------------------------------
E7FB71_DANRE/142-244--------------------------------------------------------------------------------
F1Q6J6_DANRE/201-302--------------------------------------------------------------------------------
F1QEG2_DANRE/136-238--------------------------------------------------------------------------------
F1QLH3_DANRE/143-240--------------------------------------------------------------------------------
F6S3C9_XENTR/135-236--------------------------------------------------------------------------------
F6VL93_XENTR/137-231--------------------------------------------------------------------------------
F7AJ67_XENTR/158-260--------------------------------------------------------------------------------
F7FRL0_MACMU/216-317--------------------------------------------------------------------------------
H2V3E3_TAKRU/76-175--------------------------------------------------------------------------------
H2V3E4_TAKRU/116-216--------------------------------------------------------------------------------
KBTB1_VACCW/123-219--------------------------------------------------------------------------------
KLH25_XENTR/149-250--------------------------------------------------------------------------------
Q0V9R8_XENTR/168-270--------------------------------------------------------------------------------
Q1ECZ2_DANRE/160-262--------------------------------------------------------------------------------
Q66IL9_XENTR/176-277--------------------------------------------------------------------------------
Q66JH7_XENTR/149-248--------------------------------------------------------------------------------
BTBDH_XENTR/160-257--------------------------------------------------------------------------------
Q7PNH6_ANOGA/201-303--------------------------------------------------------------------------------
Q8BUX1_MOUSE/155-254--------------------------------------------------------------------------------
BTBD9_MOUSE/143-239--------------------------------------------------------------------------------
KLHL1_MOUSE/317-416--------------------------------------------------------------------------------
Q9VRA7_DROME/151-248--------------------------------------------------------------------------------
W5MS53_LEPOC/170-271--------------------------------------------------------------------------------

PF00651

BAT47_CAEEL/8-109-----------------------
ZBT17_MOUSE/14-114-----------------------
Y2060_ARATH/201-303-----------------------
Y2060_ARATH/341-455-----------------------
O61795_CAEEL/46-153-----------------------
O76610_CAEEL/10-114-----------------------
KELC_DROME/147-253-----------------------
KLH21_HUMAN/25-133-----------------------
O45927_CAEEL/141-251-----------------------
BTBD2_HUMAN/112-217-----------------------
O44818_CAEEL/140-244-----------------------
Q18030_CAEEL/118-226-----------------------
LZTR1_HUMAN/655-764-----------------------
BAB1_DROME/117-222-----------------------
O17112_CAEEL/140-243-----------------------
BACH1_MOUSE/24-130-----------------------
BCL6_HUMAN/22-129-----------------------
BRC1_DROME/22-127-----------------------
CALI_BOVIN/18-128-----------------------
ENC1_HUMAN/36-144-----------------------
GAGA_DROME/24-129-----------------------
GCL_DROME/56-166-----------------------
ZBT48_HUMAN/16-119-----------------------
KLH41_HUMAN/23-130-----------------------
LOLA2_DROME/22-127-----------------------
KAISO_HUMAN/22-125-----------------------
ZBT14_HUMAN/26-132-----------------------
ABTB2_RAT/832-945-----------------------
ZBTB5_HUMAN/14-123-----------------------
ZBT7B_HUMAN/24-145-----------------------
ZBT22_HUMAN/47-151-----------------------
O16313_CAEEL/54-165-----------------------
O16566_CAEEL/67-171-----------------------
O16736_CAEEL/144-248-----------------------
O16740_CAEEL/129-232-----------------------
O17197_CAEEL/70-174-----------------------
O17253_CAEEL/135-236-----------------------
O17297_CAEEL/141-242-----------------------
O18147_CAEEL/41-148-----------------------
BPM3_ARATH/184-303-----------------------
Y2045_ARATH/15-132-----------------------
NACC1_RAT/20-124-----------------------
ZBT43_HUMAN/23-126-----------------------
O44815_CAEEL/142-246-----------------------
O44817_CAEEL/137-241-----------------------
O44905_CAEEL/112-216-----------------------
O45594_CAEEL/135-238-----------------------
O61932_CAEEL/71-176-----------------------
BTB1_SCHPO/608-735-----------------------
O76568_CAEEL/144-248-----------------------
KEN_DROME/23-131-----------------------
Y4409_ARATH/15-129-----------------------
BCL6B_MOUSE/28-135-----------------------
ZBT7A_CHICK/24-131-----------------------
ZBT18_HUMAN/14-121-----------------------
ZBTB6_HUMAN/23-127-----------------------
Q17523_CAEEL/126-230-----------------------
Q17782_CAEEL/193-300-----------------------
Q19838_CAEEL/23-130-----------------------
Q20183_CAEEL/184-293-----------------------
BAT38_CAEEL/220-325-----------------------
Q21899_CAEEL/143-245-----------------------
MMD4_DROME/22-128-----------------------
ABRU_DROME/93-198-----------------------
CP190_DROME/20-127-----------------------
HIC1_CHICK/53-160-----------------------
MEL26_CAEEL/191-300-----------------------
SPOP_HUMAN/190-297-----------------------
TTKB_DROME/23-127-----------------------
KBTB1_VACCW/11-118-----------------------
VMT8_MYXVL/6-112-----------------------
ZBT39_HUMAN/20-126-----------------------
ZBT24_HUMAN/27-133-----------------------
BTB3_SCHPO/157-262-----------------------
BTB3_SCHPO/296-405-----------------------
YIA1_YEAST/264-390-----------------------
BAT15_CAEEL/139-243-----------------------
BAT42_CAEEL/208-319-----------------------
BAT43_CAEEL/255-368-----------------------
YR47_CAEEL/45-146-----------------------
ZBT16_HUMAN/24-126-----------------------
ZBT25_HUMAN/14-119-----------------------
A1Z8A5_DROME/25-125-----------------------
F7A721_CALJA/24-127-----------------------
K7EJ49_HUMAN/67-178-----------------------
BACH2_MOUSE/27-132-----------------------
Q54RA9_DICDI/42-142-----------------------
Q8V3S6_SWPV1/8-114-----------------------

PF03931

Q21367_CAEEL/8-70-----------------------
SKP1_HUMAN/2-67-----------------------
O77430_DROME/2-66-----------------------
ASK16_ARATH/4-64-----------------------
ASK14_ARATH/4-64-----------------------
ASK19_ARATH/4-64-----------------------
SKP1A_ARATH/4-63-----------------------
SKP1B_ARATH/5-64-----------------------
ASK12_ARATH/4-64-----------------------
Q89374_PBCV1/1-61-----------------------
ELOC_YEAST/4-66-----------------------
SKP1A_DICDI/2-63-----------------------
SKP1_EMENI/4-65-----------------------

PF11822

Q29D48_DROPS/298-606..DTAGPSGRFACC.GQQAFRYE
Q4Q8A2_LEIMA/20-417E.DVKYLFLWFDYCAEHNVYERE
Q0IFU1_AEDAE/236-536EGRVAGPAGRYPCC.GKQAYRYE
Q383Z9_TRYB2/26-376SEDADALLAWFDLA....KNLYP
A4HGL7_LEIBR/10-407E.DVSYLVRWFDYCAEHHVYERE
A7S8V2_NEMVE/1-302TI.....VGVYPCC.QQRVLPFD
Q4DXB1_TRYCC/30-401RADSEALLAWYDYS....KYLYV
F7EPV1_XENTR/146-448SLDSPG.TGIFLCC.NQKVLRFD
H3DIA0_TETNG/1-303DRGWHG.AGLYPCC.NQRALRFD

PF02214

KCNSK_CAEEL/135-238-----------------------
KCNA5_MOUSE/113-204-----------------------
KCNAL_DROME/43-132-----------------------
KCNS1_MOUSE/21-120-----------------------
KCNS3_HUMAN/17-116-----------------------
Q18986_CAEEL/7-97-----------------------
KCNA7_MOUSE/47-138-----------------------
P91557_CAEEL/6-93-----------------------
O17001_CAEEL/21-113-----------------------
O16612_CAEEL/6-96-----------------------
O16709_CAEEL/9-96-----------------------
O16706_CAEEL/5-95-----------------------
KCNB1_HUMAN/33-132-----------------------
KCNC1_HUMAN/10-104-----------------------
P91564_CAEEL/5-95-----------------------
KCNAW_DROME/12-102-----------------------
KCNS2_MOUSE/19-118-----------------------
O16613_CAEEL/8-96-----------------------
KCA10_HUMAN/88-179-----------------------
KCND1_HUMAN/42-131-----------------------
KCND3_RAT/42-131-----------------------
Q20381_CAEEL/28-127-----------------------
KCNG1_HUMAN/65-164-----------------------
Q26597_SCHMA/53-144-----------------------
O16711_CAEEL/8-100-----------------------
KCNV1_RAT/44-153-----------------------
Q18776_CAEEL/84-176-----------------------
KCNAB_DROME/279-378-----------------------
O16630_CAEEL/2-90-----------------------
P91256_CAEEL/38-137-----------------------
BACD2_MOUSE/30-120-----------------------
O16708_CAEEL/99-187-----------------------
KCNG2_CHICK/59-158-----------------------
B4L763_DROMO/24-111-----------------------

PF16017

E7F994_DANRE/70-299-----------------------
G3W7V3_SARHA/151-380-----------------------
W4ZCZ0_STRPU/50-279-----------------------
E9JD94_SOLIN/154-383-----------------------
A9UPC4_MONBE/63-292-----------------------
E4XC39_OIKDI/75-305-----------------------
F7AXE7_CIOIN/162-392-----------------------
T1L0V7_TETUR/82-310-----------------------
W5KS29_ASTMX/198-429-----------------------
E9BXQ6_CAPO3/355-585-----------------------
K1QX87_CRAGI/168-393-----------------------
H2KQY4_CLOSI/945-1176-----------------------
A7S9A9_NEMVE/133-363-----------------------
H3FGC5_PRIPA/9-239-----------------------
B3SBZ6_TRIAD/36-264-----------------------
F2U9A9_SALR5/300-529-----------------------
G3HKB9_CRIGR/153-382-----------------------
F6TDG6_XENTR/196-425-----------------------
T1G141_HELRO/46-274-----------------------
I1FT20_AMPQE/71-291-----------------------
E5SRV9_TRISP/693-924-----------------------

PF07707

IPP_MOUSE/139-241-----------------------
KBTBC_MOUSE/131-233-----------------------
Q7PXP7_ANOGA/170-272-----------------------
KLHL8_MOUSE/178-280-----------------------
O61795_CAEEL/158-260-----------------------
KLHL6_MOUSE/172-274-----------------------
KLH18_HUMAN/140-242-----------------------
KELC_DROME/258-360-----------------------
KBTB3_HUMAN/150-252-----------------------
GAN_MOUSE/134-236-----------------------
Q7PMB5_ANOGA/179-281-----------------------
Q7QHD7_ANOGA/175-277-----------------------
Q7QI84_ANOGA/148-248-----------------------
KBTB8_HUMAN/152-254-----------------------
Q7Q1T2_ANOGA/174-276-----------------------
KLH21_HUMAN/138-239-----------------------
ENC1_HUMAN/149-251-----------------------
O16313_CAEEL/170-270-----------------------
O18147_CAEEL/153-255-----------------------
KLH41_HUMAN/135-237-----------------------
KLHL2_HUMAN/158-260-----------------------
KEAP1_RAT/184-286-----------------------
Q6DJ21_XENTR/98-200-----------------------
Q6GKZ1_DROME/195-298-----------------------
KLH23_MOUSE/139-240-----------------------
KLH21_DANRE/140-242-----------------------
Q6PFE1_MOUSE/275-376-----------------------
KLH31_DANRE/173-274-----------------------
KLH17_MOUSE/192-294-----------------------
Q6TEQ2_DANRE/149-251-----------------------
Q7KSF5_DROME/192-294-----------------------
Q7SYC4_DANRE/168-270-----------------------
Q86BQ6_DROME/179-281-----------------------
KLH26_MOUSE/156-257-----------------------
KLH38_MOUSE/136-237-----------------------
KLH31_MOUSE/172-273-----------------------
Q8N4I8_HUMAN/152-254-----------------------
KLH36_HUMAN/148-250-----------------------
KLH25_MOUSE/149-251-----------------------
Q8V3G0_SWPV1/125-224-----------------------
KLH28_MOUSE/137-239-----------------------
BTBDH_MOUSE/169-269-----------------------
Q9Q8G2_MYXVL/125-224-----------------------
Q9VGE5_DROME/143-245-----------------------
Q9VK21_DROME/187-289-----------------------
Q9W2S3_DROME/150-248-----------------------
Q9W4L5_DROME/162-265-----------------------
Q9W4S3_DROME/306-407-----------------------
A1Z7I5_DROME/227-323-----------------------
A9JSR2_XENTR/131-232-----------------------
A9ULG0_XENTR/113-214-----------------------
B8JJT0_DANRE/167-269-----------------------
E7FB71_DANRE/142-244-----------------------
F1Q6J6_DANRE/201-302-----------------------
F1QEG2_DANRE/136-238-----------------------
F1QLH3_DANRE/143-240-----------------------
F6S3C9_XENTR/135-236-----------------------
F6VL93_XENTR/137-231-----------------------
F7AJ67_XENTR/158-260-----------------------
F7FRL0_MACMU/216-317-----------------------
H2V3E3_TAKRU/76-175-----------------------
H2V3E4_TAKRU/116-216-----------------------
KBTB1_VACCW/123-219-----------------------
KLH25_XENTR/149-250-----------------------
Q0V9R8_XENTR/168-270-----------------------
Q1ECZ2_DANRE/160-262-----------------------
Q66IL9_XENTR/176-277-----------------------
Q66JH7_XENTR/149-248-----------------------
BTBDH_XENTR/160-257-----------------------
Q7PNH6_ANOGA/201-303-----------------------
Q8BUX1_MOUSE/155-254-----------------------
BTBD9_MOUSE/143-239-----------------------
KLHL1_MOUSE/317-416-----------------------
Q9VRA7_DROME/151-248-----------------------
W5MS53_LEPOC/170-271-----------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window