Sequence alignment for CL0035

PF05450

NICA_MOUSE/273-498--------------------------------------------------RVVVAA------TRLDS-------------
Q7PY38_ANOGA/276-510--------------------------------------------------RIVLVS------TRTDT-------------
Q6Z743_ORYSJ/248-457--------------------------------------------------PIIMVT------ASQDS-------------
NICA_CAEEL/278-508--------------------------------------------------KYMMVT------ARMDS-------------
NICA_ARATH/251-460--------------------------------------------------PVVLTV------ASMDT-------------
Q7KS07_DROME/236-469--------------------------------------------------KFILVT------CRLDT-------------

PF04389

Q7PQQ4_ANOGA/170-341--------------------------------------------------HALLLN------CHFDS.VA.......---
M28P1_NEUCR/178-345--------------------------------------------------GLTLVN------AHYDS.VS.......---
M28P1_YEAST/149-315--------------------------------------------------EGLLLS------AHFDS.VP.......---
Q7Q1Q7_ANOGA/130-334--------------------------------------------------RNLVLA------CHYDS......KY..---
Q7RW54_NEUCR/186-361--------------------------------------------------NLVIVS------AHYDS.TG.......---
QPCTL_MOUSE/162-367--------------------------------------------------RHLTLA------CHYDS......KF..---
Q7QJV5_ANOGA/159-330--------------------------------------------------NYLMLS------SHFDS.VP.......---
Q9YDB0_AERPE/212-375--------------------------------------------------GVVLAG------AHLDH..........---
Q7PX80_ANOGA/293-461--------------------------------------------------SVVVVS------GHLDS...W.D....---
Q9KLD3_VIBCH/193-374--------------------------------------------------EWVIVG------GHLDS.TL...GS..---
Q898V9_CLOTE/225-396--------------------------------------------------EPIIIS------GHFDH..........---
Q82DU6_STRAW/116-300--------------------------------------------------QVVMSG------SHLDS.VT.......---
Q8SX46_DROME/72-243--------------------------------------------------NYLLVN------SHYDS.EV.......---
Q7RZ44_NEUCR/250-445--------------------------------------------------NVLIVG------GHSDS.VA.......---
Q9A578_CAUCR/260-453--------------------------------------------------EYVVLT------AHLDG.LG..VGA..---
Q87AH5_XYLFT/290-488--------------------------------------------------ETVIYS------AHWDH.LGV.GAP..---
Q9SXH2_IPOBA/146-316--------------------------------------------------NAILVS------AHVDT.VF.......---
Q9HRR8_HALSA/220-384--------------------------------------------------AELLVT------SHVDA..........---
AMPX_VIBPR/196-377--------------------------------------------------EWIVIG------GHLDS.TI...GS..---
Q8TL26_METAC/121-299--------------------------------------------------KLILVT------AHLDS.VNLTGGR..---
APE3_YEAST/307-487--------------------------------------------------NIVALG------AHSDS.VE.......---
Q7X7Q3_ORYSJ/128-297--------------------------------------------------NLILVS------SHIDT.VS.......---
QPCT_BOTJA/137-351--------------------------------------------------RHLVIA------CHYDS......KY..---
YC52_SCHPO/154-322--------------------------------------------------EAVLIN------AHVDS.TL.......---
Q7UQS9_RHOBA/733-948--------------------------------------------------PVVMVG------AHIDH.LGR.GGGSN---
Q8CK35_STRCO/710-894--------------------------------------------------SVYMFG------AHLDG.VS.......---
YFI8_YEAST/119-344--------------------------------------------------EYLVLA------AHYDT......KI..---
Q9VRQ9_DROME/107-312--------------------------------------------------NFLALA------CHYDS......KY..---
Q9FBN5_STRCO/130-314--------------------------------------------------DVYMFG------AHLDS.VS.......---
Q7MAY9_PHOLL/149-318--------------------------------------------------GTLLFV------SHYDS.VR.......---
Q8MT48_DROME/150-321--------------------------------------------------AALLIN------SHFDS.VP.......---
Q9F3Y1_PSEAI/119-319--------------------------------------------------KFLVLG------AHYDT.YYGRP....---
Q86PD7_DROME/130-333--------------------------------------------------RYLVLS------CHYDS......KY..---
O64804_ARATH/146-318--------------------------------------------------ASVLMN------AHYDS.PV.......---
Q82VZ8_NITEU/829-1008--------------------------------------------------QSLVIG------AHYDH.LGLGWPD..---
O82996_AERPU/193-374--------------------------------------------------EVVVLG------GHLDS.TA...GS..---
Q9A369_CAUCR/119-286--------------------------------------------------PAILVM------SHYDS.VH.......---
Q9HZQ8_PSEAE/289-482--------------------------------------------------NVVMVG------AHLDS.VF.......---
Q8PPS0_XANAC/311-509--------------------------------------------------ETVIYS------AHWDH.IGV.GKP..---
Q8GGR6_STRAZ/146-311--------------------------------------------------GRVLIV------AHYDS.AE.......---
Q9A3U5_CAUCR/192-390--------------------------------------------------ETVIFS------GHWDH.LGV.GLP..---
Q7UGZ5_RHOBA/480-666--------------------------------------------------ETVVIG------AHYDH.VGMGGIG..---
Q7MT37_PORGI/117-314--------------------------------------------------GRMLLM------AHWDT.RPVCDQD..---
IAP_ECOLI/110-321--------------------------------------------------QQIIIM------AHLDTYAPLSDAD..---
Q8EF07_SHEON/278-467--------------------------------------------------EVVMMH------AHWDH.LGT.VIE..---
Q8PEF6_XANCP/333-532--------------------------------------------------EAVLYM------AHWDH.LGK.HDG..---
Q7S0R5_NEUCR/126-350--------------------------------------------------ALLTLV------AHYDS......KI..---
Q9A4J1_CAUCR/335-529--------------------------------------------------QTIILS------AHLDH.IGIKPNA..---
Q8EDI3_SHEON/278-480--------------------------------------------------EHILFT------GHWDH.IG...KD..---
APX_STRGR/78-262--------------------------------------------------KVLMAG------AHLDS.VS.......---
Q53737_STRAD/260-459--------------------------------------------------HTVVSG------AHLDS.VP.......---
Q9VTH7_DROME/129-318--------------------------------------------------RYLMFG------CHYDS......KY..---
M28P1_SCHPO/140-307--------------------------------------------------FPILLS------AHFDS.VS.......---
YP67_CAEEL/167-338--------------------------------------------------NSLLLN------CHFDT.MP.......---
Q9HNP7_HALSA/224-389--------------------------------------------------TEVVVI------AHHDA..........---
Q8A4P9_BACTN/117-317--------------------------------------------------KRIALF------AHWDT.RPWADND..---
Q7ND13_GLOVI/309-501--------------------------------------------------EYIVLS------AHLDH.LG..IGE..---
Q7UHT1_RHOBA/176-373--------------------------------------------------TRFLLC------AHYDT.RP..YPD..---
Q8A5P9_BACTN/139-321--------------------------------------------------EYVIVG------AHFDH.LGI.DPA..---
Q97F97_CLOAB/227-398--------------------------------------------------NPVVIS------AHFDH..........---
Q7U215_MYCBO/264-463--------------------------------------------------NVVMAG------AHLDS.VP.......---
Q8XIF2_CLOPE/231-402--------------------------------------------------PPLVLT------AHFDH..........---
O67732_AQUAE/190-352--------------------------------------------------PVLLLV------AHYDT.KP.......---
Q8P3Z6_XANCP/298-496--------------------------------------------------ETVIFS------AHWDA.FGV.GKA..---
Q93EJ5_BACLI/248-421--------------------------------------------------DIVYVT------SHYDS.VP.......---

PF09940

Q7CVW7_AGRT5/56-440-------------------------------IEQRAVPSGTRVFDWTVPQEWIVRD------AYVKNEAGRKVIDFQISN
A0KQQ6_AERHH/58-441-------------------------------LQIHEVASGTECFDWTVPDEWNVRE------AYIVGPDGRRVVDFQDHN
A1AY62_PARDP/36-438-------------------------------LKQHAVASGEQVLDWTVPNEWSVEG------AQLIGPNGEMICDFAINN
Q72C97_DESVH/55-438-------------------------------LGLHEIPSGAACFDWNVPDEWNIRS------AFVMDENGNKVIDFARNN
A5EAW0_BRASB/54-437-------------------------------LQIREVETGTAVLDWHVPKEWNIRG------AHIATMDGRRLVDFADSN
A9A1R6_NITMS/33-410-------------------------------LKIHKIPSGTKCWTWEVPLAWEVKE------AFIEN.NGGKIIDVKDHP
Q1YPT3_9GAMM/45-430-------------------------------LKIESVPSGYKAFDWTVPKEWSVVA------AYIEDDKGNVVVDFKDNN
Q74B36_GEOSL/49-431-------------------------------LRLVEVPTGTQVFDWTVPREWAIRD------AHISDSNGKRIVDFRSNN
Q9RJJ2_STRCO/40-423-------------------------------LHMHEVPTGTQVLDWTVPQEWNIRD------AYVADATGRRVVDFAASS
A8L141_FRASN/59-442-------------------------------FTVHEVPSGTPVLDWTVPREWNVAG------ARLVGPDGRVVLDVADNP
A7H288_CAMJD/53-435-------------------------------LKFHSIKSGTKVFDWIVPDEWNVKE------AYIITPEGEKICDFKKHN
A4YXC9_BRASO/50-433-------------------------------LTIHEVPTGTPVLDWHVPAEWNIRG------ATISTLSGQRLVDFADNN
Q97H19_CLOAB/50-432-------------------------------LEIHEVKSGTKVFDWTVPKEWNIKD------AYVRNSKGEKVIDFKENN
Q4HS24_CAMUP/11-393-------------------------------FQIHALASGTEVFDWTIPPEWSVKD------AYIITPQNEKICDFKKHN
A4TVT0_9PROT/37-420-------------------------------LEIHEVPSGTRAFDWTVPDEWNITD------AYILGPDGAKVVDFADNN
A5VUB4_BRUO2/56-440-------------------------------LHIHEVPTGTPLYDWKAPQEWIIRE------ACIADLAGRRIVDFARHN
Q1Q6Z8_9BACT/44-427-------------------------------VTVHEVPSGTQVFDWTVPKEWNITD------AHVKNSKGEKIIDFKENN
A4F0R1_9RHOB/34-418-------------------------------LTITEVASGTQCFDWVVPPEWNVTQ------ARLTAPDGSVVADIADHT

PF00246

Q7QC23_ANOGA/57-339-------------------------------------------------------LL-----DLLAH-------------
Q7QC23_ANOGA/466-752-------------------------------------------------------MV-----SYIQD-------------
Q7PRP0_ANOGA/83-361-------------------------------------------------------MT-----RYLRA-------------
Q7PSV3_ANOGA/117-396-------------------------------------------------------IY-----AWMEL-------------
CBPB2_HUMAN/129-411-------------------------------------------------------IY-----SWIEF-------------
CBPA3_HUMAN/125-404-------------------------------------------------------IV-----AWTEK-------------
NNAD_DROME/879-1138-------------------------------------------------------LQ-----DYLME-------------
AEBP1_MOUSE/561-887-------------------------------------------------------MR-----QLMKA-------------
Q23318_CAEEL/147-446-------------------------------------------------------IC-----DWMKD-------------
Q9W477_DROME/334-625-------------------------------------------------------IK-----QFLQT-------------
Q7Q316_ANOGA/128-403-------------------------------------------------------IY-----TWLDT-------------
CBPC1_CAEEL/734-1008-------------------------------------------------------LN-----SSLSM-------------
CBPB1_BOVIN/125-404-------------------------------------------------------IE-----AWTEQ-------------
CBPE_BOVIN/63-363-------------------------------------------------------VS-----VWLQC-------------
CBPA1_ANOGA/137-415-------------------------------------------------------IH-----AWLDQ-------------
CBPA1_DROME/131-415-------------------------------------------------------TY-----AWLQS-------------
Q9VLZ1_DROME/129-409-------------------------------------------------------IY-----AWLDD-------------
Y1242_ZYMMO/118-364-------------------------------------------------------HH-----DLIAR-------------
CBPD_ANAPL/54-375-------------------------------------------------------GQ-----ALRDL-------------
CBPD_ANAPL/942-1212-------------------------------------------------------LS-----EFLRG-------------
Q9VCM8_DROME/185-464-------------------------------------------------------IN-----AWLKK-------------
O14418_METAN/124-409-------------------------------------------------------HL-----QWMKD-------------
O17754_CAEEL/46-351-------------------------------------------------------LE-----AKLGE-------------
CBPD_RAT/70-372-------------------------------------------------------GE-----ALEAA-------------
CBPD_RAT/509-784-------------------------------------------------------ME-----IFLRR-------------
CBPD_RAT/937-1201-------------------------------------------------------LS-----EFLRG-------------
O61532_DROHE/129-408-------------------------------------------------------TY-----TWMRN-------------
YBJ7_SCHPO/189-484-------------------------------------------------------IN-----SWLRL-------------
O77063_APLCA/41-315-------------------------------------------------------IV-----SLFTS-------------
O77063_APLCA/474-752-------------------------------------------------------MT-----KFLQD-------------
O97389_HELAM/127-412-------------------------------------------------------VD-----AYLQE-------------
CBPA1_BOVIN/128-406-------------------------------------------------------IY-----DFMDL-------------
CBPB_ASTFL/12-290-------------------------------------------------------IN-----AWLDS-------------
CBPN_HUMAN/31-330-------------------------------------------------------LV-----RTLYK-------------
CBPS_STRGR/138-428-------------------------------------------------------MN-----AAIDA-------------
CBPA2_RAT/127-404-------------------------------------------------------IY-----QEMDN-------------
CBPB1_RAT/123-402-------------------------------------------------------IE-----AWIQQ-------------
CBPT_THEVU/113-402-------------------------------------------------------MV-----NKINT-------------
CBPE_LOPAM/37-342-------------------------------------------------------LR-----KALVS-------------
ECM14_YEAST/127-417-------------------------------------------------------IY-----MWLDL-------------
CBPS_STRCP/129-415-------------------------------------------------------TV-----TELNQ-------------
CBPD_DROME/46-327-------------------------------------------------------LE-----DLFAG-------------
CBPD_DROME/462-752-------------------------------------------------------ME-----SYLRA-------------
CBPZ_SIMVI/8-286-------------------------------------------------------IY-----SWLDR-------------
P73902_SYNY3/17-361-------------------------------------------------------ID-----QFLQQ-------------
P90667_APLCA/53-357-------------------------------------------------------MV-----SLMYE-------------
P91359_CAEEL/84-366-------------------------------------------------------MT-----AWLKA-------------
P91755_LUMRU/82-363-------------------------------------------------------VV-----AWMNE-------------
ENP1_LYSSH/115-389-------------------------------------------------------MM-----NDIKK-------------
Q22825_CAEEL/64-346-------------------------------------------------------LT-----DHIHN-------------
Q7NHR1_GLOVI/52-276-------------------------------------------------------DI-----AYAQR-------------
Q7NMK5_GLOVI/121-539-------------------------------------------------------TA-----VYWRK-------------
Q7NYA9_CHRVO/137-389-------------------------------------------------------YD-----QHLNL-------------
Q7NYK5_CHRVO/83-312-------------------------------------------------------TL-----AYLQK-------------
A8BM27_GIAIC/624-987-------------------------------------------------------LL-----ASADH-------------
Q7RI20_PLAYO/819-1026-------------------------------------------------------IT-----KEITK-------------
Q7S312_NEUCR/128-414-------------------------------------------------------HL-----TFLRD-------------
CBPA1_MOUSE/128-406-------------------------------------------------------IY-----EFMDL-------------
Q7UE12_RHOBA/168-401-------------------------------------------------------IA-----TWVDT-------------
Q7W2L4_BORPA/327-506-------------------------------------------------------IA-----GQMAQ-------------
Q829W4_STRAW/126-404-------------------------------------------------------LE-----EEIVR-------------
Q82L57_STRAW/15-263-------------------------------------------------------IV-----SSARA-------------
Q82MI7_STRAW/50-294-------------------------------------------------------EQ-----DFLTA-------------
Q86FI7_SCHJA/151-426-------------------------------------------------------II-----QYLDQ-------------
Q86P95_DROME/159-438-------------------------------------------------------IY-----EWLDK-------------
CBPA4_HUMAN/129-408-------------------------------------------------------IY-----HEMDN-------------
Q871Q3_NEUCS/204-502-------------------------------------------------------IT-----SWMAL-------------
Q87JK3_VIBPA/143-392-------------------------------------------------------HL-----DLLHM-------------
Q88KC6_PSEPK/125-366-------------------------------------------------------HN-----QLIER-------------
Q897X5_CLOTE/135-416-------------------------------------------------------LE-----RDING-------------
Q8AVS2_XENLA/141-421-------------------------------------------------------IE-----SWMFY-------------
Q8AXN3_PAROL/115-395-------------------------------------------------------VQ-----SWIAS-------------
Q8AXN4_PAROL/128-406-------------------------------------------------------IY-----SFQDM-------------
Q8AXN5_PAROL/128-406-------------------------------------------------------IY-----SWMDT-------------
Q8EEF8_SHEON/114-366-------------------------------------------------------YE-----RHLDL-------------
Q8EKE3_SHEON/95-358-------------------------------------------------------TI-----AWLDR-------------
Q8EQG9_OCEIH/116-389-------------------------------------------------------IQ-----D.LIL-------------
Q8ESH0_OCEIH/55-359-------------------------------------------------------EL-----EFLEE-------------
CBPZ1_PLAF7/1011-1251-------------------------------------------------------GT-----KIIKR-------------
Q8IGC4_DROME/129-411-------------------------------------------------------TH-----RWMQN-------------
Q8IMH9_DROME/186-465-------------------------------------------------------YL-----NVIDA-------------
Q8MYY0_DROME/152-429-------------------------------------------------------VL-----SFMSG-------------
B4E3Q2_HUMAN/324-632-------------------------------------------------------MR-----QLMKV-------------
Q8P4I9_XANCP/58-309-------------------------------------------------------TR-----AWLKR-------------
Q8PAS3_XANCP/44-407-------------------------------------------------------VI-----ALCDA-------------
Q8PMH9_XANAC/44-312-------------------------------------------------------VI-----ALCDA-------------
CBPA5_MOUSE/145-423-------------------------------------------------------IY-----SWIDN-------------
Q8SXR8_DROME/47-329-------------------------------------------------------II-----NYIDD-------------
Q8SZR4_DROME/44-328-------------------------------------------------------IM-----QYLDE-------------
Q8T0Q1_DROME/57-337-------------------------------------------------------IE-----AWLDE-------------
Q8TK20_METAC/106-433-------------------------------------------------------VE-----SALIN-------------
Q8UUK1_CHICK/130-406-------------------------------------------------------IY-----AFMDL-------------
Q8XMR3_CLOPE/302-537-------------------------------------------------------ID-----DWYLD-------------
CBPN_MOUSE/31-330-------------------------------------------------------LV-----RTLYK-------------
Q961J8_DROME/129-406-------------------------------------------------------IN-----AYLDE-------------
Q96K85_HUMAN/1-240-------------------------------------------------------MD-----YFFRE-------------
Q9A9J5_CAUCR/82-489-------------------------------------------------------YE-----AYLKA-------------
Q9ABB9_CAUCR/88-349-------------------------------------------------------TR-----AWFQK-------------
Q9BL88_CAEEL/131-431-------------------------------------------------------VI-----NYLNS-------------
Q9HZF4_PSEAE/85-359-------------------------------------------------------TR-----AYLEK-------------
Q9I012_PSEAE/122-366-------------------------------------------------------VE-----RALG.-------------
Q9K698_BACHD/54-324-------------------------------------------------------MV-----SFLEH-------------
Q9PUF2_BOTJA/125-404-------------------------------------------------------ID-----AWTAD-------------
Q9TZC6_CAEEL/153-440-------------------------------------------------------MV-----EFMKL-------------
Q9U9K2_AEDAE/130-407-------------------------------------------------------IH-----AWLDK-------------
Q9VRZ3_DROME/121-402-------------------------------------------------------IY-----AWLDV-------------
Q9VS63_DROME/44-354-------------------------------------------------------VN-----QYLQY-------------
Q9VS67_DROME/133-412-------------------------------------------------------IN-----QFIED-------------
Q9VX86_DROME/1095-1422-------------------------------------------------------IV-----KYLET-------------
Q9W475_DROME/827-1104-------------------------------------------------------IH-----GFIDY-------------
Q9W478_DROME/154-431-------------------------------------------------------IY-----SFMRE-------------
Q9X7P4_STRCO/55-266-------------------------------------------------------EE-----QALLS-------------
Q9XBW4_PORGN/123-386-------------------------------------------------------YI-----SMMEE-------------
Q9XU75_CAEEL/167-465-------------------------------------------------------MV-----KYMRT-------------

PF04952

ASTE_ECOLI/42-322--------------------------------------------------------------------------------
ASTE_VIBVU/52-331--------------------------------------------------------------------------------
Q8D7U9_VIBVU/56-332--------------------------------------------------------------------------------
ASTE_PSESM/48-330--------------------------------------------------------------------------------
ACY3_HUMAN/10-301--------------------------------------------------------------------------------
Q88EN1_PSEPK/47-329--------------------------------------------------------------------------------
ACY2_BOVIN/10-301--------------------------------------------------------------------------------
P72108_NATPH/45-319--------------------------------------------------------------------------------
Q8REZ3_FUSNN/9-257--------------------------------------------------------------------------------
A9CH33_AGRT5/52-333--------------------------------------------------------------------------------
ASTE_SALTY/42-322--------------------------------------------------------------------------------
ASPA_SYNY3/5-284--------------------------------------------------------------------------------
Q87RV7_VIBPA/50-319--------------------------------------------------------------------------------
ACY3_MOUSE/10-300--------------------------------------------------------------------------------
ASTE_SHEON/52-339--------------------------------------------------------------------------------
Q987A0_RHILO/66-347--------------------------------------------------------------------------------
Q92SQ8_RHIME/30-339--------------------------------------------------------------------------------
ASTE_VIBCH/52-331--------------------------------------------------------------------------------
Q8KGS0_RHILI/43-328--------------------------------------------------------------------------------
ASPA_NOSS1/3-288--------------------------------------------------------------------------------
ASTE_PSEPK/48-330--------------------------------------------------------------------------------
Q87HF0_VIBPA/56-331--------------------------------------------------------------------------------
Q9HNH1_HALSA/42-314--------------------------------------------------------------------------------
ASPA_PROMA/2-289--------------------------------------------------------------------------------
ASTE_YERPE/42-323--------------------------------------------------------------------------------
ASTE_PSEAE/48-331--------------------------------------------------------------------------------
Q89N67_BRAJA/46-333--------------------------------------------------------------------------------
Q98JD4_RHILO/49-329--------------------------------------------------------------------------------
Q8EGL7_SHEON/48-317--------------------------------------------------------------------------------
A9CLI1_AGRT5/46-332--------------------------------------------------------------------------------
Q8EAC2_SHEON/33-365--------------------------------------------------------------------------------
Q92WC2_RHIME/47-328--------------------------------------------------------------------------------
Q98AA0_RHILO/43-328--------------------------------------------------------------------------------

PF10994

A0L457_MAGSM/24-365-----------------------------------------------------FPAT.----SYQQL-------------
A4XNS7_PSEMY/6-345-----------------------------------------------------F.AQ.----SYAEA-------------
Q4DHE8_TRYCC/47-382-----------------------------------------------------F.SQ.----SYHAA-------------
Q0RN36_FRAAA/3-356-----------------------------------------------------F.SA.----NYEQA-------------
A4HIN1_LEIBR/48-391-----------------------------------------------------Y.SS.----SYQLA-------------
A0Z3J5_9GAMM/7-347-----------------------------------------------------F.SK.----SYSEA-------------
Q0EX57_9PROT/12-350-----------------------------------------------------F.AV.----DYRQA-------------
Q213B6_RHOPB/13-353-----------------------------------------------------F.AL.----DYTGA-------------
Q3K6V4_PSEPF/5-352-----------------------------------------------------FPTQP----SYREQ-------------
Q7VZV3_BORPE/14-354-----------------------------------------------------Y.AL.----DYHRA-------------
A4GJN2_9BACT/7-352-----------------------------------------------------F.SK.----SYTEA-------------
A7HS30_PARL1/18-367-----------------------------------------------------F.SD.----TYVEA-------------
Q7W0U8_BORPA/7-349-----------------------------------------------------F.SE.----TYAQA-------------
A1VW91_POLNA/13-355-----------------------------------------------------F.SL.----NYAQA-------------
A1W380_ACISJ/8-351-----------------------------------------------------F.AA.----SYAQA-------------
Q12BQ5_POLSJ/8-351-----------------------------------------------------F.SS.----SYAQA-------------
Q2KVE6_BORA1/8-348-----------------------------------------------------F.CH.----NYVEA-------------
C6BDX1_RALP1/7-346-----------------------------------------------------F.SQ.----TYDEA-------------
A9BGZ8_PETMO/4-348-----------------------------------------------------Y.SY.----DYDEC-------------
Q0K9X8_CUPNH/4-344-----------------------------------------------------F.SR.----SYAEA-------------
Q46ZZ8_CUPPJ/8-348-----------------------------------------------------F.AT.----SYAEA-------------
A4A0X2_9PLAN/9-348-----------------------------------------------------F.PR.----DYDQS-------------
Q586Z8_TRYB2/47-385-----------------------------------------------------F.AQ.----SFHVA-------------
Q118U2_TRIEI/12-348-----------------------------------------------------F.SE.----TYNEA-------------
A1TK81_ACIAC/8-351-----------------------------------------------------F.SS.----TYARA-------------
A9KLP9_CLOPH/53-407-----------------------------------------------------F.LN.----EYSEV-------------
A5V6N1_SPHWW/7-348-----------------------------------------------------F.AP.----DYDGA-------------
A7HTE6_PARL1/10-349-----------------------------------------------------F.SQ.----SYAEA-------------
A3RS53_RALSL/7-346-----------------------------------------------------F.AP.----TYDEA-------------
Q1LB58_RALME/20-354-----------------------------------------------------F.SR.----TYAEA-------------
A0YFP1_9GAMM/12-355-----------------------------------------------------F.SD.----SYETA-------------
Q1LNH9_RALME/10-350-----------------------------------------------------F.AR.----SYAEA-------------

PF07454

A9VRX1_BACWK/114-390-----------------------------------------------------LKIKD....LR.TF-------------
A0Q1S0_CLONN/78-362-----------------------------------------------------MNSKD....YL.SV-------------
Q0AXA7_SYNWW/53-297-----------------------------------------------------VYTGD....EY.IS-------------
B8FUP8_DESHD/126-356-----------------------------------------------------YNPGD....PE...-------------
A4IR37_GEOTN/100-382-----------------------------------------------------INPDD....PR.SL-------------
Q892Q4_CLOTE/87-346-----------------------------------------------------IKLED....PL.TV-------------
Q2B0L9_9BACI/100-377-----------------------------------------------------VRLND....PG.SL-------------
Q8EPW1_OCEIH/94-372-----------------------------------------------------LQPSD....PR.SL-------------
Q0SRD6_CLOPS/80-354-----------------------------------------------------IKPLD....PI.EL-------------
Q4MRJ9_BACCE/93-374-----------------------------------------------------IRFND....VR.SF-------------
Q8R9I5_THETN/52-292-----------------------------------------------------VHKKD....MY.LS-------------
A6TS45_ALKMQ/53-323-----------------------------------------------------VTRGD....QY.LS-------------
SP2P_BACSU/101-383-----------------------------------------------------INLED....PR.SF-------------
A8MH52_ALKOO/52-308-----------------------------------------------------VNKGD....QY.LS-------------
A5I646_CLOBH/89-359-----------------------------------------------------LNIHN....PI.SL-------------
A4XLX5_CALS8/99-374-----------------------------------------------------VINYD....QE...-------------
A5Z3I4_9FIRM/159-408-----------------------------------------------------L............Y-------------
Q2BBP6_9BACI/48-296-----------------------------------------------------TVASA....SI.AL-------------
Q892Q3_CLOTE/87-344-----------------------------------------------------IKPEE....PL.TI-------------
Q3AAU2_CARHZ/64-305-----------------------------------------------------VAIGD....EI.IT-------------
Q2BEI4_9BACI/44-323-----------------------------------------------------VKPTD....AR.TF-------------
Q735M7_BACC1/90-366-----------------------------------------------------INVND....LR.SL-------------
A1HR03_9FIRM/60-301-----------------------------------------------------IDIGD....SK.SL-------------
A1HTV9_9FIRM/49-295-----------------------------------------------------VRVGD....QC.LT-------------
B0KA89_THEP3/88-386-----------------------------------------------------AKVKD....PI.NI-------------
B8CXL6_HALOH/71-347-----------------------------------------------------IRIKA....PI.TY-------------
A1HTI8_9FIRM/55-292-----------------------------------------------------VHPGD....EF.ID-------------
Q2RKY1_MOOTA/91-333-----------------------------------------------------VLASP....LV.VL-------------
A5D3X4_PELTS/104-345-----------------------------------------------------VSLRG....PA.AI-------------
Q2RIV0_MOOTA/74-321-----------------------------------------------------IYIHD....EF.IS-------------
Q8RB76_THETN/88-377-----------------------------------------------------AKIKD....PL.NL-------------
A6TSM6_ALKMQ/118-410-----------------------------------------------------IDPKEVETKPEEGS-------------
O87702_BACME/80-361-----------------------------------------------------IRAED....AR.SL-------------
Q0AXW7_SYNWW/93-314-----------------------------------------------------ARKKD........M-------------
A8MFA4_ALKOO/129-420-----------------------------------------------------AEDEE....PE.ED-------------
A4J3N7_DESRM/71-313-----------------------------------------------------VAVGD....EI.IN-------------
Q97JJ8_CLOAB/86-350-----------------------------------------------------LDINK....PE.NV-------------
A5N6L6_CLOK5/94-358-----------------------------------------------------LNTSD....VL.SL-------------
A8FFD8_BACP2/101-383-----------------------------------------------------INLED....PR.SF-------------
A6CQZ1_9BACI/100-382-----------------------------------------------------VSFED....PR.SF-------------
Q0AWL6_SYNWW/49-338-----------------------------------------------------LPFKK....IE.LD-------------
A5ZX32_9FIRM/103-360-----------------------------------------------------VQPMP....EI.DL-------------
A6LRM7_CLOB8/91-349-----------------------------------------------------LNNLS....YK.GI-------------
A1BZN2_BACCE/93-367-----------------------------------------------------IKLND....IP.TL-------------
A7VIY1_9CLOT/106-364-----------------------------------------------------IAAMA....GCRSY-------------
Q5WHG7_BACSK/93-381-----------------------------------------------------INPDD....PR.SL-------------
Q9KBM3_BACHD/90-369-----------------------------------------------------IEMGD....IR.SL-------------
Q3AF15_CARHZ/56-323-----------------------------------------------------LWEEN....PR.GY-------------
Q65H48_BACLD/100-381-----------------------------------------------------INLKD....PR.SF-------------

PF01520

Q18AN8_CLOD6/486-667-----------------------------------------------------VMIDP----GH-..-------------
B8G9R1_CHLAD/244-421-----------------------------------------------------VALDP----DD-..-------------
A9BFG0_PETMO/246-450-----------------------------------------------------LVLDP----GH-..-------------
A8MFT2_ALKOO/8-185-----------------------------------------------------VFIDP----GH-..-------------
B8I4Q9_CLOCE/815-990-----------------------------------------------------VVLDA----GH-..-------------
A9VKK0_BACWK/112-312-----------------------------------------------------VVIDP----GH-..-------------
A9KSW1_CLOPH/279-457-----------------------------------------------------IVVDA----GH-..-------------
A8MIX1_ALKOO/49-238-----------------------------------------------------ITVDP----GH-..-------------
B8I0V7_CLOCE/52-254-----------------------------------------------------VCIDA----GH-..-------------
A8ZXB5_DESOH/55-253-----------------------------------------------------IALDP----GH-..-------------
Q05TN6_9SYNE/185-357-----------------------------------------------------VVIDP----GH-..-------------
Q7NKW3_GLOVI/183-391-----------------------------------------------------VVLDP----GH-..-------------
Q8KIW1_BACTI/4-180-----------------------------------------------------VWLDA----GH-..-------------
Q0P8Y7_CAMJE/436-653-----------------------------------------------------VVIDA----GH-..-------------
Q8XP50_CLOPE/109-309-----------------------------------------------------IVIDP----GH-SS-------------
Q65J97_BACLD/4-173-----------------------------------------------------IFIDP----GH-..-------------
A7B6H8_RUMGN/41-218-----------------------------------------------------VVIDS----GH-..-------------
A6LWT5_CLOB8/185-363-----------------------------------------------------IIIDP----GH-..-------------
Q667H0_YERPS/190-405-----------------------------------------------------IMLDP----GH-..-------------
Q89VV6_BRAJA/18-229-----------------------------------------------------IVVDV----GH-..-------------
Q04Q14_LEPBJ/141-357-----------------------------------------------------ILIDA----GH-..-------------
A6TNB4_ALKMQ/3-181-----------------------------------------------------IIIDS----GH-..-------------
Q1B275_MYCSS/43-246-----------------------------------------------------VFLDP----GH-..-------------
Q898S7_CLOTE/57-230-----------------------------------------------------VVLDP----GH-..-------------
A6BEP4_9FIRM/4-173-----------------------------------------------------LFIIA----GH-..-------------
Q1J062_DEIGD/254-436-----------------------------------------------------IVLDP----AR-..-------------
Q1YW18_PHOPR/4-180-----------------------------------------------------IALII----GH-..-------------
A6G6B4_9DELT/15-232-----------------------------------------------------LVIDP----GH-..-------------
A6D8D6_9VIBR/161-381-----------------------------------------------------VAIDA----GH-..-------------
Q2RL42_MOOTA/469-652-----------------------------------------------------IVIDP----GH-..-------------
A4SGW4_PROVI/340-557-----------------------------------------------------IVLDA----GH-..-------------
A5Z962_9FIRM/92-293-----------------------------------------------------ILLDP----GH-..-------------
A5I6J1_CLOBH/742-945-----------------------------------------------------IVLDA----GH-..-------------
Q92C95_LISIN/4-166-----------------------------------------------------VAIFG----GH-..-------------
Q0S524_RHOSR/65-279-----------------------------------------------------VFLDP----GH-..-------------
Q213N5_RHOPB/201-418-----------------------------------------------------VVLDP----GH-..-------------
Q0SPN3_CLOPS/3-175-----------------------------------------------------IAIRG----GH-..-------------
Q65GR1_BACLD/351-520-----------------------------------------------------VVIDA----GH-..-------------
Q3B4P2_PELLD/11-205-----------------------------------------------------VILDN----GH-..-------------
A4QID9_CORGB/191-369-----------------------------------------------------VVIDP----AL-..-------------
E0TDU6_PARBH/209-421-----------------------------------------------------IVIDP----GH-..-------------
Q03S01_LACBA/51-222-----------------------------------------------------ILV.M----GH-..-------------
Q2LTS4_SYNAS/37-231-----------------------------------------------------VMIDP----SH-..-------------
A6NUV0_9FIRM/115-300-----------------------------------------------------VVIDA----GH-..-------------
A6BCQ8_9FIRM/5-174-----------------------------------------------------IMLDA----GH-..-------------
A6GWP0_FLAPJ/28-200-----------------------------------------------------VVIDA----AH-..-------------
A4CK99_ROBBH/34-251-----------------------------------------------------VVLDA----GH-..-------------
A6VP10_ACTSZ/21-216-----------------------------------------------------VVLDT----GH-..-------------
Q5N3W4_SYNP6/389-562-----------------------------------------------------IYLDP----GH-..-------------
A5TTN3_FUSNP/131-338-----------------------------------------------------IVIDP----GH-..-------------
Q9Z8C6_CHLPN/61-239-----------------------------------------------------IFIDP----GH-..-------------
Q899C4_CLOTE/144-318-----------------------------------------------------VCLDA----GR-..-------------
A7M1G9_BACOV/3-189-----------------------------------------------------VLIDN----GH-..-------------
Q1GIB7_SILST/182-398-----------------------------------------------------VMIDP----GH-..-------------
Q3EPE6_BACTI/350-535-----------------------------------------------------IIIDP----GH-..-------------
Q9F7S2_PRB01/77-296-----------------------------------------------------VAIDA----GH-..-------------
Q9JZE9_NEIMB/5-174-----------------------------------------------------ICLTA----GH-..-------------
Q5WE61_BACSK/4-182-----------------------------------------------------IAICA----GH-..-------------
A8D7W0_STREQ/5-171-----------------------------------------------------LVI.C----GH-..-------------
A5D0T0_PELTS/124-289-----------------------------------------------------IAIDP----GH-..-------------
Q1K0X5_DESAC/166-349-----------------------------------------------------VAIDP----GH-..-------------
Q73LZ8_TREDE/115-329-----------------------------------------------------ILIDP----GH-..-------------
Q9LCR4_PAEPO/339-511-----------------------------------------------------VVIDP----GH-..-------------
Q8ETR2_OCEIH/45-230-----------------------------------------------------IVIDP----GH-..-------------
A0ZJD3_NODSP/4-182-----------------------------------------------------IFISA----AH-GG-------------
Q1MPK0_LAWIP/382-592-----------------------------------------------------ILIDA----GH-..-------------
Q1D594_MYXXD/56-271-----------------------------------------------------IYLDA----GH-..-------------
Q187L1_CLOD6/3-170-----------------------------------------------------VVIIP----GH-TL-------------
A6BIV4_9FIRM/91-291-----------------------------------------------------IVLDP----GH-SA-------------
AMIB_BUCAI/7-226-----------------------------------------------------ILIDA----GH-..-------------
A6M0K3_CLOB8/58-252-----------------------------------------------------IVVDP----GH-N.-------------
A5N4X3_CLOK5/47-233-----------------------------------------------------VLLDP----GH-..-------------
P89923_9VIRU/5-173-----------------------------------------------------VTVHA----GH-T.-------------
Q6MJS0_BDEBA/26-247-----------------------------------------------------IMLDP----GH-..-------------
Q9RRC5_DEIRA/161-334-----------------------------------------------------IVLDP----GH-..-------------
Q1ATQ5_RUBXD/173-345-----------------------------------------------------IVIDA----AH-..-------------
A2W3V4_9BURK/65-263-----------------------------------------------------IVVDT----GH-..-------------
A7B7G5_RUMGN/233-431-----------------------------------------------------VVICA----GH-..-------------
A4J7N3_DESRM/56-235-----------------------------------------------------LIIDP----GH-..-------------
Q660K4_BORGA/111-328-----------------------------------------------------IIIDP----GH-..-------------
A5ZLC0_9BACE/142-353-----------------------------------------------------VV..S----GH-..-------------
A8F7U0_THELT/27-198-----------------------------------------------------IVVDP----GH-..-------------
A7B5H6_RUMGN/3-173-----------------------------------------------------IGLRG----GH-..-------------
A7VC22_9CLOT/62-238-----------------------------------------------------VCLDP----GH-..-------------
Q1K061_DESAC/6-189-----------------------------------------------------ILIDP----GH-..-------------
A0YSJ1_LYNSP/1619-1787-----------------------------------------------------IILDP----GH-..-------------
A0NJM0_OENOE/125-302-----------------------------------------------------IVLDP----GH-..-------------
Q2YZD0_9FLAO/42-220-----------------------------------------------------IIIDV----GH-..-------------
A6LTJ0_CLOB8/6-175-----------------------------------------------------VAV..----GH-..-------------
Q1INP2_KORVE/300-482-----------------------------------------------------VVLDA----AH-..-------------
Q67SM9_SYMTH/5-211-----------------------------------------------------IVLDP----GH-..-------------
A7VQB6_9CLOT/5-183-----------------------------------------------------IFIDQ----GH-N.-------------
O67592_AQUAE/134-352-----------------------------------------------------VVVDA----GH-..-------------
Q82B44_STRAW/116-328-----------------------------------------------------VVIDP----GH-..-------------
Q8PUP2_METMA/39-226-----------------------------------------------------ICIDP----GH-..-------------
A7GP61_BACCN/4-172-----------------------------------------------------AAISA----GH-..-------------
Q5WG95_BACSK/210-375-----------------------------------------------------VVIDP----GH-..-------------
Q5JC43_CLODI/3-169-----------------------------------------------------IGINC----GH-TK-------------
A8ATJ1_9CAUD/7-177-----------------------------------------------------LAIYA----GH-..-------------
Q2FGU8_STAA3/181-364-----------------------------------------------------IMLVA----GH-..-------------
Q185X4_CLOD6/3-175-----------------------------------------------------ICITV----GH-SI-------------
Q2J4A8_FRASC/242-415-----------------------------------------------------VAIDP----GH-..-------------
A3UD36_9RHOB/176-386-----------------------------------------------------VVIDP----GH-..-------------

PF02127

DNPEP_MOUSE/22-460FVNRSPSPFHVVAECRSRLL.QAGFRELKETEGWD..I.VPENKYFLTRNSSSIIA------FAVGG-------------
APEA_BORBU/28-456FISKFKTEREVTAYALDKAK.KLGFINAEEKKNL.....MPGDKIFYTCREK.SVA------FAIIG-------------
AMPL_YEAST/59-501FIYKNPTTYHVVSFFAELLD.KHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSA------FILGK-------------
DNPEP_YEAST/25-478FLNSSHSPYHTVHNIKKHLV.SNGFKELSERDSWAGHV.AQKGKYFVTRNGSSIIA------FAVGG-------------
DNPEP_SCHPO/15-453FVNASPTPYHAVQNLAEHYM.SHGFQYLSEKSDWQSKI.EPGNSYFVTRNKSSIIA------FSIGK-------------
APEB_MYCLE/11-421FINASPSPFHVCATVAGRLL.DAGYAELSEVERWP..D.HP.GRYFIVRAGS.LVA------WSAGQ-------------
DNPEP_CAEEL/22-459YLNKAVTPFHATQEVKDRLL.QAGFTELPESGHWD..I.QPTSKYFVTKNRSAILA------FAVGG-------------
APEA_THENE/27-449FMGRAKTERLAVREIRKFLE.KEGFVPIEDFAG......DPMDMAVYAVNRG.KAI------AAFRV-------------
APEB_BORBU/15-419LLDNSPTPYHLVNYIEEKLINYFNAQQLKLNEKWK..I.KT.GSYYIKKEGTSLIA------FNIDV-------------

PF05343

Q8XBQ0_ECO57/43-325---------------------------------------------------GSVLI------RLNES-------------
Q8R656_FUSNN/53-342---------------------------------------------------GALIA------Y.IKG-------------
Q97RZ9_STRPN/45-334---------------------------------------------------GGVNV------T.IKG-------------
Q99TB9_STAAM/49-339---------------------------------------------------GGFFG------V.KKS-------------
O58255_PYRHO/44-324---------------------------------------------------GNLIV------E.LGE-------------
Q8U0N9_PYRFU/45-335---------------------------------------------------GNVIA------H.KKG-------------
Q8XLP6_CLOPE/50-337---------------------------------------------------GCGVI------T.IPG-------------
Q9A1S8_STRP1/45-336---------------------------------------------------GGIFG------I.RDS-------------
Q97MI2_CLOAB/40-324---------------------------------------------------GNIIA------H.KKG-------------
Q8RCI6_THETN/40-326---------------------------------------------------GNLIA------C.KKG-------------
SGCX_SALTY/46-346---------------------------------------------------GNVVA------R.YGS-------------
YSDC_BACSU/48-342---------------------------------------------------GSLIA------K.KTG-------------
Q9K874_BACHD/48-342---------------------------------------------------GSLVA------K.KVG-------------
Q9PQL1_UREPA/50-344---------------------------------------------------GSIIF------..KKT-------------
Q8NUY1_STAAW/45-340---------------------------------------------------GGIFG------K.KNA-------------
AMP_CLOTM/47-324---------------------------------------------------GNLIA------V.KKG-------------
YHFE_BACSU/48-336---------------------------------------------------GGLIA------T.LPG-------------
Q92CJ1_LISIN/45-340---------------------------------------------------GSAVA------K.KVG-------------
Q8NW29_STAAW/49-339---------------------------------------------------GGFFG------V.KKS-------------
P70801_NOSS1/49-337---------------------------------------------------.NIIA------K.IPG-------------
Q92W97_RHIME/53-341---------------------------------------------------GAIRA------L.RPG-------------
Q9X0D8_THEMA/46-324---------------------------------------------------GSLIG------Y.KKG-------------
YTOP_BACSU/46-337---------------------------------------------------GSVFG------V.RRG-------------
Q9K7V2_BACHD/46-337---------------------------------------------------GSIFG------V.KRG-------------
Q8P2X3_STRP8/45-336---------------------------------------------------GGIFG------I.RDS-------------
Q9V0Z4_PYRAB/45-335---------------------------------------------------GNVIA------H.RKG-------------
Q97L72_CLOAB/48-335---------------------------------------------------GNIMA------T.LPG-------------
Q8NWU5_STAAW/45-333---------------------------------------------------GALLI------T.VPG-------------
PEPA_LACLM/44-336---------------------------------------------------GGIFV------T.KAS-------------
Q9UZ39_PYRAB/45-327---------------------------------------------------GAL..------..VAG-------------
Q8X8A6_ECO57/43-333---------------------------------------------------GSFVA------R.KGN-------------
AMPK_PYRFU/45-331---------------------------------------------------GNVIA------H.FKG-------------
Q97NY6_STRPN/45-335---------------------------------------------------GGIFG------I.KHS-------------
Q92D39_LISIN/51-339---------------------------------------------------GGLIV------T.LPG-------------
Q9X0D9_THEMA/40-324---------------------------------------------------GNLIA------L.KRG-------------
Q8ZX99_PYRAE/45-340---------------------------------------------------GNVIG------V.KKG-------------
Q92B98_LISIN/46-337---------------------------------------------------GGIFG------V.RHG-------------
Q9UYH8_PYRAB/43-323---------------------------------------------------GNLIV------E.LGE-------------
Q97MI3_CLOAB/43-327---------------------------------------------------NNIYI------N.KRG-------------
Q8TYB9_METKA/48-341---------------------------------------------------GNVIG------T.IEG-------------
O26537_METTH/45-335---------------------------------------------------GNIIA------V.KRG-------------
O58468_PYRHO/45-327---------------------------------------------------GAL..------..IAG-------------
Q9CIH3_LACLA/44-336---------------------------------------------------GGIFV------T.KTS-------------
Q8RCI5_THETN/45-320---------------------------------------------------GNMIC------V.KKG-------------
TET_PYRHO/50-340---------------------------------------------------GNVIA------H.KKG-------------
Q98PJ2_MYCPU/53-348---------------------------------------------------GSLIL------KHEKS-------------
Q8RCI7_THETN/44-328---------------------------------------------------GNLIF------K.KKG-------------
Q9YCC1_AERPE/44-332---------------------------------------------------GNVVV------N.PSG-------------
Q9V1Q0_PYRAB/45-331---------------------------------------------------GNVIA------H.FKG-------------
FRVX_ECOLI/43-333---------------------------------------------------GSFVA------R.KGN-------------
Q8K8V2_STRP3/45-336---------------------------------------------------GGIFG------I.RDS-------------
O59485_PYRHO/53-339---------------------------------------------------GNVIA------H.FKG-------------
SGCX_SALTI/46-346---------------------------------------------------GNVVA------R.YGS-------------
Q99UB5_STAAM/45-333---------------------------------------------------GALLI------T.VPG-------------
Q8PZ22_METMA/55-349---------------------------------------------------GNLIA------V.KEG-------------
Q8TJD6_METAC/42-336---------------------------------------------------GNLIA------I.KEG-------------
Q8Y6S2_LISMO/46-337---------------------------------------------------GGIFG------V.RHG-------------
Y555_METJA/44-338---------------------------------------------------GNLIA------K.RGN-------------
Q9RXS7_DEIRA/71-359---------------------------------------------------GSVYA------E.LGP-------------
O28479_ARCFU/2-292---------------------------------------------------GNLIC------T.KNG-------------
Q9X0E0_THEMA/42-324---------------------------------------------------GNLIV------W.KGS-------------
Q9HPS1_HALSA/46-335---------------------------------------------------GNAVA------V.AEG-------------
Q8Y7Q5_LISMO/45-340---------------------------------------------------GSAVA------K.KVG-------------
Q8ZX44_PYRAE/36-306---------------------------------------------------GNVVV------R.GS.-------------
Q9HYE5_PSEAE/53-341---------------------------------------------------GTIRA------T.LQG-------------
Q8Y8C6_LISMO/51-339---------------------------------------------------GGLIV------T.LPG-------------
SGCX_ECOLI/46-346---------------------------------------------------GNVVA------R.YGS-------------
Q8U3T6_PYRFU/43-324---------------------------------------------------GNLIV------E.LGE-------------
Q99RH7_STAAM/45-340---------------------------------------------------GGIFG------K.KNA-------------

PF01546

DAPE_RALSO/70-380-----------------------------------------------------VFA------GHTDV-------------
AMHX_BACSU/68-369-----------------------------------------------------AVR------ADIDA-------------
ILL9_ORYSJ/112-431-----------------------------------------------------ALR------ADMDA-------------
DAPE_ZYMMO/70-373-----------------------------------------------------AYA------GHSDV-------------
Q92S66_RHIME/76-388-----------------------------------------------------GIR------ADIDA-------------
YXEP_BACSU/69-374-----------------------------------------------------AIR------ADIDA-------------
DAPE_BORPE/64-374-----------------------------------------------------VFA------GHTDV-------------
YHAA_BACSU/79-392-----------------------------------------------------ALR------ADFDA-------------
Q9FVL5_CUCPE/95-434-----------------------------------------------------FVG------SHMDV-------------
Q880G9_PSESM/87-417-----------------------------------------------------LCG------SHLDS-------------
Q832Y9_ENTFA/78-393-----------------------------------------------------LLR------ADIDA-------------
ILR1_ARATH/109-425-----------------------------------------------------GLR------ADMDA-------------
YJ75_SCHPO/124-397-----------------------------------------------------VLT------SHIDT-------------
Q7WAL0_BORPA/80-413-----------------------------------------------------ATG------SHCDT-------------
Q8FLW7_COREF/70-397-----------------------------------------------------AFR------ADTDG-------------
O29728_ARCFU/50-314-----------------------------------------------------IVS------THLDT-------------
DAPE_BRAJA/67-385-----------------------------------------------------TFA------GHTDV-------------
Q82HY6_STRAW/97-413-----------------------------------------------------ALR------ADIDA-------------
Q7D266_AGRT5/85-459-----------------------------------------------------LFY------GHYDV-------------
Q7W1K0_BORPA/81-415-----------------------------------------------------MTG------SHFDT-------------
Q974N2_SULTO/65-421-----------------------------------------------------LIY------NHYDV-------------
Q9RSU7_DEIRA/81-449-----------------------------------------------------LIY------GHYDV-------------
Q7U3I0_SYNPX/107-432-----------------------------------------------------MTG------SHLDT-------------
LYSK_AERPE/68-345-----------------------------------------------------GLV------GHLDT-------------
Q8TV20_METKA/71-376-----------------------------------------------------VLN------AHLDT-------------
Q17899_CAEEL/71-393-----------------------------------------------------MLY------SHTDV-------------
Q7VS04_BORPE/67-381-----------------------------------------------------VLS------GHTDV-------------
Q9VCQ9_DROME/76-397-----------------------------------------------------VLN------SHTDV-------------
Q89IN7_BRAJA/140-435-----------------------------------------------------LIA------GHMDT-------------
Q984M3_RHILO/78-404-----------------------------------------------------LIG------SHIDT-------------
Q9HS25_HALSA/106-420-----------------------------------------------------GLR------VDIDA-------------
Q97VB6_SULSO/71-398-----------------------------------------------------AIG------SHMDS-------------
IAAH_ENTAG/112-429-----------------------------------------------------AFR------VDMDA-------------
Y1497_METJA/61-343-----------------------------------------------------ILN------SHIDT-------------
Q89D44_BRAJA/88-452-----------------------------------------------------LIY------GHGDV-------------
Q8EMA9_OCEIH/73-390-----------------------------------------------------ALR------ADMDA-------------
ABGA_ECOLI/112-429-----------------------------------------------------AFR------VDMDA-------------
Q82Z92_ENTFA/66-375-----------------------------------------------------GFS------GHMDV-------------
Q92U74_RHIME/82-410-----------------------------------------------------LIG------SHLDT-------------
Q98AF9_RHILO/84-453-----------------------------------------------------LIY------GHYDV-------------
Q7VTF2_BORPE/75-389-----------------------------------------------------VLS------GHTDV-------------
Q9KFW8_BACHD/72-371-----------------------------------------------------LLV------AHMDT-------------
ILL6_ARATH/146-457-----------------------------------------------------AVR------ADMDA-------------
DAPE_PSESM/69-380-----------------------------------------------------CFA------GHTDV-------------
Q8Y9J0_LISMO/73-386-----------------------------------------------------ALR------ADMDA-------------
Q8ELE3_OCEIH/73-408-----------------------------------------------------GLG------SHLDT-------------
DAPE_NEIMB/64-374-----------------------------------------------------CFA------GHTDV-------------
Q9AA70_CAUCR/101-467-----------------------------------------------------VLM------AHQDV-------------
Q8FRQ2_COREF/75-384-----------------------------------------------------AFR------ADIDA-------------
Q8XLK9_CLOPE/110-427-----------------------------------------------------ALR------FDIDG-------------
Q9ZBI7_STRCO/86-442-----------------------------------------------------LVH------GHLDV-------------
DAPE_PASMU/63-373-----------------------------------------------------AFA------GHTDV-------------
Q8XSI7_RALSO/130-504-----------------------------------------------------LLM------AHQDV-------------
Q8CTS7_STAES/74-385-----------------------------------------------------ALR------ADFDA-------------
Q8NLV7_CORGL/76-438-----------------------------------------------------TLL------GHTDV-------------
LYSK_SULTO/63-340-----------------------------------------------------LLA------SHIDT-------------
ALLC_ECOLI/77-406-----------------------------------------------------LSG------SHIDT-------------
Q83EG0_COXBU/70-381-----------------------------------------------------AFH------ANMDA-------------
Q8ESD5_OCEIH/87-390-----------------------------------------------------VIS------AHLDT-------------
DAPE_BUCAI/62-372-----------------------------------------------------TFA------GHTDV-------------
ILL8_ORYSJ/116-436-----------------------------------------------------ALR------ADMDA-------------
Q9RV75_DEIRA/80-405-----------------------------------------------------YIG------SHLDT-------------
DAPE_RICPR/65-381-----------------------------------------------------CFV------GHVDV-------------
Q8D176_YERPE/85-415-----------------------------------------------------LLG------SHLDT-------------
Q89GU6_BRAJA/77-406-----------------------------------------------------LAG------SHLES-------------
ARGE_MORAB/74-378-----------------------------------------------------LLA------GHTDT-------------
Q7NVG4_CHRVO/67-384-----------------------------------------------------VLS------GHSDV-------------
Q7CRI5_AGRT5/79-410-----------------------------------------------------LIG------SHLDS-------------
Q98GJ6_RHILO/84-458-----------------------------------------------------LFY------GHYDV-------------
Q93RZ9_STRCO/83-441-----------------------------------------------------LVH------GHLDV-------------
DAPE_SHIFL/62-372-----------------------------------------------------AFA------GHTDV-------------
Q9CI04_LACLA/65-368-----------------------------------------------------ILT------GHVDT-------------
Q9A7W4_CAUCR/98-396-----------------------------------------------------ILT------GHYDT-------------
Q7N102_PHOLL/113-431-----------------------------------------------------AFR------VDMDA-------------
DAPE_HAEIN/63-373-----------------------------------------------------AFA------GHTDV-------------
Q9I056_PSEAE/107-408-----------------------------------------------------LLM------IHYDT-------------
Q8AWF8_XENLA/112-483-----------------------------------------------------CFY------GHMDV-------------
Q9VCR2_DROME/76-397-----------------------------------------------------ILN------SHTDV-------------
Q7WEA4_BORBR/77-416-----------------------------------------------------MTG------SHLDS-------------
LYSK_THET2/63-350-----------------------------------------------------VLL------GHIDT-------------
O58003_PYRHO/93-411-----------------------------------------------------WIL------SHLDV-------------
Q8FME3_COREF/102-468-----------------------------------------------------LLY------SHFDV-------------
Q81AB5_BACCR/70-375-----------------------------------------------------AVR------ADIDA-------------
Q8XL37_CLOPE/78-393-----------------------------------------------------ALR------ADIDG-------------
Q882Q5_PSESM/82-379-----------------------------------------------------LLL------GHRDT-------------
O49682_ARATH/58-397-----------------------------------------------------FVG------MHMDV-------------
LYSK_PYRAE/58-333-----------------------------------------------------WLH------AHMDT-------------
Q8TRI4_METAC/86-410-----------------------------------------------------ALR------TDTDG-------------
Q8DMU8_THEEB/75-387-----------------------------------------------------AIR------TDMDA-------------
Q89MN6_BRAJA/99-418-----------------------------------------------------ILQ------GHCDV-------------
ARGE_VIBCH/72-375-----------------------------------------------------LLA------GHSDT-------------
DAPE_BUCBP/63-373-----------------------------------------------------AFS------GHTDV-------------
Q7VWF6_BORPE/82-413-----------------------------------------------------ATG------SHIDT-------------
Q7UJ49_RHOBA/95-464-----------------------------------------------------LVY------GHYDV-------------
Q8PUV0_METMA/80-404-----------------------------------------------------ALR------TDTDG-------------
Q17686_CAEEL/70-392-----------------------------------------------------MLY------SHTDV-------------
Q7NHJ5_GLOVI/90-402-----------------------------------------------------GVR------ADMDG-------------
C2H5Z6_ENTFL/79-386-----------------------------------------------------GWR------ADIDG-------------
Q891H7_CLOTE/124-441-----------------------------------------------------AFR------FDIDA-------------
Q92Y75_RHIME/65-371-----------------------------------------------------IIS------GHMDV-------------
Q870Z2_NEUCS/93-468-----------------------------------------------------LVY------GHYDV-------------
Q8A601_BACTN/82-450-----------------------------------------------------LVY------AHYDV-------------
P74654_SYNY3/97-412-----------------------------------------------------AIR------ADMDA-------------
Q7P6B6_FUSNV/81-400-----------------------------------------------------GLR------ADMDA-------------
Q9A411_CAUCR/97-405-----------------------------------------------------VIA------AHLDT-------------
Q8NYT5_STAAW/74-386-----------------------------------------------------AIR------ADFDA-------------
Q93DA3_STRMU/86-455-----------------------------------------------------IFY------NHYDT-------------
Q9RRJ7_DEIRA/74-369-----------------------------------------------------LVL------THADT-------------
ILL4_ARATH/105-421-----------------------------------------------------ALR------ADMDA-------------
ARGE_DICDI/99-443-----------------------------------------------------FVG------SHLDV-------------
Q8XT42_RALSO/90-389-----------------------------------------------------LLM------AHMDT-------------
Q88JE5_PSEPK/77-391-----------------------------------------------------GLR------ADMDA-------------
DUG1_SCHPO/93-468-----------------------------------------------------LIY------NHFDV-------------
Q8PDQ1_XANCP/86-416-----------------------------------------------------LIG------SHLDS-------------
HIPO_CAMJE/72-380-----------------------------------------------------GLR------ADMDA-------------
O58453_PYRHO/75-385-----------------------------------------------------ALR------ADMDA-------------
DAPE_STAES/68-401-----------------------------------------------------AIS------GHMDV-------------
Q8XVG0_RALSO/71-391-----------------------------------------------------GLR------ADMDA-------------
Q831D3_ENTFA/57-417-----------------------------------------------------AFD------GHMDT-------------
Q7V9Q6_PROMA/75-386-----------------------------------------------------GFR------VDMDA-------------
DAPE_RHILO/70-392-----------------------------------------------------MFA------GHTDV-------------
Q882Q4_PSESM/90-456-----------------------------------------------------LSY------GHGDV-------------
Q9A3G5_CAUCR/106-469-----------------------------------------------------LLL------AHIDV-------------
Q8A1V9_BACTN/69-352-----------------------------------------------------LLN------SHIDT-------------
DAPE_WOLSU/62-362-----------------------------------------------------CLA------GHIDV-------------
Q8DRG0_STRR6/86-455-----------------------------------------------------IFY------NHYDT-------------
Q82IQ8_STRAW/88-458-----------------------------------------------------LVY------GHHDV-------------
Q97V97_SULSO/67-433-----------------------------------------------------LIY------NHYDV-------------
Q7CSF2_AGRT5/83-392-----------------------------------------------------GIR------ADIDA-------------
Q8RL92_PSESX/71-384-----------------------------------------------------ALR------ADMDA-------------
Y1078_STAES/63-379-----------------------------------------------------AFR------ADIDA-------------
Q92VC5_RHIME/72-385-----------------------------------------------------GLR------ADMDA-------------
Q884H3_PSESM/106-407-----------------------------------------------------LLM------VHYDT-------------
Q97ZB7_SULSO/81-369-----------------------------------------------------HFN------FHYDV-------------
Q9CMA2_PASMU/70-369-----------------------------------------------------VLS------GHMDT-------------
Q81IL2_BACCR/66-365-----------------------------------------------------AIR------ADMDA-------------
Q89J35_BRAJA/90-405-----------------------------------------------------VLS------GHTDV-------------
Q8CMV9_STAES/68-407-----------------------------------------------------GIS------GHMDV-------------
DAPEL_LISMO/64-370-----------------------------------------------------GYR------TDIDA-------------
Q7VXC4_BORPE/82-409-----------------------------------------------------MTG------SHIDT-------------
Q83F46_COXBU/98-471-----------------------------------------------------LLY------GHMDK-------------
Q89WA3_BRAJA/87-383-----------------------------------------------------LVL------SHLDT-------------
Q893C9_CLOTE/76-402-----------------------------------------------------AMG------SHCDS-------------
YODQ_BACSU/99-418-----------------------------------------------------ILN------GHIDV-------------
Q88AX7_PSESM/67-382-----------------------------------------------------LLS------GHTDV-------------
Q7VV76_BORPE/73-393-----------------------------------------------------GLR------ADMDA-------------
CNDP1_MOUSE/103-477-----------------------------------------------------CFY------GHLDV-------------
YTNL_BACSU/99-404-----------------------------------------------------ALR------ADIDA-------------
Q98L43_RHILO/88-418-----------------------------------------------------HFN------SHIDV-------------
Q8ERY9_OCEIH/74-385-----------------------------------------------------ALR------ADFDG-------------
Q9F464_ARTAU/78-409-----------------------------------------------------AVG------SHFDS-------------
Q970S3_SULTO/66-380-----------------------------------------------------MLN------GHYDV-------------
Q8RNM5_LEGPN/102-463-----------------------------------------------------LLL------AHTDV-------------
Q984M2_RHILO/65-375-----------------------------------------------------ALR------ADMDA-------------
Q981W6_RHILO/74-384-----------------------------------------------------GLR------ADMDA-------------
DAPE_AGRT5/69-390-----------------------------------------------------MFA------GHTDV-------------
Q9MB49_CITLA/95-434-----------------------------------------------------FVG------SHMDV-------------
Q8EY68_LEPIN/112-477-----------------------------------------------------ILT------NHIDV-------------
Q9PEM8_XYLFA/67-363-----------------------------------------------------LFN------VHLDT-------------
Q87PY5_VIBPA/125-505-----------------------------------------------------VFM------AHQDV-------------
P20D1_MOUSE/121-489-----------------------------------------------------MLM------AHIDV-------------
ALLC_BACSU/80-409-----------------------------------------------------VTG------SHIDT-------------
DAPE_SHEON/71-381-----------------------------------------------------CFA------GHTDV-------------
ARGE_PASMU/75-378-----------------------------------------------------LLA------GHTDT-------------
HYUC_PSESN/79-412-----------------------------------------------------MIG------SHIDS-------------
Q891H8_CLOTE/88-404-----------------------------------------------------LLR------ADMDA-------------
Q7UZP5_PROMP/74-383-----------------------------------------------------GLR------VDMDA-------------
Q7W8K8_BORPA/72-383-----------------------------------------------------ILR------ADMDA-------------
Q7NWU5_CHRVO/81-393-----------------------------------------------------GLR------ADMDA-------------
DAPE_BUCAP/62-372-----------------------------------------------------TFA------GHTDV-------------
Q8T490_DROME/78-398-----------------------------------------------------ILN------SHMDV-------------
DAPE_BLOFL/67-381-----------------------------------------------------LFA------GHTDV-------------
Q8G2N9_BRUSU/82-409-----------------------------------------------------YMG------SHLDT-------------
DAPE_HELPY/75-379-----------------------------------------------------CFA------GHIDV-------------
Q8F2U4_LEPIN/71-388-----------------------------------------------------LVR------ADMDA-------------
Q98FX1_RHILO/74-383-----------------------------------------------------GLR------ADMDA-------------
Q89IN2_BRAJA/73-382-----------------------------------------------------GLR------ADMDA-------------
Q8TZ13_METKA/63-348-----------------------------------------------------CLT------SHLDT-------------
DAPE_CORGL/73-369-----------------------------------------------------MLA------GHIDT-------------
Q7QJQ9_ANOGA/101-476-----------------------------------------------------CLY------GHLDV-------------
DAPE_COXBU/62-372-----------------------------------------------------IFA------GHTDV-------------
Q7UHC4_RHOBA/118-448-----------------------------------------------------LVG------SHIDT-------------
DAPE_XYLFA/62-372-----------------------------------------------------VLL------GHTDV-------------
Q8NXY4_STAAW/73-384-----------------------------------------------------ALR------AVFDA-------------
Q17898_CAEEL/71-393-----------------------------------------------------MLY------SHTDV-------------
Q9VCQ8_DROME/76-397-----------------------------------------------------ILS------SHMDV-------------
Q89RR4_BRAJA/35-345-----------------------------------------------------GLR------ADMDA-------------
Q880D7_PSESM/109-408-----------------------------------------------------LLM------AHMDT-------------
DAPEL_STRMU/66-373-----------------------------------------------------GWR------TDIDA-------------
Q986X8_RHILO/100-420-----------------------------------------------------ILN------GHIDV-------------
DAPEL_BACSU/65-371-----------------------------------------------------AYR------ADIDA-------------
ARGE_BUCAP/75-378-----------------------------------------------------LFS------GHTDT-------------
DAPE_STAAW/68-402-----------------------------------------------------ALS------GHMDV-------------
Q83GM1_TROWT/81-442-----------------------------------------------------LLY------AHHDV-------------
Q8DY53_STRA5/86-456-----------------------------------------------------IFY------NHYDT-------------
Q8DWD2_STRMU/65-371-----------------------------------------------------ALR------ADIDA-------------
ARGE_BUCAI/75-378-----------------------------------------------------LLS------GHSDT-------------
Q8G5E2_BIFLO/92-452-----------------------------------------------------LLY------AHHDV-------------
Q8EKY8_OCEIH/76-404-----------------------------------------------------LIG------SHFDS-------------
Q7VU38_BORPE/77-375-----------------------------------------------------LIL------GHIDT-------------
Q9KET8_BACHD/83-411-----------------------------------------------------MTG------SHIDS-------------
Q7NNN7_GLOVI/86-399-----------------------------------------------------AVR------ADMDA-------------
YGEY_ECOLI/77-398-----------------------------------------------------AMD------AHIDT-------------
Q9K657_BACHD/82-451-----------------------------------------------------LIY------GHYDV-------------
Q9YEE4_AERPE/91-410-----------------------------------------------------HFN------GHYDV-------------
ILL3_ORYSJ/85-406-----------------------------------------------------GLR------ADMDA-------------
ILL1_ARATH/107-420-----------------------------------------------------ALR------ADMDA-------------
Q8CRD2_STAES/63-369-----------------------------------------------------AVR------TDIDA-------------
Q7VUP2_BORPE/77-391-----------------------------------------------------GLR------ADMDA-------------
Q7MWN9_PORGI/81-449-----------------------------------------------------LVY------AHYDV-------------
Q9VCR0_DROME/75-396-----------------------------------------------------ILN------SHMDV-------------
LYSK_DEIRA/65-358-----------------------------------------------------ALL------GHMDT-------------
Q88AR3_PSESM/72-376-----------------------------------------------------VLA------GHSDT-------------
Q8DYF9_STRA5/84-398-----------------------------------------------------ALR------ADFDA-------------
Q8ELE6_OCEIH/107-424-----------------------------------------------------ALR------FDMDA-------------
Q9CP93_PASMU/75-406-----------------------------------------------------AFG------SHIDT-------------
Q979Q6_THEVO/81-397-----------------------------------------------------WLI------AHIDT-------------
Q98IQ8_RHILO/70-379-----------------------------------------------------LFR------SELDA-------------
Q8ENA3_OCEIH/73-389-----------------------------------------------------ALR------ADMDA-------------
CBPX2_SULSO/77-389-----------------------------------------------------ALR------ADMDA-------------
Q8FQF3_COREF/51-354-----------------------------------------------------ILA------GHLDT-------------
Q8FMB2_COREF/72-389-----------------------------------------------------ALR------GDIDA-------------
Q88Q81_PSEPK/91-418-----------------------------------------------------MTG------SHIDT-------------
Q89QV3_BRAJA/77-385-----------------------------------------------------GLR------ADMDA-------------
Q9RSV5_DEIRA/73-444-----------------------------------------------------LIY------NHYDV-------------
Q7V908_PROMM/75-385-----------------------------------------------------GLR------VDMDA-------------
Y1286_STAAW/63-379-----------------------------------------------------AYR------ADIDA-------------
O58880_PYRHO/64-349-----------------------------------------------------FFE------VHMDT-------------
Q7P4W2_FUSNV/78-489-----------------------------------------------------ILQ------GHMDM-------------
Q8RFU4_FUSNN/74-389-----------------------------------------------------LLR------ADMDA-------------
Q9I7K3_DROME/76-397-----------------------------------------------------LLN------SHMDV-------------
DAPE_CAUCR/71-380-----------------------------------------------------CFA------GHTDV-------------
Q8G331_BRUSU/87-465-----------------------------------------------------LFY------GHYDV-------------
DAPE_NITEU/63-373-----------------------------------------------------CFA------GHTDV-------------
Y100_SYNY3/73-386-----------------------------------------------------AIR------TDMDA-------------
Q8R5U3_THETN/61-363-----------------------------------------------------IVE------VHYDV-------------
Q987H6_RHILO/65-371-----------------------------------------------------ILS------GHTDV-------------
Q8VUL6_9PSED/86-408-----------------------------------------------------AMG------SHLDT-------------
DAPE_VIBCH/64-374-----------------------------------------------------VFA------GHTDV-------------
Q8CUJ6_OCEIH/84-452-----------------------------------------------------LLY------GHYDV-------------
LYSK_PYRAB/63-322-----------------------------------------------------LLA------GHVDT-------------
Q97AQ8_THEVO/83-399-----------------------------------------------------GLR------ADMDA-------------
ARGE_ECOLI/76-379-----------------------------------------------------LLA------GHTDT-------------
Q8Y3L8_LISMO/75-390-----------------------------------------------------ALR------ADFDA-------------
ILL1_ORYSJ/106-423-----------------------------------------------------ALR------ADMDA-------------
DAPEL_OCEIH/64-370-----------------------------------------------------GFR------ADIDG-------------
Q7USI1_RHOBA/111-424-----------------------------------------------------AIR------ADIDA-------------
Q7VSS1_BORPE/72-394-----------------------------------------------------GLR------ADMDA-------------
DAPEL_BACCR/65-371-----------------------------------------------------GYR------ADIDG-------------
Q7S4G6_NEUCR/139-448-----------------------------------------------------LVT------SHIDV-------------
DAPE_HELHP/72-381-----------------------------------------------------CFA------GHIDV-------------
Q9AK43_STRCO/90-406-----------------------------------------------------ALR------ADIDA-------------
Q82IK8_STRAW/68-359-----------------------------------------------------ILA------GHIDT-------------
Q8DG76_THEEB/92-406-----------------------------------------------------AIR------ADMDA-------------
Q839D6_ENTFA/58-371-----------------------------------------------------ALR------ADMDA-------------
Q82ZQ2_ENTFA/75-403-----------------------------------------------------LTG------SHIDT-------------
Y588_HAEIN/75-406-----------------------------------------------------AFG------SHIDT-------------
ILL5_ORYSJ/93-409-----------------------------------------------------ALR------ADMDA-------------
Q9LPE9_ARATH/93-426-----------------------------------------------------LFN------SHLDS-------------
Q7U9W5_SYNPX/74-384-----------------------------------------------------GLR------VDMDA-------------
O58754_PYRHO/73-383-----------------------------------------------------ALR------ADMDA-------------
Q9A561_CAUCR/80-410-----------------------------------------------------IIG------SHIDS-------------
A9CGN8_AGRT5/61-370-----------------------------------------------------GFR------SDMDA-------------
Q8XYW5_RALSO/75-389-----------------------------------------------------VLS------GHTDV-------------
Q89R53_BRAJA/83-410-----------------------------------------------------GIG------SHLDT-------------
Q8FB92_ECOL6/71-385-----------------------------------------------------GLR------ADMDA-------------
DAPE_CHRVO/62-372-----------------------------------------------------CFA------GHTDV-------------
Q89H48_BRAJA/89-419-----------------------------------------------------MLG------SHYDT-------------
Q7NW88_CHRVO/76-389-----------------------------------------------------GIR------ADMDA-------------
Q93H22_STRAW/84-440-----------------------------------------------------LIH------GHTDV-------------
Q81G37_BACCR/72-385-----------------------------------------------------AIR------ADIDA-------------
O53227_MYCTU/102-459-----------------------------------------------------LLY------AHHDV-------------
Q8ENA4_OCEIH/109-426-----------------------------------------------------ALR------FDIDA-------------
Q7CSZ0_AGRT5/74-383-----------------------------------------------------GFR------ADMDA-------------
ILL7_ORYSJ/127-444-----------------------------------------------------ALR------ADMDA-------------
Q8RTT1_9PROT/116-483-----------------------------------------------------LFT------AHTDV-------------
Q98K54_RHILO/83-410-----------------------------------------------------YVG------SHLDT-------------
ARGE_PHOLL/76-379-----------------------------------------------------LLC------GHTDT-------------
DAPE_WIGBR/60-371-----------------------------------------------------LFA------GHTDV-------------
Q81HT0_BACCR/72-385-----------------------------------------------------AIR------ADMDA-------------
DAPE_BRUSU/70-392-----------------------------------------------------MFA------GHTDV-------------
Q7X340_9BACT/107-429-----------------------------------------------------LLI------GHLDT-------------
Q9AD91_STRCO/88-444-----------------------------------------------------LIH------GHTDV-------------
Q8FY52_BRUSU/74-383-----------------------------------------------------GLR------ADMDA-------------
Q82HL3_STRAW/71-409-----------------------------------------------------VTG------SHLDS-------------
Q9A2D4_CAUCR/74-388-----------------------------------------------------VLS------GHTDV-------------
A9CF54_AGRT5/65-371-----------------------------------------------------ILS------GHMDV-------------
Q9K425_STRCO/86-447-----------------------------------------------------LLY------AHYDV-------------
LYSK_SULSO/64-341-----------------------------------------------------LLA------SHVDT-------------
ARGE_MYXXA/75-375-----------------------------------------------------ALV------GHSDC-------------
Q8NV66_STAAW/63-369-----------------------------------------------------AVR------ADIDA-------------
Q89Q07_BRAJA/80-408-----------------------------------------------------LLG------SHLDS-------------
ACY1_PIG/76-396-----------------------------------------------------LLN------SHTDV-------------
Q7ZVV2_DANRE/88-409-----------------------------------------------------VLN------SHTDV-------------
Q7W8K0_BORPA/79-416-----------------------------------------------------MTG------SHLDS-------------
Q8U375_PYRFU/127-437-----------------------------------------------------ALR------ADMDA-------------
Q88FQ3_PSEPK/88-415-----------------------------------------------------MTG------SHIDT-------------
Q8GGD4_CORST/76-395-----------------------------------------------------AFR------ADFDA-------------
Q97KA5_CLOAB/71-388-----------------------------------------------------GLR------GDMDA-------------
Q89NT5_BRAJA/145-448-----------------------------------------------------MLI------AHMDT-------------
Q8XUU2_RALSO/122-426-----------------------------------------------------MLI------AHMDT-------------
Q96W94_LACKL/110-445-----------------------------------------------------ATG------SHLDT-------------
Q8P4C4_XANCP/97-429-----------------------------------------------------ALR------ADMDA-------------
Q8ZVD7_PYRAE/78-394-----------------------------------------------------HFN------GHYDV-------------
Q8G5Q0_BIFLO/70-377-----------------------------------------------------GLR------ADIDG-------------
Q81DV3_BACCR/97-416-----------------------------------------------------ILN------GHIDV-------------
Q8KDJ8_CHLTE/87-402-----------------------------------------------------ALR------ADIDA-------------
Q8Y9J1_LISMO/76-406-----------------------------------------------------IVG------SHFDS-------------
Q8XUB8_RALSO/98-420-----------------------------------------------------ALN------AHGDV-------------
Q9HW57_PSEAE/76-386-----------------------------------------------------GLR------ADMDA-------------
Q9HZS5_PSEAE/74-386-----------------------------------------------------GLR------ADMDA-------------
Q9HTY4_PSEAE/72-376-----------------------------------------------------VLA------GHTDT-------------
Q8RC51_THETN/70-383-----------------------------------------------------AIR------ADMDA-------------
CBPS_YEAST/164-571-----------------------------------------------------LLM------AHQDV-------------
Q8PQM2_XANAC/86-416-----------------------------------------------------LIG------SHLDS-------------
ABGA_HAEIN/104-420-----------------------------------------------------ALR------FDIDC-------------
A9CL51_AGRT5/72-381-----------------------------------------------------AFN------THMDT-------------
O29358_ARCFU/84-400-----------------------------------------------------WIV------AHLDV-------------
O18000_CAEEL/95-469-----------------------------------------------------LVY------GHLDV-------------
Q89QR0_BRAJA/85-459-----------------------------------------------------IFY------GHYDV-------------
Q8D5L5_VIBVU/73-371-----------------------------------------------------MMI------GHMDT-------------
Q8CMY3_STAES/74-388-----------------------------------------------------AIR------ADFDA-------------
Q84FR8_9MICC/81-412-----------------------------------------------------VLG------SHTDT-------------
LYSK_PYRHO/62-321-----------------------------------------------------LLA------GHIDT-------------
Q9KE02_BACHD/99-417-----------------------------------------------------ILQ------SHVDV-------------
Q885F3_PSESM/68-380-----------------------------------------------------GIR------ADMDA-------------
YE48_SCHPO/193-589-----------------------------------------------------VLM------GHQDV-------------
Q8Y3L6_LISMO/79-393-----------------------------------------------------AIR------ADFDA-------------
Q9Z6S9_CHLPN/119-487-----------------------------------------------------MLY------NHYDV-------------
Q92MD6_RHIME/74-383-----------------------------------------------------GLR------ADMDA-------------
Q92MZ4_RHIME/83-410-----------------------------------------------------HIG------SHLDT-------------
DAPE_PHOLL/62-372-----------------------------------------------------AFA------GHTDV-------------
O30185_ARCFU/62-368-----------------------------------------------------MLT------SHLDT-------------
Y4TI_RHISN/82-394-----------------------------------------------------AVR------GDIDA-------------
Q7UM22_RHOBA/107-416-----------------------------------------------------AYF------CHTDV-------------
Q7W1K2_BORPA/73-390-----------------------------------------------------VLR------ADMDA-------------
Q89ER6_BRAJA/82-381-----------------------------------------------------LLM------GHRDT-------------
Q9FBL9_STRCO/68-359-----------------------------------------------------ILA------GHIDT-------------
Q18621_CAEEL/72-345-----------------------------------------------------LLN------THLDT-------------
Q8VXY9_ARATH/134-472-----------------------------------------------------ATG------SHIDA-------------
Q985I5_RHILO/80-409-----------------------------------------------------LIG------SHLDS-------------
Q7CX68_AGRT5/76-403-----------------------------------------------------YIG------SHLDT-------------
Q972L9_SULTO/72-422-----------------------------------------------------LVY------NHYDV-------------
Q88CJ5_PSEPK/72-376-----------------------------------------------------VLA------GHSDT-------------
Q89IE8_BRAJA/75-385-----------------------------------------------------GLR------ADMDA-------------
Q8P8J5_XANCP/68-364-----------------------------------------------------LFN------VHLDT-------------
Q7QEF5_ANOGA/84-405-----------------------------------------------------ILN------SHMDV-------------
Q96XG6_SULTO/80-366-----------------------------------------------------HFN------FHYDV-------------
Q9HTH4_PSEAE/66-380-----------------------------------------------------CLS------GHTDV-------------
Q97Y12_SULSO/89-404-----------------------------------------------------AFN------AHYDV-------------
DAPE_HAEDU/63-373-----------------------------------------------------VFA------GHTDI-------------
Q896S2_CLOTE/77-402-----------------------------------------------------LIG------SHLDS-------------
Q8YV79_NOSS1/124-437-----------------------------------------------------AIR------TDMDA-------------
Q92TU1_RHIME/91-555-----------------------------------------------------VMA------GHFDT-------------
CBPG_PSES6/108-410-----------------------------------------------------LLM------SHMDT-------------
Q88GZ4_PSEPK/73-387-----------------------------------------------------VLS------GHTDV-------------
A9CF81_AGRT5/85-394-----------------------------------------------------GLR------ADMDA-------------
Q9A5J1_CAUCR/78-407-----------------------------------------------------ALR------ADMDA-------------
Q822A3_CHLCV/82-450-----------------------------------------------------LLY------NHYDV-------------
Q44415_RHIRD/55-364-----------------------------------------------------LIR------SELDA-------------
Q98LM4_RHILO/87-417-----------------------------------------------------VSG------SHIDS-------------
Q9WXY3_THEMA/60-350-----------------------------------------------------TLI------GHLDT-------------
Q88A71_PSESM/106-428-----------------------------------------------------LLI------GHLDT-------------
Q7WAX1_BORPA/107-486-----------------------------------------------------LLY------GHLDK-------------
DAPEL_STRR6/65-372-----------------------------------------------------GWR------TDIDG-------------
DAPEL_LACPL/70-372-----------------------------------------------------GYR------TDIDA-------------

PF00883

AMPL_BOVIN/196-509----------------------------------------------------QNLA------RRLME-------------
AMPL1_ARATH/202-512----------------------------------------------------VIFG------RELIN-------------
AMPL_CAEEL/170-478----------------------------------------------------VRET------ARLID-------------
AMPA_RICPR/182-494----------------------------------------------------VFFT------RDISN-------------
AMPA_MYCLE/200-515----------------------------------------------------VATA------RDLVN-------------
AMPA_MYCPN/134-437----------------------------------------------------VNMA------RQLQD-------------
AMPL2_SOLLC/253-561----------------------------------------------------VILG------RELVN-------------
AMPA_HELPY/174-487----------------------------------------------------LNIV------KDLVN-------------
AMPL1_SOLLC/255-566----------------------------------------------------VILG------RELVN-------------
AMPA_ECOLI/184-491----------------------------------------------------IKAA------KDLGN-------------
AMPA_BACSU/178-487----------------------------------------------------TNSA------RTLVN-------------
PEPB_ECOLI/110-423----------------------------------------------------V...------RDTIN-------------
AMPA_SYNY3/177-485----------------------------------------------------VILA------REMVA-------------
AMPA_MYCGE/135-439----------------------------------------------------VNLA------RELQD-------------
AMPA_MYCSA/148-453----------------------------------------------------QNFA------RNLGV-------------
AMPA_HAEIN/178-484----------------------------------------------------IKAA------RDIAN-------------
YA55_SCHPO/194-508----------------------------------------------------QNLA------RSLME-------------

PF05450

NICA_MOUSE/273-498--------------------------------------------------------------------------RSFFWN
Q7PY38_ANOGA/276-510--------------------------------------------------------------------------TTMFDG
Q6Z743_ORYSJ/248-457--------------------------------------------------------------------------ASFFRD
NICA_CAEEL/278-508--------------------------------------------------------------------------FGMIPE
NICA_ARATH/251-460--------------------------------------------------------------------------ASFFRD
Q7KS07_DROME/236-469--------------------------------------------------------------------------TTMFDG

PF04389

Q7PQQ4_ANOGA/170-341----------------------------------------------------------------------..........
M28P1_NEUCR/178-345----------------------------------------------------------------------..........
M28P1_YEAST/149-315----------------------------------------------------------------------..........
Q7Q1Q7_ANOGA/130-334----------------------------------------------------------------------..FPG....K
Q7RW54_NEUCR/186-361----------------------------------------------------------------------....GS.STA
QPCTL_MOUSE/162-367----------------------------------------------------------------------..FPPG..LP
Q7QJV5_ANOGA/159-330----------------------------------------------------------------------..........
Q9YDB0_AERPE/212-375----------------------------------------------------------------------..........
Q7PX80_ANOGA/293-461----------------------------------------------------------------------..........
Q9KLD3_VIBCH/193-374----------------------------------------------------------------------..HTNE..QS
Q898V9_CLOTE/225-396----------------------------------------------------------------------..LGSDLSGT
Q82DU6_STRAW/116-300----------------------------------------------------------------------..........
Q8SX46_DROME/72-243----------------------------------------------------------------------..........
Q7RZ44_NEUCR/250-445----------------------------------------------------------------------..........
Q9A578_CAUCR/260-453----------------------------------------------------------------------..PIDG..DA
Q87AH5_XYLFT/290-488----------------------------------------------------------------------..DAKG..DT
Q9SXH2_IPOBA/146-316----------------------------------------------------------------------..........
Q9HRR8_HALSA/220-384----------------------------------------------------------------------....H....D
AMPX_VIBPR/196-377----------------------------------------------------------------------..HTNE..QS
Q8TL26_METAC/121-299----------------------------------------------------------------------..EA......
APE3_YEAST/307-487----------------------------------------------------------------------..........
Q7X7Q3_ORYSJ/128-297----------------------------------------------------------------------..........
QPCT_BOTJA/137-351----------------------------------------------------------------------..FPPQLDGK
YC52_SCHPO/154-322----------------------------------------------------------------------..........
Q7UQS9_RHOBA/733-948----------------------------------------------------------------------SLARSDEENQ
Q8CK35_STRCO/710-894----------------------------------------------------------------------..........
YFI8_YEAST/119-344----------------------------------------------------------------------..AP.....T
Q9VRQ9_DROME/107-312----------------------------------------------------------------------..FPN...DP
Q9FBN5_STRCO/130-314----------------------------------------------------------------------..........
Q7MAY9_PHOLL/149-318----------------------------------------------------------------------..........
Q8MT48_DROME/150-321----------------------------------------------------------------------..........
Q9F3Y1_PSEAI/119-319----------------------------------------------------------------------..........
Q86PD7_DROME/130-333----------------------------------------------------------------------..MPG....V
O64804_ARATH/146-318----------------------------------------------------------------------..........
Q82VZ8_NITEU/829-1008----------------------------------------------------------------------..VRAANRGK
O82996_AERPU/193-374----------------------------------------------------------------------..APNS..RT
Q9A369_CAUCR/119-286----------------------------------------------------------------------..........
Q9HZQ8_PSEAE/289-482----------------------------------------------------------------------..........
Q8PPS0_XANAC/311-509----------------------------------------------------------------------..DARG..DT
Q8GGR6_STRAZ/146-311----------------------------------------------------------------------..........
Q9A3U5_CAUCR/192-390----------------------------------------------------------------------..DAKG..DK
Q7UGZ5_RHOBA/480-666----------------------------------------------------------------------..SLAPGTIE
Q7MT37_PORGI/117-314----------------------------------------------------------------------..ANPAMHTE
IAP_ECOLI/110-321----------------------------------------------------------------------..ADANLGGL
Q8EF07_SHEON/278-467----------------------------------------------------------------------..DGKP..EI
Q8PEF6_XANCP/333-532----------------------------------------------------------------------..ETG...DN
Q7S0R5_NEUCR/126-350----------------------------------------------------------------------..SP.....E
Q9A4J1_CAUCR/335-529----------------------------------------------------------------------..KPGE..DA
Q8EDI3_SHEON/278-480----------------------------------------------------------------------..DSKE.GDK
APX_STRGR/78-262----------------------------------------------------------------------..........
Q53737_STRAD/260-459----------------------------------------------------------------------..........
Q9VTH7_DROME/129-318----------------------------------------------------------------------..FKD....F
M28P1_SCHPO/140-307----------------------------------------------------------------------..........
YP67_CAEEL/167-338----------------------------------------------------------------------..........
Q9HNP7_HALSA/224-389----------------------------------------------------------------------....H....D
Q8A4P9_BACTN/117-317----------------------------------------------------------------------..ADEKNHHT
Q7ND13_GLOVI/309-501----------------------------------------------------------------------..PIGG..DR
Q7UHT1_RHOBA/176-373----------------------------------------------------------------------..RDRRDPKG
Q8A5P9_BACTN/139-321----------------------------------------------------------------------..LDG...DQ
Q97F97_CLOAB/227-398----------------------------------------------------------------------..VGEDLNGE
Q7U215_MYCBO/264-463----------------------------------------------------------------------..........
Q8XIF2_CLOPE/231-402----------------------------------------------------------------------..MGKGLSGE
O67732_AQUAE/190-352----------------------------------------------------------------------..........
Q8P3Z6_XANCP/298-496----------------------------------------------------------------------..DASG..DT
Q93EJ5_BACLI/248-421----------------------------------------------------------------------..........

PF09940

Q7CVW7_AGRT5/56-440LHLMNYSIPQRRVMPLGELQAHIHTLPAQPDLIPYKTAYYTDAWGFCMAHHDFLKLEEGDYEVVIDTEK.TSGNLFYGEY
A0KQQ6_AERHH/58-441LHLVGYSEPVRCTLSLAELQPHLHSLPEQPDAIPYVTSYYKRRWGFCLPHRLREALPEGEYQVVIDATL.APGSLTYGDW
A1AY62_PARDP/36-438LHLVNYSIPMQASLSLEELQPYLHSLPHLPDAIPYVTSYYNPRWGFCLPHRQRTALPDGTYRVDIRTTH.APGAVNFATT
Q72C97_DESVH/55-438LHVVGYSEPVDVTLSLDELQQHLHSLEEQPDAIPYVTSYYRRTWGFCLSHNERMALRPGNYRVVIDSTL.APGFMTYGDV
A5EAW0_BRASB/54-437LHVMGYSKPVRGVFTRAELATHVHTLPDQPDLIPYRTGYYADDWGFCIPHHLWQSMTDETYRVEINSDI.SPGSLTYGEF
A9A1R6_NITMS/33-410LHLASYSTPIDKIISKEELMKHLSSNKERPNAIPFDYKYYQNDWGFCVQFNKLKDFTEKNYHVVINSEF.KEGELKIGEL
Q1YPT3_9GAMM/45-430LHLVGYSHSIDKWVELDELDDHLFSLPEQPTAIPYVTSYYDLNWGFCITDILRKQLKEGKYHVVIDSKL.EDGVLNYGEL
Q74B36_GEOSL/49-431LHVVGYSVPVDRTISLAELQNHLYSLETMPDAIPYVTSYYQERWGFCLTHRQRSGLPDGEYRVFIDSEL.KDGHLTYGEL
Q9RJJ2_STRCO/40-423LHVLGYSVPVSATMPLAELRPHLHTLPDHPAWVPYRTSYYRPQWGFCLAQETLDALPEGDYEVRIDSTL.ADGHLTYAEH
A8L141_FRASN/59-442LHLLGYSTPVRARMPLRELRQHLYSMPDRPDWVPYRTSYYNDAWGFCLTDRQLAALPDGEYQVEIDTSL.TDGSLTYAEI
A7H288_CAMJD/53-435LHLLNYSEAIDQEIELEELQDHLYSIEEMPDAIPYVTSYYKRRWGFCLTHNERKKLKKGKYKVYIDAKHDENGFLDYADF
A4YXC9_BRASO/50-433LHVMGYSKPVQGVLSRAELARHVHTLPDQPDLIPYRTGYYADDWGFCLPDRLWREMTDDRYQVEIDSAI.TQGSLTYGEY
Q97H19_CLOAB/50-432LHVMSYSVPVHKTMTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDELCDDDYEVVIDSSL.EDGSLTYGEY
Q4HS24_CAMUP/11-393LHLLNYSAPINTELDFEELDKHLYSLKELPDAIPYVTSYYKRRWGFCLSHHQRLKLSKGKYRVFIDSKHDEKGVLNYADI
A4TVT0_9PROT/37-420LHVVGYSEPVDMVLGLDELQDHLYSLPETPDWIPYVTSYYRRHWGFCLSENRRRQLQPGEYRVVIRSTL.AAGALSYGEL
A5VUB4_BRUO2/56-440LHVVNFSMPVRARMSLDALKNHIHTLPDQPDLIPYRTCYHGESWGFCMAHNALLAMEDGEFDVVIDAER.RDGSLVFGEF
Q1Q6Z8_9BACT/44-427LHVLNYSLPVKKKVSLGELKEHLFTQPEYPGWIPYRTSYYKENWGFCISHDQLLDLKEDEYEVFIDSSL.GNGSLTYGEY
A4F0R1_9RHOB/34-418LHLLGYSTPVDLRLSLDELQSHLYSLPDQPDAIPYMTSYYKERWGFCITDTARQALQPGEYHARIESTLDADGALSYGEL

PF00246

Q7QC23_ANOGA/57-339----------------------LQ..KDYPELA----------------------------------------..KVHTI
Q7QC23_ANOGA/466-752----------------------LA..SNYPSIT----------------------------------------..HLYTI
Q7PRP0_ANOGA/83-361----------------------TT..ARYPNLT----------------------------------------..ALYSI
Q7PSV3_ANOGA/117-396----------------------LA..ERFPGAV----------------------------------------..STLDI
CBPB2_HUMAN/129-411----------------------IT..ERHPDML----------------------------------------..TKIHI
CBPA3_HUMAN/125-404----------------------MM..DKYPEMV----------------------------------------..SRIKI
NNAD_DROME/879-1138----------------------IQRHPVKSKFC----------------------------------------..KLRLL
AEBP1_MOUSE/561-887----------------------VN..EECPTIT----------------------------------------..RTYSL
Q23318_CAEEL/147-446----------------------IE..RKYPDKA----------------------------------------..KVFTM
Q9W477_DROME/334-625----------------------LL..ETYSENV----------------------------------------..ELIQI
Q7Q316_ANOGA/128-403----------------------LI..EQYPDVV----------------------------------------..SPIVA
CBPC1_CAEEL/734-1008----------------------LK..KRKQENV----------------------------------------YCREDVI
CBPB1_BOVIN/125-404----------------------VA..SENPDLI----------------------------------------..SRSAI
CBPE_BOVIN/63-363----------------------AA.......VS----------------------------------------..RIYTV
CBPA1_ANOGA/137-415----------------------LA..SEHPKEV----------------------------------------..ELLDA
CBPA1_DROME/131-415----------------------LA..QTNPGVV----------------------------------------..TLIEG
Q9VLZ1_DROME/129-409----------------------IL..AAYPTIT----------------------------------------..ESFIV
Y1242_ZYMMO/118-364----------------------MA..GK..SGV----------------------------------------..GYEML
CBPD_ANAPL/54-375----------------------VA..EAPPGLA----------------------------------------..RLFSI
CBPD_ANAPL/942-1212----------------------LY..LNYPHIT----------------------------------------..NLTSL
Q9VCM8_DROME/185-464----------------------LA..ETHPEVL----------------------------------------...LVEL
O14418_METAN/124-409----------------------IA..FQYPSNV----------------------------------------..KSVTS
O17754_CAEEL/46-351----------------------IN..EKCPEIT----------------------------------------..TLYEI
CBPD_RAT/70-372----------------------AA..AGPPGLA----------------------------------------..RLFSI
CBPD_RAT/509-784----------------------FA..NEYPNIT----------------------------------------..RLYSL
CBPD_RAT/937-1201----------------------LV..MNYPHIT----------------------------------------..NLTTL
O61532_DROHE/129-408----------------------LA..TKYPHVV----------------------------------------..TLVEG
YBJ7_SCHPO/189-484----------------------MA..SLYKDLS----------------------------------------..ELVPV
O77063_APLCA/41-315----------------------LH..AQYPDIT----------------------------------------..KLHNI
O77063_APLCA/474-752----------------------LA..DKYPALA----------------------------------------..KLTSI
O97389_HELAM/127-412----------------------LA..KEFPNVV----------------------------------------..TVVEG
CBPA1_BOVIN/128-406----------------------LV..AEHPQLV----------------------------------------..SKLQI
CBPB_ASTFL/12-290----------------------LA..TDYPELA----------------------------------------..SVEDV
CBPN_HUMAN/31-330----------------------VQ..NECPGIT----------------------------------------..RVYSI
CBPS_STRGR/138-428----------------------RI..AANPSIM----------------------------------------..SKRVI
CBPA2_RAT/127-404----------------------LV..AENPGLV----------------------------------------..SKVNL
CBPB1_RAT/123-402----------------------VA..TDNPDLV----------------------------------------..TQSVI
CBPT_THEVU/113-402----------------------VA..SNYPNIV----------------------------------------..KKFSI
CBPE_LOPAM/37-342----------------------VW..LQCPTIA----------------------------------------..RIYTI
ECM14_YEAST/127-417----------------------LE..RSFPSLV----------------------------------------..AVEHL
CBPS_STRCP/129-415----------------------TV..TDHPNLV----------------------------------------..RLSSV
CBPD_DROME/46-327----------------------LE..KAYPNQA----------------------------------------..KVHFL
CBPD_DROME/462-752----------------------IS..SSYPSLT----------------------------------------..RLYSI
CBPZ_SIMVI/8-286----------------------LV..QEHPEHV----------------------------------------..EPVVG
P73902_SYNY3/17-361----------------------LQ..TSYGSLL----------------------------------------..TVQTI
P90667_APLCA/53-357----------------------VN..KACPEVT----------------------------------------..RIYNL
P91359_CAEEL/84-366----------------------TR..LNYPNIT----------------------------------------..HLYSA
P91755_LUMRU/82-363----------------------TS..QLYPDLA----------------------------------------..STFSI
ENP1_LYSSH/115-389----------------------LQ..TAYPFL.----------------------------------------..QGTPI
Q22825_CAEEL/64-346----------------------LH..RKFPNLT----------------------------------------..HIYSA
Q7NHR1_GLOVI/52-276----------------------LA..AASP.LV----------------------------------------..QLQLL
Q7NMK5_GLOVI/121-539----------------------L...DQESDRM----------------------------------------..RLVTI
Q7NYA9_CHRVO/137-389----------------------IG.QAQGSGLC----------------------------------------..QVSDL
Q7NYK5_CHRVO/83-312----------------------LA..AAKPDLI----------------------------------------..QLTEL
A8BM27_GIAIC/624-987----------------------KN..IDIPILS----------------------------------------..HKV.V
Q7RI20_PLAYO/819-1026----------------------...........----------------------------------------.......
Q7S312_NEUCR/128-414----------------------LV..AAHPNQS----------------------------------------..EIVTS
CBPA1_MOUSE/128-406----------------------LV..TEHPQLV----------------------------------------..SKIQI
Q7UE12_RHOBA/168-401----------------------LA...QFPFVE----------------------------------------..S..SL
Q7W2L4_BORPA/327-506----------------------LG..GVPFQAV----------------------------------------.......
Q829W4_STRAW/126-404----------------------TG..AAHPDLT----------------------------------------..KVVSI
Q82L57_STRAW/15-263----------------------LA..AHRPGLC----------------------------------------..ALRQV
Q82MI7_STRAW/50-294----------------------L...DRTSERV----------------------------------------..SLARI
Q86FI7_SCHJA/151-426----------------------LS..QMHSHLT----------------------------------------...VENF
Q86P95_DROME/159-438----------------------MV..EKYPNRV----------------------------------------..TVLDM
CBPA4_HUMAN/129-408----------------------IA..ADFPDLA----------------------------------------..RRVKI
Q871Q3_NEUCS/204-502----------------------ME..TMFPSIA----------------------------------------..KMESI
Q87JK3_VIBPA/143-392----------------------....AQSAHHC----------------------------------------..KLDTL
Q88KC6_PSEPK/125-366----------------------AC...QLPGV.----------------------------------------..ELLAS
Q897X5_CLOTE/135-416----------------------LK..RRYPFI.----------------------------------------..EVGSI
Q8AVS2_XENLA/141-421----------------------MN..KTHHDLV----------------------------------------..SLFTI
Q8AXN3_PAROL/115-395----------------------IS..SSNPDLI----------------------------------------..SKQVI
Q8AXN4_PAROL/128-406----------------------LV..AENLGMV----------------------------------------..SKIVI
Q8AXN5_PAROL/128-406----------------------LV..AQYPHLV----------------------------------------..TKEEI
Q8EEF8_SHEON/114-366----------------------LSNAQLHPDV.----------------------------------------..NLEHL
Q8EKE3_SHEON/95-358----------------------LA..AETT.KL----------------------------------------..QKVSL
Q8EQG9_OCEIH/116-389----------------------LQ..QVYPFIQ----------------------------------------..QRY.I
Q8ESH0_OCEIH/55-359----------------------VA..TL.SDRV----------------------------------------..SYDQI
CBPZ1_PLAF7/1011-1251----------------------FE..EKYDNNL----------------------------------------.....LF
Q8IGC4_DROME/129-411----------------------LV..GKYPDVV----------------------------------------..SVFVA
Q8IMH9_DROME/186-465----------------------RQ..GSDKRFT----------------------------------------..RCVLV
Q8MYY0_DROME/152-429----------------------LA..ARYPQFC----------------------------------------..RYESL
B4E3Q2_HUMAN/324-632----------------------VN..EMCPNIT----------------------------------------..RIYNI
Q8P4I9_XANCP/58-309----------------------LV..AASPLL.----------------------------------------..SLEVF
Q8PAS3_XANCP/44-407----------------------FA..QRYPQAV----------------------------------------..RCISF
Q8PMH9_XANAC/44-312----------------------FA..QRYPQAV----------------------------------------..RCIQF
CBPA5_MOUSE/145-423----------------------FV..AEHSNLV----------------------------------------..SKIHI
Q8SXR8_DROME/47-329----------------------LA..QRFPSRV----------------------------------------..FVKTV
Q8SZR4_DROME/44-328----------------------LA..LSHSNRV----------------------------------------..TLKDV
Q8T0Q1_DROME/57-337----------------------IL..NAYPSVT----------------------------------------..EEFIV
Q8TK20_METAC/106-433----------------------LK..ALHPDLV----------------------------------------..TLIEL
Q8UUK1_CHICK/130-406----------------------LV..AENPNLV----------------------------------------..SKLEI
Q8XMR3_CLOPE/302-537----------------------KN..GVGNQIV----------------------------------------..TEGVY
CBPN_MOUSE/31-330----------------------VH..NQCPDIT----------------------------------------..RLYNI
Q961J8_DROME/129-406----------------------LA..AAYPSRV----------------------------------------..SVQVA
Q96K85_HUMAN/1-240----------------------QL.........----------------------------------------.......
Q9A9J5_CAUCR/82-489----------------------L...AAKSDRM----------------------------------------..KLVDM
Q9ABB9_CAUCR/88-349----------------------LD..KASP.LI----------------------------------------..RVEDF
Q9BL88_CAEEL/131-431----------------------LA..ITYPELV----------------------------------------..SVQPI
Q9HZF4_PSEAE/85-359----------------------LV..AASSGRI----------------------------------------..ALREL
Q9I012_PSEAE/122-366----------------------....IEGVERL----------------------------------------.....AV
Q9K698_BACHD/54-324----------------------V...TSRSDLL----------------------------------------..ELETI
Q9PUF2_BOTJA/125-404----------------------IA..NENPSLV----------------------------------------..SRLQI
Q9TZC6_CAEEL/153-440----------------------LS..EQKSDMV----------------------------------------..EMVKV
Q9U9K2_AEDAE/130-407----------------------LA..NQYDQV.----------------------------------------..QLLEG
Q9VRZ3_DROME/121-402----------------------IE..DRYPDIV----------------------------------------..TPFTI
Q9VS63_DROME/44-354----------------------LA..QRYAHFV----------------------------------------..HVHIL
Q9VS67_DROME/133-412----------------------LA..GEHPRRV----------------------------------------..FLKTV
Q9VX86_DROME/1095-1422----------------------VR..MRHPQLV----------------------------------------..ELIHI
Q9W475_DROME/827-1104----------------------MA..KTYPDIC----------------------------------------..STEII
Q9W478_DROME/154-431----------------------IR..TKFPNIV----------------------------------------..RLYTI
Q9X7P4_STRCO/55-266----------------------AA..DRASDRV----------------------------------------..ALDRI
Q9XBW4_PORGN/123-386----------------------FQ..TKYPSLC----------------------------------------..TTSVI
Q9XU75_CAEEL/167-465----------------------IE..FYYPRIA----------------------------------------..KIVRI

PF04952

ASTE_ECOLI/42-322--------------------------------------------------------------------------------
ASTE_VIBVU/52-331--------------------------------------------------------------------------------
Q8D7U9_VIBVU/56-332--------------------------------------------------------------------------------
ASTE_PSESM/48-330--------------------------------------------------------------------------------
ACY3_HUMAN/10-301--------------------------------------------------------------------------------
Q88EN1_PSEPK/47-329--------------------------------------------------------------------------------
ACY2_BOVIN/10-301--------------------------------------------------------------------------------
P72108_NATPH/45-319--------------------------------------------------------------------------------
Q8REZ3_FUSNN/9-257--------------------------------------------------------------------------------
A9CH33_AGRT5/52-333--------------------------------------------------------------------------------
ASTE_SALTY/42-322--------------------------------------------------------------------------------
ASPA_SYNY3/5-284--------------------------------------------------------------------------------
Q87RV7_VIBPA/50-319--------------------------------------------------------------------------------
ACY3_MOUSE/10-300--------------------------------------------------------------------------------
ASTE_SHEON/52-339--------------------------------------------------------------------------------
Q987A0_RHILO/66-347--------------------------------------------------------------------------------
Q92SQ8_RHIME/30-339--------------------------------------------------------------------------------
ASTE_VIBCH/52-331--------------------------------------------------------------------------------
Q8KGS0_RHILI/43-328--------------------------------------------------------------------------------
ASPA_NOSS1/3-288--------------------------------------------------------------------------------
ASTE_PSEPK/48-330--------------------------------------------------------------------------------
Q87HF0_VIBPA/56-331--------------------------------------------------------------------------------
Q9HNH1_HALSA/42-314--------------------------------------------------------------------------------
ASPA_PROMA/2-289--------------------------------------------------------------------------------
ASTE_YERPE/42-323--------------------------------------------------------------------------------
ASTE_PSEAE/48-331--------------------------------------------------------------------------------
Q89N67_BRAJA/46-333--------------------------------------------------------------------------------
Q98JD4_RHILO/49-329--------------------------------------------------------------------------------
Q8EGL7_SHEON/48-317--------------------------------------------------------------------------------
A9CLI1_AGRT5/46-332--------------------------------------------------------------------------------
Q8EAC2_SHEON/33-365--------------------------------------------------------------------------------
Q92WC2_RHIME/47-328--------------------------------------------------------------------------------
Q98AA0_RHILO/43-328--------------------------------------------------------------------------------

PF10994

A0L457_MAGSM/24-365----------------------REHFLAAAKGCPH.....---------------------------------RHMAYVH
A4XNS7_PSEMY/6-345----------------------RQKFLASCARRGL.....---------------------------------AVESHVH
Q4DHE8_TRYCC/47-382----------------------RMKFKDAAKEAKA.....---------------------------------EWKQHTV
Q0RN36_FRAAA/3-356----------------------RQRFLAAARDRGA.....---------------------------------HLESFPL
A4HIN1_LEIBR/48-391----------------------RERFLAAAKTAHA.....---------------------------------ETEHHLI
A0Z3J5_9GAMM/7-347----------------------RERFLDAANDCGF.....---------------------------------SIHSQVL
Q0EX57_9PROT/12-350----------------------RAAFLTAAKQAGA.....---------------------------------HITTHDH
Q213B6_RHOPB/13-353----------------------RGKFVATATALGC.....---------------------------------ALSQYRH
Q3K6V4_PSEPF/5-352----------------------RERFLAAAKVAGA.....---------------------------------TLSSYAH
Q7VZV3_BORPE/14-354----------------------RDKFRAAAAAAGA.....---------------------------------SLTQYLH
A4GJN2_9BACT/7-352----------------------KKRFHESVNQLESLGHQV---------------------------------QRDSLSL
A7HS30_PARL1/18-367----------------------RAQFLAAAEAAGG.....---------------------------------RLRHYEN
Q7W0U8_BORPA/7-349----------------------RAKFLEAARAAGA.....---------------------------------DIHSYCH
A1VW91_POLNA/13-355----------------------RAKFLEAAETAGL.....---------------------------------HVTSYPL
A1W380_ACISJ/8-351----------------------RAQFVGAAAVAGL.....---------------------------------ALQPQVH
Q12BQ5_POLSJ/8-351----------------------RVKFLEAAAAAGL.....---------------------------------KVDSHLH
Q2KVE6_BORA1/8-348----------------------RNAFQEAARQQKA.....---------------------------------DLSTHLL
C6BDX1_RALP1/7-346----------------------RGKFLAAAQARGL.....---------------------------------RIERHLH
A9BGZ8_PETMO/4-348----------------------RKNFYTFENELKKYYSTV---------------------------------SNDSYSI
Q0K9X8_CUPNH/4-344----------------------RQKFLDAARTAGA.....---------------------------------ALAQFPH
Q46ZZ8_CUPPJ/8-348----------------------RQKFLAAARGAGA.....---------------------------------TLAEFPH
A4A0X2_9PLAN/9-348----------------------RAEFLAVGKELGG.....---------------------------------AWESHAI
Q586Z8_TRYB2/47-385----------------------REKFTSAATKAGA.....---------------------------------EVKRAVI
Q118U2_TRIEI/12-348----------------------RNKFCDAAKAANA.....---------------------------------KLETIEL
A1TK81_ACIAC/8-351----------------------RAQFLDAAAAAGL.....---------------------------------AVESHPH
A9KLP9_CLOPH/53-407----------------------RENIAKKAEELAAAGY..---------------------------------LSEAYNY
A5V6N1_SPHWW/7-348----------------------RETFLQAAELARL.....---------------------------------DVATSVH
A7HTE6_PARL1/10-349----------------------RRRFLAAAEAAGA.....---------------------------------RVNHHEH
A3RS53_RALSL/7-346----------------------RSRFLGAARARGL.....---------------------------------AVERTIH
Q1LB58_RALME/20-354----------------------RQKFLQAAASRGL.....---------------------------------DVESHEL
A0YFP1_9GAMM/12-355----------------------REQFLSEADAAGA.....---------------------------------IIESFKH
Q1LNH9_RALME/10-350----------------------RQKFLAAARACGA.....---------------------------------ALTEFPH

PF07454

A9VRX1_BACWK/114-390----------------------VG-----------------------------------------------------KEV
A0Q1S0_CLONN/78-362----------------------LG-----------------------------------------------------KEI
Q0AXA7_SYNWW/53-297----------------------AS-----------------------------------------------------NGR
B8FUP8_DESHD/126-356----------------------YE-----------------------------------------------------GEI
A4IR37_GEOTN/100-382----------------------LG-----------------------------------------------------SEL
Q892Q4_CLOTE/87-346----------------------LE-----------------------------------------------------KEI
Q2B0L9_9BACI/100-377----------------------LG-----------------------------------------------------REL
Q8EPW1_OCEIH/94-372----------------------LG-----------------------------------------------------NEL
Q0SRD6_CLOPS/80-354----------------------VM-----------------------------------------------------NEV
Q4MRJ9_BACCE/93-374----------------------VG-----------------------------------------------------KEL
Q8R9I5_THETN/52-292----------------------GD-----------------------------------------------------NKL
A6TS45_ALKMQ/53-323----------------------GD-----------------------------------------------------NKM
SP2P_BACSU/101-383----------------------LG-----------------------------------------------------REL
A8MH52_ALKOO/52-308----------------------GD-----------------------------------------------------NKM
A5I646_CLOBH/89-359----------------------VE-----------------------------------------------------KEM
A4XLX5_CALS8/99-374----------------------.R-----------------------------------------------------QDN
A5Z3I4_9FIRM/159-408----------------------TE-----------------------------------------------------KNI
Q2BBP6_9BACI/48-296----------------------CT-----------------------------------------------------LAL
Q892Q3_CLOTE/87-344----------------------LG-----------------------------------------------------KEM
Q3AAU2_CARHZ/64-305----------------------ED-----------------------------------------------------DRH
Q2BEI4_9BACI/44-323----------------------LG-----------------------------------------------------TEL
Q735M7_BACC1/90-366----------------------LT-----------------------------------------------------REL
A1HR03_9FIRM/60-301----------------------LR-----------------------------------------------------MEI
A1HTV9_9FIRM/49-295----------------------AD-----------------------------------------------------NKR
B0KA89_THEP3/88-386----------------------LK-----------------------------------------------------FQL
B8CXL6_HALOH/71-347----------------------LK-----------------------------------------------------REI
A1HTI8_9FIRM/55-292----------------------EN-----------------------------------------------------DRV
Q2RKY1_MOOTA/91-333----------------------PG-----------------------------------------------------QE.
A5D3X4_PELTS/104-345----------------------LQ-----------------------------------------------------SQV
Q2RIV0_MOOTA/74-321----------------------AD-----------------------------------------------------NRR
Q8RB76_THETN/88-377----------------------IK-----------------------------------------------------FQI
A6TSM6_ALKMQ/118-410----------------------LG-----------------------------------------------------GDL
O87702_BACME/80-361----------------------FG-----------------------------------------------------SEL
Q0AXW7_SYNWW/93-314----------------------EK-----------------------------------------------------SEL
A8MFA4_ALKOO/129-420----------------------WS-----------------------------------------------------REI
A4J3N7_DESRM/71-313----------------------SE-----------------------------------------------------GQH
Q97JJ8_CLOAB/86-350----------------------IS-----------------------------------------------------KEV
A5N6L6_CLOK5/94-358----------------------LG-----------------------------------------------------REM
A8FFD8_BACP2/101-383----------------------LG-----------------------------------------------------REL
A6CQZ1_9BACI/100-382----------------------LG-----------------------------------------------------REL
Q0AWL6_SYNWW/49-338----------------------KK-----------------------------------------------------QAA
A5ZX32_9FIRM/103-360----------------------AP-----------------------------------------------------ERL
A6LRM7_CLOB8/91-349----------------------IQ-----------------------------------------------------NEL
A1BZN2_BACCE/93-367----------------------IK-----------------------------------------------------NEL
A7VIY1_9CLOT/106-364----------------------MQ-----------------------------------------------------EKL
Q5WHG7_BACSK/93-381----------------------LG-----------------------------------------------------REL
Q9KBM3_BACHD/90-369----------------------LG-----------------------------------------------------REL
Q3AF15_CARHZ/56-323----------------------LQ-----------------------------------------------------KTL
Q65H48_BACLD/100-381----------------------LG-----------------------------------------------------REL

PF01520

Q18AN8_CLOD6/486-667----------------------..-----------------------------------------------------.G.
B8G9R1_CHLAD/244-421----------------------..-----------------------------------------------------.N.
A9BFG0_PETMO/246-450----------------------..-----------------------------------------------------.G.
A8MFT2_ALKOO/8-185----------------------..-----------------------------------------------------.G.
B8I4Q9_CLOCE/815-990----------------------..-----------------------------------------------------.G.
A9VKK0_BACWK/112-312----------------------..-----------------------------------------------------.Q.
A9KSW1_CLOPH/279-457----------------------..-----------------------------------------------------.G.
A8MIX1_ALKOO/49-238----------------------..-----------------------------------------------------.G.
B8I0V7_CLOCE/52-254----------------------..-----------------------------------------------------.G.
A8ZXB5_DESOH/55-253----------------------..-----------------------------------------------------.G.
Q05TN6_9SYNE/185-357----------------------..-----------------------------------------------------.G.
Q7NKW3_GLOVI/183-391----------------------..-----------------------------------------------------.G.
Q8KIW1_BACTI/4-180----------------------..-----------------------------------------------------.G.
Q0P8Y7_CAMJE/436-653----------------------..-----------------------------------------------------.G.
Q8XP50_CLOPE/109-309----------------------TI-----------------------------------------------------SN.
Q65J97_BACLD/4-173----------------------..-----------------------------------------------------.G.
A7B6H8_RUMGN/41-218----------------------..-----------------------------------------------------.G.
A6LWT5_CLOB8/185-363----------------------..-----------------------------------------------------.G.
Q667H0_YERPS/190-405----------------------..-----------------------------------------------------.G.
Q89VV6_BRAJA/18-229----------------------..-----------------------------------------------------.T.
Q04Q14_LEPBJ/141-357----------------------..-----------------------------------------------------.G.
A6TNB4_ALKMQ/3-181----------------------..-----------------------------------------------------.G.
Q1B275_MYCSS/43-246----------------------..-----------------------------------------------------NG.
Q898S7_CLOTE/57-230----------------------..-----------------------------------------------------.G.
A6BEP4_9FIRM/4-173----------------------..-----------------------------------------------------.G.
Q1J062_DEIGD/254-436----------------------..-----------------------------------------------------VS.
Q1YW18_PHOPR/4-180----------------------..-----------------------------------------------------.S.
A6G6B4_9DELT/15-232----------------------..-----------------------------------------------------.G.
A6D8D6_9VIBR/161-381----------------------..-----------------------------------------------------.G.
Q2RL42_MOOTA/469-652----------------------..-----------------------------------------------------.GT
A4SGW4_PROVI/340-557----------------------..-----------------------------------------------------.G.
A5Z962_9FIRM/92-293----------------------..-----------------------------------------------------.C.
A5I6J1_CLOBH/742-945----------------------..-----------------------------------------------------.G.
Q92C95_LISIN/4-166----------------------..-----------------------------------------------------.N.
Q0S524_RHOSR/65-279----------------------..-----------------------------------------------------QG.
Q213N5_RHOPB/201-418----------------------..-----------------------------------------------------.G.
Q0SPN3_CLOPS/3-175----------------------..-----------------------------------------------------.N.
Q65GR1_BACLD/351-520----------------------..-----------------------------------------------------.G.
Q3B4P2_PELLD/11-205----------------------..-----------------------------------------------------.G.
A4QID9_CORGB/191-369----------------------..-----------------------------------------------------GG.
E0TDU6_PARBH/209-421----------------------..-----------------------------------------------------.G.
Q03S01_LACBA/51-222----------------------..-----------------------------------------------------.G.
Q2LTS4_SYNAS/37-231----------------------..-----------------------------------------------------.G.
A6NUV0_9FIRM/115-300----------------------..-----------------------------------------------------.G.
A6BCQ8_9FIRM/5-174----------------------..-----------------------------------------------------.G.
A6GWP0_FLAPJ/28-200----------------------..-----------------------------------------------------.G.
A4CK99_ROBBH/34-251----------------------..-----------------------------------------------------.G.
A6VP10_ACTSZ/21-216----------------------..-----------------------------------------------------.T.
Q5N3W4_SYNP6/389-562----------------------..-----------------------------------------------------.G.
A5TTN3_FUSNP/131-338----------------------..-----------------------------------------------------.G.
Q9Z8C6_CHLPN/61-239----------------------..-----------------------------------------------------.G.
Q899C4_CLOTE/144-318----------------------..-----------------------------------------------------.G.
A7M1G9_BACOV/3-189----------------------..-----------------------------------------------------.G.
Q1GIB7_SILST/182-398----------------------..-----------------------------------------------------.G.
Q3EPE6_BACTI/350-535----------------------..-----------------------------------------------------.G.
Q9F7S2_PRB01/77-296----------------------..-----------------------------------------------------.G.
Q9JZE9_NEIMB/5-174----------------------..-----------------------------------------------------.S.
Q5WE61_BACSK/4-182----------------------..-----------------------------------------------------.G.
A8D7W0_STREQ/5-171----------------------..-----------------------------------------------------.GQ
A5D0T0_PELTS/124-289----------------------..-----------------------------------------------------.G.
Q1K0X5_DESAC/166-349----------------------..-----------------------------------------------------.G.
Q73LZ8_TREDE/115-329----------------------..-----------------------------------------------------.G.
Q9LCR4_PAEPO/339-511----------------------..-----------------------------------------------------.G.
Q8ETR2_OCEIH/45-230----------------------..-----------------------------------------------------.G.
A0ZJD3_NODSP/4-182----------------------RE-----------------------------------------------------AG.
Q1MPK0_LAWIP/382-592----------------------..-----------------------------------------------------.G.
Q1D594_MYXXD/56-271----------------------..-----------------------------------------------------.G.
Q187L1_CLOD6/3-170----------------------IG-----------------------------------------------------KG.
A6BIV4_9FIRM/91-291----------------------VV-----------------------------------------------------AT.
AMIB_BUCAI/7-226----------------------..-----------------------------------------------------.G.
A6M0K3_CLOB8/58-252----------------------..-----------------------------------------------------YG.
A5N4X3_CLOK5/47-233----------------------..-----------------------------------------------------.G.
P89923_9VIRU/5-173----------------------..-----------------------------------------------------QG.
Q6MJS0_BDEBA/26-247----------------------..-----------------------------------------------------.G.
Q9RRC5_DEIRA/161-334----------------------..-----------------------------------------------------.G.
Q1ATQ5_RUBXD/173-345----------------------..-----------------------------------------------------.G.
A2W3V4_9BURK/65-263----------------------..-----------------------------------------------------.T.
A7B7G5_RUMGN/233-431----------------------..-----------------------------------------------------.D.
A4J7N3_DESRM/56-235----------------------..-----------------------------------------------------.G.
Q660K4_BORGA/111-328----------------------..-----------------------------------------------------.G.
A5ZLC0_9BACE/142-353----------------------..-----------------------------------------------------.G.
A8F7U0_THELT/27-198----------------------..-----------------------------------------------------.G.
A7B5H6_RUMGN/3-173----------------------..-----------------------------------------------------.S.
A7VC22_9CLOT/62-238----------------------..-----------------------------------------------------.G.
Q1K061_DESAC/6-189----------------------..-----------------------------------------------------.G.
A0YSJ1_LYNSP/1619-1787----------------------..-----------------------------------------------------.GI
A0NJM0_OENOE/125-302----------------------..-----------------------------------------------------.G.
Q2YZD0_9FLAO/42-220----------------------..-----------------------------------------------------.G.
A6LTJ0_CLOB8/6-175----------------------..-----------------------------------------------------.T.
Q1INP2_KORVE/300-482----------------------..-----------------------------------------------------.G.
Q67SM9_SYMTH/5-211----------------------..-----------------------------------------------------.G.
A7VQB6_9CLOT/5-183----------------------.P-----------------------------------------------------SG.
O67592_AQUAE/134-352----------------------..-----------------------------------------------------.G.
Q82B44_STRAW/116-328----------------------..-----------------------------------------------------.N.
Q8PUP2_METMA/39-226----------------------..-----------------------------------------------------.G.
A7GP61_BACCN/4-172----------------------..-----------------------------------------------------.N.
Q5WG95_BACSK/210-375----------------------..-----------------------------------------------------.G.
Q5JC43_CLODI/3-169----------------------TG-----------------------------------------------------AG.
A8ATJ1_9CAUD/7-177----------------------..-----------------------------------------------------.G.
Q2FGU8_STAA3/181-364----------------------..-----------------------------------------------------.G.
Q185X4_CLOD6/3-175----------------------.L-----------------------------------------------------KG.
Q2J4A8_FRASC/242-415----------------------..-----------------------------------------------------.G.
A3UD36_9RHOB/176-386----------------------..-----------------------------------------------------.G.

PF02127

DNPEP_MOUSE/22-460----------------------QY-------------------------------------------------VPGNGFS
APEA_BORBU/28-456----------------------KN-------------------------------------------------PIEDGMN
AMPL_YEAST/59-501----------------------NW-------------------------------------------------RAEKGVG
DNPEP_YEAST/25-478----------------------KW-------------------------------------------------EPGNPIA
DNPEP_SCHPO/15-453----------------------KW-------------------------------------------------KPGNGFS
APEB_MYCLE/11-421----------------------GV-------------------------------------------------KAHAPFR
DNPEP_CAEEL/22-459----------------------SY-------------------------------------------------KPGSGFS
APEA_THENE/27-449----------------------VD-------------------------------------------------DLKKGLN
APEB_BORBU/15-419----------------------K.-------------------------------------------------KKYEPFL

PF05343

Q8XBQ0_ECO57/43-325----------------------..-------------------------------------------------.TGP.KV
Q8R656_FUSNN/53-342----------------------.K-------------------------------------------------DSNY.KK
Q97RZ9_STRPN/45-334----------------------.Q-------------------------------------------------NDEQ.HR
Q99TB9_STAAM/49-339----------------------KN-------------------------------------------------PNAK.RV
O58255_PYRHO/44-324----------------------..-------------------------------------------------.GEE.RI
Q8U0N9_PYRFU/45-335----------------------..-------------------------------------------------.EGP.KV
Q8XLP6_CLOPE/50-337----------------------.E-------------------------------------------------SDEK.VI
Q9A1S8_STRP1/45-336----------------------KA-------------------------------------------------EKAP.RI
Q97MI2_CLOAB/40-324----------------------.S-------------------------------------------------GK...KI
Q8RCI6_THETN/40-326----------------------.K-------------------------------------------------KEKP.KV
SGCX_SALTY/46-346----------------------DK-------------------------------------------------PDAL.RL
YSDC_BACSU/48-342----------------------.A-------------------------------------------------ENGP.KI
Q9K874_BACHD/48-342----------------------.K-------------------------------------------------EDGP.KI
Q9PQL1_UREPA/50-344----------------------NS-------------------------------------------------NKGP.KI
Q8NUY1_STAAW/45-340----------------------..-------------------------------------------------ENGQYSI
AMP_CLOTM/47-324----------------------..-------------------------------------------------.KGK.KI
YHFE_BACSU/48-336----------------------.R-------------------------------------------------DTSR.HR
Q92CJ1_LISIN/45-340----------------------.A-------------------------------------------------EDGP.KI
Q8NW29_STAAW/49-339----------------------KN-------------------------------------------------PNAK.RV
P70801_NOSS1/49-337----------------------.K-------------------------------------------------NSDI.AV
Q92W97_RHIME/53-341----------------------.A-------------------------------------------------AERP.AR
Q9X0D8_THEMA/46-324----------------------..-------------------------------------------------.KGIGKL
YTOP_BACSU/46-337----------------------.A-------------------------------------------------EDAP.RI
Q9K7V2_BACHD/46-337----------------------.N-------------------------------------------------EQGP.KV
Q8P2X3_STRP8/45-336----------------------KV-------------------------------------------------EKAP.RI
Q9V0Z4_PYRAB/45-335----------------------..-------------------------------------------------.EGP.KV
Q97L72_CLOAB/48-335----------------------.K-------------------------------------------------NSSF.ER
Q8NWU5_STAAW/45-333----------------------.K-------------------------------------------------NDEV.QR
PEPA_LACLM/44-336----------------------KV-------------------------------------------------ENAP.RI
Q9UZ39_PYRAB/45-327----------------------.N-------------------------------------------------HREP.KL
Q8X8A6_ECO57/43-333----------------------..-------------------------------------------------.KGP.KV
AMPK_PYRFU/45-331----------------------..-------------------------------------------------.SAP.KV
Q97NY6_STRPN/45-335----------------------EA-------------------------------------------------VDAP.RV
Q92D39_LISIN/51-339----------------------.K-------------------------------------------------DDSK.HR
Q9X0D9_THEMA/40-324----------------------.R-------------------------------------------------DSSK.KL
Q8ZX99_PYRAE/45-340----------------------..-------------------------------------------------ASNY.RA
Q92B98_LISIN/46-337----------------------.A-------------------------------------------------TDGP.RV
Q9UYH8_PYRAB/43-323----------------------..-------------------------------------------------.GDE.RL
Q97MI3_CLOAB/43-327----------------------..-------------------------------------------------.KGAGKI
Q8TYB9_METKA/48-341----------------------..-------------------------------------------------.SEY.EV
O26537_METTH/45-335----------------------..-------------------------------------------------.SGP.SI
O58468_PYRHO/45-327----------------------.N-------------------------------------------------HPKP.EL
Q9CIH3_LACLA/44-336----------------------KV-------------------------------------------------ANAP.RI
Q8RCI5_THETN/45-320----------------------..-------------------------------------------------.KGK.KI
TET_PYRHO/50-340----------------------..-------------------------------------------------.EGP.KV
Q98PJ2_MYCPU/53-348----------------------KS-------------------------------------------------N.SP.RI
Q8RCI7_THETN/44-328----------------------..-------------------------------------------------LKGKYKV
Q9YCC1_AERPE/44-332----------------------..-------------------------------------------------.GEP.RL
Q9V1Q0_PYRAB/45-331----------------------..-------------------------------------------------.SSP.RV
FRVX_ECOLI/43-333----------------------..-------------------------------------------------.KGP.KV
Q8K8V2_STRP3/45-336----------------------KA-------------------------------------------------EKAP.RI
O59485_PYRHO/53-339----------------------..-------------------------------------------------.SSP.RI
SGCX_SALTI/46-346----------------------DK-------------------------------------------------SDAL.RL
Q99UB5_STAAM/45-333----------------------.K-------------------------------------------------NDEV.QR
Q8PZ22_METMA/55-349----------------------..-------------------------------------------------.KGP.SV
Q8TJD6_METAC/42-336----------------------..-------------------------------------------------.KGP.SV
Q8Y6S2_LISMO/46-337----------------------.A-------------------------------------------------EEGP.RV
Y555_METJA/44-338----------------------..-------------------------------------------------.KGK.KI
Q9RXS7_DEIRA/71-359----------------------..-------------------------------------------------ENGP.AI
O28479_ARCFU/2-292----------------------..-------------------------------------------------.GEP.EI
Q9X0E0_THEMA/42-324----------------------..-------------------------------------------------.GEK.KV
Q9HPS1_HALSA/46-335----------------------..-------------------------------------------------.GAP.AV
Q8Y7Q5_LISMO/45-340----------------------.A-------------------------------------------------EDGP.KI
Q8ZX44_PYRAE/36-306----------------------..-------------------------------------------------.....KV
Q9HYE5_PSEAE/53-341----------------------.R-------------------------------------------------LNTP.DR
Q8Y8C6_LISMO/51-339----------------------.K-------------------------------------------------DETK.HR
SGCX_ECOLI/46-346----------------------DK-------------------------------------------------PDAL.RL
Q8U3T6_PYRFU/43-324----------------------..-------------------------------------------------.GEV.KA
Q99RH7_STAAM/45-340----------------------..-------------------------------------------------ENGQYSI

PF01546

DAPE_RALSO/70-380----------------------VP..TGPVEQW......RSDPFEP...........................THRDGKL
AMHX_BACSU/68-369----------------------LW..QE.VNGT......FR.....................................AN
ILL9_ORYSJ/112-431----------------------LPV.QE.LVDWEH..KSQEN...................................GKM
DAPE_ZYMMO/70-373----------------------VP...A.GQGW......SSDPFTP...........................TIKDGYL
Q92S66_RHIME/76-388----------------------LPI.QE.ETGVAY..ASTKP...................................GLM
YXEP_BACSU/69-374----------------------LPI.QE.QTNLPF..ASKVD...................................GTM
DAPE_BORPE/64-374----------------------VP..PGPRDKW......DSDPFVP...........................TERDGFL
YHAA_BACSU/79-392----------------------LPI.QD.EKDVPY..ASKVP...................................GVM
Q9FVL5_CUCPE/95-434----------------------VP...ADPSAW......TFDPFSL...........................SISGDQL
Q880G9_PSESM/87-417----------------------QP........................................................
Q832Y9_ENTFA/78-393----------------------LEL.PD.ATGAAY..ASKNP...................................GLN
ILR1_ARATH/109-425----------------------LPL.QE.LVEWES..KSKVD...................................GKM
YJ75_SCHPO/124-397----------------------VN...............PFLPYY.............................IEGDKI
Q7WAL0_BORPA/80-413----------------------VM........................................................
Q8FLW7_COREF/70-397----------------------LPI.KE.DTGAEY..ASTATGFLP..........................DGQEVPVM
O29728_ARCFU/50-314----------------------TP...............VKAPFS.............................TDGVYA
DAPE_BRAJA/67-385----------------------VP..AGDESAW......SVGAFSG...........................EVKDGFL
Q82HY6_STRAW/97-413----------------------LPI.PDAKVDCAY..RSTVP...................................DRA
Q7D266_AGRT5/85-459----------------------QP...............VDPLELWENDPFE...............PAIKDIGAGRKVI
Q7W1K0_BORPA/81-415----------------------VR........................................................
Q974N2_SULTO/65-421----------------------QP...............VEPLDKWNTD....................PFTPTIKEGKI
Q9RSU7_DEIRA/81-449----------------------QP...............EAPLEEWHTP....................PFEPTVRDGRI
Q7U3I0_SYNPX/107-432----------------------VP........................................................
LYSK_AERPE/68-345----------------------VPGRLEARLEG.....YT.......................................L
Q8TV20_METKA/71-376----------------------VP...P.GDGW.....EVTDPFDP...........................TIRNGKL
Q17899_CAEEL/71-393----------------------VP...TFREHW......THDPYSA..........................FKDEDGNI
Q7VS04_BORPE/67-381----------------------VP...VDGQPW......TTDPFCL...........................TEKDGRL
Q9VCQ9_DROME/76-397----------------------VP...VFREKW......THEPFSA..........................DIDEEGRI
Q89IN7_BRAJA/140-435----------------------VH...............LVGTIEKL........................KWRREGSKC
Q984M3_RHILO/78-404----------------------VI........................................................
Q9HS25_HALSA/106-420----------------------LHI.TESEADDHHPAAAGFRSE...............................HDGCM
Q97VB6_SULSO/71-398----------------------VP........................................................
IAAH_ENTAG/112-429----------------------LDL.NEDTDGHHRPFREDFASC...............................NPGMM
Y1497_METJA/61-343----------------------VK...............IQSNFK.............................KDDNNF
Q89D44_BRAJA/88-452----------------------.V...............DGMEGEWRDGR..................DPWRTTVAGTRL
Q8EMA9_OCEIH/73-390----------------------LPI.QE.QTHTPY..ESQNP...................................GVM
ABGA_ECOLI/112-429----------------------LDL.SEEQDVSHRPYRDGFASC...............................NAGMM
Q82Z92_ENTFA/66-375----------------------VS..EGDESQW......TFPPFAA...........................HIEGNKL
Q92U74_RHIME/82-410----------------------QI........................................................
Q98AF9_RHILO/84-453----------------------QP...............PDPLDAWVTP....................PFEPTIRDGRL
Q7VTF2_BORPE/75-389----------------------VP...VDGQDW......SADPFAL...........................REQEGRL
Q9KFW8_BACHD/72-371----------------------VF...............PVGTAAAR........................PFQLIGTRA
ILL6_ARATH/146-457----------------------LPI.QE.AVEWEH..ISKVA...................................GKM
DAPE_PSESM/69-380----------------------VP..TGPVQDW......QNDPFDA..........................LIDEHGML
Q8Y9J0_LISMO/73-386----------------------LPV.QELNQDLPY..KSTED...................................GKM
Q8ELE3_OCEIH/73-408----------------------VY........................................................
DAPE_NEIMB/64-374----------------------VP..TGPVEKW......DSPPFEP...........................AERDGRL
Q9AA70_CAUCR/101-467----------------------VPVTPGSEGQW......THPPFAG...........................VVADGKV
Q8FRQ2_COREF/75-384----------------------LPL.TE.TTGLDY..SSTVP...................................GVA
Q8XLK9_CLOPE/110-427----------------------VKV.LECENNEHFPFKNGFSSL...............................NRGIM
Q9ZBI7_STRCO/86-442----------------------VP...AEAADW......SVHPFSG...........................EIRDGVV
DAPE_PASMU/63-373----------------------VP..VGDTTQW......QYPPFSA...........................QLVDNVL
Q8XSI7_RALSO/130-504----------------------VPVAPGTEGDW......TEPPFAG...........................VVKDGMV
Q8CTS7_STAES/74-385----------------------LPV.QE.LNDVPY..RSKNK...................................GCM
Q8NLV7_CORGL/76-438----------------------VP...VDLPKW......TKDPFGA...........................EISDGQI
LYSK_SULTO/63-340----------------------VP...............GFIQPK.............................IEGEVI
ALLC_ECOLI/77-406----------------------VV........................................................
Q83EG0_COXBU/70-381----------------------LPLAETNTFHHKSKHKNV.......................................M
Q8ESD5_OCEIH/87-390----------------------VF..PEGTDTTVSEKEGK.......................................Y
DAPE_BUCAI/62-372----------------------VP..IGQDKDW......QTDPFQP...........................VIRSGYL
ILL8_ORYSJ/116-436----------------------LPL.QE.LVDWEF..KSQEK...................................GKM
Q9RV75_DEIRA/80-405----------------------VP........................................................
DAPE_RICPR/65-381----------------------VP..AGNYEFW.....HNSNPFKF...........................HEQDGKI
Q8D176_YERPE/85-415----------------------VR........................................................
Q89GU6_BRAJA/77-406----------------------QN........................................................
ARGE_MORAB/74-378----------------------VP...FDDDLW......TKDPFKL...........................TEKDDKW
Q7NVG4_CHRVO/67-384----------------------VP...VDGQDW......SYPPFQL..........................TDGGDGRL
Q7CRI5_AGRT5/79-410----------------------QP........................................................
Q98GJ6_RHILO/84-458----------------------QP...............VDPIELWENDPFA...............PAVKEVGPDHKVI
Q93RZ9_STRCO/83-441----------------------VP...ADAAEW......RVPPFSG...........................EIQDGYL
DAPE_SHIFL/62-372----------------------VP..PGDADRW......INPPFEP...........................TIRDGML
Q9CI04_LACLA/65-368----------------------VV..SGHLADW......KFSPTDA...........................RVEEGKL
Q9A7W4_CAUCR/98-396----------------------VY...............PENSPFQA........................VSTRSDGAL
Q7N102_PHOLL/113-431----------------------LDL.NEEQTHVHRPYAEGFSSC...............................NTHMM
DAPE_HAEIN/63-373----------------------VP..TGDENQW......SSPPFSA...........................EIIDGML
Q9I056_PSEAE/107-408----------------------VF...............AAGSAAKR........................PFREDAERA
Q8AWF8_XENLA/112-483----------------------QP...............AKQTDGWLTE....................PYTVVEKDDNL
Q9VCR2_DROME/76-397----------------------VP...VFEEKW......THGPFSA..........................DLDAEGRI
Q7WEA4_BORBR/77-416----------------------VP........................................................
LYSK_THET2/63-350----------------------VP...............GQIPVR.............................LEGGRL
O58003_PYRHO/93-411----------------------VP...P.GEGW.....TVTEPFKP...........................IVKDGKV
Q8FME3_COREF/102-468----------------------VP...............AGPLDLWTTDPF................TLTERETENGVRW
Q81AB5_BACCR/70-375----------------------LPI.QE.ETHLSY..ASKVR...................................GKM
Q8XL37_CLOPE/78-393----------------------LPM.DD.KKTCSY..SSKVK...................................GRM
Q882Q5_PSESM/82-379----------------------VF...............PKGTTAIR........................GYTNDSELA
O49682_ARATH/58-397----------------------VT...ANPDDW......EFDPFSL...........................SIDGDKL
LYSK_PYRAE/58-333----------------------VP...............GPLPVK.............................REGGVV
Q8TRI4_METAC/86-410----------------------LQV.QEEFTERNEGYISRND...................................GVM
Q8DMU8_THEEB/75-387----------------------LPI.QE.RTGLEF..SSKHA...................................GVM
Q89MN6_BRAJA/99-418----------------------VP..AGPLELW......DTPPFSP...........................VIKDGKM
ARGE_VIBCH/72-375----------------------VP...FDEGRW......NYNPHAL...........................TQVNNRF
DAPE_BUCBP/63-373----------------------VP..IGNKILW......NSPPFSP...........................TVDKGVL
Q7VWF6_BORPE/82-413----------------------QP........................................................
Q7UJ49_RHOBA/95-464----------------------QP...............PEPLDLWTSP....................PFEPVVRDGKV
Q8PUV0_METMA/80-404----------------------LQV.QEEPAERNREYISRTE...................................GVM
Q17686_CAEEL/70-392----------------------VP...TFREYW......THDPYSA..........................FKDEDGNI
Q7NHJ5_GLOVI/90-402----------------------LPI.AE.QTELPY..RSQVR...................................GVM
C2H5Z6_ENTFL/79-386----------------------LPI.QE.EVVSAF..QSKRP...................................GFM
Q891H7_CLOTE/124-441----------------------NEG.IESNSLDHRPVKEGFASI...............................NDGAM
Q92Y75_RHIME/65-371----------------------VP...AAETGW......TSDPFRL...........................RVEADRL
Q870Z2_NEUCS/93-468----------------------QP...............AEKSDGWDTEP...................FDLTVKEDGRM
Q8A601_BACTN/82-450----------------------MP...............AEPLELWKSQ....................PFEPEVRDGYI
P74654_SYNY3/97-412----------------------LPV.TE.ENEVDY..RSLHP...................................GKM
Q7P6B6_FUSNV/81-400----------------------LPI.EE.ETGLEF..SSTHK...................................GCM
Q9A411_CAUCR/97-405----------------------VF..PEGTDVKVRREGTK.......................................L
Q8NYT5_STAAW/74-386----------------------LPI.TE.DTGLSF..ASQNK...................................GVM
Q93DA3_STRMU/86-455----------------------VP...............ADNDQIWTDN....................PFKLTLRKGYM
Q9RRJ7_DEIRA/74-369----------------------VW...............PHGTLGRM........................PWREDGERL
ILL4_ARATH/105-421----------------------LAM.QE.MVEWEH..KSKVP...................................GKM
ARGE_DICDI/99-443----------------------VP...ADKTAW......DRNPFQL...........................IIEGDKL
Q8XT42_RALSO/90-389----------------------VF...............KDGTARAK........................PFYIKDKRA
Q88JE5_PSEPK/77-391----------------------LPM.GE.KNAFAH..ASKIP...................................GRM
DUG1_SCHPO/93-468----------------------QP...............ASLEDGWSTDP...................FTLTVDNKGRM
Q8PDQ1_XANCP/86-416----------------------VR........................................................
HIPO_CAMJE/72-380----------------------LPL.QE.CTNLPY..KSKKE...................................NVM
O58453_PYRHO/75-385----------------------LPI.QE.ENDVPY..KSRVP...................................GKM
DAPE_STAES/68-401----------------------VD..AGDHDDW......TFPPFEL...........................TDKDGKL
Q8XVG0_RALSO/71-391----------------------LPL.AE.ANQFTH..RSRHE...................................GKM
Q831D3_ENTFA/57-417----------------------VG..IGEMSNW......KFDPYDG...........................YETETEI
Q7V9Q6_PROMA/75-386----------------------LPV.EE.KTGLSF..ASLRQ...................................GVM
DAPE_RHILO/70-392----------------------VP..VGDEAAW......THPPFAA...........................EIANGEM
Q882Q4_PSESM/90-456----------------------.V...............RGYDAQWQAGL..................SPWKVVERGDRW
Q9A3G5_CAUCR/106-469----------------------VE...AKREDW......TRDPFKL...........................VEENGYF
Q8A1V9_BACTN/69-352----------------------VK...P.VNGW......RKDPFTP...........................REENGKL
DAPE_WOLSU/62-362----------------------VP..PG.E.GW......SVDPFGA...........................ELKEGYL
Q8DRG0_STRR6/86-455----------------------VP...............ADGDQVWTED....................PFTLSVRNGFM
Q82IQ8_STRAW/88-458----------------------QP...............AAREDGWDTE....................PFEPVIRDNRL
Q97V97_SULSO/67-433----------------------QP...............VDPISEWKRA....................PFSATIENDRI
Q7CSF2_AGRT5/83-392----------------------LPI.HE.ETGLAY..ASETS...................................GIM
Q8RL92_PSESX/71-384----------------------LPI.QE.ENTFAH..RSRHD...................................GWM
Y1078_STAES/63-379----------------------LPIYEENDIDFKSKNDNV.......................................M
Q92VC5_RHIME/72-385----------------------LAM.PE.LADRPY..KSTVA...................................GKM
Q884H3_PSESM/106-407----------------------VF...............GPGTAARR........................PFRLDSERA
Q97ZB7_SULSO/81-369----------------------VP...P.GDGW......LTNPFEL...........................KVVDNKA
Q9CMA2_PASMU/70-369----------------------VF...............KTGTVNER........................PFRIEQDKA
Q81IL2_BACCR/66-365----------------------LW......QEVNGEFKAN........................................
Q89J35_BRAJA/90-405----------------------VP...VAGQDW......SHDPFKL...........................VERDGRL
Q8CMV9_STAES/68-407----------------------VS..EGNHDDW......TYDPFTL...........................TENQGYL
DAPEL_LISMO/64-370----------------------LPI.TE.ETELPF..ASKHP...................................GNM
Q7VXC4_BORPE/82-409----------------------QP........................................................
Q83F46_COXBU/98-471----------------------QP...............EMKGWDADLG....................PWKPVIKEDKL
Q89WA3_BRAJA/87-383----------------------VH...............PLGFIERL........................PFKVEGDSA
Q893C9_CLOTE/76-402----------------------VV........................................................
YODQ_BACSU/99-418----------------------VP..EGSVKDW......KYEPYQA...........................VEENGKI
Q88AX7_PSESM/67-382----------------------VP...AAGQAW......TMPPFQA...........................TLRDGRI
Q7VV76_BORPE/73-393----------------------LPM.QE.ANTFEH..ASRNP...................................GKM
CNDP1_MOUSE/103-477----------------------QP...............AQKDDGWLTD....................PYTLTEVDGKL
YTNL_BACSU/99-404----------------------LPI.EE.KTGLPY..ASKHK...................................GIM
Q98L43_RHILO/88-418----------------------VE...A.GDGW......TVDPFAG...........................IVRDGRV
Q8ERY9_OCEIH/74-385----------------------LPI.QD.EKNVPY..KSKVP...................................GVM
Q9F464_ARTAU/78-409----------------------VR........................................................
Q970S3_SULTO/66-380----------------------VP..TGDVNKW......KYNPFSG...........................KIIDDKV
Q8RNM5_LEGPN/102-463----------------------VE...AKASDW......SMDPFQL...........................TEKEGYF
Q984M2_RHILO/65-375----------------------LRI.SE.QSSAPY..RSGNP...................................GVM
Q981W6_RHILO/74-384----------------------LPI.HE.TPGKDW..ASKTP...................................GKM
DAPE_AGRT5/69-390----------------------VP..VGDEAAW......SHPPFSA...........................DIAGGEM
Q9MB49_CITLA/95-434----------------------VP...ANRDTW......EFDPFSL...........................SIDGDKL
Q8EY68_LEPIN/112-477----------------------VE...ADPSEW......DEAPFSG...........................VRKGDRI
Q9PEM8_XYLFA/67-363----------------------VP...D.SPTW......SADPHVM...........................RRAVDRV
Q87PY5_VIBPA/125-505----------------------VPVAEESRSQW......KEDPFSG...........................AIKDGYI
P20D1_MOUSE/121-489----------------------VP...APEEGW......EVPPFSG...........................LERNGFI
ALLC_BACSU/80-409----------------------VI........................................................
DAPE_SHEON/71-381----------------------VP..TGDLSRW......HTPPFEP...........................TIIDGYL
ARGE_PASMU/75-378----------------------VP...FDEGRW......QFDPFKL...........................TEKDGKF
HYUC_PSESN/79-412----------------------VR........................................................
Q891H8_CLOTE/88-404----------------------LPI.EE.TTDLPF..KSKNK...................................GVM
Q7UZP5_PROMP/74-383----------------------LPI.YE.NTNLSF..SSKID...................................GIM
Q7W8K8_BORPA/72-383----------------------LHI.AE.APAEDRPHASRND...................................GYM
Q7NWU5_CHRVO/81-393----------------------LHL.HE.QGELPY..RSQHA...................................GRM
DAPE_BUCAP/62-372----------------------VP..PGDYKYW......NDDPFNP...........................VIKNGLL
Q8T490_DROME/78-398----------------------VP...VFPEKW......THEPFGA..........................HIDAQGRI
DAPE_BLOFL/67-381----------------------VP..PGDIHNW......QYPPFSG...........................TVHNNII
Q8G2N9_BRUSU/82-409----------------------QP........................................................
DAPE_HELPY/75-379----------------------VP...P.GNHW......QSDPFKP...........................VIKEGFL
Q8F2U4_LEPIN/71-388----------------------LPI.FE.ESNQEY..KSVHE...................................GVM
Q98FX1_RHILO/74-383----------------------LPL.NE.ITGKPY..ASTVP...................................GKM
Q89IN2_BRAJA/73-382----------------------LPM.EE.NTNLKW..SSKIP...................................GRF
Q8TZ13_METKA/63-348----------------------VP........PD....EMEKPFEP...........................RIVDGKL
DAPE_CORGL/73-369----------------------VPIADNLPSRV......ED....................................GIM
Q7QJQ9_ANOGA/101-476----------------------QP...............AILEDGWATE....................PFVLTEKDGKL
DAPE_COXBU/62-372----------------------VP..PGDETQW......HSPPFTP...........................TEKNGYI
Q7UHC4_RHOBA/118-448----------------------VP........................................................
DAPE_XYLFA/62-372----------------------VP..PGPIEAW......TSDPFIP...........................QRREGKL
Q8NXY4_STAAW/73-384----------------------LPV.EE.LNDVPY..KSKNP...................................GCM
Q17898_CAEEL/71-393----------------------VP...TFREHW......THDPYSA..........................FKDEDGNI
Q9VCQ8_DROME/76-397----------------------VP...VFPEMW......THEPFSA..........................DIDEEGRI
Q89RR4_BRAJA/35-345----------------------LPI.TE.DTGLPY..ASTTS...................................GVM
Q880D7_PSESM/109-408----------------------VF...............KEGSAAER........................PFHIKDGRA
DAPEL_STRMU/66-373----------------------LPV.VE.ETGLAF..ASQHE...................................GRM
Q986X8_RHILO/100-420----------------------VP..TGPLDRW......VRDPYDP...........................AIEDGWM
DAPEL_BACSU/65-371----------------------LSI.EE.QTGLPF..ASEHH...................................GNM
ARGE_BUCAP/75-378----------------------VD...FDEHLW......TKDPFKL...........................TEKNNKL
DAPE_STAAW/68-402----------------------VD..AGNQDNW......TYPPFQL...........................TEKAGKL
Q83GM1_TROWT/81-442----------------------QP...............AGDPDKWVTP....................AFSPDERDGRL
Q8DY53_STRA5/86-456----------------------VP...............ADEVEQWTED....................PFTLSLRYGKM
Q8DWD2_STRMU/65-371----------------------LPI.IE.KTGLAY..ASKN....................................GAM
ARGE_BUCAI/75-378----------------------VD...FDEKKW......TKDPFKL...........................TETNNKF
Q8G5E2_BIFLO/92-452----------------------QP...............VPDPAEWNTD....................PFVATEIDGRL
Q8EKY8_OCEIH/76-404----------------------VP........................................................
Q7VU38_BORPE/77-375----------------------VH...............PIGTLQDN........................PCRIDGDRL
Q9KET8_BACHD/83-411----------------------VP........................................................
Q7NNN7_GLOVI/86-399----------------------LPI.LE.GNRVEY..ASENT...................................GIM
YGEY_ECOLI/77-398----------------------VG..IGNIKNW......DFDPYEG...........................METDELI
Q9K657_BACHD/82-451----------------------QP...............VDPINLWETP....................PFEPSIREGKI
Q9YEE4_AERPE/91-410----------------------VP...G.GPGW.....SVTEPFKP...........................VVKDGKL
ILL3_ORYSJ/85-406----------------------LPI.QE.MVEWEF..KSLED...................................GKM
ILL1_ARATH/107-420----------------------LPI.QE.AVEWEH..KSKNP...................................GKM
Q8CRD2_STAES/63-369----------------------LPI.EE.QVKHEF..TSKYQ...................................GAM
Q7VUP2_BORPE/77-391----------------------LPM.TE.DNDFGH..KSTKP...................................GLM
Q7MWN9_PORGI/81-449----------------------MP...............PEPLELWKSE....................PFEPVIRDGHI
Q9VCR0_DROME/75-396----------------------VP...VFRDKW......THDPFAA..........................DIDEEGRI
LYSK_DEIRA/65-358----------------------VP...............GDIPVR............................VDEAGVL
Q88AR3_PSESM/72-376----------------------VP...FDEALW......KTDPLKL...........................TEVDGRW
Q8DYF9_STRA5/84-398----------------------LPI.QE.ETGLSF..ASKTA...................................GVM
Q8ELE6_OCEIH/107-424----------------------LPI.HESEEANHIPNKEGYRSK...............................VPNTM
Q9CP93_PASMU/75-406----------------------VV........................................................
Q979Q6_THEVO/81-397----------------------VP..VGDPSLW......TKPPFEL...........................TVEGDKM
Q98IQ8_RHILO/70-379----------------------LPI.EE.LSGVPH..ASQVP...................................GKS
Q8ENA3_OCEIH/73-389----------------------LPI.QE.ETDVSF..KSKKA...................................DIM
CBPX2_SULSO/77-389----------------------LPV.EE.TSDVEF..KSKVK...................................GVM
Q8FQF3_COREF/51-354----------------------VPIADNVPGHR......APNAD...............................GVDTL
Q8FMB2_COREF/72-389----------------------LPV.TE.QTGLDY..ASEAH...................................GVM
Q88Q81_PSEPK/91-418----------------------QP........................................................
Q89QV3_BRAJA/77-385----------------------LPV.EE.QTNLPY..ASKNP...................................GKM
Q9RSV5_DEIRA/73-444----------------------QP...............EDPLELWDTP....................PFELTERGGRL
Q7V908_PROMM/75-385----------------------LPV.EE.RTGLVY..ASRRD...................................GVM
Y1286_STAAW/63-379----------------------LPILEENDVPYRSQSDHV.......................................M
O58880_PYRHO/64-349----------------------ID........P......RAEPF..............................VRGNIV
Q7P4W2_FUSNV/78-489----------------------VCEKELDSNHNFKTDGLDLI..................................IDGK
Q8RFU4_FUSNN/74-389----------------------LPI.TE.ESRCTF..KSTHD...................................GKM
Q9I7K3_DROME/76-397----------------------VP...VFPENW......THPPFGA..........................DIDEEGRI
DAPE_CAUCR/71-380----------------------VP..VGDDAAW......TAGPFEA...........................EIKEGVL
Q8G331_BRUSU/87-465----------------------QP...............VDPLSLWENDPFDPA...........IKDVGDASNGGRKIL
DAPE_NITEU/63-373----------------------VP..TGPVTQW......DSDPFTP...........................VVRDGFL
Y100_SYNY3/73-386----------------------LPI.EE.MVSLPF..ASRHP...................................GVM
Q8R5U3_THETN/61-363----------------------VP...............SVIEGYQT........................KEGEENGRI
Q987H6_RHILO/65-371----------------------VP...AGEPQW......SSAPFAL...........................RREGEQL
Q8VUL6_9PSED/86-408----------------------QP........................................................
DAPE_VIBCH/64-374----------------------VP..AGPLSQW......HTPPFEP...........................TVIDGFL
Q8CUJ6_OCEIH/84-452----------------------QP...............VDPIELWDSD....................PFKPELRDGRI
LYSK_PYRAB/63-322----------------------VP...............GYIPVR.............................IEGDIL
Q97AQ8_THEVO/83-399----------------------LPV.QE.QTGLPF..ASKNS...................................GVM
ARGE_ECOLI/76-379----------------------VP...FDDGRW......TRDPFTL...........................TEHDGKL
Q8Y3L8_LISMO/75-390----------------------LPI.EE.QTELPF..KSKNP...................................GVM
ILL1_ORYSJ/106-423----------------------LPM.QE.SVEWEH..KSKVP...................................GKM
DAPEL_OCEIH/64-370----------------------LPI.LE.QTNLPY..ASLHE...................................GRM
Q7USI1_RHOBA/111-424----------------------LPI.QT.MVQHEY..ASGTD...................................QVM
Q7VSS1_BORPE/72-394----------------------LPM.PE.HNRFAH..RSTIE...................................GRM
DAPEL_BACCR/65-371----------------------LPI.TE.ETGYEF..ASIHE...................................GMM
Q7S4G6_NEUCR/139-448----------------------VP...............PFIPYHINTPG...................GSDQVTSDTFI
DAPE_HELHP/72-381----------------------VP..TG.E.GW......EFEPFCG...........................TQDEKYI
Q9AK43_STRCO/90-406----------------------LPI.PDTKSECAY..RSQVP...................................DRA
Q82IK8_STRAW/68-359----------------------VPIADNVPSRL......DEN...................................GVL
Q8DG76_THEEB/92-406----------------------LPV.QE.ENNKPY..RSLHE...................................GKM
Q839D6_ENTFA/58-371----------------------LPV.QELNEDLAY..KSLEA...................................GKM
Q82ZQ2_ENTFA/75-403----------------------VV........................................................
Y588_HAEIN/75-406----------------------VV........................................................
ILL5_ORYSJ/93-409----------------------LPV.QE.LVEWEH..KSKVD...................................GVM
Q9LPE9_ARATH/93-426----------------------VP...AESEKW......TYPPFSA..........................HKTIDGHI
Q7U9W5_SYNPX/74-384----------------------LPV.EE.RTGLSF..ASTRQ...................................GVM
O58754_PYRHO/73-383----------------------LPI.QE.ENDVPY..KSRVP...................................GKM
Q9A561_CAUCR/80-410----------------------VR........................................................
A9CGN8_AGRT5/61-370----------------------LPI.LE.TSGKPW..ASKVP...................................GKA
Q8XYW5_RALSO/75-389----------------------VP...VDGQRW......SSDPFAP...........................EVRDGRL
Q89R53_BRAJA/83-410----------------------QP........................................................
Q8FB92_ECOL6/71-385----------------------LPI.YE.NSGKPW..ASKHP...................................GLM
DAPE_CHRVO/62-372----------------------VP..TGPLDKW......DSPPFEP...........................TVRNGLL
Q89H48_BRAJA/89-419----------------------VR........................................................
Q7NW88_CHRVO/76-389----------------------LPI.HE.ETGLPY..ASKLP...................................GKM
Q93H22_STRAW/84-440----------------------VP...ANAADW......THHPFSG...........................EIADGCV
Q81G37_BACCR/72-385----------------------LPI.QE.ETSKSY..TSVNK...................................GMM
O53227_MYCTU/102-459----------------------QP...............EGDRGQWVSP....................PFEPTERGGRL
Q8ENA4_OCEIH/109-426----------------------LPI.NESTHQSHIPASEAFNSI...............................NSRVM
Q7CSZ0_AGRT5/74-383----------------------LPI.LE.ETGKPW..ASKTA...................................GAM
ILL7_ORYSJ/127-444----------------------LPL.QE.LVDWEH..KSEES...................................GKM
Q8RTT1_9PROT/116-483----------------------VPIEIGTEDGW......QHPPFAG...........................VIENNNL
Q98K54_RHILO/83-410----------------------QP........................................................
ARGE_PHOLL/76-379----------------------VP...FDEGLW......TKDPFTL...........................TERDNKL
DAPE_WIGBR/60-371----------------------VH..AGNVKNW......KYPPFSS...........................KLKDGIL
Q81HT0_BACCR/72-385----------------------LPI.HE.ENEFDF..ISTYK...................................GVM
DAPE_BRUSU/70-392----------------------VP..PGDEKDW......KHPPFAA...........................AIEDGVM
Q7X340_9BACT/107-429----------------------VF........E......ADSPFQKY.........................ERINADTA
Q9AD91_STRCO/88-444----------------------VP...ANADDW......THHPFSG...........................EVADGCV
Q8FY52_BRUSU/74-383----------------------LPI.TE.TSGAEW..ASQNP...................................GKA
Q82HL3_STRAW/71-409----------------------VP........................................................
Q9A2D4_CAUCR/74-388----------------------VP...VDGQPW......STDPWTL...........................TERDGRL
A9CF54_AGRT5/65-371----------------------VP...AGEPEW......SSDPFML...........................RAKGERL
Q9K425_STRCO/86-447----------------------QP...............PLDEAGWATP....................PFELTERDGRW
LYSK_SULSO/64-341----------------------VY...............GYIEPK.............................IENELI
ARGE_MYXXA/75-375----------------------VP...Y.DAAW......TDALRL............................TEKDGRL
Q8NV66_STAAW/63-369----------------------LPI.QE.LVEQDF..KSENE...................................GVM
Q89Q07_BRAJA/80-408----------------------QP........................................................
ACY1_PIG/76-396----------------------VP...VFKEHW......SHDPFEG..........................FKDADGYI
Q7ZVV2_DANRE/88-409----------------------VP...VYEEHW......EHHPFAA..........................VKDADGNI
Q7W8K0_BORPA/79-416----------------------VP........................................................
Q8U375_PYRFU/127-437----------------------LPI.QE.ENEVPY..KSRVP...................................GKM
Q88FQ3_PSEPK/88-415----------------------QP........................................................
Q8GGD4_CORST/76-395----------------------LPI.TE.NTGLDY..SADPE..................................LGMM
Q97KA5_CLOAB/71-388----------------------LPL.MENNENRSY..CSKVN...................................GRM
Q89NT5_BRAJA/145-448----------------------VY...............LKGMLKDQ........................PFRVDGDKA
Q8XUU2_RALSO/122-426----------------------VY...............LKGMLAQQ........................PFRIDGDRA
Q96W94_LACKL/110-445----------------------QP........................................................
Q8P4C4_XANCP/97-429----------------------LPV.TE.QTGLPF..ASKATSQYR...........................GETVGVM
Q8ZVD7_PYRAE/78-394----------------------VP..PGPLESW.....RVTMPFEP...........................VYREGRV
Q8G5Q0_BIFLO/70-377----------------------LPI.VE.DSGLEF..SSVNE...................................GVM
Q81DV3_BACCR/97-416----------------------VP..EGDVNQW......EHHPYSG...........................EKIGNRI
Q8KDJ8_CHLTE/87-402----------------------LPL.QE.ENGHDF..CSTVE...................................RCM
Q8Y9J1_LISMO/76-406----------------------VP........................................................
Q8XUB8_RALSO/98-420----------------------VP...P.GLGW......THDPYGGEI.......................VETEHGPTM
Q9HW57_PSEAE/76-386----------------------LPI.VE.ATGLGY..SSCHG...................................GRM
Q9HZS5_PSEAE/74-386----------------------LPI.QE.ATGLPY..ASQVD...................................GVM
Q9HTY4_PSEAE/72-376----------------------VP...YDEALW......SSDPLRL...........................DERDGRW
Q8RC51_THETN/70-383----------------------LPI.QE.ENEVEY..ASKIP...................................GKM
CBPS_YEAST/164-571----------------------VPVNNETLSSW......KFPPFSGH.........................YDPETDFV
Q8PQM2_XANAC/86-416----------------------VR........................................................
ABGA_HAEIN/104-420----------------------VNV.TETRSPEHIPNKEGFASI...............................NDGFM
A9CL51_AGRT5/72-381----------------------VP...A.GDGW......TTDAFIL...........................REDDGKL
O29358_ARCFU/84-400----------------------VP..EGDERLW......ETPPFKG...........................IVKNGRI
O18000_CAEEL/95-469----------------------QP...............AAKSDGWDTE....................PFELVEKDGKL
Q89QR0_BRAJA/85-459----------------------QP...............VDPLDLWHRPPFE...............PAVTDHADGRKII
Q8D5L5_VIBVU/73-371----------------------VF...............PVGTAAAR........................PMSLDAEKA
Q8CMY3_STAES/74-388----------------------LPI.KE.ETELPY..ASKNE...................................GVM
Q84FR8_9MICC/81-412----------------------VE........................................................
LYSK_PYRHO/62-321----------------------VP...............GYIPVR.............................IEGEVL
Q9KE02_BACHD/99-417----------------------VS..PEPVEHW......TYDPWGA...........................TIVENRM
Q885F3_PSESM/68-380----------------------LPI.QE.LGDSLH..KSAHK...................................GCM
YE48_SCHPO/193-589----------------------VPVNQASLDRW......YFPPFSA...........................TYHNGHV
Q8Y3L6_LISMO/79-393----------------------LPI.QE.ETGLAF..ASKNP...................................GVM
Q9Z6S9_CHLPN/119-487----------------------QP...............AQLSDGWKGD....................PFILREENGNL
Q92MD6_RHIME/74-383----------------------LPI.TE.ASGRAW..SSTAP...................................GKM
Q92MZ4_RHIME/83-410----------------------QP........................................................
DAPE_PHOLL/62-372----------------------VP..AGDESQW......EYPPFEP...........................TIRNGML
O30185_ARCFU/62-368----------------------VP...............AGDELLN..........................PVIVDGKL
Y4TI_RHISN/82-394----------------------LPI.QETRDDLPY..QSHVE...................................GVM
Q7UM22_RHOBA/107-416----------------------VP.....ADRWG...GPGGNPFEA...........................VIEDNRL
Q7W1K2_BORPA/73-390----------------------LPI.HE.TNTFGH..ASRHA...................................GRM
Q89ER6_BRAJA/82-381----------------------VF...............GKGEAGRR........................PFTIRDNRA
Q9FBL9_STRCO/68-359----------------------VPIAGNVPSRL......DED...................................GVL
Q18621_CAEEL/72-345----------------------VP...............PYFPPT.............................QDEQNI
Q8VXY9_ARATH/134-472----------------------IP........................................................
Q985I5_RHILO/80-409----------------------QP........................................................
Q7CX68_AGRT5/76-403----------------------QP........................................................
Q972L9_SULTO/72-422----------------------QP...............VDPLNEWKYP....................PFSAIIENGHI
Q88CJ5_PSEPK/72-376----------------------VP...YDEQLW......ASDPLKL...........................IETDGRW
Q89IE8_BRAJA/75-385----------------------LPI.TE.TSGVPY..ASKVP...................................GKM
Q8P8J5_XANCP/68-364----------------------VP...D.SPHW......SADPHVM...........................RRTEDRV
Q7QEF5_ANOGA/84-405----------------------VP...VYPERW......THAPFGA..........................EMDHEGRI
Q96XG6_SULTO/80-366----------------------VP...P.GDNW......ITEPFKL...........................KIIDNKA
Q9HTH4_PSEAE/66-380----------------------VP...ADGQAW......SVPPFRL...........................SERDGRL
Q97Y12_SULSO/89-404----------------------VP...A.GEGW......SVDPYKG...........................IEKDGKI
DAPE_HAEDU/63-373----------------------VP..TGDPAQW......QYPPFSA...........................IIVDEML
Q896S2_CLOTE/77-402----------------------VI........................................................
Q8YV79_NOSS1/124-437----------------------LPI.QE.RTGLEY..ASRTD...................................GIM
Q92TU1_RHIME/91-555----------------------VS........TDNYHELKALACDSLALKDALIESLSARTGRSEQEERALQDLASGDFL
CBPG_PSES6/108-410----------------------VY...............LKGILAKA........................PFRVEGDKA
Q88GZ4_PSEPK/73-387----------------------VP...VDGQAW......TVEPFAL...........................SERDGRL
A9CF81_AGRT5/85-394----------------------LPM.PE.ETGLPY..TSVYP...................................GKF
Q9A5J1_CAUCR/78-407----------------------LPV.EE.KTGLPF..ASKVKATWE...........................GRTVPVM
Q822A3_CHLCV/82-450----------------------QP...............ADLADGWLAD....................PFTMRREGERL
Q44415_RHIRD/55-364----------------------LPI.HE.KSEADY..RSRTD...................................GKG
Q98LM4_RHILO/87-417----------------------QT........................................................
Q9WXY3_THEMA/60-350----------------------VF...............PEGESKRR........................PFTIEGNIA
Q88A71_PSESM/106-428----------------------VF...............PQTSRFQTF.......................AYLDGGKKA
Q7WAX1_BORPA/107-486----------------------QP...............EFSGWRADLG....................PWTPKYENGKL
DAPEL_STRR6/65-372----------------------LPI.VE.QTGLPF..ASQHQ...................................GRM
DAPEL_LACPL/70-372----------------------LPV.TE.NTGLPF..ASTHP...................................GVM

PF00883

AMPL_BOVIN/196-509----------------------TPANEMTPTKFAEIVEENLKSA-----------------------------S.IKTDV
AMPL1_ARATH/202-512----------------------SPANVLTPAVLAEEAAKVASTY-----------------------------SD.VFTA
AMPL_CAEEL/170-478----------------------TPANILTTDALVDEAVKVGNAT-----------------------------G...SKI
AMPA_RICPR/182-494----------------------EPSNIKTPQVYAERIVEILEP.-----------------------------..LGVNI
AMPA_MYCLE/200-515----------------------TPPSHLFPAEFAKCAKTLGESA-----------------------------G...LEV
AMPA_MYCPN/134-437----------------------TPSDQLYPEEFVKRFEKAATGL-----------------------------G...VKI
AMPL2_SOLLC/253-561----------------------APANVLTPAVLAEEAKKIASTY-----------------------------SD.VFSA
AMPA_HELPY/174-487----------------------TPPMIGTPVYMAEVAQKVAKEN-----------------------------H...LEI
AMPL1_SOLLC/255-566----------------------APANIVTPAVLAEEAKKIASTY-----------------------------SD.VISV
AMPA_ECOLI/184-491----------------------MPPNICNAAYLASQARQLADSY-----------------------------S.KNVIT
AMPA_BACSU/178-487----------------------MPGNMLTATDLASYAEELAAKY-----------------------------D...FEC
PEPB_ECOLI/110-423----------------------APAEELGPSQLAQRAVDLISNV-----------------------------AGDRVTY
AMPA_SYNY3/177-485----------------------APANEVTPLTFTEIATELAQTY-----------------------------G...LEL
AMPA_MYCGE/135-439----------------------TPSDLLYSEVFVKHFEKAASKL-----------------------------P...VKI
AMPA_MYCSA/148-453----------------------TPPNELNSEQLAEIIRKDFKKY-----------------------------HN..LKV
AMPA_HAEIN/178-484----------------------MPPNICNPAYLAEQAKNLAEN.-----------------------------S.TALSL
YA55_SCHPO/194-508----------------------CPANYMTSLQFCHFAQELFQNS-----------------------------S..KVKV

PF05450

NICA_MOUSE/273-498VAPG-------------------AESAVASF---VTQ-------------------------------------------
Q7PY38_ANOGA/276-510VGLG-------------------AMDSVVPF---AVL-------------------------------------------
Q6Z743_ORYSJ/248-457RSLG-------------------ADSPISGL---IAL-------------------------------------------
NICA_CAEEL/278-508ISVG-------------------EVSVLTSI---ISV-------------------------------------------
NICA_ARATH/251-460KSFG-------------------ADSPISGL---VAL-------------------------------------------
Q7KS07_DROME/236-469VGLG-------------------AMDSLMGF---AVF-------------------------------------------

PF04389

Q7PQQ4_ANOGA/170-341GSPG-------------------ASDDSGSC...AVM-------------------------------------------
M28P1_NEUCR/178-345TGFG-------------------ATDDGMGV...VTA-------------------------------------------
M28P1_YEAST/149-315TGYG-------------------ATDDGMGV...VSL-------------------------------------------
Q7Q1Q7_ANOGA/130-334QFIG-------------------ATDSSVPC...AML-------------------------------------------
Q7RW54_NEUCR/186-361RGPG-------------------ADDNGSGV...VVI-------------------------------------------
QPCTL_MOUSE/162-367PFVG-------------------ATDSAVPC...ALL-------------------------------------------
Q7QJV5_ANOGA/159-330QSPG-------------------AGDDGTMS...VIM-------------------------------------------
Q9YDB0_AERPE/212-375WYTG-------------------FTDNILGV...AQA-------------------------------------------
Q7PX80_ANOGA/293-461VGVG-------------------AMDDGGGA...MIS-------------------------------------------
Q9KLD3_VIBCH/193-374IAPG-------------------ADDDASGI...ASL-------------------------------------------
Q898V9_CLOTE/225-396VYNG-------------------ALDNASGI...SFV-------------------------------------------
Q82DU6_STRAW/116-300AGPG-------------------INDNGSGS...AAV-------------------------------------------
Q8SX46_DROME/72-243QTPA-------------------AGDDGVMV...VVM-------------------------------------------
Q7RZ44_NEUCR/250-445AGPG-------------------INDDGSGV...IGI-------------------------------------------
Q9A578_CAUCR/260-453INNG-------------------AMDNASGV...ASL-------------------------------------------
Q87AH5_XYLFT/290-488IFNG-------------------ALDNASGT...AAL-------------------------------------------
Q9SXH2_IPOBA/146-316AAEG-------------------AGDDSSNV...AVM-------------------------------------------
Q9HRR8_HALSA/220-384ITDG-------------------AMDNGAGT...AMA-------------------------------------------
AMPX_VIBPR/196-377VAPG-------------------ADDDASGI...AAV-------------------------------------------
Q8TL26_METAC/121-299PAPG-------------------ADDNASGA...AGV-------------------------------------------
APE3_YEAST/307-487EGPG-------------------INDDGSGT...ISL-------------------------------------------
Q7X7Q3_ORYSJ/128-297TTEG-------------------AGDCSSCV...GVM-------------------------------------------
QPCT_BOTJA/137-351VFVG-------------------ATDSAVPC...AMM-------------------------------------------
YC52_SCHPO/154-322PSPG-------------------ATDDALAV...AIL-------------------------------------------
Q7UQS9_RHOBA/733-948VHVG-------------------ADDNASGV...AAM-------------------------------------------
Q8CK35_STRCO/710-894AGPG-------------------INDNGSGS...AAL-------------------------------------------
YFI8_YEAST/119-344GMVG-------------------AIDSAASC...AAL-------------------------------------------
Q9VRQ9_DROME/107-312GFVG-------------------ATDSAVPC...AIL-------------------------------------------
Q9FBN5_STRCO/130-314AGPG-------------------MNDNGSGS...AAL-------------------------------------------
Q7MAY9_PHOLL/149-318TAPG-------------------ASDNGIAV...ASV-------------------------------------------
Q8MT48_DROME/150-321GSSG-------------------AGDAGMMC...VIM-------------------------------------------
Q9F3Y1_PSEAI/119-319TLQG-------------------LDDNASGA...AVL-------------------------------------------
Q86PD7_DROME/130-333EFLG-------------------ATDSAVPC...AML-------------------------------------------
O64804_ARATH/146-318NSPG-------------------AGDCGSCVGEFASL-------------------------------------------
Q82VZ8_NITEU/829-1008IHYG-------------------ADDNASGV...AVM-------------------------------------------
O82996_AERPU/193-374LAPG-------------------ADDDASGI...ATL-------------------------------------------
Q9A369_CAUCR/119-286NSPG-------------------AADDASGT...AAA-------------------------------------------
Q9HZQ8_PSEAE/289-482EGPG-------------------INDNGSGS...AAQ-------------------------------------------
Q8PPS0_XANAC/311-509IFNG-------------------ALDNASGT...AAL-------------------------------------------
Q8GGR6_STRAZ/146-311NSHG-------------------ASDDGIGL...ATA-------------------------------------------
Q9A3U5_CAUCR/192-390IYNG-------------------AVDNATGI...AAM-------------------------------------------
Q7UGZ5_RHOBA/480-666IHNG-------------------ADDNASGT...ATM-------------------------------------------
Q7MT37_PORGI/117-314TFDG-------------------ADDGGSGV...GVL-------------------------------------------
IAP_ECOLI/110-321TLQG-------------------MDDNAAGL...GVM-------------------------------------------
Q8EF07_SHEON/278-467I.NG-------------------AVDNASGV...AGV-------------------------------------------
Q8PEF6_XANCP/333-532IYNG-------------------AVDNATGV...AGI-------------------------------------------
Q7S0R5_NEUCR/126-350GFIG-------------------ATDSAAPC...AVL-------------------------------------------
Q9A4J1_CAUCR/335-529INNG-------------------ALDNASGI...ATL-------------------------------------------
Q8EDI3_SHEON/278-480IYNG-------------------AMDNASGI...AGI-------------------------------------------
APX_STRGR/78-262SGAG-------------------INDNGSGS...AAV-------------------------------------------
Q53737_STRAD/260-459EGPG-------------------INDNGVAA...AVL-------------------------------------------
Q9VTH7_DROME/129-318DFMA-------------------ATDSAVPC...ALM-------------------------------------------
M28P1_SCHPO/140-307TGYG-------------------ATDDGMGV...ATV-------------------------------------------
YP67_CAEEL/167-338DTPG-------------------ATDDAVAC...TIM-------------------------------------------
Q9HNP7_HALSA/224-389IGEG-------------------ALDNGCGV...ATL-------------------------------------------
Q8A4P9_BACTN/117-317PILG-------------------ANDGASGV...GAL-------------------------------------------
Q7ND13_GLOVI/309-501IYNG-------------------AMDNAAGV...ATL-------------------------------------------
Q7UHT1_RHOBA/176-373VFVG-------------------ANDGASGA...AAL-------------------------------------------
Q8A5P9_BACTN/139-321IYNG-------------------ADDNASGV...SAV-------------------------------------------
Q97F97_CLOAB/227-398IYHG-------------------ALDNASGV...SFI-------------------------------------------
Q7U215_MYCBO/264-463EGPG-------------------INDNGSGV...AAV-------------------------------------------
Q8XIF2_CLOPE/231-402IYRG-------------------ALDNASGA...SFL-------------------------------------------
O67732_AQUAE/190-352FVYG-------------------AIDNGLSV...ALL-------------------------------------------
Q8P3Z6_XANCP/298-496IRRG-------------------AVDNATGV...ASV-------------------------------------------
Q93EJ5_BACLI/248-421YAPG-------------------ANDNASGT...SVV-------------------------------------------

PF09940

Q7CVW7_AGRT5/56-440LHRG..KNAKEVLLFAHICHPSLANDNCSGL---ALL-------------------------------------------
A0KQQ6_AERHH/58-441VLPG..ESEQEILLSSYTCHPSMANNELSGP---CVG-------------------------------------------
A1AY62_PARDP/36-438RLEG..DSDETVLISSYLCHPSMANNELSGP---LGL-------------------------------------------
Q72C97_DESVH/55-438VIPG..RSEKTVLLTSYVCHPSMANNELSGP---VLL-------------------------------------------
A5EAW0_BRASB/54-437YLPG..ETTDEVLFSCHICHPSLANDNLSGI---AVM-------------------------------------------
A9A1R6_NITMS/33-410FVKG..ELKETIVLVAHLCHPAMANDDLSGV---SVL-------------------------------------------
Q1YPT3_9GAMM/45-430IIPG..ETDREILLSTYICHPSMANNELSGP---VVT-------------------------------------------
Q74B36_GEOSL/49-431IIPG..ETDREIFLSTYVCHPSMANNELSGP---VVA-------------------------------------------
Q9RJJ2_STRCO/40-423VVQG..QVSDEVIVSCHVCHPSLANDNLAGI---AVA-------------------------------------------
A8L141_FRASN/59-442VLPG..ATDEEFLVTTHTCHPAMANDNSSGI---AVA-------------------------------------------
A7H288_CAMJD/53-435ILPSTQNSKDEILISTYLCHPSMANNELSGP---VVA-------------------------------------------
A4YXC9_BRASO/50-433FIPG..ETANEVLITCHVCHPSLANDNLSGV---SIM-------------------------------------------
Q97H19_CLOAB/50-432YIRG..ELEEEILLTTYTCHPSMCNDNLSGV---ALI-------------------------------------------
Q4HS24_CAMUP/11-393VIPSTTGLKDEILISTYLCHPSMANNELSGP---CVA-------------------------------------------
A4TVT0_9PROT/37-420ILPG..ETADEILLSTYVCHPSMANNELSGP---VVT-------------------------------------------
A5VUB4_BRUO2/56-440IHRG..QTDATFLLSAHLCHPSLANDNCSGL---ALL-------------------------------------------
Q1Q6Z8_9BACT/44-427YIKG..EKTEEVLISAHVCHPSLCNDNLSGI---VLA-------------------------------------------
A4F0R1_9RHOB/34-418VIPG..ESEQEIFISTYICHPSMANNELSGP---VVA-------------------------------------------

PF00246

Q7QC23_ANOGA/57-339.GQ.-------------------SREGVPLS---VLEIRPNVN..............................RPRPLLM
Q7QC23_ANOGA/466-752.GK.-------------------SVQGRDLW---VMEVTEQPG...............................QHAPGK
Q7PRP0_ANOGA/83-361.GK.-------------------SAQGRDLW---VLVVSASPY...............................EHMLGK
Q7PSV3_ANOGA/117-396.GT.-------------------SYEGRPIR---GVKLSRR....................................PGN
CBPB2_HUMAN/129-411.GS.-------------------SFEKYPLY---VLKVSGK..................................EQAAK
CBPA3_HUMAN/125-404.GS.-------------------TVEDNPLY---VLKIGEK...................................NERR
NNAD_DROME/879-1138.CR.-------------------TLAGNNVY---YLTVTAPSSN.............................EENMRRK
AEBP1_MOUSE/561-887.GK.-------------------SSRGLKIY---AMEISDNPG...............................DHELGE
Q23318_CAEEL/147-446.GT.-------------------TSEGRPIQ---GIKIGSQV.................................WRNDK
Q9W477_DROME/334-625.GV.-------------------TRNKRPLE---VIRVSNG...................................NPDN
Q7Q316_ANOGA/128-403.GE.-------------------SYEGREIR---GVKVSY....................................KQGN
CBPC1_CAEEL/734-1008.GH.-------------------SLAGNPIK---MLTITTPAS..............................AAEIAAR
CBPB1_BOVIN/125-404.GT.-------------------TFLGNTIY---LLKVGKP...................................GSNK
CBPE_BOVIN/63-363.GR.-------------------SFEGRELL---VLELSDNPG...............................VHEPGE
CBPA1_ANOGA/137-415.GR.-------------------SHQNRTMK---GVKLSY....................................GPGR
CBPA1_DROME/131-415.GK.-------------------TYQGRSIL---GVKITKGGE..............................TINGKAK
Q9VLZ1_DROME/129-409.GQ.-------------------SYEGRTIR---GIKISY....................................KSNN
Y1242_ZYMMO/118-364.GK.-------------------SLDGQSMD---CLTMG......................................EGR
CBPD_ANAPL/54-375.GR.-------------------SVEGRPLW---VLRLTAGLPELPEARQDGEKKKKE.EEEEEEEEEGEEGGGGALPGR
CBPD_ANAPL/942-1212.GQ.-------------------SVEFRQIW---SLEISNKPN...............................HSEPEE
Q9VCM8_DROME/185-464.GV.-------------------SAQGRPIL---GVQIAFD...................................NENR
O14418_METAN/124-409.GT.-------------------TGDGNTIT---GLHIFGSS.................................GGGNK
O17754_CAEEL/46-351.GQ.-------------------SVEGRPLV---VIQFSTTPG...............................EHIPTK
CBPD_RAT/70-372.GN.-------------------SVEGRPLW---VLRLTAGLGPPPTPAA.................VGLDAAGPLLPGR
CBPD_RAT/509-784.GK.-------------------SVESRELY---VMEISDNPG...............................VHEPGE
CBPD_RAT/937-1201.GQ.-------------------SVEYRHIW---SLEISNKPN...............................ISEPEE
O61532_DROHE/129-408.GK.-------------------TYQGRSIL---GVKISKS...................................QSEK
YBJ7_SCHPO/189-484.GI.-------------------TAEGRTIL---GLKLNGRHPSD...........................NGEKIRNK
O77063_APLCA/41-315.GS.-------------------SVQERQLL---AIQITDNVN...............................ISEPGE
O77063_APLCA/474-752.GQ.-------------------SVQGRDLW---VLEITENPG...............................QHMPGK
O97389_HELAM/127-412.GK.-------------------SFEGRSIK---YLRISTTN................................FQDASK
CBPA1_BOVIN/128-406.GR.-------------------SYEGRPIY---VLKFSTG...................................GSNR
CBPB_ASTFL/12-290.GL.-------------------SYEGRTMK---LLKLGKG...................................GADK
CBPN_HUMAN/31-330.GR.-------------------SVEGRHLY---VLEFSDHPG...............................IHEPLE
CBPS_STRGR/138-428.GK.-------------------TYQGRDVI---AVKVSDNV................................ATDEAE
CBPA2_RAT/127-404.GS.-------------------SFENRPMN---VLKFST....................................GGDK
CBPB1_RAT/123-402.GT.-------------------TFEGRNMY---VLKIGKT...................................RPNK
CBPT_THEVU/113-402.GK.-------------------SYEGRELW---AVKISDNV................................GTDENE
CBPE_LOPAM/37-342.GE.-------------------SFEGRELL---VLEMSDNPG...............................THEPGE
ECM14_YEAST/127-417.GR.-------------------TFEGRELK---ALHISGNKP...............................ESNPEK
CBPS_STRCP/129-415.GK.-------------------SYQGRDLW---MLKLSDNP................................AVDENE
CBPD_DROME/46-327.GR.-------------------SLEGRNLL---ALQISRNTR...............................SRNLLT
CBPD_DROME/462-752.GK.-------------------SVQGRDLW---VLEIFATPG...............................SHVPGV
CBPZ_SIMVI/8-286.GK.-------------------SYEGREIR---GVKVSY....................................KKGN
P73902_SYNY3/17-361.GQ.-------------------SYAGRDIW---VAIATNQAT...............................GDYRNK
P90667_APLCA/53-357.SEP-------------------SVEKRNLT---VLEITENPG...............................VHVPGK
P91359_CAEEL/84-366.GK.-------------------SVEGRELW---VLIISDKPK...............................EHKLME
P91755_LUMRU/82-363.GY.-------------------TVLGRPMQ---ILKLGLN...................................GGNK
ENP1_LYSSH/115-389.GN.-------------------SVLAQPIP---EILIG......................................NGS
Q22825_CAEEL/64-346.GQ.-------------------SVQGRELW---VLVVSRYPI...............................EHRKLI
Q7NHR1_GLOVI/52-276.GK.-------------------SPEGRAIP---VLVVSKDKAFT..........................PEAARATGK
Q7NMK5_GLOVI/121-539.GK.-------------------TAEGRPQL---MAILTSPENHKKLGRYQEIARK....LALAEGLNDSQAKALAAEGK
Q7NYA9_CHRVO/137-389.GS.-------------------TVQGRDMN---LLTIGHE...................................VESD
Q7NYK5_CHRVO/83-312QEK.-------------------TGEGRPFM---MAVASSSADKS..........................AAGLKASGK
A8BM27_GIAIC/624-987.TK.-------------------SIGGNDVD---MLTITSSSTS.............................MQELKAR
Q7RI20_PLAYO/819-1026.GI.-------------------TKEITKGI---TKEI........................................TK
Q7S312_NEUCR/128-414.GT.-------------------SVNGNAIT---GIRFWGSA.................................GKGVK
CBPA1_MOUSE/128-406.GS.-------------------TFEGRPIN---VLKFSTG...................................GTNR
Q7UE12_RHOBA/168-401AGR.-------------------SVQDRPIH---RLAIGN....................................PDSK
Q7W2L4_BORPA/327-506....-------------------SRQGRPVL---GAYVA......................................GPG
Q829W4_STRAW/126-404.GK.-------------------TLNGQDIL---ALKLTKGAK..............................KTKDGAK
Q82L57_STRAW/15-263.GV.-------------------SRAGRPLH---LLSVG......................................HAT
Q82MI7_STRAW/50-294.GT.-------------------TEQGRPLD---LVRVGGG...................................HRAR
Q86FI7_SCHJA/151-426.GF.-------------------TAEGRQMK---GVKIST....................................DSTK
Q86P95_DROME/159-438.GS.-------------------STQGNAIK---GVKLTS....................................NANN
CBPA4_HUMAN/129-408.GH.-------------------SFENRPMY---VLKFSTG..................................KGVRR
Q871Q3_NEUCS/204-502.GD.-------------------SYEGRPIH---SFRIGDHSGD.............................NANNGTR
Q87JK3_VIBPA/143-392.GH.-------------------TLDGNDMS---LLTFGEP...................................EEGK
Q88KC6_PSEPK/125-366.GR.-------------------SVQGRDIP---LLRAGDG...................................AEGK
Q897X5_CLOTE/135-416.GK.-------------------SVLGRELY---YLKLG......................................NGP
Q8AVS2_XENLA/141-421.GK.-------------------SYEGRSLY---VLKLGKD..................................TKSYK
Q8AXN3_PAROL/115-395.GN.-------------------TYEGRPMT---VLKLGKK..................................SSSTK
Q8AXN4_PAROL/128-406.GS.-------------------SYQGRPLN---VLKFSTG...................................GSNR
Q8AXN5_PAROL/128-406.GR.-------------------SYENRPMY---VLKFSTG...................................GNKR
Q8EEF8_SHEON/114-366.GL.-------------------TLDGRDIT---LMKVGDG...................................NPDK
Q8EKE3_SHEON/95-358.GK.-------------------SPQGRDIW---MYVASSEGINE..........................SAQLKQNAK
Q8EQG9_OCEIH/116-389.GN.-------------------SVLGKDII---ELQIG......................................AGS
Q8ESH0_OCEIH/55-359.GT.-------------------SVEGRPIH---LVRVGFPEPP............................SDEDIANG
CBPZ1_PLAF7/1011-1251.KR.-------------------KDEKRSLS---ASPKKKK...................................KKKK
Q8IGC4_DROME/129-411.GQ.-------------------SYEGRELL---GLRINHND.................................GRAEK
Q8IMH9_DROME/186-465..K.-------------------SLQNRNVD---LLTIDHVTAKQR........................STNRLDRSFI
Q8MYY0_DROME/152-429.GR.-------------------SNEGRHIA---ALSISLNS.................................RVRPR
B4E3Q2_HUMAN/324-632.GK.-------------------SHQGLKLY---AVEISDHPG...............................EHEVGE
Q8P4I9_XANCP/58-309.GT.-------------------SSEGRDLL---LVRARKG...................................AAGK
Q8PAS3_XANCP/44-407.GT.-------------------TPEGRPMK---ALVVSTSGALD..........................AASAAQRAL
Q8PMH9_XANAC/44-312.GT.-------------------TPEGRPMK---ALIASTSGALD..........................PQSAAQRKL
CBPA5_MOUSE/145-423.GK.-------------------SFENRSIL---VLKFSTG...................................GPNR
Q8SXR8_DROME/47-329.GW.-------------------SYEQRVLK---TITITNGD.................................GKANK
Q8SZR4_DROME/44-328.AR.-------------------TYENRALK---MAIITNGD.................................GRPGK
Q8T0Q1_DROME/57-337.GK.-------------------SYEGRTIR---GIKISH....................................KAGN
Q8TK20_METAC/106-433PHQ.-------------------SWENRTSH---AVRVRAG..................................TNTNR
Q8UUK1_CHICK/130-406.GR.-------------------TTENRPIY---VLKFSKG...................................GTNR
Q8XMR3_CLOPE/302-537.GK.-------------------SGNGRDLE---YYRIG......................................HGK
CBPN_MOUSE/31-330.GR.-------------------SVKGRYLY---VLEFSDYPG...............................IHEPLE
Q961J8_DROME/129-406.GK.-------------------SYENRDIK---TITITNGD.................................GKTGK
Q96K85_HUMAN/1-240.GQ.-------------------SVQQRKLD---LLTITSPDN..............................LREGAEQ
Q9A9J5_CAUCR/82-489.GK.-------------------SEEGRSMW---MAIVSSPANLAKLDQYKTIARK....LAKAEGVSEAEARKLAAEGK
Q9ABB9_CAUCR/88-349.GV.-------------------SPQGREIF---AVIASKDGD...............................KLDPKK
Q9BL88_CAEEL/131-431.GT.-------------------THEGRQIP---LIKITNKR.................................NGGTK
Q9HZF4_PSEAE/85-359PER.-------------------SAEGHPML---LVTASTEADKS..........................AAGLKRSAK
Q9I012_PSEAE/122-366.GT.-------------------SVQGRDIE---LLRVRRH...................................PDSH
Q9K698_BACHD/54-324.GQ.-------------------SVMGRDLF---LVTFGT....................................NPDN
Q9PUF2_BOTJA/125-404.GT.-------------------TFEGRPMP---LLKVGKP...................................GVNK
Q9TZC6_CAEEL/153-440.AT.-------------------SSEGRSIY---GVKIHPPG................................PSPPEK
Q9U9K2_AEDAE/130-407.GH.-------------------SFENRSIK---GVKVSY....................................KTGN
Q9VRZ3_DROME/121-402.GN.-------------------SYEGRPIR---GVKISY....................................KEGN
Q9VS63_DROME/44-354.GH.-------------------THEKREIR---ALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCR
Q9VS67_DROME/133-412.GR.-------------------SYEGRWLK---TITITNGD.................................ARRNK
Q9VX86_DROME/1095-1422.GR.-------------------SFEGRPLI---VVKIESKQTAAAANNDGL.............HTIKRPKRKRKSGQA
Q9W475_DROME/827-1104.GY.-------------------SVEKRPLK---ILKISNG...................................NARN
Q9W478_DROME/154-431.GQ.-------------------TAEGRDLK---VLRISEN...................................PREN
Q9X7P4_STRCO/55-266.GT.-------------------TKQNRPLQ---LVTIGR....................................PSAA
Q9XBW4_PORGN/123-386.GK.-------------------SVKDRKLM---ICKLTSSA.................................NTGKK
Q9XU75_CAEEL/167-465.GA.-------------------THEGKPIE---GLKIGAR..................................SSHKK

PF04952

ASTE_ECOLI/42-322------------------------------------------------------------------------------PQ
ASTE_VIBVU/52-331------------------------------------------------------------------------------ET
Q8D7U9_VIBVU/56-332------------------------------------------------------------------------------SG
ASTE_PSESM/48-330------------------------------------------------------------------------------NG
ACY3_HUMAN/10-301------------------------------------------------------------------------------PL
Q88EN1_PSEPK/47-329------------------------------------------------------------------------------IG
ACY2_BOVIN/10-301------------------------------------------------------------------------------PI
P72108_NATPH/45-319------------------------------------------------------------------------------PG
Q8REZ3_FUSNN/9-257------------------------------------------------------------------------------AS
A9CH33_AGRT5/52-333------------------------------------------------------------------------------DG
ASTE_SALTY/42-322------------------------------------------------------------------------------VD
ASPA_SYNY3/5-284------------------------------------------------------------------------------AV
Q87RV7_VIBPA/50-319------------------------------------------------------------------------------EG
ACY3_MOUSE/10-300------------------------------------------------------------------------------PL
ASTE_SHEON/52-339------------------------------------------------------------------------------QG
Q987A0_RHILO/66-347------------------------------------------------------------------------------KG
Q92SQ8_RHIME/30-339------------------------------------------------------------------------------AA
ASTE_VIBCH/52-331------------------------------------------------------------------------------AT
Q8KGS0_RHILI/43-328------------------------------------------------------------------------------EG
ASPA_NOSS1/3-288------------------------------------------------------------------------------KI
ASTE_PSEPK/48-330------------------------------------------------------------------------------CG
Q87HF0_VIBPA/56-331------------------------------------------------------------------------------PG
Q9HNH1_HALSA/42-314------------------------------------------------------------------------------DG
ASPA_PROMA/2-289------------------------------------------------------------------------------SG
ASTE_YERPE/42-323------------------------------------------------------------------------------YT
ASTE_PSEAE/48-331------------------------------------------------------------------------------NG
Q89N67_BRAJA/46-333------------------------------------------------------------------------------AG
Q98JD4_RHILO/49-329------------------------------------------------------------------------------PG
Q8EGL7_SHEON/48-317------------------------------------------------------------------------------PG
A9CLI1_AGRT5/46-332------------------------------------------------------------------------------DG
Q8EAC2_SHEON/33-365------------------------------------------------------------------------------SG
Q92WC2_RHIME/47-328------------------------------------------------------------------------------EG
Q98AA0_RHILO/43-328------------------------------------------------------------------------------EG

PF10994

A0L457_MAGSM/24-365PL.R-------------------GSRGEELA---MDVVRLGH----------------------------------AQCH
A4XNS7_PSEMY/6-345PL.P-------------------GRDGEQLA---IDVARLGA----------------------------------ADAA
Q4DHE8_TRYCC/47-382LQ..-------------------.EEGFEYS---IDTAFVRG----------------------------------KKAK
Q0RN36_FRAAA/3-356GELR-------------------GARGESLS---TDVARIGA----------------------------------SRGR
A4HIN1_LEIBR/48-391TK..-------------------.RGNVEYY---MDTAFFPG----------------------------------KRKA
A0Z3J5_9GAMM/7-347DI.S-------------------GPAGEELA---MDFAVGGP----------------------------------ADAA
Q0EX57_9PROT/12-350PL.T-------------------GPEGEALA---TDLAWLGD----------------------------------SDAE
Q213B6_RHOPB/13-353PTKT-------------------GPDGEALL---IDVARLGD----------------------------------PGAP
Q3K6V4_PSEPF/5-352PL.N-------------------GPFGESLS---TDVAVLGD----------------------------------PAAK
Q7VZV3_BORPE/14-354EGRT-------------------GPDGRPLH---TDVARFGR----------------------------------ADAP
A4GJN2_9BACT/7-352DL.V-------------------GPDGEDLT---IDIAVLGS----------------------------------LTSN
A7HS30_PARL1/18-367QHAK-------------------GPGETRLF---TDTAWFGP----------------------------------ANAE
Q7W0U8_BORPA/7-349DTQR-------------------GPDGEALY---LDVARLGG----------------------------------AQAS
A1VW91_POLNA/13-355AL.P-------------------GRDGEALA---VDAAWQGP----------------------------------RQAT
A1W380_ACISJ/8-351PL.C-------------------GPNGETLA---LDVVREGP----------------------------------LDAH
Q12BQ5_POLSJ/8-351PE.P-------------------GRDGEVLA---MDVVLDGS----------------------------------LDAK
Q2KVE6_BORA1/8-348PGRL-------------------GAQGEALA---MDLAYLGP----------------------------------PDAD
C6BDX1_RALP1/7-346PDAV-------------------GPSGEQLS---IDTALLAP----------------------------------AQAE
A9BGZ8_PETMO/4-348....-------------------...EEDSY---IDSFLCQN----------------------------------EGNR
Q0K9X8_CUPNH/4-344PTKR-------------------GSAGEDLA---IDVALAGP----------------------------------AEAR
Q46ZZ8_CUPPJ/8-348PTRR-------------------GSAGEDLA---MDVAWVGP----------------------------------ADAR
A4A0X2_9PLAN/9-348ES.L-------------------EPQSDPLS---IDLLTLGD----------------------------------PQAP
Q586Z8_TRYB2/47-385AS..-------------------.RDGVEYT---LDTAFLRG----------------------------------KNSK
Q118U2_TRIEI/12-348YS.Q-------------------NCPNNSLY---TDIAWLGN----------------------------------SKPH
A1TK81_ACIAC/8-351PL.P-------------------GREGEPLA---MDVVRDGP----------------------------------ADAH
A9KLP9_CLOPH/53-407PI..-------------------.DEEDGLY---IDTILCDS----------------------------------KEEK
A5V6N1_SPHWW/7-348PL.Q-------------------GPAGQALA---TDTLRIGP----------------------------------ADAE
A7HTE6_PARL1/10-349PM.A-------------------GPDGEKLA---TDVARLGP----------------------------------DDAR
A3RS53_RALSL/7-346PHAL-------------------GPAGESLS---IDTACFLP----------------------------------ERPG
Q1LB58_RALME/20-354PL.D-------------------GAHGETLA---TDVVRDGP----------------------------------LHAS
A0YFP1_9GAMM/12-355PSAR-------------------CPDGAALF---TDTAWLGP----------------------------------RHAS
Q1LNH9_RALME/10-350PTET-------------------GNEGEALA---MDVAWVGA----------------------------------ADAS

PF07454

A9VRX1_BACWK/114-390PGMS-------------------KYYSNIIV---AGEGTNFT--------------------------------------
A0Q1S0_CLONN/78-362AYLS-------------------ADEEYKSL---EDEKNFKD--------------------------------------
Q0AXA7_SYNWW/53-297YKVV-------------------EII..GNT---ARCKYQGD--------------------------------------
B8FUP8_DESHD/126-356PELE-------------------EIPLTPSP---VPPEHEEP--------------------------------------
A4IR37_GEOTN/100-382PGFA-------------------LYDSKILI---AGEGTDYT--------------------------------------
Q892Q4_CLOTE/87-346SLIN-------------------TSEIYKQK---DYE.....--------------------------------------
Q2B0L9_9BACI/100-377PAFR-------------------GYEGALLT---AGEETNNS--------------------------------------
Q8EPW1_OCEIH/94-372PGFS-------------------IYDSQILM---ASGDNHFT--------------------------------------
Q0SRD6_CLOPS/80-354PYFG-------------------AVNKIASI---DKVNYVSA--------------------------------------
Q4MRJ9_BACCE/93-374PGFG-------------------KYDTEIVI---AGEGTNYS--------------------------------------
Q8R9I5_THETN/52-292YEIV-------------------EVDEGEKI---AYAKYIRT--------------------------------------
A6TS45_ALKMQ/53-323YEVT-------------------RVNTSSRI---AYADFIND--------------------------------------
SP2P_BACSU/101-383PGFA-------------------QFDTEILL---AGQGTDYT--------------------------------------
A8MH52_ALKOO/52-308YKVT-------------------KVNKKNNT---AYAEFMED--------------------------------------
A5I646_CLOBH/89-359PVLC-------------------LNSSKEDT---KDKSMA..--------------------------------------
A4XLX5_CALS8/99-374SKAS-------------------EKNQADDN---IEFQKYLK--------------------------------------
A5Z3I4_9FIRM/159-408GSFK-------------------EVINRFYT---VTNATTIK--------------------------------------
Q2BBP6_9BACI/48-296SWFF-------------------LYDGKDTL---YNTFSTPQ--------------------------------------
Q892Q3_CLOTE/87-344AFID-------------------TNEVYNTD---YK......--------------------------------------
Q3AAU2_CARHZ/64-305YKIT-------------------RVDHERAY---ARYLGEDQ--------------------------------------
Q2BEI4_9BACI/44-323PGLV-------------------YFDTEIVV---AGEGTDLS--------------------------------------
Q735M7_BACC1/90-366PNMN-------------------QFYSEILI---AGEGTDYT--------------------------------------
A1HR03_9FIRM/60-301PLLA-------------------AVKSSIPI---VSAKSLPN--------------------------------------
A1HTV9_9FIRM/49-295YEVY-------------------QIE..GDT---ARARLIGQ--------------------------------------
B0KA89_THEP3/88-386PILA-------------------QVDLK...---KVSTNNIQ--------------------------------------
B8CXL6_HALOH/71-347PLLS-------------------YYTPATLR---QPSRKVYE--------------------------------------
A1HTI8_9FIRM/55-292YEIT-------------------AVE..GTL---AKARYVRD--------------------------------------
Q2RKY1_MOOTA/91-333....-------------------.KTPSLLT---TEEEYVQP--------------------------------------
A5D3X4_PELTS/104-345PLLA-------------------AAEPSPAV---PAVRPVGP--------------------------------------
Q2RIV0_MOOTA/74-321YRVI-------------------RIEGNKGI---CREIGVEQ--------------------------------------
Q8RB76_THETN/88-377PVFA-------------------QVDYKKYQ---KVTQVTKG--------------------------------------
A6TSM6_ALKMQ/118-410YFAD-------------------YYEEDDVI---QEDHLQET--------------------------------------
O87702_BACME/80-361PGFS-------------------IYDSNIII---AGEGTNFT--------------------------------------
Q0AXW7_SYNWW/93-314NPIS-------------------QKLSAASI---SYPHTVEA--------------------------------------
A8MFA4_ALKOO/129-420HLVD-------------------YDGDEGTI---AVDKNIDG--------------------------------------
A4J3N7_DESRM/71-313YRIT-------------------KVSKGAAS---AKSLGMDK--------------------------------------
Q97JJ8_CLOAB/86-350SFLG-------------------EALPKSIK---SECP....--------------------------------------
A5N6L6_CLOK5/94-358AFLD-------------------LDSSKDVS---........--------------------------------------
A8FFD8_BACP2/101-383PGFE-------------------HFDTKIIL---AGEGTDYT--------------------------------------
A6CQZ1_9BACI/100-382PGFS-------------------IFDGEILV---AGEGTDFT--------------------------------------
Q0AWL6_SYNWW/49-338SLFR-------------------EVNVVFAG---EKTSFPMT--------------------------------------
A5ZX32_9FIRM/103-360ADYD-------------------YLMNHFFI---LDPNTETS--------------------------------------
A6LRM7_CLOB8/91-349SFFG-------------------DGESSSNT---ETNFS...--------------------------------------
A1BZN2_BACCE/93-367PGFS-------------------TYYSEIAV---AGEGTNES--------------------------------------
A7VIY1_9CLOT/106-364ADYD-------------------YIKNHFYV---IDSTTNVS--------------------------------------
Q5WHG7_BACSK/93-381PGFS-------------------LFDTTIHI---AGEGTDYT--------------------------------------
Q9KBM3_BACHD/90-369PGLA-------------------LFDTRIIV---AGEGTNLS--------------------------------------
Q3AF15_CARHZ/56-323GFKQ-------------------KNDEEGNL---SQEYALWL--------------------------------------
Q65H48_BACLD/100-381PGFS-------------------HFDSEILI---AGQGTDYT--------------------------------------

PF01520

Q18AN8_CLOD6/486-667...G-------------------S.AP....---........--------------------------------------
B8G9R1_CHLAD/244-421...D-------------------........---........--------------------------------------
A9BFG0_PETMO/246-450...G-------------------I.DP....---........--------------------------------------
A8MFT2_ALKOO/8-185...G-------------------T.DV....---........--------------------------------------
B8I4Q9_CLOCE/815-990...G-------------------S.ES....---........--------------------------------------
A9VKK0_BACWK/112-312...Q-------------------K.ANLNLE---AIGPG..A--------------------------------------
A9KSW1_CLOPH/279-457...G-------------------Y.DS....---........--------------------------------------
A8MIX1_ALKOO/49-238...G-------------------I.DG....---........--------------------------------------
B8I0V7_CLOCE/52-254...K-------------------T.SRLNTE---TEPIAPGA--------------------------------------
A8ZXB5_DESOH/55-253...G-------------------T.DT....---........--------------------------------------
Q05TN6_9SYNE/185-357...G-------------------P.DP....---........--------------------------------------
Q7NKW3_GLOVI/183-391...G-------------------T.RKI...---........--------------------------------------
Q8KIW1_BACTI/4-180...A-------------------H.DS....---........--------------------------------------
Q0P8Y7_CAMJE/436-653...G-------------------K.DS....---........--------------------------------------
Q8XP50_CLOPE/109-309...E-------------------T.EPECPG---SQK.....--------------------------------------
Q65J97_BACLD/4-173...G-------------------T.DP....---........--------------------------------------
A7B6H8_RUMGN/41-218...G-------------------K.DP....---........--------------------------------------
A6LWT5_CLOB8/185-363...G-------------------S.EL....---........--------------------------------------
Q667H0_YERPS/190-405...G-------------------E.DP....---........--------------------------------------
Q89VV6_BRAJA/18-229...P-------------------D.SY....---........--------------------------------------
Q04Q14_LEPBJ/141-357...G-------------------K.DP....---........--------------------------------------
A6TNB4_ALKMQ/3-181...G-------------------K.DP....---........--------------------------------------
Q1B275_MYCSS/43-246...A-------------------N.DASISR---Q.......--------------------------------------
Q898S7_CLOTE/57-230...G-------------------M.DK....---........--------------------------------------
A6BEP4_9FIRM/4-173...A-------------------G.DS....---........--------------------------------------
Q1J062_DEIGD/254-436...G-------------------L.......---........--------------------------------------
Q1YW18_PHOPR/4-180...A-------------------K.SG....---........--------------------------------------
A6G6B4_9DELT/15-232...G-------------------E.NE....---........--------------------------------------
A6D8D6_9VIBR/161-381...G-------------------E.DP....---........--------------------------------------
Q2RL42_MOOTA/469-652DPQG-------------------S.DP....---........--------------------------------------
A4SGW4_PROVI/340-557...G-------------------K.DP....---........--------------------------------------
A5Z962_9FIRM/92-293...K-------------------K.HI....---........--------------------------------------
A5I6J1_CLOBH/742-945...G-------------------K.DS....---........--------------------------------------
Q92C95_LISIN/4-166...G-------------------TYEQ....---........--------------------------------------
Q0S524_RHOSR/65-279...S-------------------S.EGHDLA---QQ......--------------------------------------
Q213N5_RHOPB/201-418...G-------------------I.DN....---........--------------------------------------
Q0SPN3_CLOPS/3-175...F-------------------L.SK....---........--------------------------------------
Q65GR1_BACLD/351-520...G-------------------H.DS....---........--------------------------------------
Q3B4P2_PELLD/11-205...S-------------------D.TP....---........--------------------------------------
A4QID9_CORGB/191-369...S-------------------..NK....---........--------------------------------------
E0TDU6_PARBH/209-421...G-------------------R.DP....---........--------------------------------------
Q03S01_LACBA/51-222...A-------------------G.DS....---........--------------------------------------
Q2LTS4_SYNAS/37-231...G-------------------P.DR....---........--------------------------------------
A6NUV0_9FIRM/115-300...G-------------------E.DG....---........--------------------------------------
A6BCQ8_9FIRM/5-174...G-------------------AKDP....---........--------------------------------------
A6GWP0_FLAPJ/28-200...G-------------------S.DL....---........--------------------------------------
A4CK99_ROBBH/34-251...G-------------------H.DP....---........--------------------------------------
A6VP10_ACTSZ/21-216...E-------------------T.DY....---........--------------------------------------
Q5N3W4_SYNP6/389-562...S-------------------AEDL....---........--------------------------------------
A5TTN3_FUSNP/131-338...G-------------------K.DP....---........--------------------------------------
Q9Z8C6_CHLPN/61-239...G-------------------K.DQ....---........--------------------------------------
Q899C4_CLOTE/144-318...G-------------------S.DK....---........--------------------------------------
A7M1G9_BACOV/3-189...E-------------------N.TP....---........--------------------------------------
Q1GIB7_SILST/182-398...G-------------------L.DP....---........--------------------------------------
Q3EPE6_BACTI/350-535...G-------------------V.DS....---........--------------------------------------
Q9F7S2_PRB01/77-296...G-------------------K.YP....---........--------------------------------------
Q9JZE9_NEIMB/5-174...N-------------------T.DP....---........--------------------------------------
Q5WE61_BACSK/4-182...G-------------------S.NS....---........--------------------------------------
A8D7W0_STREQ/5-171GRTG-------------------Y.DP....---........--------------------------------------
A5D0T0_PELTS/124-289...G-------------------N.DW....---........--------------------------------------
Q1K0X5_DESAC/166-349...G-------------------E.ET....---........--------------------------------------
Q73LZ8_TREDE/115-329...G-------------------K.DP....---........--------------------------------------
Q9LCR4_PAEPO/339-511...G-------------------K.DP....---........--------------------------------------
Q8ETR2_OCEIH/45-230...G-------------------P.DG....---........--------------------------------------
A0ZJD3_NODSP/4-182...G-------------------I.DP....---........--------------------------------------
Q1MPK0_LAWIP/382-592...G-------------------K.DP....---........--------------------------------------
Q1D594_MYXXD/56-271...A-------------------EGNT....---........--------------------------------------
Q187L1_CLOD6/3-170...T-------------------........---........--------------------------------------
A6BIV4_9FIRM/91-291...G-------------------T.EPLGPG---SSE.....--------------------------------------
AMIB_BUCAI/7-226...G-------------------Y.DP....---........--------------------------------------
A6M0K3_CLOB8/58-252...G-------------------..DL....---........--------------------------------------
A5N4X3_CLOK5/47-233...G-------------------I.DS....---........--------------------------------------
P89923_9VIRU/5-173...G-------------------........---........--------------------------------------
Q6MJS0_BDEBA/26-247...G-------------------V.DT....---........--------------------------------------
Q9RRC5_DEIRA/161-334...G-------------------D.EF....---........--------------------------------------
Q1ATQ5_RUBXD/173-345...G-------------------P.DR....---........--------------------------------------
A2W3V4_9BURK/65-263...P-------------------A.HP....---........--------------------------------------
A7B7G5_RUMGN/233-431...A-------------------T.HT....---........--------------------------------------
A4J7N3_DESRM/56-235...G-------------------T.DP....---........--------------------------------------
Q660K4_BORGA/111-328...G-------------------H.DA....---........--------------------------------------
A5ZLC0_9BACE/142-353...G-------------------P.DP....---........--------------------------------------
A8F7U0_THELT/27-198...G-------------------KEDR....---........--------------------------------------
A7B5H6_RUMGN/3-173...P-------------------N.CK....---........--------------------------------------
A7VC22_9CLOT/62-238...G-------------------S.DI....---........--------------------------------------
Q1K061_DESAC/6-189...G-------------------S.DP....---........--------------------------------------
A0YSJ1_LYNSP/1619-1787TNTG-------------------F.DP....---........--------------------------------------
A0NJM0_OENOE/125-302...G-------------------S.DP....---........--------------------------------------
Q2YZD0_9FLAO/42-220...G-------------------K.DS....---........--------------------------------------
A6LTJ0_CLOB8/6-175...A-------------------S.......---........--------------------------------------
Q1INP2_KORVE/300-482...G-------------------D.ER....---........--------------------------------------
Q67SM9_SYMTH/5-211...G-------------------W.DP....---........--------------------------------------
A7VQB6_9CLOT/5-183...H-------------------..NA....---........--------------------------------------
O67592_AQUAE/134-352...G-------------------K.DP....---........--------------------------------------
Q82B44_STRAW/116-328...S-------------------G.NFQHTA---DIN.....--------------------------------------
Q8PUP2_METMA/39-226...G-------------------Y.DP....---........--------------------------------------
A7GP61_BACCN/4-172...S-------------------I.VP....---........--------------------------------------
Q5WG95_BACSK/210-375...G-------------------R.DP....---........--------------------------------------
Q5JC43_CLODI/3-169...S-------------------........---........--------------------------------------
A8ATJ1_9CAUD/7-177...G-------------------V.DS....---........--------------------------------------
Q2FGU8_STAA3/181-364...Y-------------------N.DP....---........--------------------------------------
Q185X4_CLOD6/3-175...G-------------------K.ST....---........--------------------------------------
Q2J4A8_FRASC/242-415...G-------------------D.DP....---........--------------------------------------
A3UD36_9RHOB/176-386...G-------------------R.DP....---........--------------------------------------

PF02127

DNPEP_MOUSE/22-460LIGA-------------------HTDSPCLR---VKRKSRRS--------------------------------------
APEA_BORBU/28-456FIVS-------------------HTDSPRLD---AKPSPISE--------------------------------------
AMPL_YEAST/59-501VIGS-------------------HVDALTVK---LKPVSFKD--------------------------------------
DNPEP_YEAST/25-478ITGA-------------------HTDSPALR---IKPISKRV--------------------------------------
DNPEP_SCHPO/15-453IIAT-------------------HTDSPTLR---LKPKSQKS--------------------------------------
APEB_MYCLE/11-421IVGA-------------------HTDSPNLR---VKQHPDLL--------------------------------------
DNPEP_CAEEL/22-459IVVG-------------------HTDSPCLR---VKPISHQK--------------------------------------
APEA_THENE/27-449LVVA-------------------HIDSPRLD---FKPNPLVE--------------------------------------
APEB_BORBU/15-419IAAA-------------------HTDSPGLK---LKIDATEK--------------------------------------

PF05343

Q8XBQ0_ECO57/43-325MICA-------------------HMDEVGFM---VRS-------------------------------------------
Q8R656_FUSNN/53-342MISA-------------------HVDTLGAV---VKK-------------------------------------------
Q97RZ9_STRPN/45-334YVTA-------------------HVDTLGAI---VRA-------------------------------------------
Q99TB9_STAAM/49-339MIAA-------------------HMDEIGFM---ITN-------------------------------------------
O58255_PYRHO/44-324LFMA-------------------HMDEIGLL---ITG-------------------------------------------
Q8U0N9_PYRFU/45-335MIAA-------------------HMDQIGLM---VTH-------------------------------------------
Q8XLP6_CLOPE/50-337GLAA-------------------HVDTLGAM---VRS-------------------------------------------
Q9A1S8_STRP1/45-336LVAA-------------------HMDEVGFM---VSD-------------------------------------------
Q97MI2_CLOAB/40-324MLDA-------------------HMDEVGFI---ITS-------------------------------------------
Q8RCI6_THETN/40-326MLAA-------------------HMDEVALM---VKS-------------------------------------------
SGCX_SALTY/46-346MIFA-------------------HMDEVGFM---VRK-------------------------------------------
YSDC_BACSU/48-342MIAG-------------------HLDEVGFM---VTQ-------------------------------------------
Q9K874_BACHD/48-342MVAG-------------------HLDEIGFM---VTS-------------------------------------------
Q9PQL1_UREPA/50-344LIAT-------------------HMDEVGFV---VQQ-------------------------------------------
Q8NUY1_STAAW/45-340MISG-------------------HMDEVGFM---VTK-------------------------------------------
AMP_CLOTM/47-324MVAA-------------------HMDEIGVM---VTY-------------------------------------------
YHFE_BACSU/48-336MLTA-------------------HVDTLGAM---VKE-------------------------------------------
Q92CJ1_LISIN/45-340MIAG-------------------HLDEVGFM---VTQ-------------------------------------------
Q8NW29_STAAW/49-339MIAA-------------------HMDEIGFM---ITN-------------------------------------------
P70801_NOSS1/49-337AITA-------------------HKDEIGAI---VKN-------------------------------------------
Q92W97_RHIME/53-341GIVS-------------------HLDTLGAQ---VKA-------------------------------------------
Q9X0D8_THEMA/46-324AFFA-------------------HVDEIGFV---VSK-------------------------------------------
YTOP_BACSU/46-337MVAG-------------------HMDEVGFM---VTS-------------------------------------------
Q9K7V2_BACHD/46-337MVAG-------------------HMDEVGFM---VTS-------------------------------------------
Q8P2X3_STRP8/45-336LVAA-------------------HMDEVGFM---VSD-------------------------------------------
Q9V0Z4_PYRAB/45-335MIAA-------------------HMDQIGLM---VTN-------------------------------------------
Q97L72_CLOAB/48-335TISA-------------------HLDTLGAM---VKE-------------------------------------------
Q8NWU5_STAAW/45-333CITA-------------------HVDTLGAM---VKE-------------------------------------------
PEPA_LACLM/44-336MVAA-------------------HMDEVGFM---VSS-------------------------------------------
Q9UZ39_PYRAB/45-327VVIA-------------------HVDTLGAM---VKE-------------------------------------------
Q8X8A6_ECO57/43-333AVVG-------------------HMDEVGFM---VTH-------------------------------------------
AMPK_PYRFU/45-331MVAA-------------------HMDKIGLM---VNH-------------------------------------------
Q97NY6_STRPN/45-335LVAS-------------------HMDEVGFM---VSE-------------------------------------------
Q92D39_LISIN/51-339MLTA-------------------HVDTLGAM---VKE-------------------------------------------
Q9X0D9_THEMA/40-324LVSA-------------------HMDEVGFV---VSK-------------------------------------------
Q8ZX99_PYRAE/45-340MVAA-------------------HIDEIGLI---IDH-------------------------------------------
Q92B98_LISIN/46-337LVAA-------------------HMDEVGFM---VTQ-------------------------------------------
Q9UYH8_PYRAB/43-323LFMA-------------------HMDEIGLL---ITG-------------------------------------------
Q97MI3_CLOAB/43-327ALMA-------------------HGDEIFLM---ISG-------------------------------------------
Q8TYB9_METKA/48-341MVAA-------------------HMDEVGFI---VKS-------------------------------------------
O26537_METTH/45-335MLAA-------------------HMDEIGLM---VRH-------------------------------------------
O58468_PYRHO/45-327VVIA-------------------HVDTLGAM---VKE-------------------------------------------
Q9CIH3_LACLA/44-336MIAA-------------------HMDEVGFM---VSS-------------------------------------------
Q8RCI5_THETN/45-320MVAA-------------------HADEIGIM---VTH-------------------------------------------
TET_PYRHO/50-340MIAA-------------------HMDQIGLM---VTH-------------------------------------------
Q98PJ2_MYCPU/53-348MVAA-------------------HMDEVGYT---LRE-------------------------------------------
Q8RCI7_THETN/44-328MLAA-------------------HLDEIGLM---VKD-------------------------------------------
Q9YCC1_AERPE/44-332LAAA-------------------HMDELGFV---ITG-------------------------------------------
Q9V1Q0_PYRAB/45-331MVSA-------------------HMDKIGVM---VNH-------------------------------------------
FRVX_ECOLI/43-333AVVG-------------------HMDEVGFM---VTH-------------------------------------------
Q8K8V2_STRP3/45-336LVAA-------------------HMDEVGFM---VSD-------------------------------------------
O59485_PYRHO/53-339MVAA-------------------HMDKIGVM---VNH-------------------------------------------
SGCX_SALTI/46-346MIFA-------------------HMDEVGFM---VRK-------------------------------------------
Q99UB5_STAAM/45-333CITA-------------------HVDTLGAM---VKE-------------------------------------------
Q8PZ22_METMA/55-349MLAA-------------------HMDEIGLM---VRY-------------------------------------------
Q8TJD6_METAC/42-336MLAA-------------------HMDEIGLM---VRY-------------------------------------------
Q8Y6S2_LISMO/46-337LVAA-------------------HMDEVGFM---VTQ-------------------------------------------
Y555_METJA/44-338MIAA-------------------HMDEIGLM---VKY-------------------------------------------
Q9RXS7_DEIRA/71-359ALMG-------------------HLDEIGLI---VSH-------------------------------------------
O28479_ARCFU/2-292MVAA-------------------HMDEIGFA---VKY-------------------------------------------
Q9X0E0_THEMA/42-324ILDA-------------------HIDEIGVV---VTN-------------------------------------------
Q9HPS1_HALSA/46-335AFTG-------------------HADEIGFA---VAE-------------------------------------------
Q8Y7Q5_LISMO/45-340MIAG-------------------HLDEVGFM---VTQ-------------------------------------------
Q8ZX44_PYRAE/36-306AFVA-------------------HMDEVGLL---VTN-------------------------------------------
Q9HYE5_PSEAE/53-341AVSA-------------------HLDTIGAL---VRE-------------------------------------------
Q8Y8C6_LISMO/51-339MLTA-------------------HVDTLGAM---VKE-------------------------------------------
SGCX_ECOLI/46-346MIFA-------------------HMDEVGFM---VRK-------------------------------------------
Q8U3T6_PYRFU/43-324VFMA-------------------HMDEIGLL---ITG-------------------------------------------
Q99RH7_STAAM/45-340MISG-------------------HMDEVGFM---VTK-------------------------------------------

PF01546

DAPE_RALSO/70-380YGRG-------------------AADMKTSI---AGF-------------------------------------------
AMHX_BACSU/68-369HSCG-------------------HDSHMTMA---LGT-------------------------------------------
ILL9_ORYSJ/112-431HACG-------------------HDAHTAML---LGA-------------------------------------------
DAPE_ZYMMO/70-373VGRG-------------------AVDMKSSV---AAF-------------------------------------------
Q92S66_RHIME/76-388HACG-------------------HDGHTAML---LGA-------------------------------------------
YXEP_BACSU/69-374HACG-------------------HDFHTASI---IGT-------------------------------------------
DAPE_BORPE/64-374YGRG-------------------AADMKSSI---AAF-------------------------------------------
YHAA_BACSU/79-392HACG-------------------HDGHTAAL---LAV-------------------------------------------
Q9FVL5_CUCPE/95-434RGRG-------------------TTDCLGHV---ALL-------------------------------------------
Q880G9_PSESM/87-417.SAG-------------------RFDGVYGV---LAG-------------------------------------------
Q832Y9_ENTFA/78-393HACG-------------------HDGHAAAL---LGA-------------------------------------------
ILR1_ARATH/109-425HACG-------------------HDTHVAML---LGA-------------------------------------------
YJ75_SCHPO/124-397HGRG-------------------SCDAKSSV---AAQ-------------------------------------------
Q7WAL0_BORPA/80-413.AGG-------------------RFDGIIGV---LAG-------------------------------------------
Q8FLW7_COREF/70-397HGCG-------------------HDTHVATA---LAA-------------------------------------------
O29728_ARCFU/50-314YGTG-------------------VCDAKASV---AAI-------------------------------------------
DAPE_BRAJA/67-385HGRG-------------------AVDMKGGI---ACS-------------------------------------------
Q82HY6_STRAW/97-413HACG-------------------HDVHTTVV---LGA-------------------------------------------
Q7D266_AGRT5/85-459TGRG-------------------TADDKGQL---MTF-------------------------------------------
Q7W1K0_BORPA/81-415.DGG-------------------RYDGRLGI---LLP-------------------------------------------
Q974N2_SULTO/65-421FARG-------------------VGDDKGTL---MAR-------------------------------------------
Q9RSU7_DEIRA/81-449YARG-------------------STDDKGQA---FAH-------------------------------------------
Q7U3I0_SYNPX/107-432.TGG-------------------RFDGVLGV---LAG-------------------------------------------
LYSK_AERPE/68-345WGRG-------------------AVDAKGPL---AAM-------------------------------------------
Q8TV20_METKA/71-376YGRG-------------------AADCKGGL---AAA-------------------------------------------
Q17899_CAEEL/71-393FARG-------------------AQDTKCLG---VQH-------------------------------------------
Q7VS04_BORPE/67-381HGRG-------------------TADMKGFI---AAV-------------------------------------------
Q9VCQ9_DROME/76-397FARG-------------------TQDMKSVG---TQY-------------------------------------------
Q89IN7_BRAJA/140-435YGPG-------------------ICDMKGGN---YLS-------------------------------------------
Q984M3_RHILO/78-404.DAG-------------------IYDGCYGV---LAG-------------------------------------------
Q9HS25_HALSA/106-420HACG-------------------HDGHATIG---VGV-------------------------------------------
Q97VB6_SULSO/71-398.YGG-------------------KYDGFYGV---MAG-------------------------------------------
IAAH_ENTAG/112-429HACG-------------------HDGHTAIG---LGL-------------------------------------------
Y1497_METJA/61-343YGTG-------------------VIDAKGNV---VLM-------------------------------------------
Q89D44_BRAJA/88-452YGRG-------------------TADNKGQH---SIN-------------------------------------------
Q8EMA9_OCEIH/73-390HACG-------------------HDAHTAIL---LGA-------------------------------------------
ABGA_ECOLI/112-429HACG-------------------HDGHTAIG---LGL-------------------------------------------
Q82Z92_ENTFA/66-375YGRG-------------------ATDMKSGL---VAM-------------------------------------------
Q92U74_RHIME/82-410.NGG-------------------RFDGIAGV---LSG-------------------------------------------
Q98AF9_RHILO/84-453YARG-------------------ASDDKGST---AIA-------------------------------------------
Q7VTF2_BORPE/75-389YGRG-------------------SCDMKGFI---AAS-------------------------------------------
Q9KFW8_BACHD/72-371YGPG-------------------VIDMKGSL---VAC-------------------------------------------
ILL6_ARATH/146-457HACG-------------------HDAHVTML---LGA-------------------------------------------
DAPE_PSESM/69-380CGRG-------------------AADMKGSL---AAM-------------------------------------------
Q8Y9J0_LISMO/73-386HACG-------------------HDAHTAML---ITA-------------------------------------------
Q8ELE3_OCEIH/73-408.NGG-------------------GFDGVAGV---LTA-------------------------------------------
DAPE_NEIMB/64-374YGRG-------------------AADMKTSI---ACF-------------------------------------------
Q9AA70_CAUCR/101-467WGRG-------------------AIDDKGSL---VTI-------------------------------------------
Q8FRQ2_COREF/75-384HSCG-------------------HDIHTVIA---LAL-------------------------------------------
Q8XLK9_CLOPE/110-427HACG-------------------HDGHIAIG---LGV-------------------------------------------
Q9ZBI7_STRCO/86-442WGRG-------------------AVDMKNMD---AMI-------------------------------------------
DAPE_PASMU/63-373YGRG-------------------AADMKGSL---AAM-------------------------------------------
Q8XSI7_RALSO/130-504WGRG-------------------AWDDKGNL---IAQ-------------------------------------------
Q8CTS7_STAES/74-385HACG-------------------HDGHTAIL---LGV-------------------------------------------
Q8NLV7_CORGL/76-438WGRG-------------------SVDMLFIT---ATQ-------------------------------------------
LYSK_SULTO/63-340YGRG-------------------AVDAKGPL---IAM-------------------------------------------
ALLC_ECOLI/77-406.NGG-------------------NLDGQFGA---LAA-------------------------------------------
Q83EG0_COXBU/70-381HACG-------------------YDGHTAIL---LTI-------------------------------------------
Q8ESD5_OCEIH/87-390FAPG-------------------IGDDTRGL---AEV-------------------------------------------
DAPE_BUCAI/62-372FGRG-------------------SADMKGAL---AAM-------------------------------------------
ILL8_ORYSJ/116-436HACG-------------------HDAHVTML---LGA-------------------------------------------
Q9RV75_DEIRA/80-405.NAG-------------------RYDGIIGV---VFG-------------------------------------------
DAPE_RICPR/65-381YGRG-------------------TVDMKGAI---ACF-------------------------------------------
Q8D176_YERPE/85-415.NAG-------------------RYDGMLGV---LTA-------------------------------------------
Q89GU6_BRAJA/77-406.YAG-------------------WLDGPLGV---VYA-------------------------------------------
ARGE_MORAB/74-378YGLG-------------------TIDMKGFF---AFV-------------------------------------------
Q7NVG4_CHRVO/67-384YGRG-------------------SADMKGFI---ACV-------------------------------------------
Q7CRI5_AGRT5/79-410.AGG-------------------RFDGALGT---LCA-------------------------------------------
Q98GJ6_RHILO/84-458TGRG-------------------SADDKGQL---MTF-------------------------------------------
Q93RZ9_STRCO/83-441WGRG-------------------AIDMKDTV---AVM-------------------------------------------
DAPE_SHIFL/62-372FGRG-------------------AADMKGSL---AAM-------------------------------------------
Q9CI04_LACLA/65-368FGLG-------------------ASDMKGGD---VGN-------------------------------------------
Q9A7W4_CAUCR/98-396HGPG-------------------IADMKGGI---SVM-------------------------------------------
Q7N102_PHOLL/113-431HACG-------------------HDGHTAIG---LGL-------------------------------------------
DAPE_HAEIN/63-373YGRG-------------------AADMKGSL---AAM-------------------------------------------
Q9I056_PSEAE/107-408YGPG-------------------VADAKGGV---AMV-------------------------------------------
Q8AWF8_XENLA/112-483YGRG-------------------TSDDKGQV---LAL-------------------------------------------
Q9VCR2_DROME/76-397FARG-------------------SQDMKCVG---TQY-------------------------------------------
Q7WEA4_BORBR/77-416.RGG-------------------NYDGAAGV---VAG-------------------------------------------
LYSK_THET2/63-350FGRG-------------------AVDAKGPF---VAM-------------------------------------------
O58003_PYRHO/93-411YGRG-------------------SEDNGQAI---VSS-------------------------------------------
Q8FME3_COREF/102-468FGRG-------------------AADCKGNL---VMH-------------------------------------------
Q81AB5_BACCR/70-375HACG-------------------HDFHTAAI---LGT-------------------------------------------
Q8XL37_CLOPE/78-393HACG-------------------HDAHTTIL---LGA-------------------------------------------
Q882Q5_PSESM/82-379YGPG-------------------VADMKGGL---VLN-------------------------------------------
O49682_ARATH/58-397RGRG-------------------TTDCLGHV---ALV-------------------------------------------
LYSK_PYRAE/58-333WGRG-------------------AVDDKGPL---VAY-------------------------------------------
Q8TRI4_METAC/86-410HACG-------------------HDGHMAML---FGA-------------------------------------------
Q8DMU8_THEEB/75-387HACG-------------------HDVHTTVG---LGT-------------------------------------------
Q89MN6_BRAJA/99-418FGRG-------------------ACDMKSGT---IGA-------------------------------------------
ARGE_VIBCH/72-375YGLG-------------------TADMKGFF---AFI-------------------------------------------
DAPE_BUCBP/63-373FGRG-------------------SADMKGAL---AAM-------------------------------------------
Q7VWF6_BORPE/82-413.TGG-------------------KFDGCFGV---LAG-------------------------------------------
Q7UJ49_RHOBA/95-464FARG-------------------ATDDKGQV---LTH-------------------------------------------
Q8PUV0_METMA/80-404HACG-------------------HDGHMAML---FGA-------------------------------------------
Q17686_CAEEL/70-392FARG-------------------AQDMKCVG---VQY-------------------------------------------
Q7NHJ5_GLOVI/90-402HACG-------------------HDLHTAIG---LGT-------------------------------------------
C2H5Z6_ENTFL/79-386HACG-------------------HDFHMTIG---LGV-------------------------------------------
Q891H7_CLOTE/124-441HSCG-------------------HDGHISIG---LIL-------------------------------------------
Q92Y75_RHIME/65-371YGRG-------------------TTDMKGFL---AAV-------------------------------------------
Q870Z2_NEUCS/93-468CGRG-------------------ATDDKGPV---LGW-------------------------------------------
Q8A601_BACTN/82-450WARG-------------------ADDDKGQS---FIQ-------------------------------------------
P74654_SYNY3/97-412HACG-------------------HDGHTAIA---LGT-------------------------------------------
Q7P6B6_FUSNV/81-400HACG-------------------HDGHTAML---LGA-------------------------------------------
Q9A411_CAUCR/97-405MAPG-------------------IGDDTRAL---STL-------------------------------------------
Q8NYT5_STAAW/74-386HACG-------------------HDAHTAYM---LVL-------------------------------------------
Q93DA3_STRMU/86-455YGRG-------------------VDDDKGHI---TAR-------------------------------------------
Q9RRJ7_DEIRA/74-369YGPG-------------------TYDMKGGV---VGL-------------------------------------------
ILL4_ARATH/105-421HACG-------------------HDAHTTML---LGA-------------------------------------------
ARGE_DICDI/99-443YGRG-------------------TTDCLGHV---ALL-------------------------------------------
Q8XT42_RALSO/90-389YGPG-------------------VMDDKGGI---VAG-------------------------------------------
Q88JE5_PSEPK/77-391HACG-------------------HDGHTAIL---LAA-------------------------------------------
DUG1_SCHPO/93-468FGRG-------------------ATDDKGPL---IGW-------------------------------------------
Q8PDQ1_XANCP/86-416.AAG-------------------RYDGPLGV---LLG-------------------------------------------
HIPO_CAMJE/72-380HACG-------------------HDGHTTSL---LLA-------------------------------------------
O58453_PYRHO/75-385HACG-------------------HDAHTAML---LGA-------------------------------------------
DAPE_STAES/68-401FGRG-------------------TTDMKGGL---MAM-------------------------------------------
Q8XVG0_RALSO/71-391HACG-------------------HDGHTAML---LGA-------------------------------------------
Q831D3_ENTFA/57-417GGRG-------------------TSDQEGGI---VSA-------------------------------------------
Q7V9Q6_PROMA/75-386HACG-------------------HDIHICIG---IGL-------------------------------------------
DAPE_RHILO/70-392YGRG-------------------AVDMKGGI---ACF-------------------------------------------
Q882Q4_PSESM/90-456YGRG-------------------TADNKGQH---LIN-------------------------------------------
Q9A3G5_CAUCR/106-469YGRG-------------------TSDDKAQA---AIW-------------------------------------------
Q8A1V9_BACTN/69-352YGLG-------------------SNDAGASV---VSL-------------------------------------------
DAPE_WOLSU/62-362YGRG-------------------AQDMKSGV---AAM-------------------------------------------
Q8DRG0_STRR6/86-455YGRG-------------------VDDDKGHI---TAR-------------------------------------------
Q82IQ8_STRAW/88-458YARG-------------------AADDKGQV---FFH-------------------------------------------
Q97V97_SULSO/67-433YARG-------------------ASDNKGTL---MAR-------------------------------------------
Q7CSF2_AGRT5/83-392HACG-------------------HDGHTTVL---LAA-------------------------------------------
Q8RL92_PSESX/71-384HACG-------------------HDGHITML---LGA-------------------------------------------
Y1078_STAES/63-379HACG-------------------HDGHTTAL---MLF-------------------------------------------
Q92VC5_RHIME/72-385HACG-------------------HDGHTTML---LGA-------------------------------------------
Q884H3_PSESM/106-407YGPG-------------------VADAKGGV---AMI-------------------------------------------
Q97ZB7_SULSO/81-369YGRG-------------------TSDMKGSI---VSL-------------------------------------------
Q9CMA2_PASMU/70-369FGPG-------------------IADMKAGL---LAG-------------------------------------------
Q81IL2_BACCR/66-365HSCG-------------------HDAHMTIV---MG.-------------------------------------------
Q89J35_BRAJA/90-405YGRG-------------------TTDMKGFV---AVC-------------------------------------------
Q8CMV9_STAES/68-407YGRG-------------------AADMKSGL---AAL-------------------------------------------
DAPEL_LISMO/64-370HACG-------------------HDLHMSIA---LGV-------------------------------------------
Q7VXC4_BORPE/82-409.TGG-------------------KFDGCYGV---LAG-------------------------------------------
Q83F46_COXBU/98-471YGRG-------------------GADDGYAA---FAS-------------------------------------------
Q89WA3_BRAJA/87-383FGPG-------------------IYDMKGGA---YIA-------------------------------------------
Q893C9_CLOTE/76-402.QGG-------------------NYDGILGV---LTA-------------------------------------------
YODQ_BACSU/99-418YGRG-------------------STDMKGGN---TAL-------------------------------------------
Q88AX7_PSESM/67-382YGRG-------------------TCDMKGFI---ALA-------------------------------------------
Q7VV76_BORPE/73-393HACG-------------------HDGHTAML---LAA-------------------------------------------
CNDP1_MOUSE/103-477YGRG-------------------ATDNKGPV---LAW-------------------------------------------
YTNL_BACSU/99-404HACG-------------------HDFHTAAL---LGA-------------------------------------------
Q98L43_RHILO/88-418YGRG-------------------ACDMKGGL---AAS-------------------------------------------
Q8ERY9_OCEIH/74-385HACG-------------------HDGHTATL---LVL-------------------------------------------
Q9F464_ARTAU/78-409.NGG-------------------MFDGTAGV---VCA-------------------------------------------
Q970S3_SULTO/66-380YGRG-------------------STDMKGGL---AVF-------------------------------------------
Q8RNM5_LEGPN/102-463YGRG-------------------TLDDKAQA---AIW-------------------------------------------
Q984M2_RHILO/65-375HACG-------------------HDGHTAML---LGA-------------------------------------------
Q981W6_RHILO/74-384HACG-------------------HDGHTSML---LGA-------------------------------------------
DAPE_AGRT5/69-390YGRG-------------------AVDMKGGI---ACF-------------------------------------------
Q9MB49_CITLA/95-434RGRG-------------------TTDCLGHV---ALL-------------------------------------------
Q8EY68_LEPIN/112-477YGRG-------------------AVDMKGLG---IME-------------------------------------------
Q9PEM8_XYLFA/67-363IGLG-------------------VCDIKGAA---AAL-------------------------------------------
Q87PY5_VIBPA/125-505WGRG-------------------VLDDKNQI---HAI-------------------------------------------
P20D1_MOUSE/121-489YGRG-------------------ALDNKNSV---MAI-------------------------------------------
ALLC_BACSU/80-409.NGG-------------------KYDGAYGV---LAA-------------------------------------------
DAPE_SHEON/71-381YGRG-------------------AADMKGSL---AAM-------------------------------------------
ARGE_PASMU/75-378YGLG-------------------TADMKGFF---AFV-------------------------------------------
HYUC_PSESN/79-412.NGG-------------------KFDGVIGV---LAG-------------------------------------------
Q891H8_CLOTE/88-404HACG-------------------HDVHTSIL---LGA-------------------------------------------
Q7UZP5_PROMP/74-383HACG-------------------HDLHTCIG---LGV-------------------------------------------
Q7W8K8_BORPA/72-383HACG-------------------HDGHTTML---LGA-------------------------------------------
Q7NWU5_CHRVO/81-393HACG-------------------HDGHCAML---LGA-------------------------------------------
DAPE_BUCAP/62-372FGRG-------------------SSDMKGAL---ASM-------------------------------------------
Q8T490_DROME/78-398YARG-------------------AQDMKSVG---CQY-------------------------------------------
DAPE_BLOFL/67-381YGRG-------------------SSDMKGAL---AAM-------------------------------------------
Q8G2N9_BRUSU/82-409.TGG-------------------KFDGVLGV---LGG-------------------------------------------
DAPE_HELPY/75-379YGRG-------------------AQDMKGGV---GAF-------------------------------------------
Q8F2U4_LEPIN/71-388HACG-------------------HDAHTSIL---MGL-------------------------------------------
Q98FX1_RHILO/74-383HACG-------------------HDGHTAML---LGA-------------------------------------------
Q89IN2_BRAJA/73-382HGCG-------------------HDGHTTML---LGT-------------------------------------------
Q8TZ13_METKA/63-348YGRG-------------------ACDAKANL---AVY-------------------------------------------
DAPE_CORGL/73-369YGCG-------------------TVDMKSGL---AVY-------------------------------------------
Q7QJQ9_ANOGA/101-476FGRG-------------------SSDDKGPV---LGW-------------------------------------------
DAPE_COXBU/62-372YGRG-------------------AADMKSGL---AAM-------------------------------------------
Q7UHC4_RHOBA/118-448.CAG-------------------ALDGTLGV---VAG-------------------------------------------
DAPE_XYLFA/62-372YGRG-------------------AADMKGSV---AAF-------------------------------------------
Q8NXY4_STAAW/73-384HACG-------------------HDGHTAIL---LTV-------------------------------------------
Q17898_CAEEL/71-393FARG-------------------AQDMKCVG---VQQ-------------------------------------------
Q9VCQ8_DROME/76-397FARG-------------------AQDMKSVG---TQY-------------------------------------------
Q89RR4_BRAJA/35-345HACG-------------------HDGHTASL---LGA-------------------------------------------
Q880D7_PSESM/109-408YGPG-------------------VMDDKGGI---VAA-------------------------------------------
DAPEL_STRMU/66-373HACG-------------------HDMHMTIA---LGL-------------------------------------------
Q986X8_RHILO/100-420HGRG-------------------AGDMKAGL---SAC-------------------------------------------
DAPEL_BACSU/65-371HACG-------------------HDLHMTIA---LGI-------------------------------------------
ARGE_BUCAP/75-378YGLG-------------------TVDMKGFF---AFI-------------------------------------------
DAPE_STAAW/68-402YGRG-------------------TTDMKGGL---MAL-------------------------------------------
Q83GM1_TROWT/81-442YGRG-------------------AADDKVAI---AMH-------------------------------------------
Q8DY53_STRA5/86-456YGRG-------------------VDDDKGHI---TAR-------------------------------------------
Q8DWD2_STRMU/65-371HACG-------------------HDFHQTSL---LGA-------------------------------------------
ARGE_BUCAI/75-378YGLG-------------------AVDMKGFF---ALI-------------------------------------------
Q8G5E2_BIFLO/92-452YGRG-------------------SADDGGGI---AIH-------------------------------------------
Q8EKY8_OCEIH/76-404.NGG-------------------SYDGPAGV---VAG-------------------------------------------
Q7VU38_BORPE/77-375YGPG-------------------SYDMKAGI---YLA-------------------------------------------
Q9KET8_BACHD/83-411.HGG-------------------RFDGTLGV---LGA-------------------------------------------
Q7NNN7_GLOVI/86-399HACG-------------------HDGHVAIA---LGT-------------------------------------------
YGEY_ECOLI/77-398GGRG-------------------TSDQEGGM---ASM-------------------------------------------
Q9K657_BACHD/82-451FARG-------------------ATDDKGQT---FMH-------------------------------------------
Q9YEE4_AERPE/91-410YGRG-------------------AIDMKGGI---AAA-------------------------------------------
ILL3_ORYSJ/85-406HACG-------------------HDVHVAML---LGA-------------------------------------------
ILL1_ARATH/107-420HACG-------------------HDGHVAML---LGA-------------------------------------------
Q8CRD2_STAES/63-369HACG-------------------HDIHMASI---LAT-------------------------------------------
Q7VUP2_BORPE/77-391HGCG-------------------HDGHTAVL---IGA-------------------------------------------
Q7MWN9_PORGI/81-449WARG-------------------ADDDKGQG---MIQ-------------------------------------------
Q9VCR0_DROME/75-396FARG-------------------TQDMKSVG---TGY-------------------------------------------
LYSK_DEIRA/65-358HGRG-------------------SVDAKGSL---CTF-------------------------------------------
Q88AR3_PSESM/72-376VGLG-------------------SCDMKGFF---ALV-------------------------------------------
Q8DYF9_STRA5/84-398HACG-------------------HDAHTAYL---LIL-------------------------------------------
Q8ELE6_OCEIH/107-424HACG-------------------HDSHTAMG---LGL-------------------------------------------
Q9CP93_PASMU/75-406.NAG-------------------KLDGPLGS---VAG-------------------------------------------
Q979Q6_THEVO/81-397YGRG-------------------TEDDGQAV---FTA-------------------------------------------
Q98IQ8_RHILO/70-379HMCG-------------------HDGHTAIL---AAL-------------------------------------------
Q8ENA3_OCEIH/73-389HACG-------------------HDAHTAML---LGA-------------------------------------------
CBPX2_SULSO/77-389HACG-------------------HDTHVAML---LGG-------------------------------------------
Q8FQF3_COREF/51-354YGCG-------------------TVDMKSGL---AVY-------------------------------------------
Q8FMB2_COREF/72-389HACG-------------------HDFHITTL---LSA-------------------------------------------
Q88Q81_PSEPK/91-418.TGG-------------------KFDGCYGV---MAG-------------------------------------------
Q89QV3_BRAJA/77-385HACG-------------------HDGHTAML---LGA-------------------------------------------
Q9RSV5_DEIRA/73-444YGRG-------------------ASDDKGEL---ASR-------------------------------------------
Q7V908_PROMM/75-385HACG-------------------HDLHTCIG---LGV-------------------------------------------
Y1286_STAAW/63-379HACG-------------------HDGHTTAL---MLF-------------------------------------------
O58880_PYRHO/64-349YGTG-------------------ASDIKGGI---ASI-------------------------------------------
Q7P4W2_FUSNV/78-489.YLR-------------------ANKTTLGA---DNG-------------------------------------------
Q8RFU4_FUSNN/74-389HACG-------------------HDGHTAGL---LGA-------------------------------------------
Q9I7K3_DROME/76-397FARG-------------------TQDMKSVG---MQH-------------------------------------------
DAPE_CAUCR/71-380YGRG-------------------AVDMKSAI---AAF-------------------------------------------
Q8G331_BRUSU/87-465TGRG-------------------TSDDKGQL---MTF-------------------------------------------
DAPE_NITEU/63-373YGRG-------------------AADMKTSL---AAF-------------------------------------------
Y100_SYNY3/73-386HACG-------------------HDIHTTLG---LGT-------------------------------------------
Q8R5U3_THETN/61-363YGRG-------------------TSDVLGGV---AIL-------------------------------------------
Q987H6_RHILO/65-371YGRG-------------------TTDMKGFL---AAV-------------------------------------------
Q8VUL6_9PSED/86-408.SGG-------------------RFDGILGV---LAG-------------------------------------------
DAPE_VIBCH/64-374HGRG-------------------AADMKGSL---ACM-------------------------------------------
Q8CUJ6_OCEIH/84-452FARG-------------------SSDDKGQV---FMH-------------------------------------------
LYSK_PYRAB/63-322WGRG-------------------SVDAKGPL---SAL-------------------------------------------
Q97AQ8_THEVO/83-399HACG-------------------HDSHVAML---IGA-------------------------------------------
ARGE_ECOLI/76-379YGLG-------------------TADMKGFF---AFI-------------------------------------------
Q8Y3L8_LISMO/75-390HACG-------------------HDGHTAYL---LVL-------------------------------------------
ILL1_ORYSJ/106-423HGCG-------------------HDAHVAML---LGS-------------------------------------------
DAPEL_OCEIH/64-370HACG-------------------HDLHMTIA---LGA-------------------------------------------
Q7USI1_RHOBA/111-424HACG-------------------HDAHAAMA---YGA-------------------------------------------
Q7VSS1_BORPE/72-394HGCG-------------------HDGHTAML---LGA-------------------------------------------
DAPEL_BACCR/65-371HACG-------------------HDVHTTIG---LGL-------------------------------------------
Q7S4G6_NEUCR/139-448SGRG-------------------SVDAKASV---AAQ-------------------------------------------
DAPE_HELHP/72-381YGRG-------------------TQDMKGGI---SAF-------------------------------------------
Q9AK43_STRCO/90-406HACG-------------------HDVHTTVV---LGT-------------------------------------------
Q82IK8_STRAW/68-359WGCG-------------------TCDMKSGV---AVQ-------------------------------------------
Q8DG76_THEEB/92-406HACG-------------------HDGHTAIA---LGT-------------------------------------------
Q839D6_ENTFA/58-371HACG-------------------HDSHTAML---VTV-------------------------------------------
Q82ZQ2_ENTFA/75-403.NGG-------------------TLDGQYGV---IAS-------------------------------------------
Y588_HAEIN/75-406.NAG-------------------KFDGPLGS---VAG-------------------------------------------
ILL5_ORYSJ/93-409HACG-------------------HDVHTAML---LGA-------------------------------------------
Q9LPE9_ARATH/93-426YARG-------------------AQDDKCIG---VQY-------------------------------------------
Q7U9W5_SYNPX/74-384HACG-------------------HDLHTCIG---LGV-------------------------------------------
O58754_PYRHO/73-383HACG-------------------HDAHTAML---LGA-------------------------------------------
Q9A561_CAUCR/80-410.NGG-------------------RYDGPLGI---MLG-------------------------------------------
A9CGN8_AGRT5/61-370HSCG-------------------HDGHTAML---LGA-------------------------------------------
Q8XYW5_RALSO/75-389YGRG-------------------TCDMKGFI---AAS-------------------------------------------
Q89R53_BRAJA/83-410.TGG-------------------KYDGILGT---LGA-------------------------------------------
Q8FB92_ECOL6/71-385HACG-------------------HDGHTTIL---LGA-------------------------------------------
DAPE_CHRVO/62-372YGRG-------------------AADMKASL---AAF-------------------------------------------
Q89H48_BRAJA/89-419.DAG-------------------KWDGPLGV---ITA-------------------------------------------
Q7NW88_CHRVO/76-389HACG-------------------HDGHTAIL---LAA-------------------------------------------
Q93H22_STRAW/84-440WGRG-------------------AVDMKDMD---AMT-------------------------------------------
Q81G37_BACCR/72-385HACG-------------------HDAHAAIL---LST-------------------------------------------
O53227_MYCTU/102-459YGRG-------------------TADDKAGI---ATH-------------------------------------------
Q8ENA4_OCEIH/109-426HACG-------------------HDGHITIG---LGV-------------------------------------------
Q7CSZ0_AGRT5/74-383HACG-------------------HDGHTAML---LGA-------------------------------------------
ILL7_ORYSJ/127-444HACG-------------------HDAHTTML---LGA-------------------------------------------
Q8RTT1_9PROT/116-483YGRG-------------------TLDDKQGV---LSL-------------------------------------------
Q98K54_RHILO/83-410.TGG-------------------KYDGVLGV---LGG-------------------------------------------
ARGE_PHOLL/76-379YGLG-------------------TADMKGFF---AFI-------------------------------------------
DAPE_WIGBR/60-371YGRG-------------------SADMKGAL---AAM-------------------------------------------
Q81HT0_BACCR/72-385HACG-------------------HDGHIAIL---LGV-------------------------------------------
DAPE_BRUSU/70-392YGRG-------------------AVDMKGGI---ACF-------------------------------------------
Q7X340_9BACT/107-429RGPG-------------------VIDMKGGN---VVI-------------------------------------------
Q9AD91_STRCO/88-444WGRG-------------------AVDMKDMD---AMT-------------------------------------------
Q8FY52_BRUSU/74-383HSCG-------------------HDGHTAML---LGA-------------------------------------------
Q82HL3_STRAW/71-409.DGG-------------------AFDGPLGV---VSS-------------------------------------------
Q9A2D4_CAUCR/74-388YGRG-------------------TCDMKGFL---ALA-------------------------------------------
A9CF54_AGRT5/65-371YGRG-------------------TTDMKGFL---ATV-------------------------------------------
Q9K425_STRCO/86-447YGRG-------------------AADCKGGV---LMH-------------------------------------------
LYSK_SULSO/64-341YGRG-------------------AVDAKGPL---ISM-------------------------------------------
ARGE_MYXXA/75-375YARG-------------------ACDTKGFI---ACA-------------------------------------------
Q8NV66_STAAW/63-369HACG-------------------HDIHMASI---LAT-------------------------------------------
Q89Q07_BRAJA/80-408.TGG-------------------KFDGAAGV---MAA-------------------------------------------
ACY1_PIG/76-396YGRG-------------------AQDMKCVS---IQY-------------------------------------------
Q7ZVV2_DANRE/88-409YARG-------------------AQDMKSVT---IQY-------------------------------------------
Q7W8K0_BORPA/79-416.AGG-------------------NFDGAAGV---VAG-------------------------------------------
Q8U375_PYRFU/127-437HACG-------------------HDAHTAML---LGA-------------------------------------------
Q88FQ3_PSEPK/88-415.TGG-------------------KFDGCFGV---MAG-------------------------------------------
Q8GGD4_CORST/76-395HACG-------------------HDLHTTAL---LGA-------------------------------------------
Q97KA5_CLOAB/71-388HACG-------------------HDAHTTIL---MGA-------------------------------------------
Q89NT5_BRAJA/145-448YGLG-------------------IADDKQGV---ALI-------------------------------------------
Q8XUU2_RALSO/122-426YGLG-------------------IADDKNGV---AVI-------------------------------------------
Q96W94_LACKL/110-445.EAG-------------------KYDGILGV---LAG-------------------------------------------
Q8P4C4_XANCP/97-429HACG-------------------HDAHTAIL---LGV-------------------------------------------
Q8ZVD7_PYRAE/78-394YGRG-------------------AVDMKGGL---TSI-------------------------------------------
Q8G5Q0_BIFLO/70-377HGCG-------------------HDLHMTGL---LGA-------------------------------------------
Q81DV3_BACCR/97-416YGRG-------------------TTDMKGGN---VAL-------------------------------------------
Q8KDJ8_CHLTE/87-402HACG-------------------HDMHTAML---LGA-------------------------------------------
Q8Y9J1_LISMO/76-406.NGG-------------------AFDGPAGV---ITG-------------------------------------------
Q8XUB8_RALSO/98-420FGRG-------------------VAVSKSDF---ATY-------------------------------------------
Q9HW57_PSEAE/76-386HACG-------------------HDGHTAML---LGA-------------------------------------------
Q9HZS5_PSEAE/74-386HACG-------------------HDGHTAML---LAA-------------------------------------------
Q9HTY4_PSEAE/72-376YGLG-------------------SCDMKGFF---PLA-------------------------------------------
Q8RC51_THETN/70-383HACG-------------------HDVHTAIL---LGT-------------------------------------------
CBPS_YEAST/164-571WGRG-------------------SNDCKNLL---IAE-------------------------------------------
Q8PQM2_XANAC/86-416.DAG-------------------RYDGPLGI---LLG-------------------------------------------
ABGA_HAEIN/104-420HACG-------------------HDSHITIG---LGV-------------------------------------------
A9CL51_AGRT5/72-381FGRG-------------------ACDCKGPL---IAM-------------------------------------------
O29358_ARCFU/84-400YGRG-------------------SEDNGQSL---VSS-------------------------------------------
O18000_CAEEL/95-469FGRG-------------------SSDDKGPV---LCW-------------------------------------------
Q89QR0_BRAJA/85-459VARG-------------------AEDDKGQV---MTF-------------------------------------------
Q8D5L5_VIBVU/73-371YGPG-------------------VSDMKSGL---LNI-------------------------------------------
Q8CMY3_STAES/74-388HACG-------------------HDAHTAYM---LIL-------------------------------------------
Q84FR8_9MICC/81-412.RGG-------------------RFDGIVGV---LGA-------------------------------------------
LYSK_PYRHO/62-321WGRG-------------------SVDAKGPL---ATL-------------------------------------------
Q9KE02_BACHD/99-417YGRG-------------------IQDMKSGL---AAM-------------------------------------------
Q885F3_PSESM/68-380HACG-------------------HDGHTAIL---LAT-------------------------------------------
YE48_SCHPO/193-589YSRG-------------------AADDKNSV---VAI-------------------------------------------
Q8Y3L6_LISMO/79-393HACG-------------------HDGHTAYM---LIL-------------------------------------------
Q9Z6S9_CHLPN/119-487YARG-------------------ASDNKGQC---FYT-------------------------------------------
Q92MD6_RHIME/74-383HACG-------------------HDGHTAML---LGA-------------------------------------------
Q92MZ4_RHIME/83-410.TGG-------------------KFDGVLGV---LSG-------------------------------------------
DAPE_PHOLL/62-372YGRG-------------------AADMKGSL---AAM-------------------------------------------
O30185_ARCFU/62-368YGRG-------------------SCDAKGCV---AAI-------------------------------------------
Y4TI_RHISN/82-394HACG-------------------HDLHASIA---MGV-------------------------------------------
Q7UM22_RHOBA/107-416YGRG-------------------ACDMKGSL---AAM-------------------------------------------
Q7W1K2_BORPA/73-390HACG-------------------HDGHTAML---LGA-------------------------------------------
Q89ER6_BRAJA/82-381YGPG-------------------VADMKSGV---VMN-------------------------------------------
Q9FBL9_STRCO/68-359WGCG-------------------TCDMKAGV---AVQ-------------------------------------------
Q18621_CAEEL/72-345YGNG-------------------SNDAKGQL---AAM-------------------------------------------
Q8VXY9_ARATH/134-472.YSG-------------------KYDGVVGV---LGA-------------------------------------------
Q985I5_RHILO/80-409.TGG-------------------RFDGALGT---LSA-------------------------------------------
Q7CX68_AGRT5/76-403.TGG-------------------KFDGVLGV---LAG-------------------------------------------
Q972L9_SULTO/72-422YGRG-------------------ASDNKGVL---IAR-------------------------------------------
Q88CJ5_PSEPK/72-376VGLG-------------------SCDMKGFF---ALV-------------------------------------------
Q89IE8_BRAJA/75-385HACG-------------------HDGHTAML---LGA-------------------------------------------
Q8P8J5_XANCP/68-364IGLG-------------------VCDIKGAA---AAL-------------------------------------------
Q7QEF5_ANOGA/84-405YARG-------------------AQDMKCVG---MQF-------------------------------------------
Q96XG6_SULTO/80-366FGRG-------------------TSDMKGAI---VSL-------------------------------------------
Q9HTH4_PSEAE/66-380YGRG-------------------TADMKGYL---ACV-------------------------------------------
Q97Y12_SULSO/89-404YGRG-------------------ASDMKSGI---VAQ-------------------------------------------
DAPE_HAEDU/63-373HGRG-------------------AADMKGSL---AAL-------------------------------------------
Q896S2_CLOTE/77-402.NGG-------------------RYDGVAGV---IAG-------------------------------------------
Q8YV79_NOSS1/124-437HACG-------------------HDIHTTVG---LGA-------------------------------------------
Q92TU1_RHIME/91-555PGRG-------------------LLDMKSGL---AVA-------------------------------------------
CBPG_PSES6/108-410YGPG-------------------IADDKGGN---AVI-------------------------------------------
Q88GZ4_PSEPK/73-387YGRG-------------------TADMKGFI---ASV-------------------------------------------
A9CF81_AGRT5/85-394HGCG-------------------HDVHTTIL---LGT-------------------------------------------
Q9A5J1_CAUCR/78-407HACG-------------------HDTHVAML---LGA-------------------------------------------
Q822A3_CHLCV/82-450IARG-------------------ASDNKGQC---FYT-------------------------------------------
Q44415_RHIRD/55-364HLCG-------------------HDGHSTIL---TAL-------------------------------------------
Q98LM4_RHILO/87-417.PGG-------------------RYDGALGA---IAA-------------------------------------------
Q9WXY3_THEMA/60-350KGPG-------------------VCDMKGGV---VIL-------------------------------------------
Q88A71_PSESM/106-428KGPG-------------------VIDDKGGV---VTM-------------------------------------------
Q7WAX1_BORPA/107-486YGRG-------------------GADDGYAI---YAS-------------------------------------------
DAPEL_STRR6/65-372HACG-------------------HDFHMTIA---LGC-------------------------------------------
DAPEL_LACPL/70-372HACG-------------------HDIHMSVA---LGI-------------------------------------------

PF00883

AMPL_BOVIN/196-509FIRP-------------------KSWIEEQE---MGS-------------------------------------------
AMPL1_ARATH/202-512NILN-------------------EEQCKELK---MGS-------------------------------------------
AMPL_CAEEL/170-478TVIR-------------------GEELLKAG---FGG-------------------------------------------
AMPA_RICPR/182-494DVIG-------------------EHDIKNLG---MGA-------------------------------------------
AMPA_MYCLE/200-515EVLD-------------------DKALQKAG---YGG-------------------------------------------
AMPA_MYCPN/134-437TVLK-------------------QADLIKKK---MGL-------------------------------------------
AMPL2_SOLLC/253-561NILD-------------------VEQCKELK---MGS-------------------------------------------
AMPA_HELPY/174-487HVHD-------------------EKFLEEKK---MNA-------------------------------------------
AMPL1_SOLLC/255-566NILD-------------------AEQCKELK---MGA-------------------------------------------
AMPA_ECOLI/184-491RVIG-------------------EQQMKELG---MHS-------------------------------------------
AMPA_BACSU/178-487EILE-------------------KSEMEELG---MGG-------------------------------------------
PEPB_ECOLI/110-423RITK-------------------GEDLREQG---YMG-------------------------------------------
AMPA_SYNY3/177-485EVLG-------------------QTECEALG---MGA-------------------------------------------
AMPA_MYCGE/135-439KVLK-------------------QSDLIKKK---MGL-------------------------------------------
AMPA_MYCSA/148-453KVLE-------------------RKQIELLG---MDL-------------------------------------------
AMPA_HAEIN/178-484KVVD-------------------EEEMAKLG---MNA-------------------------------------------
YA55_SCHPO/194-508FVHD-------------------EKWIDEQK---MNG-------------------------------------------

PF05450

NICA_MOUSE/273-498---LAAAEAL....H---------------------------------------------------KA--.PDVTTLSR-
Q7PY38_ANOGA/276-510---VAVAHFL....S---------------------------------------------------QA--LP..SND.R-
Q6Z743_ORYSJ/248-457---LTAVDAL....S---------------------------------------------------HL--.HDISNLKK-
NICA_CAEEL/278-508---LAAARSMGTQIE---------------------------------------------------KW--QKASNTSNR-
NICA_ARATH/251-460---LGAVDAL....S---------------------------------------------------RV--.DGISNLKK-
Q7KS07_DROME/236-469---THVAYLL....K---------------------------------------------------QL--LPPQSKDLH-

PF04389

Q7PQQ4_ANOGA/170-341---LEVLRVLS...R---------------------------------------------------.Q--SDVN...RY.
M28P1_NEUCR/178-345---LQVLKYFT...A---------------------------------------------------.P--GHQP...QR.
M28P1_YEAST/149-315---LANLKYHI...K---------------------------------------------------..--.HRP...NR.
Q7Q1Q7_ANOGA/130-334---ITMASLLA..P.---------------------------------------------------HL--ESIK...ART
Q7RW54_NEUCR/186-361---LEALRVLA..N.---------------------------------------------------.A--KFAP...KD.
QPCTL_MOUSE/162-367---LELVQALD..A.---------------------------------------------------.M--LSRI...KQQ
Q7QJV5_ANOGA/159-330---LEVMRQLA...Q---------------------------------------------------.G--KRSY...EH.
Q9YDB0_AERPE/212-375---VETAGRLR...G---------------------------------------------------.R--GLAA......
Q7PX80_ANOGA/293-461---WKALTYLK...A---------------------------------------------------.M--GLRP...RR.
Q9KLD3_VIBCH/193-374---SEIIRVLR...D---------------------------------------------------.N--NFRP...KR.
Q898V9_CLOTE/225-396---IEFSKYLK...S---------------------------------------------------IG--VPKN......
Q82DU6_STRAW/116-300---LETALAVA...R---------------------------------------------------.T--NYQP...TK.
Q8SX46_DROME/72-243---LETLRVIS...R---------------------------------------------------.S--ERRL...TH.
Q7RZ44_NEUCR/250-445---LTVAKALA...K---------------------------------------------------..--.FQV...KN.
Q9A578_CAUCR/260-453---IEQAAALK...A---------------------------------------------------..--GAPP...KR.
Q87AH5_XYLFT/290-488---LELARGFA...R---------------------------------------------------..--GPQP...QR.
Q9SXH2_IPOBA/146-316---LELARGLS...K---------------------------------------------------.Q--ASGF...KN.
Q9HRR8_HALSA/220-384---VELARILA...A---------------------------------------------------.R--ESAL...DT.
AMPX_VIBPR/196-377---TEVIRVLS...E---------------------------------------------------.N--NFQP...KR.
Q8TL26_METAC/121-299---LEIARVLA...E---------------------------------------------------..--.HPA...KQ.
APE3_YEAST/307-487---LNVAKQLT...H---------------------------------------------------..--.FKI...NN.
Q7X7Q3_ORYSJ/128-297---LELARGVA...Q---------------------------------------------------.W--AHGF...KS.
QPCT_BOTJA/137-351---LELARSLD...R---------------------------------------------------PL--SFLK...QSS
YC52_SCHPO/154-322---LEAIRIFI...S---------------------------------------------------.R--PVPL...TH.
Q7UQS9_RHOBA/733-948---LEIAQYLV...D---------------------------------------------------QR--NSGRLKMKR.
Q8CK35_STRCO/710-894---LETALTLA...E---------------------------------------------------.Q--NPTM...DN.
YFI8_YEAST/119-344---LYTAQFLT...H---------------------------------------------------IA--CHERT.KEYN
Q9VRQ9_DROME/107-312---LNTAKTLG...A---------------------------------------------------YL--QKEF...RNR
Q9FBN5_STRCO/130-314---LENALTLA...R---------------------------------------------------.Q--NPTM...QG.
Q7MAY9_PHOLL/149-318---LQLMRDLA...E---------------------------------------------------..--RTDI...KN.
Q8MT48_DROME/150-321---LEVLRVIT...K---------------------------------------------------.Y--ETPL...TY.
Q9F3Y1_PSEAI/119-319---TEIARNLG...G---------------------------------------------------..--...IA.LEN.
Q86PD7_DROME/130-333---LNLAQVLQ...E---------------------------------------------------QL--KPLKK.SKL.
O64804_ARATH/146-318---LELARLVV...D---------------------------------------------------.S--GWVP...PQ.
Q82VZ8_NITEU/829-1008---LELARQIA...T---------------------------------------------------..--RWQP...QR.
O82996_AERPU/193-374---TEVLRVIA...E---------------------------------------------------.Q--GRQP...ER.
Q9A369_CAUCR/119-286---LEIARALK...A---------------------------------------------------.S--GPHA....R.
Q9HZQ8_PSEAE/289-482---LEMAVLLA...K---------------------------------------------------.A--LPVN......
Q8PPS0_XANAC/311-509---LELARGFA...K---------------------------------------------------..--GPTP...ER.
Q8GGR6_STRAZ/146-311---LEVARALK...T---------------------------------------------------..--GPAP...RN.
Q9A3U5_CAUCR/192-390---LEMGRLAA...S---------------------------------------------------..--GPKP...DR.
Q7UGZ5_RHOBA/480-666---LAVAERVV...S---------------------------------------------------.E--LTDAS.EHR.
Q7MT37_PORGI/117-314---LEIARYLG...Q---------------------------------------------------QK--DLGM......
IAP_ECOLI/110-321---LELAERLK...N---------------------------------------------------.T--PTEY......
Q8EF07_SHEON/278-467---LALARYFT...K---------------------------------------------------.Q--AQTAP.LER.
Q8PEF6_XANCP/333-532---LEIADAFA...H---------------------------------------------------.Q--DPKP...AR.
Q7S0R5_NEUCR/126-350---MHVARTVE...G---------------------------------------------------YL--KKVY...EEG
Q9A4J1_CAUCR/335-529---LEVARGFK...N---------------------------------------------------.S--KVRP...KR.
Q8EDI3_SHEON/278-480---LEIARQLADNAT---------------------------------------------------.Q--GHGL...AR.
APX_STRGR/78-262---LETALAVS...R---------------------------------------------------.A--GYQP...DK.
Q53737_STRAD/260-459---LESALAAA...K---------------------------------------------------.D--HGTRA.EDN.
Q9VTH7_DROME/129-318---LNMATILK...H---------------------------------------------------.Q--FHRS...QV.
M28P1_SCHPO/140-307---MAIARYYA...K---------------------------------------------------..--.NQP...NR.
YP67_CAEEL/167-338---MDVLEVLA...H---------------------------------------------------.S--KTEL...EN.
Q9HNP7_HALSA/224-389---VAAARVLA...A---------------------------------------------------.M--ESVL...ET.
Q8A4P9_BACTN/117-317---LEIARLVN...Q---------------------------------------------------.Q--QPEL......
Q7ND13_GLOVI/309-501---IDVAAGMR...A---------------------------------------------------.Q--NLKL...KR.
Q7UHT1_RHOBA/176-373---MELSHQFP...T---------------------------------------------------.L--PSDI......
Q8A5P9_BACTN/139-321---LQIARAFL...A---------------------------------------------------.S--GQQP...ER.
Q97F97_CLOAB/227-398---LEMSKFLK...S---------------------------------------------------.L--GT.P...DR.
Q7U215_MYCBO/264-463---LETAVQLG...N---------------------------------------------------..--SPHV...SN.
Q8XIF2_CLOPE/231-402---LELSSFLA...S---------------------------------------------------.L--.PQP...SR.
O67732_AQUAE/190-352---LVMSRELA...G---------------------------------------------------FQ--EIPF......
Q8P3Z6_XANCP/298-496---LELARVFA...A---------------------------------------------------..--GPRP...QR.
Q93EJ5_BACLI/248-421---LELARIMK...T---------------------------------------------------.V--PADK......

PF09940

Q7CVW7_AGRT5/56-440---TCLAAGLK---S---------------------------------------------------RS--TY.Y------
A0KQQ6_AERHH/58-441---VFLMAWLA---S---------------------------------------------------LP--KRRY------
A1AY62_PARDP/36-438---LRLYEHIK---A---------------------------------------------------MP--HRNY------
Q72C97_DESVH/55-438---AALARLLR---S---------------------------------------------------RE--NR.L------
A5EAW0_BRASB/54-437---TALALSQQ---A---------------------------------------------------RR--RQ.L------
A9A1R6_NITMS/33-410---VDIGKNLL---E---------------------------------------------------KN--NLKY------
Q1YPT3_9GAMM/45-430---TALAKWLM---G---------------------------------------------------QM--NRKY------
Q74B36_GEOSL/49-431---TMLARWIM---S---------------------------------------------------RP--RR.F------
Q9RJJ2_STRCO/40-423---TFLARELA---E---------------------------------------------------RN--PY.Y------
A8L141_FRASN/59-442---AELASALA---A---------------------------------------------------RE--RR.F------
A7H288_CAMJD/53-435---IFLAKWLL---S---------------------------------------------------LK--ERRY------
A4YXC9_BRASO/50-433---TALAMRQM---R---------------------------------------------------RT--SR.L------
Q97H19_CLOAB/50-432---TFIAKALS---K---------------------------------------------------LK--TK.Y------
Q4HS24_CAMUP/11-393---IFLAKWLH---T---------------------------------------------------LN--TRKY------
A4TVT0_9PROT/37-420---TALARWLM---T---------------------------------------------------QP--KRRF------
A5VUB4_BRUO2/56-440---ALLGEAMK---S---------------------------------------------------RR--TR.L------
Q1Q6Z8_9BACT/44-427---VFLAKHLI---Q---------------------------------------------------KS--LR.Y------
A4F0R1_9RHOB/34-418---TALAMWLS---R---------------------------------------------------LP--QRKY------

PF00246

Q7QC23_ANOGA/57-339P-MFKYVGNMH---G---------------------------------------------------DE..TVG-------
Q7QC23_ANOGA/466-752P-EVKYIANMH---G---------------------------------------------------NE..VVG-------
Q7PRP0_ANOGA/83-361P-DVKYIGNIH---G---------------------------------------------------NE..AVG-------
Q7PSV3_ANOGA/117-396K-AIVVEGGIH---A---------------------------------------------------RE..WIS-------
CBPB2_HUMAN/129-411N-AIWIDCGIH---A---------------------------------------------------RE..WIS-------
CBPA3_HUMAN/125-404K-AIFTDCGIH---A---------------------------------------------------RE..WVS-------
NNAD_DROME/879-1138K-SIVVSARVH---P---------------------------------------------------SE..TPA-------
AEBP1_MOUSE/561-887P-EFRYTAGIH---G---------------------------------------------------NE..VLG-------
Q23318_CAEEL/147-446R-IFWIDGGIH---A---------------------------------------------------RE..WAA-------
Q9W477_DROME/334-625W-AVFVDAGLQ---A---------------------------------------------------RD..WLS-------
Q7Q316_ANOGA/128-403P-AVFMEGTIH---A---------------------------------------------------RE..WIS-------
CBPC1_CAEEL/734-1008E-VIVLSARVH---P---------------------------------------------------GE..TNA-------
CBPB1_BOVIN/125-404P-AVFMDCGFH---A---------------------------------------------------RE..WIS-------
CBPE_BOVIN/63-363P-EFKYIGNMH---G---------------------------------------------------NE..AVG-------
CBPA1_ANOGA/137-415P-GVFLEGGIH---A---------------------------------------------------RE..WIS-------
CBPA1_DROME/131-415P-GIFLEAGIH---A---------------------------------------------------RE..WIA-------
Q9VLZ1_DROME/129-409P-GVLIESNIH---A---------------------------------------------------RE..WIT-------
Y1242_ZYMMO/118-364R-SIWLIARQH---P---------------------------------------------------GE..TMA-------
CBPD_ANAPL/54-375P-QVKLVGNMH---G---------------------------------------------------DE..PLA-------
CBPD_ANAPL/942-1212P-KIRFVAGIH---G---------------------------------------------------NA..PVG-------
Q9VCM8_DROME/185-464T-TVFVESGIH---A---------------------------------------------------RE..WIA-------
O14418_METAN/124-409P-AVVFHGTVH---A---------------------------------------------------RE..WIV-------
O17754_CAEEL/46-351P-EVKLIGNMH---G---------------------------------------------------NE..PIG-------
CBPD_RAT/70-372P-QVKLVGNMH---G---------------------------------------------------DE..TVS-------
CBPD_RAT/509-784P-EFKYIGNMH---G---------------------------------------------------NE..VVG-------
CBPD_RAT/937-1201P-KIRFVAGIH---G---------------------------------------------------NA..PVG-------
O61532_DROHE/129-408P-GIFLEAGIH---A---------------------------------------------------RE..WIN-------
YBJ7_SCHPO/189-484K-VIIIQGGSH---A---------------------------------------------------RE..WIG-------
O77063_APLCA/41-315P-MFKYVGNMH---G---------------------------------------------------NE..AIG-------
O77063_APLCA/474-752P-EFKYIGNMH---G---------------------------------------------------NE..VVG-------
O97389_HELAM/127-412P-VVMMQSLLH---C---------------------------------------------------RE..WVT-------
CBPA1_BOVIN/128-406P-AIWIDLGIH---S---------------------------------------------------RE..WIT-------
CBPB_ASTFL/12-290P-IIFIDGGIH---A---------------------------------------------------RE..WIA-------
CBPN_HUMAN/31-330P-EVKYVGNMH---G---------------------------------------------------NE..ALG-------
CBPS_STRGR/138-428P-EVLFTAHQH---A---------------------------------------------------RE..HLT-------
CBPA2_RAT/127-404P-AIWLDAGIH---A---------------------------------------------------RE..WVT-------
CBPB1_RAT/123-402P-AIFIDCGFH---A---------------------------------------------------RE..WIS-------
CBPT_THEVU/113-402P-EVLYTALHH---A---------------------------------------------------RE..HLT-------
CBPE_LOPAM/37-342P-EFKYIANMH---G---------------------------------------------------NE..AVG-------
ECM14_YEAST/127-417K-TIVITGGIH---A---------------------------------------------------RE..WIS-------
CBPS_STRCP/129-415P-EVLFTCNMH---A---------------------------------------------------RE..HLT-------
CBPD_DROME/46-327P-PVKYIANMH---G---------------------------------------------------DE..TVG-------
CBPD_DROME/462-752P-EFKYVANMH---G---------------------------------------------------NE..VVG-------
CBPZ_SIMVI/8-286P-VVMVESNIH---A---------------------------------------------------RE..WIT-------
P73902_SYNY3/17-361P-GYWIDANTH---A---------------------------------------------------GE..VTG-------
P90667_APLCA/53-357P-EFKYVANMH---G---------------------------------------------------NE..VVG-------
P91359_CAEEL/84-366P-ELKIVGNMH---G---------------------------------------------------NE..VVG-------
P91755_LUMRU/82-363W-RVWMDAGVH---A---------------------------------------------------RE..WLA-------
ENP1_LYSSH/115-389K-RIHYKASFH---A---------------------------------------------------NE..WIT-------
Q22825_CAEEL/64-346P-EFKYVANMH---G---------------------------------------------------NE..VTG-------
Q7NHR1_GLOVI/52-276D-IVLVNAAIH---P---------------------------------------------------GE..IPG-------
Q7NMK5_GLOVI/121-539A-VIWIDGGLH---A---------------------------------------------------TE..VVG-------
Q7NYA9_CHRVO/137-389L-KIWITARQH---P---------------------------------------------------GE..TMA-------
Q7NYK5_CHRVO/83-312P-TIYIEAGIH---P---------------------------------------------------GE..ANG-------
A8BM27_GIAIC/624-987K-IVVVSARIH---P---------------------------------------------------GE..AQS-------
Q7RI20_PLAYO/819-1026E-IIFLTCRVH---P---------------------------------------------------GE..TNA-------
Q7S312_NEUCR/128-414P-AIVFHGTVH---A---------------------------------------------------RE..WIT-------
CBPA1_MOUSE/128-406P-AIWIDTGIH---S---------------------------------------------------RE..WVT-------
Q7UE12_RHOBA/168-401E-VIYALSRQH---P---------------------------------------------------PE..VTG-------
Q7W2L4_BORPA/327-506P-AVFISGAQH---A---------------------------------------------------NE..SSG-------
Q829W4_STRAW/126-404P-SALYMSNQH---A---------------------------------------------------RE..WIT-------
Q82L57_STRAW/15-263R-AVLVVAGAH---A---------------------------------------------------NE..PTG-------
Q82MI7_STRAW/50-294A-TVLLVCSQH---G---------------------------------------------------DE..PSG-------
Q86FI7_SCHJA/151-426P-IIWIDAGIH---A---------------------------------------------------RE..WIA-------
Q86P95_DROME/159-438K-AIFIESGIH---A---------------------------------------------------RE..WIS-------
CBPA4_HUMAN/129-408P-AVWLNAGIH---S---------------------------------------------------RE..WIS-------
Q871Q3_NEUCS/204-502K-TILVTGGLH---G---------------------------------------------------RE..WIS-------
Q87JK3_VIBPA/143-392K-KIWMIARQH---P---------------------------------------------------GE..TMA-------
Q88KC6_PSEPK/125-366R-KLWLIAQQH---P---------------------------------------------------GE..HMA-------
Q897X5_CLOTE/135-416N-KVFYNGAHH---S---------------------------------------------------LE..WIT-------
Q8AVS2_XENLA/141-421K-AIWIDCGMH---A---------------------------------------------------RE..WIG-------
Q8AXN3_PAROL/115-395P-AIFMDCGIH---A---------------------------------------------------RE..WIS-------
Q8AXN4_PAROL/128-406P-AIWIDTGIH---S---------------------------------------------------RE..WVT-------
Q8AXN5_PAROL/128-406P-AIWIDLGIH---S---------------------------------------------------RE..WVS-------
Q8EEF8_SHEON/114-366R-NIWITARQH---P---------------------------------------------------GE..TMA-------
Q8EKE3_SHEON/95-358P-TILVQAGIH---A---------------------------------------------------GE..IDG-------
Q8EQG9_OCEIH/116-389K-QVHMNGSFH---A---------------------------------------------------NE..WIT-------
Q8ESH0_OCEIH/55-359N-NMLVIGTQH---G---------------------------------------------------NE..AAP-------
CBPZ1_PLAF7/1011-1251K-IIVLTARVH---P---------------------------------------------------GE..TNS-------
Q8IGC4_DROME/129-411Q-SIFLEAGMH---A---------------------------------------------------RE..WIG-------
Q8IMH9_DROME/186-465R-VIVVLCRTH---S---------------------------------------------------SE..APA-------
Q8MYY0_DROME/152-429R-VAYIQAATH---G---------------------------------------------------RE..WIT-------
B4E3Q2_HUMAN/324-632P-EFHYIAGAH---G---------------------------------------------------NE..VLG-------
Q8P4I9_XANCP/58-309P-VVLAQAGIH---A---------------------------------------------------GE..IDG-------
Q8PAS3_XANCP/44-407P-VVLVQGGIH---A---------------------------------------------------GE..IDG-------
Q8PMH9_XANAC/44-312P-VVLVQGGIH---A---------------------------------------------------GE..IDG-------
CBPA5_MOUSE/145-423P-AIWIDTGIH---S---------------------------------------------------RE..WIT-------
Q8SXR8_DROME/47-329K-VIFMDGGFH---A---------------------------------------------------RE..WIS-------
Q8SZR4_DROME/44-328R-VIFLDAALH---S---------------------------------------------------RE..WMT-------
Q8T0Q1_DROME/57-337P-GIFIESNIH---A---------------------------------------------------RE..WIT-------
Q8TK20_METAC/106-433V-GVLFTGSMH---A---------------------------------------------------RE..WGG-------
Q8UUK1_CHICK/130-406P-AIWIDTGIH---S---------------------------------------------------RE..WVT-------
Q8XMR3_CLOPE/302-537K-VLFSVFGVH---G---------------------------------------------------YEDAWSG-------
CBPN_MOUSE/31-330P-EVKYVGNMH---G---------------------------------------------------NE..VLG-------
Q961J8_DROME/129-406N-VVFLDAGIH---A---------------------------------------------------RE..WIA-------
Q96K85_HUMAN/1-240K-VVFITGRVH---P---------------------------------------------------GE..TPS-------
Q9A9J5_CAUCR/82-489A-VVWIDAGLH---A---------------------------------------------------NE..TVT-------
Q9ABB9_CAUCR/88-349P-LLLVQAGIH---P---------------------------------------------------GE..IDG-------
Q9BL88_CAEEL/131-431R-GIWVDGGIH---A---------------------------------------------------RE..WVS-------
Q9HZF4_PSEAE/85-359P-TLLVEAEIH---P---------------------------------------------------GE..ANG-------
Q9I012_PSEAE/122-366L-KLWVIAQQH---P---------------------------------------------------GE..HMA-------
Q9K698_BACHD/54-324P-TIVFLTQQH---G---------------------------------------------------NE..EMV-------
Q9PUF2_BOTJA/125-404K-AIFIDCGFH---A---------------------------------------------------RE..WIS-------
Q9TZC6_CAEEL/153-440P-SIIVDAGVH---A---------------------------------------------------RE..WIA-------
Q9U9K2_AEDAE/130-407P-GIFVEGGIH---A---------------------------------------------------RE..WIS-------
Q9VRZ3_DROME/121-402P-AVFIESNIH---A---------------------------------------------------RE..WIT-------
Q9VS63_DROME/44-354K-TVFIEAGTH---A---------------------------------------------------RE..WIS-------
Q9VS67_DROME/133-412N-VILVDGGFH---A---------------------------------------------------RE..WIS-------
Q9VX86_DROME/1095-1422N-AVFVEAGAQ---G---------------------------------------------------LA..WIG-------
Q9W475_DROME/827-1104P-GIWIDGGMH---A---------------------------------------------------RE..WIS-------
Q9W478_DROME/154-431K-KVWIDGGIH---A---------------------------------------------------RE..WIS-------
Q9X7P4_STRCO/55-266N-KVLLVCSQH---G---------------------------------------------------DE..PSG-------
Q9XBW4_PORGN/123-386P-RVLYTSTMH---G---------------------------------------------------DE..TTG-------
Q9XU75_CAEEL/167-465R-AVWVDGNIH---A---------------------------------------------------RE..WAS-------

PF04952

ASTE_ECOLI/42-322G-ALVISAGIH---G---------------------------------------------------NE--TAP-------
ASTE_VIBVU/52-331K-NIILSSGIH---G---------------------------------------------------DE--TAP-------
Q8D7U9_VIBVU/56-332K-KFVITAGVH---G---------------------------------------------------DE--YNG-------
ASTE_PSESM/48-330T-DLLLSAGIH---G---------------------------------------------------NE--TAP-------
ACY3_HUMAN/10-301R-RVAVTGGTH---G---------------------------------------------------NE--MSG-------
Q88EN1_PSEPK/47-329P-TVLLTGGNH---G---------------------------------------------------DE--YEG-------
ACY2_BOVIN/10-301K-KVAIFGGTH---G---------------------------------------------------NE--LTG-------
P72108_NATPH/45-319P-TLFLSAAIH---G---------------------------------------------------DE--LNG-------
Q8REZ3_FUSNN/9-257P-QRFTIETPY---G---------------------------------------------------ER--WF.-------
A9CH33_AGRT5/52-333P-TALLTGANH---G---------------------------------------------------DE--YEG-------
ASTE_SALTY/42-322R-ALILSAGIH---G---------------------------------------------------NE--TAP-------
ASPA_SYNY3/5-284R-SLAIVGGVH---G---------------------------------------------------NE--RTG-------
Q87RV7_VIBPA/50-319P-VLMVNAAIH---G---------------------------------------------------DE--LNG-------
ACY3_MOUSE/10-300L-RVAVTGGTH---G---------------------------------------------------NE--MCG-------
ASTE_SHEON/52-339K-DVILSCGVH---G---------------------------------------------------NE--TAP-------
Q987A0_RHILO/66-347P-TALLSGGNH---G---------------------------------------------------DE--YEG-------
Q92SQ8_RHIME/30-339P-RTYIQAALH---A---------------------------------------------------NE--LPG-------
ASTE_VIBCH/52-331K-NMVISCGIH---G---------------------------------------------------DE--TAP-------
Q8KGS0_RHILI/43-328P-RLLVTGGNH---G---------------------------------------------------NE--LEG-------
ASPA_NOSS1/3-288N-RVAIVGGTH---G---------------------------------------------------NE--FTG-------
ASTE_PSEPK/48-330L-DLLLSAGIH---G---------------------------------------------------NE--TAP-------
Q87HF0_VIBPA/56-331K-KIMITAGVH---G---------------------------------------------------DE--YNG-------
Q9HNH1_HALSA/42-314K-TLYMQAASD---G---------------------------------------------------DE--LNG-------
ASPA_PROMA/2-289I-QVLLVAGTH---G---------------------------------------------------NE--INA-------
ASTE_YERPE/42-323Q-SVVISAGIH---G---------------------------------------------------NE--TAP-------
ASTE_PSEAE/48-331V-DLLLSAGIH---G---------------------------------------------------NE--TAP-------
Q89N67_BRAJA/46-333P-KLLLMAGNH---G---------------------------------------------------DE--YEG-------
Q98JD4_RHILO/49-329K-RGVLVSGVH---G---------------------------------------------------DE--MSS-------
Q8EGL7_SHEON/48-317P-TLLVCAAIH---G---------------------------------------------------DE--LNG-------
A9CLI1_AGRT5/46-332P-SILLMAGNH---G---------------------------------------------------DE--YEG-------
Q8EAC2_SHEON/33-365P-KVYIQANVH---G---------------------------------------------------AE--VQG-------
Q92WC2_RHIME/47-328P-TALLTGGNH---G---------------------------------------------------DE--YEG-------
Q98AA0_RHILO/43-328P-SLLITGGNH---G---------------------------------------------------NE--LQG-------

PF10994

A0L457_MAGSM/24-365A.TLVITSACH---G---------------------------------------------------VE-GPAG-------
A4XNS7_PSEMY/6-345N.LLVLSSGCH---G---------------------------------------------------IE-GFCG-------
Q4DHE8_TRYCC/47-382N.LLIHMSGTR---G---------------------------------------------------VD-GFTG-------
Q0RN36_FRAAA/3-356S.VLVLVSGTH---G---------------------------------------------------AE-GFAG-------
A4HIN1_LEIBR/48-391K.LLVHTSGTH---G---------------------------------------------------VE-GYTG-------
A0Z3J5_9GAMM/7-347T.ALVIVSGTH---G---------------------------------------------------PE-GYTG-------
Q0EX57_9PROT/12-350T.VLVLLSATH---G---------------------------------------------------VE-GFCG-------
Q213B6_RHOPB/13-353S.QLVIISGTH---G---------------------------------------------------LE-GLSG-------
Q3K6V4_PSEPF/5-352R.RLVALSGTH---G---------------------------------------------------VE-GYYG-------
Q7VZV3_BORPE/14-354R.RLLAISGTH---G---------------------------------------------------LE-GFFG-------
A4GJN2_9BACT/7-352K.LLLYTSGIH---G---------------------------------------------------VE-GFAG-------
A7HS30_PARL1/18-367T.VLLNTCGTH---G---------------------------------------------------AE-GYGG-------
Q7W0U8_BORPA/7-349R.MLVVGCGTH---G---------------------------------------------------IE-GYSG-------
A1VW91_POLNA/13-355K.LLLLSSGVH---G---------------------------------------------------VE-GYAG-------
A1W380_ACISJ/8-351R.LLIVSSGCH---G---------------------------------------------------VE-GLCG-------
Q12BQ5_POLSJ/8-351S.LLIVTSACH---G---------------------------------------------------VE-GYCG-------
Q2KVE6_BORA1/8-348Q.LLILSSGTH---G---------------------------------------------------VE-GFCG-------
C6BDX1_RALP1/7-346A.LLIVTSGVH---G---------------------------------------------------VE-GFCG-------
A9BGZ8_PETMO/4-348K.LFLITTGEH---G---------------------------------------------------IE-GFAG-------
Q0K9X8_CUPNH/4-344R.CLMVTSGTH---G---------------------------------------------------AE-GFAG-------
Q46ZZ8_CUPPJ/8-348R.VLIISSGVH---G---------------------------------------------------VE-GFCG-------
A4A0X2_9PLAN/9-348H.CLVLSSGLH---G---------------------------------------------------LE-APLG-------
Q586Z8_TRYB2/47-385R.LLVHISGSD---G---------------------------------------------------IG-GFTG-------
Q118U2_TRIEI/12-348N.VILHSSGLH---G---------------------------------------------------VE-GFAG-------
A1TK81_ACIAC/8-351R.LLILSSACH---G---------------------------------------------------VE-GHCG-------
A9KLP9_CLOPH/53-407KNLIVLTTGVH---G---------------------------------------------------IE-GYVG-------
A5V6N1_SPHWW/7-348T.LLVLTSGMH---G---------------------------------------------------PE-LMCG-------
A7HTE6_PARL1/10-349F.VLGIGSGTH---G---------------------------------------------------VE-GYCG-------
A3RS53_RALSL/7-346A.LLVLTSGIH---G---------------------------------------------------VE-GFCG-------
Q1LB58_RALME/20-354K.LVIIISGVH---G---------------------------------------------------VE-GYCG-------
A0YFP1_9GAMM/12-355N.VMIMICGTH---G---------------------------------------------------PE-SFTG-------
Q1LNH9_RALME/10-350R.VLLVTSGTH---G---------------------------------------------------AE-GFCG-------

PF07454

A9VRX1_BACWK/114-390--NIPNESSVP---IEEVTKEREV...AKDKVTEAEKNNPVQKKNGA................K--KG--ESA-------
A0Q1S0_CLONN/78-362--RDPEHIFNE---FILNDDQVYV...ENANENKSDGNGN.MASAPVFSKELQKKM........--PS--KPE-------
Q0AXA7_SYNWW/53-297--EKMPVLSYD---KKSNAWNFNSKEQPVV.................................A--GK--RPT-------
B8FUP8_DESHD/126-356--ALP......---.................................................L--DD--EVL-------
A4IR37_GEOTN/100-382--NIPYESAPP---LEVMLAERQA...SVEELQQAEQNQD.KKPLPPPAQT............T--GG--RKV-------
Q892Q4_CLOTE/87-346--......LEP---FKLDEKYVLK............EEVKKEINKKIHNPNLKKKL.......D--KS--KPE-------
Q2B0L9_9BACI/100-377--NMPIESPPP---IESLRAEQEA...SLMNGGKMAGIDE......ETRMT............T--GG--KKI-------
Q8EPW1_OCEIH/94-372--SFPIESNPP---LEEVLKDREA.......VVEDDVDEE.LPPEEDIEQT............T--GD--RDV-------
Q0SRD6_CLOPS/80-354--EK....VSS---FDLNKDSIDI...VSEEESKKSAELEASKNSEVYDPSLKKEL.......D--QS--KPE-------
Q4MRJ9_BACCE/93-374--NLPIESSVP---LEEVVKERTG...EGGQAPKPDTNKE.KK...QPAQT............T--GK--RQV-------
Q8R9I5_THETN/52-292--EKLPDVDEE---VSAAIAVSQ........................................N--TG--EKR-------
A6TS45_ALKMQ/53-323--VQLPKINLE---ALERVKLALDGPEGLAALFLAQEEEGEEGEGEGERPGGW..........E--NL--ERR-------
SP2P_BACSU/101-383--NMPAESPPP---SKVMEEEREA...NLAEIEKQQTQSD.NAQKDPPKQT............T--GD--KKV-------
A8MH52_ALKOO/52-308--VVLPKVDKE---MLTSIKQGLSEGFSIDSLLAQAGNS........................G--KE--DRK-------
A5I646_CLOBH/89-359--......LDP---FKLEEKEVSKYKAEEMKDGKEDLNLE.NKVVNVQDPKLKKKL.......N--PK--KPE-------
A4XLX5_CALS8/99-374--NIRPNGSIS---YNIEVMNQTEYRIDITKFLNTKFKIY.......................S--KV--KPS-------
A5Z3I4_9FIRM/159-408--ESDMPIKQA---LNKEFKITG........................................N--NK--KPQ-------
Q2BBP6_9BACI/48-296--NEHSASTAA---I................................................K--NQ--DPL-------
Q892Q3_CLOTE/87-344--......LHP---FKLDEKYVLK..........EEKVVTKELNKKIHNPSLKKRL.......D--KS--KPE-------
Q3AAU2_CARHZ/64-305--ILLGYKEYF---ERVVLPAGAM.......................................P--KK--KGI-------
Q2BEI4_9BACI/44-323--TLPFESAPP---AEVLMNEREV...AEEKLQQPVADKP.AQPAKKPEKT.............--..--..D-------
Q735M7_BACC1/90-366--NIPEESSIP---LENIKNEGTA...VKHPKSEKENNS.........NTQ............N--NG--ENK-------
A1HR03_9FIRM/60-301--FPKFDPQTF---L................................................L--PG--KPL-------
A1HTV9_9FIRM/49-295--VNLAQYAPP---TGGAMAMFEGLLQPRVA................................R--AQ--GGK-------
B0KA89_THEP3/88-386--NDDAQTNPP---SNNNVNLFDTNAQSDKNTSQTQGEEEKPVLKNI................D--NS--KPY-------
B8CXL6_HALOH/71-347--PAEDKSKKS---SVIRLKFDLRESKQREADNIKK...........................A--VE--RPL-------
A1HTI8_9FIRM/55-292--ETYSQSEFD---AIPVQAPAA........................................P--AQ--PPL-------
Q2RKY1_MOOTA/91-333--EPPVEESPP---PAPSEVETTS........................................--SK--NPL-------
A5D3X4_PELTS/104-345--GGADAGSGT---VP...............................................P--AG--GAL-------
Q2RIV0_MOOTA/74-321--ISQEDTGVP---AQAGQTMPGDGTNPVQ.................................A--AG--SQI-------
Q8RB76_THETN/88-377--EEEKVIIPP---PKVAEERKEEKKEPSGEEKKG............................D--NS--KPY-------
A6TSM6_ALKMQ/118-410--SA....QPE---MDEDDKGERQEGVYLIDQHNIIDSLAGDLEGALAGLTRPEKIKF.....Q--AG--KPD-------
O87702_BACME/80-361--NFPRESAPP---LDETLKERNS.......TTKVQQPKENDGTNAPNNNT............T--GG--KKV-------
Q0AXW7_SYNWW/93-314--QALL