Sequence alignment for CL0035

PF05450

NICA_MOUSE/273-498---------------------------------------------------------------R----------------
Q7PY38_ANOGA/276-510---------------------------------------------------------------R----------------
Q6Z743_ORYSJ/248-457---------------------------------------------------------------P----------------
NICA_CAEEL/278-508---------------------------------------------------------------K----------------
NICA_ARATH/251-460---------------------------------------------------------------P----------------
Q7KS07_DROME/236-469---------------------------------------------------------------K----------------

PF04389

Q7UGZ5_RHOBA/466-676-----------------------------------------------------NVIGVL....E.G--------------
Q7UQS9_RHOBA/713-958-----------------------------------------------------NVIARLPVDSE.A--------------
IAP_ECOLI/99-331-----------------------------------------------------TVIAAH....E.G--------------
Q7PX80_ANOGA/279-471-----------------------------------------------------NTIGEL....V.G--------------
Q8A5P9_BACTN/127-331-----------------------------------------------------NVLAMI....P.G--------------
Q82DU6_STRAW/104-310-----------------------------------------------------NLIADW....P.G--------------
M28P1_SCHPO/127-317-----------------------------------------------------NILVKF....E.G--------------
Q8EF07_SHEON/292-502-----------------------------------------------------NVAALL....P.G--------------
Q7PQQ4_ANOGA/155-351-----------------------------------------------------NVVVKL....V.G--------------
Q97F97_CLOAB/215-408-----------------------------------------------------NIIGCI....K.G--------------
Q7RZ44_NEUCR/238-455-----------------------------------------------------NVIAET....K.G--------------
Q9A3U5_CAUCR/179-398-----------------------------------------------------NVVGKV....T.G--------------
Q8TL26_METAC/107-308-----------------------------------------------------NVIADR......S--------------
YC52_SCHPO/139-332-----------------------------------------------------NIVVRL....S.N--------------
Q86PD7_DROME/119-343-----------------------------------------------------NIIATL....N.P--------------
Q8PEF6_XANCP/320-540-----------------------------------------------------NVVGVL....P.G--------------
APE3_YEAST/295-497-----------------------------------------------------NIIADT....K.H--------------
Q9A4J1_CAUCR/320-539-----------------------------------------------------NVVGMI....E.G--------------
Q9HZQ8_PSEAE/277-492-----------------------------------------------------NVVAET....R.R--------------
Q9VRQ9_DROME/96-322-----------------------------------------------------NVVGTI....N.P--------------
Q9A578_CAUCR/245-463-----------------------------------------------------NVAAML....P.G--------------
O67732_AQUAE/181-362-----------------------------------------------------NLYVEF......G--------------
Q82VZ8_NITEU/814-1018-----------------------------------------------------NVIGIL....P.G--------------
Q9KLD3_VIBCH/180-384-----------------------------------------------------SVVLTI....Q.G--------------
Q7ND13_GLOVI/294-511-----------------------------------------------------NVAAML....P.G--------------
Q7QJV5_ANOGA/144-340-----------------------------------------------------NVVARI....V.P--------------
Q9HNP7_HALSA/213-399-----------------------------------------------------NTHGVL....G.P--------------
Q898V9_CLOTE/213-406-----------------------------------------------------NVVGTI....K.G--------------
M28P1_NEUCR/167-355-----------------------------------------------------DYAHGM......R--------------
Q8A4P9_BACTN/106-327-----------------------------------------------------NIIGSY....K.P--------------
Q7MT37_PORGI/106-324-----------------------------------------------------NIIASY....R.P--------------
Q7Q1Q7_ANOGA/119-344-----------------------------------------------------NVIASL....N.P--------------
QPCTL_MOUSE/151-377-----------------------------------------------------NVVATL....D.P--------------
Q9FBN5_STRCO/118-324-----------------------------------------------------NLIAEW....PHG--------------
Q7X7Q3_ORYSJ/116-307-----------------------------------------------------RVVPKY....L.P--------------
Q9VTH7_DROME/118-327-----------------------------------------------------NIVARQ....N.P--------------
Q8MT48_DROME/136-331-----------------------------------------------------NVVVKL....S.P--------------
YP67_CAEEL/153-348-----------------------------------------------------NVVVRI....G.P--------------
Q9HRR8_HALSA/209-394-----------------------------------------------------NVHATL......G--------------
Q8EDI3_SHEON/300-522-----------------------------------------------------NVVATL....A.G--------------
M28P1_YEAST/136-325-----------------------------------------------------NILVKL....E.G--------------
Q8P3Z6_XANCP/285-504-----------------------------------------------------NVVGKL....T.G--------------
Q9A369_CAUCR/106-296-----------------------------------------------------NLIGIL....P.G--------------
Q8CK35_STRCO/698-904-----------------------------------------------------NLIAEW....PKG--------------
Q7UHT1_RHOBA/165-383-----------------------------------------------------NLIAAW....N.P--------------
Q7MAY9_PHOLL/137-328-----------------------------------------------------NLIAKL....EVP--------------
Q8XIF2_CLOPE/218-412-----------------------------------------------------NVTGII....K.G--------------
YFI8_YEAST/108-354-----------------------------------------------------NLVMTL....Q.N--------------
A0KMQ2_AERHH/300-500-----------------------------------------------------.VVLTL....K.G--------------
A1ZBK1_DROME/141-334-----------------------------------------------------NVVVKI....S.Q--------------
B1W291_STRGG/111-316-----------------------------------------------------NLIADW....P.G--------------
F4HRW3_ARATH/131-323-----------------------------------------------------NILMRI....S.S--------------
P96264_MYCTU/252-471-----------------------------------------------------NVIAQT....K.T--------------
Q65DH7_BACLD/234-429-----------------------------------------------------NVIGVR....K.A--------------
Q8P530_XANCP/298-511-----------------------------------------------------NVVARL....E.G--------------
V5IL52_NEUCR/186-374-----------------------------------------------------.IIAKI....P.G--------------

PF16254

E3I196_RHOVT/23-360----------------------------------------------------HAIAAEIFPLCR-S--------------
Q72C97_DESVH/23-362----------------------------------------------------YKWACDLFPVCR-S--------------
V6F7J1_9PROT/5-345----------------------------------------------------YDWARDLFPLCR-S--------------
A8L141_FRASN/24-365----------------------------------------------------HDLVSALMPPMR-S--------------
A4YXC9_BRASO/19-355----------------------------------------------------HALVAELFPINR-S--------------
D2B4H6_STRRD/11-348----------------------------------------------------HALVERLYPLCR-S--------------
K9TUF6_9CYAN/28-366----------------------------------------------------YQTISRLYPICR-S--------------
A9A1R6_NITMS/2-337----------------------------------------------------YNLINDLYQKQR-N--------------
K9R692_9CYAN/22-359----------------------------------------------------YQLISKLYPICR-S--------------
K8GK59_9CYAN/18-355----------------------------------------------------YHLISELYPICR-S--------------
D8PH49_9BACT/2-340----------------------------------------------------YRFISELYPICR-S--------------
A6X4E0_OCHA4/24-360----------------------------------------------------YDLAARLYPVCR-S--------------
G0FP92_AMYMS/13-348----------------------------------------------------HALVERLYPICR-S--------------
Q0P8W2_CAMJE/19-363----------------------------------------------------YELACELFPIPR-S--------------
B8DNR6_DESVM/11-350----------------------------------------------------YRWMADLFPICR-S--------------
E4TGF1_CALNY/8-350----------------------------------------------------HDLIRRLFPINR-S--------------
B8J2H8_DESDA/5-344----------------------------------------------------HSFLQRLFPICR-S--------------
Q2J611_FRASC/47-388----------------------------------------------------HDLVATLLPPMR-S--------------
Q7CVW7_AGRT5/25-363----------------------------------------------------HDLASRLFPICR-S--------------
B6IYF3_RHOCS/20-362----------------------------------------------------HAFMRELFPLCR-S--------------
C9YZ07_STRSW/8-345----------------------------------------------------HALVERLYPLCR-S--------------
Q74B36_GEOSL/18-356----------------------------------------------------YRLLAELFPLCR-S--------------
W8EZ41_9BACT/23-362----------------------------------------------------HALLERLFPICR-S--------------
K9UPJ0_9CHRO/224-561----------------------------------------------------YELISKLYPICR-S--------------
PBPAD_CLOAB/19-355----------------------------------------------------YNLIEELFPICR-S--------------
F4KR41_HALH1/11-348----------------------------------------------------YRLAEKLFPICR-S--------------

PF07454

G7M1H4_9CLOT/98-351..YKGIIQNEVSYF.....................................TDVDSDSVSKPDS-TFSLFQINDDSILKV
B7GKC2_ANOFW/97-371NDPRSLLGRELPGF.SLYDSEIILAGEG.........TDFTNIPYESPPPLEVLLAEREAAQEQ-LQEEETPPAPA....
R7FHF1_9CLOT/95-400....SFLETEISSIKGMEETEKEKN...................QTEDSNGSDNKKNTSDENKS-DSNNSITEDEKIILA
E6TW22_BACCJ/104-380GDHRTLLGTELPGF.SLFDGTIILAGEG.........VDYTEMPLESAPPMEVLLAESEAADER-IAEIDMLREEMAGQD
SP2P_BACSU/104-382EDPRSFLGRELPGF.AQFDTEILLAGQG.........TDYTNMPAESPPPSKVMEEEREANLAE-IEKQQTQSDNAQKDP
W6RYD9_9CLOT/92-354DNPKSIIGKEFIGI......................................SMVNKDNISNSG-GIKGFASDSIVIKTK
R6Y5Z6_9CLOT/84-328KDPTTLLSSNIKSS...........KSE.........TKNKYTKDAEAKEDDYNASVYEKITSY-VENPLK.........
R6FU89_9CLOT/96-359.....IVNNELSVF...................................AQINDNITGAVANNG-GIQPYEIKSNSVAMI
Q8EPW1_OCEIH/97-371SDPRSLLGNELPGF.SIYDSQILMASGD.........NHFTSFPIESNPPLEEVLKDREAVVED-DVDEELPPEED....
L0KBT3_HALHC/114-380......................VVSRNK.........SNQAEKNSKQRVAEKIQAEGRHTGEKN-YKVKLDFWQTKPQNK
B2TLZ1_CLOBB/101-350...ENILKSEVGFF.......................................NNIDKNDESTL-TFNQFSVNEDSILKF
A0Q1S0_CLONN/81-361KDYLSVLGKEIAYL......SADEEYKS......................LEDEKNFKDRDPEH-IFNEFILNDDQVYVE
C0ZB23_BREBN/92-372GDLRSLLGRELPGMVTTEDARFVVQGKG.........ASLADFYLEYPAHPKQVADQSQVVPIV-EPKPEDTTKSGEAKP
A5N6L6_CLOK5/97-357SDVLSLLGREMAFL..........................................DLDSSKDV-SFNEFNLEDKEIEKS
R6BH31_9FIRM/101-413........................PESE.........KTQETQKSSEVQNTQDQMPQKAEAESM-EETEKTVIQKAVKKK
R4K1D8_CLOPA/88-355SHPDEILKKEISYL......DGDDN...........................SI.....KDGTA-AIGDFNLSNSDVIKN
Q892Q3_CLOTE/90-343EEPLTILGKEMAFI........................................DTNEVYNTDY-KLHPFKLDEKYVLKE
A5I646_CLOBH/92-358HNPISLVEKEMPVL....................................CLNSSKEDTKDKSM-ALDPFKLEEKEVSKY
A6TSM6_ALKMQ/126-409KPEEGSLGGDLYFA..................................................-...DYYEEDDVIQED
D5DKD3_BACMD/102-382ADTRSLFGSELPGF.SIFDSHILLAGEG.........TDYTTIPHESAPPLESISGERDLDPAE-SKTYEESKKQSQAQ.
F3ZZL9_MAHA5/110-385.QPNSLLNLQIPML...............................AGAPQSISVSSRGAARITP-GVEKIEDEDGDIILH
Q892Q4_CLOTE/90-345EDPLTVLEKEISLI.......................................NTSEIYKQKDY-ELEPFKLDEKYVLKE
Q0AWL6_SYNWW/52-337.KKIELDKKQAASLFREVNVVFAGEKTS.........FPMTRHYFKEKMPEELMISSIQALAYG-RSEEDLRENEGENEV
Q81RH8_BACAN/96-373NDVRSFVGKELPGF.GKYDTEIVIAGEG.........TNYSNLPIESSVPLEEVVKERTGEGGQ-APKPDTNKEKKQ...
Q5WHG7_BACSK/96-380DDPRSLLGRELPGF.SLFDTTIHIAGEG.........TDYTSLPVESSPPDDLLASEQKAKQEA-LDRKKAEEEAAKKKE
Q8XIS4_CLOPE/83-353LDPIELVMNEVPYF................................GAVNKIASIDKVNYVSAE-KVSSFDLNKDSIDIV
F4LT33_TEPAE/61-306..GDQYLNEQNILY.EIVKVSGNKAYAK..........................FKEEVDIEQA-LELPESQVTSEIFQD
B2A1M1_NATTJ/95-352NSPETILGTQFSPV.....................................RDYSKEIQAMAEE-QKPDQKSSKEVVWQE
E3E9H1_PAEPS/109-393QDPKSLISREIPGM.SAGAPVLLRKGSG.........NDKVEGPTDYQPDQGTTDTPGGSDAAE-NPPSTTPDIPTTPET
R5SWF7_9CLOT/86-332TKPSSIIASYVSKT........................NNYNSITLEHNDDYSNLEELKKISSY-IEDPY..........
B8CXL6_HALOH/74-346KAPITYLKREIPLL........................SYYTPATLRQPSRKVYEPAEDKSKKS-SVIRLKFDLRESKQR
C8VZ23_DESAS/71-308STGDEIYKPDGKSY.KVVRVEGEKAYAK.........YLGRDKELVAWQEFFNNYEVPVTSKTE-KDN............
F2JQY0_CELLD/81-394GEPLSLLANAIPYI............................EENEGFKASYNEIVGYFTPDDL-KNQKISQTNEQVKET
I0JP55_HALH3/103-369NDPRSLLGREIPGL.SFYNSQIIIAGEG.........TNFATLPIESEPPLDVDHKGEEGDVEE-KQQDSPEGNQTIKED
R4KD37_CLOPA/91-359TKPDEILKREISYF......KVDNN...........................SINYNNKSI...-NVSNFQLKDGDITKN
Q3AF15_CARHZ/59-322ENPRGYLQKTLGFK..................................................-...QKNDEEGNLSQE
A8MFA4_ALKOO/132-419EEPEEDWSREIHLV..................................................-...DYDGDEGTIAVD
D9QV82_ACEAZ/112-379DNPASILQAELPNL........................SVVNRNMAEREERKTEADQKETFNQK-RQAQDEVQETELNFT
Q8RB76_THETN/91-376KDPLNLIKFQIPVF.................................AQVDYKKYQKVTQVTKG-EEEKVIIPPPKVAEE
R5KZW5_9CLOT/103-377.DILKLMEEEEKVI..........................................GSQKKKGS-TSEESYTGGGTIVTY
R6L1N6_9FIRM/117-447.....................................KKTESTVTAEAEPGQAQTEIKTKEEDK-QQQKEPSEDENIKQT
R6QET5_9FIRM/92-366................................................................-...............
C5D4U7_GEOSW/103-381DDPRSLLGGELPGF.ALYDSKIIVAGEG.........TDYTNMPYESAPPLEVMLAERQASLEN-LEEADKKNNEKQIPP
R6G2S5_9CLOT/93-364..SISIVAGELNIF...........................SEADDMIYRGSKPVREIVSNTNS-HINPYEIDDGSISKV
R4K976_CLOPA/94-363SHPDEILKKEVSYF......REDNN...........................SVAYNSNDTGIA-KISDFNLKDSDITKN
Q81NS4_BACAN/93-365NDLRSLLTRELPNM.NQFYSEILIAGEG.........TDYTNIPEESSIPLENIQDKGTAVKHP-KSEKENNSNIQNNGE
A6LRM7_CLOB8/99-348.....IIQNELSFF.....................................GDGESSSNTETNF-SFNPFQISEDSISKV
I3VX26_THESW/94-382RDPLKILKYQIPII...................................AQIDKGEKNNTSNTQ-VADNHSANQSENGQA
C3AKV3_BACMY/56-328HDLRTFVGKEVPGM.SKYYSNIIVAGEG.........TDYTNIPNESSVPIEEVTKEREVAKDK-VTEADKKNPVQKNKN
X5A281_9BACL/111-398GDPKSLLSREVPGM.AADDAVLLRKGSGGVEGAPVDYHPGADEPAEATPAPTSGGSAGAQETPL-PENSDAPAPSSAPAQ
D3FXK3_BACPE/103-378DDPRSLLGRELPGF.SLFDGQIIVAGEG.........TDYTNLPFESAPPLEVIMAEREATKES-LAKLEELKQAGDN..
R6PS90_9CLOT/86-357.DILDIIKKYTELY............................................ADDKRD-ADIRATTYGKTGATH
N0B327_9BACI/103-379DDPRSLLGRELPGF.SLFDGKIVVAGEG.........TNYTNMPMESAPPVEVLKAEQEASLQN-TEGIDGTGNSGGSSP
D3E4Y7_GEOS4/111-412KDPKSLLAGELPGM.KANQPVQLSHGSG.........NEDGEAPADYRPDPAEEQAEGEPAETG-EEPTQGEQGNSGNEG
R5Y996_9FIRM/99-374QDIAELMRQEEAVI..........................................DSQTVKGK-TSEESYTGGGTVVTH
R7IMN7_9FIRM/105-428........................TKKD.........MMLAQEQTPAGNADGTDTAQNTMQEQE-QTESPTDQQQDTQQN
A8FFD8_BACP2/104-382EDPRSFLGRELPGF.EHFDTKIILAGEG.........TDYTNMPMESPPPSEVIQDEKEANLAE-LDKLDKDVPKKPAKE
U5LAD6_9BACI/47-322TDARTFLGTELPGL.VYFDTEIVVAGEG.........TDLSTLPFESAPPAEVLMNEREVAEEK-LQQPVADKPAQPAKK
K0J3S0_AMPXN/101-371TDIRTLFGNEIPGF.YPYQNRIIIGQAN.........TNYSNLPIESSPPLEVVLEDHNVIDPP-KDDQDMPGHQDQTTE
K0B2K4_CLOA9/112-386..PKTYFKMQLPAI..FTLVNSEHVNVA.........SNMYNGNPEESLHYEDIIFTEDPSENY-NGKQVETTKDLISSE
A6TS45_ALKMQ/55-322.RGDQYLSGDNKMY.EVTRVNTSSRIAY.........ADF....INDVQLPKINLEALERVKLA-LDGPEGLAALFLAQE
Q97JJ8_CLOAB/89-349NKPENVISKEVSFL......................................GEALPKSIKSEC-PNESFTLDDKDVVKS
R6B5M3_9CLOT/98-368...........................................................NNIVE-EPTIVENNNTDNTIE
G2TNJ2_BACCO/102-380EDPRSFLGRELPGF.EIFDSKILVAGDG.........ADYTNMPIESVPPDSALQSKDPATQNT-EKIEENGGSDDAKQR
U5RWI9_9CLOT/89-351NNPKSLLGREVAFL........................................GLGYSKNQDI-SFNEFKLDDKQIKKN
Q9KBM3_BACHD/93-368GDIRSLLGRELPGL.ALFDTRIIVAGEG.........TNLSNMPFESPPPMEVLLEEREAVMES-SDEEEADTESTPDTE
Q65H48_BACLD/103-380KDPRSFLGRELPGF.SHFDSEILIAGQG.........TDYTNMPSESPPPTEVLKEEREANLAE-LEGKQKKKTDGEKP.
A8MH52_ALKOO/53-307NKGDQYLSGDNKMY.KVTKVNKKNNTAY.........AEF....MEDVVLPKVDKEMLTSIKQG-LSEGFSIDSLLAQAG
U5LDU1_9BACI/103-376NDPGSLLGRELPAF.RGYEGALLTAGEE.........TNNSNMPIESPPPIESLRAEQEASLMN-GGKMAGIDEE.....

PF01520

Q18AN8_PEPD6/486-667--------------------------------------------------------------------------------
A9BFG0_PETMO/246-450--------------------------------------------------------------------------------
A8MFT2_ALKOO/8-185--------------------------------------------------------------------------------
B8I4Q9_CLOCE/815-990--------------------------------------------------------------------------------
A9KSW1_CLOPH/279-457--------------------------------------------------------------------------------
A8MIX1_ALKOO/49-238--------------------------------------------------------------------------------
B8I0V7_CLOCE/52-254--------------------------------------------------------------------------------
A8ZXB5_DESOH/55-253--------------------------------------------------------------------------------
Q7NKW3_GLOVI/183-391--------------------------------------------------------------------------------
Q0P8Y7_CAMJE/436-653--------------------------------------------------------------------------------
Q8XP50_CLOPE/109-309--------------------------------------------------------------------------------
Q65J97_BACLD/4-173--------------------------------------------------------------------------------
A6LWT5_CLOB8/185-363--------------------------------------------------------------------------------
Q89VV6_BRADU/18-229--------------------------------------------------------------------------------
A6TNB4_ALKMQ/3-181--------------------------------------------------------------------------------
Q898S7_CLOTE/57-230--------------------------------------------------------------------------------
Q2RL42_MOOTA/469-652--------------------------------------------------------------------------------
A5I6J1_CLOBH/742-945--------------------------------------------------------------------------------
Q0S524_RHOSR/65-279--------------------------------------------------------------------------------
Q213N5_RHOPB/201-418--------------------------------------------------------------------------------
Q65GR1_BACLD/351-520--------------------------------------------------------------------------------
Q3B4P2_PELLD/11-205--------------------------------------------------------------------------------
E0TDU6_PARBH/209-421--------------------------------------------------------------------------------
Q03S01_LACBA/51-222--------------------------------------------------------------------------------
Q2LTS4_SYNAS/37-231--------------------------------------------------------------------------------
A6GWP0_FLAPJ/28-200--------------------------------------------------------------------------------
A4CK99_ROBBH/34-251--------------------------------------------------------------------------------
A6VP10_ACTSZ/21-216--------------------------------------------------------------------------------
Q899C4_CLOTE/144-318--------------------------------------------------------------------------------
Q1GIB7_RUEST/182-398--------------------------------------------------------------------------------
Q5WE61_BACSK/4-182--------------------------------------------------------------------------------
Q73LZ8_TREDE/115-329--------------------------------------------------------------------------------
Q8ETR2_OCEIH/45-230--------------------------------------------------------------------------------
A0ZJD3_NODSP/4-182--------------------------------------------------------------------------------
Q1MPK0_LAWIP/382-592--------------------------------------------------------------------------------
Q1D594_MYXXD/56-271--------------------------------------------------------------------------------
Q187L1_PEPD6/3-170--------------------------------------------------------------------------------
AMIB_BUCAI/7-226--------------------------------------------------------------------------------
A6M0K3_CLOB8/58-252--------------------------------------------------------------------------------
A5N4X3_CLOK5/47-233--------------------------------------------------------------------------------
Q6MJS0_BDEBA/26-247--------------------------------------------------------------------------------
Q9RRC5_DEIRA/161-334--------------------------------------------------------------------------------
Q1ATQ5_RUBXD/173-345--------------------------------------------------------------------------------
A4J7N3_DESRM/56-235--------------------------------------------------------------------------------
A8F7U0_THELT/27-198--------------------------------------------------------------------------------
A6LTJ0_CLOB8/6-175--------------------------------------------------------------------------------
Q1INP2_KORVE/300-482--------------------------------------------------------------------------------
Q67SM9_SYMTH/5-211--------------------------------------------------------------------------------
O67592_AQUAE/134-352--------------------------------------------------------------------------------
Q82B44_STRAW/116-328--------------------------------------------------------------------------------
Q5WG95_BACSK/210-375--------------------------------------------------------------------------------
Q2J4A8_FRASC/242-415--------------------------------------------------------------------------------
B4EFF6_BURCJ/51-248--------------------------------------------------------------------------------
E3E7W5_PAEPS/339-510--------------------------------------------------------------------------------
F0LNP9_VIBFN/125-343--------------------------------------------------------------------------------
O51610_BORBU/108-323--------------------------------------------------------------------------------
Q04G91_OENOB/125-301--------------------------------------------------------------------------------
Q0WI21_YERPE/190-404--------------------------------------------------------------------------------
Q183X8_PEPD6/3-169--------------------------------------------------------------------------------
Q2FYD8_STAA8/181-363--------------------------------------------------------------------------------
Q31QC3_SYNE7/389-561--------------------------------------------------------------------------------
Q6LSI5_PHOPR/4-180--------------------------------------------------------------------------------
Q816X3_BACCR/105-303--------------------------------------------------------------------------------
Q8F0Q8_LEPIN/141-356--------------------------------------------------------------------------------
Q8NL57_CORGL/209-386--------------------------------------------------------------------------------
Q8RE04_FUSNN/127-333--------------------------------------------------------------------------------
R5KJW1_9CLOT/62-237--------------------------------------------------------------------------------
R5TN65_9FIRM/5-172--------------------------------------------------------------------------------
R5TUS7_9FIRM/59-235--------------------------------------------------------------------------------
R5U1F0_9BACE/144-352--------------------------------------------------------------------------------
R6MZX5_9CLOT/5-182--------------------------------------------------------------------------------
R7FPN2_9FIRM/5-173--------------------------------------------------------------------------------

PF00246

Q7QC23_ANOGA/57-339-----------------------------------------------------L-LDLLAHLQK-DYPELAKVHTI----
Q7QC23_ANOGA/466-752-----------------------------------------------------M-VSYIQDLAS-NYPSITHLYTI----
Q7PRP0_ANOGA/83-361-----------------------------------------------------M-TRYLRATTA-RYPNLTALYSI----
Q7PSV3_ANOGA/117-396-----------------------------------------------------I-YAWMELLAE-RFPGAVSTLDI----
CBPB2_HUMAN/129-411-----------------------------------------------------I-YSWIEFITE-RHPDMLTKIHI----
CBPA3_HUMAN/125-404-----------------------------------------------------I-VAWTEKMMD-KYPEMVSRIKI----
AEBP1_MOUSE/561-887-----------------------------------------------------M-RQLMKAVNE-ECPTITRTYSL----
Q23318_CAEEL/147-446-----------------------------------------------------I-CDWMKDIER-KYPDKAKVFTM----
Q9W477_DROME/334-625-----------------------------------------------------I-KQFLQTLLE-TYSENVELIQI----
Q7Q316_ANOGA/128-403-----------------------------------------------------I-YTWLDTLIE-QYPDVVSPIVA----
CBPB1_BOVIN/125-404-----------------------------------------------------I-EAWTEQVAS-ENPDLISRSAI----
CBPE_BOVIN/63-363-----------------------------------------------------V-SVWLQCAA.-....VSRIYTV----
CBPA1_ANOGA/137-415-----------------------------------------------------I-HAWLDQLAS-EHPKEVELLDA----
CBPA1_DROME/131-415-----------------------------------------------------T-YAWLQSLAQ-TNPGVVTLIEG----
Q9VLZ1_DROME/129-409-----------------------------------------------------I-YAWLDDILA-AYPTITESFIV----
CBPD_ANAPL/54-375-----------------------------------------------------G-QALRDLVAE-APPGLARLFSI----
CBPD_ANAPL/942-1212-----------------------------------------------------L-SEFLRGLYL-NYPHITNLTSL----
Q9VCM8_DROME/185-464-----------------------------------------------------I-NAWLKKLAE-THPEVL.LVEL----
O17754_CAEEL/46-351-----------------------------------------------------L-EAKLGEINE-KCPEITTLYEI----
CBPD_RAT/70-372-----------------------------------------------------G-EALEAAAAA-GPPGLARLFSI----
CBPD_RAT/509-784-----------------------------------------------------M-EIFLRRFAN-EYPNITRLYSL----
YBJ7_SCHPO/189-484-----------------------------------------------------I-NSWLRLMAS-LYKDLSELVPV----
CBPA1_BOVIN/128-406-----------------------------------------------------I-YDFMDLLVA-EHPQLVSKLQI----
CBPN_HUMAN/31-330-----------------------------------------------------L-VRTLYKVQN-ECPGITRVYSI----
CBPA2_RAT/127-404-----------------------------------------------------I-YQEMDNLVA-ENPGLVSKVNL----
CBPB1_RAT/123-402-----------------------------------------------------I-EAWIQQVAT-DNPDLVTQSVI----
ECM14_YEAST/127-417-----------------------------------------------------I-YMWLDLLER-SFPSLVAVEHL----
CBPD_DROME/46-327-----------------------------------------------------L-EDLFAGLEK-AYPNQAKVHFL----
CBPD_DROME/462-752-----------------------------------------------------M-ESYLRAISS-SYPSLTRLYSI----
P73902_SYNY3/17-361-----------------------------------------------------I-DQFLQQLQT-SYGSLLTVQTI----
P91359_CAEEL/84-366-----------------------------------------------------M-TAWLKATRL-NYPNITHLYSA----
Q22825_CAEEL/64-346-----------------------------------------------------L-TDHIHNLHR-KFPNLTHIYSA----
Q7NMK5_GLOVI/121-539-----------------------------------------------------T-AVYWRKL.D-QESDRMRLVTI----
A8BM27_GIAIC/624-987-----------------------------------------------------L-LASADHKNI-DIPILSHKV.V----
Q7S312_NEUCR/128-414-----------------------------------------------------H-LTFLRDLVA-AHPNQSEIVTS----
CBPA1_MOUSE/128-406-----------------------------------------------------I-YEFMDLLVT-EHPQLVSKIQI----
Q829W4_STRAW/126-404-----------------------------------------------------L-EEEIVRTGA-AHPDLTKVVSI----
CBPA4_HUMAN/129-408-----------------------------------------------------I-YHEMDNIAA-DFPDLARRVKI----
Q897X5_CLOTE/135-416-----------------------------------------------------L-ERDINGLKR-RYPFI.EVGSI----
Q8ESH0_OCEIH/55-359-----------------------------------------------------E-LEFLEEVAT-L.SDRVSYDQI----
Q8IMH9_DROME/186-465-----------------------------------------------------Y-LNVIDARQG-SDKRFTRCVLV----
Q8PAS3_XANCP/44-407-----------------------------------------------------V-IALCDAFAQ-RYPQAVRCISF----
CBPA5_MOUSE/145-423-----------------------------------------------------I-YSWIDNFVA-EHSNLVSKIHI----
Q8TK20_METAC/106-433-----------------------------------------------------V-ESALINLKA-LHPDLVTLIEL----
Q961J8_DROME/129-406-----------------------------------------------------I-NAYLDELAA-AYPSRVSVQVA----
Q9A9J5_CAUCR/82-489-----------------------------------------------------Y-EAYLKAL.A-AKSDRMKLVDM----
Q9BL88_CAEEL/131-431-----------------------------------------------------V-INYLNSLAI-TYPELVSVQPI----
Q9TZC6_CAEEL/153-440-----------------------------------------------------M-VEFMKLLSE-QKSDMVEMVKV----
Q9VRZ3_DROME/121-402-----------------------------------------------------I-YAWLDVIED-RYPDIVTPFTI----
Q9VS63_DROME/44-354-----------------------------------------------------V-NQYLQYLAQ-RYAHFVHVHIL----
Q9VS67_DROME/133-412-----------------------------------------------------I-NQFIEDLAG-EHPRRVFLKTV----
Q9VX86_DROME/1095-1422-----------------------------------------------------I-VKYLETVRM-RHPQLVELIHI----
Q9W475_DROME/827-1104-----------------------------------------------------I-HGFIDYMAK-TYPDICSTEII----
Q9W478_DROME/154-431-----------------------------------------------------I-YSFMREIRT-KFPNIVRLYTI----
Q9XU75_CAEEL/167-465-----------------------------------------------------M-VKYMRTIEF-YYPRIAKIVRI----
B1W3W4_STRGG/138-427-----------------------------------------------------M-NAAIDARIA-ANPSIMSKRVI----
C4QKW6_SCHMA/144-418-----------------------------------------------------I-VQYLDQLSQ-MRSH.MKVEDF----
E9EJD9_METAR/109-392-----------------------------------------------------.-LQWMKDIAS-QYPSNVKSVTS----
F5HE64_PORGI/124-385-----------------------------------------------------.-ISMMEEFQT-KYPSLCTTSVI----
G3QW16_GORGO/122-429-----------------------------------------------------M-RQLMKVVNE-MCPNITRIYNI----
H3C3M9_TETNG/129-405-----------------------------------------------------.-YRFQDMLVA-ENPSLVSKIVI----
I3JV32_ORENI/42-340-----------------------------------------------------.-.....SVWL-QCPTITRIYTI----
Q0E9F9_DROME/159-437-----------------------------------------------------I-YEWLDKMVE-KYPNRVTVLDM----
Q16RZ2_AEDAE/130-406-----------------------------------------------------I-HAWLDKLAS-QYDQV.ELLEG----
Q1K5C5_NEUCR/204-501-----------------------------------------------------I-TSWMALMET-MFPSIAKMESI----
Q9VL87_DROME/126-405-----------------------------------------------------.-HRWMQNLVG-KYPDVVSVFVA----
Q9VLZ2_DROME/128-406-----------------------------------------------------I-EAWLDEILN-AYPSVTEEFIV----
Q9VS64_DROME/153-428-----------------------------------------------------.-LSFMSGLAA-RYPQFCRYESL----
Q9VS66_DROME/130-410-----------------------------------------------------I-INYIDDLAQ-RFPSRVFVKTV----
Q9VS80_DROME/44-327-----------------------------------------------------I-MQYLDELAL-SHSNRVTLKDV----

PF04952

ASTE_ECOLI/42-322--------------------------------------------------------------------------------
ASTE_PSESM/48-330--------------------------------------------------------------------------------
ACY3_HUMAN/10-301--------------------------------------------------------------------------------
Q88EN1_PSEPK/47-329--------------------------------------------------------------------------------
ACY2_BOVIN/10-301--------------------------------------------------------------------------------
A9CH33_AGRT5/52-333--------------------------------------------------------------------------------
ASTE_SALTY/42-322--------------------------------------------------------------------------------
ASPA_SYNY3/5-284--------------------------------------------------------------------------------
Q87RV7_VIBPA/50-319--------------------------------------------------------------------------------
ACY3_MOUSE/10-300--------------------------------------------------------------------------------
ASTE_SHEON/52-339--------------------------------------------------------------------------------
Q987A0_RHILO/66-347--------------------------------------------------------------------------------
Q92SQ8_RHIME/30-339--------------------------------------------------------------------------------
ASTE_VIBCH/52-331--------------------------------------------------------------------------------
ASPA_NOSS1/3-288--------------------------------------------------------------------------------
ASTE_PSEPK/48-330--------------------------------------------------------------------------------
Q87HF0_VIBPA/56-331--------------------------------------------------------------------------------
Q9HNH1_HALSA/42-314--------------------------------------------------------------------------------
ASPA_PROMA/2-289--------------------------------------------------------------------------------
ASTE_YERPE/42-323--------------------------------------------------------------------------------
ASTE_PSEAE/48-331--------------------------------------------------------------------------------
Q89N67_BRADU/46-333--------------------------------------------------------------------------------
Q98JD4_RHILO/49-329--------------------------------------------------------------------------------
Q8EGL7_SHEON/48-317--------------------------------------------------------------------------------
A9CLI1_AGRT5/46-332--------------------------------------------------------------------------------
Q8EAC2_SHEON/33-365--------------------------------------------------------------------------------
Q92WC2_RHIME/47-328--------------------------------------------------------------------------------
Q98AA0_RHILO/43-328--------------------------------------------------------------------------------
Q3INS5_NATPD/45-316--------------------------------------------------------------------------------
Q7MEW4_VIBVY/56-329--------------------------------------------------------------------------------
ASTE_VIBVY/53-329--------------------------------------------------------------------------------

PF10994

A0L457_MAGSM/24-365-----------------------------------------------------FPATSYQQLRE-HFLAAAKGCPH----
A4XNS7_PSEMY/6-345-----------------------------------------------------F.AQSYAEARQ-KFLASCARRGL----
Q4DHE8_TRYCC/47-382-----------------------------------------------------F.SQSYHAARM-KFKDAAKEAKA----
Q0RN36_FRAAA/3-356-----------------------------------------------------F.SANYEQARQ-RFLAAARDRGA----
A4HIN1_LEIBR/48-391-----------------------------------------------------Y.SSSYQLARE-RFLAAAKTAHA----
Q213B6_RHOPB/13-353-----------------------------------------------------F.ALDYTGARG-KFVATATALGC----
Q7VZV3_BORPE/14-354-----------------------------------------------------Y.ALDYHRARD-KFRAAAAAAGA----
A7HS30_PARL1/18-367-----------------------------------------------------F.SDTYVEARA-QFLAAAEAAGG----
A1VW91_POLNA/13-355-----------------------------------------------------F.SLNYAQARA-KFLEAAETAGL----
A1W380_ACISJ/8-351-----------------------------------------------------F.AASYAQARA-QFVGAAAVAGL----
Q12BQ5_POLSJ/8-351-----------------------------------------------------F.SSSYAQARV-KFLEAAAAAGL----
Q2KVE6_BORA1/8-348-----------------------------------------------------F.CHNYVEARN-AFQEAARQQKA----
A9BGZ8_PETMO/4-348-----------------------------------------------------Y.SYDYDECRK-NFYTFENELKK----
Q0K9X8_CUPNH/4-344-----------------------------------------------------F.SRSYAEARQ-KFLDAARTAGA----
Q586Z8_TRYB2/47-385-----------------------------------------------------F.AQSFHVARE-KFTSAATKAGA----
Q118U2_TRIEI/12-348-----------------------------------------------------F.SETYNEARN-KFCDAAKAANA----
A1TK81_ACIAC/8-351-----------------------------------------------------F.SSTYARARA-QFLDAAAAAGL----
A9KLP9_CLOPH/53-407-----------------------------------------------------F.LNEYSEVRE-NIAKKAEELAA----
A5V6N1_SPHWW/7-348-----------------------------------------------------F.APDYDGARE-TFLQAAELARL----
A7HTE6_PARL1/10-349-----------------------------------------------------F.SQSYAEARR-RFLAAAEAAGA----
Q1LB58_RALME/20-354-----------------------------------------------------F.SRTYAEARQ-KFLQAAASRGL----
Q1LNH9_RALME/10-350-----------------------------------------------------F.ARSYAEARQ-KFLAAARACGA----
B2UCT3_RALPJ/7-346-----------------------------------------------------F.SQTYDEARG-KFLAAAQTRRL----
Q7VV37_BORPE/7-348-----------------------------------------------------F.SETYAQARA-KFLEAARAAGA----
Q8XVM7_RALSO/9-348-----------------------------------------------------F.AQTYDQARA-RFLDAARARGL----

PF17033

O25708_HELPY/1-227-----------------------------------------------------MKKIWLLVWGL-CSWVFLHAIEM----
D3UGK0_HELM1/1-188-----------------------------------------------------M..........-...........----

PF02127

DNPEP_MOUSE/22-460FVNRSPSPFHVVAECRSRLL.QAGFRELKETEGWD..I.VPENKYFLTRNSSSIIAFAVGG-QY----------------
APEA_BORBU/28-456FISKFKTEREVTAYALDKAK.KLGFINAEEKKNL.....MPGDKIFYTCREK.SVAFAIIG-KN----------------
AMPL_YEAST/59-501FIYKNPTTYHVVSFFAELLD.KHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSAFILGK-NW----------------
DNPEP_YEAST/25-478FLNSSHSPYHTVHNIKKHLV.SNGFKELSERDSWAGHV.AQKGKYFVTRNGSSIIAFAVGG-KW----------------
DNPEP_SCHPO/15-453FVNASPTPYHAVQNLAEHYM.SHGFQYLSEKSDWQSKI.EPGNSYFVTRNKSSIIAFSIGK-KW----------------
APEB_MYCLE/11-421FINASPSPFHVCATVAGRLL.DAGYAELSEVERWP..D.HP.GRYFIVRAGS.LVAWSAGQ-GV----------------
DNPEP_CAEEL/22-459YLNKAVTPFHATQEVKDRLL.QAGFTELPESGHWD..I.QPTSKYFVTKNRSAILAFAVGG-SY----------------
APEB_BORBU/15-419LLDNSPTPYHLVNYIEEKLINYFNAQQLKLNEKWK..I.KT.GSYYIKKEGTSLIAFNIDV-K.----------------

PF05343

Q8R656_FUSNN/53-342---------------------------------------------------GALIAY.IKG-.K----------------
Q8U0N9_PYRFU/45-335---------------------------------------------------GNVIAH.KKG-..----------------
Q8XLP6_CLOPE/50-337---------------------------------------------------GCGVIT.IPG-.E----------------
Q9A1S8_STRP1/45-336---------------------------------------------------GGIFGI.RDS-KA----------------
Q97MI2_CLOAB/40-324---------------------------------------------------GNIIAH.KKG-.S----------------
Q8RCI6_THETN/40-326---------------------------------------------------GNLIAC.KKG-.K----------------
SGCX_SALTY/46-346---------------------------------------------------GNVVAR.YGS-DK----------------
YSDC_BACSU/48-342---------------------------------------------------GSLIAK.KTG-.A----------------
Q9K874_BACHD/48-342---------------------------------------------------GSLVAK.KVG-.K----------------
Q9PQL1_UREPA/50-344---------------------------------------------------GSIIF..KKT-NS----------------
YHFE_BACSU/48-336---------------------------------------------------GGLIAT.LPG-.R----------------
P70801_NOSS1/49-337---------------------------------------------------.NIIAK.IPG-.K----------------
Q92W97_RHIME/53-341---------------------------------------------------GAIRAL.RPG-.A----------------
Q9X0D8_THEMA/46-324---------------------------------------------------GSLIGY.KKG-..----------------
YTOP_BACSU/46-337---------------------------------------------------GSVFGV.RRG-.A----------------
Q9K7V2_BACHD/46-337---------------------------------------------------GSIFGV.KRG-.N----------------
Q97L72_CLOAB/48-335---------------------------------------------------GNIMAT.LPG-.K----------------
AMPK_PYRFU/45-331---------------------------------------------------GNVIAH.FKG-..----------------
Q9X0D9_THEMA/40-324---------------------------------------------------GNLIAL.KRG-.R----------------
Q8ZX99_PYRAE/45-340---------------------------------------------------GNVIGV.KKG-..----------------
Q97MI3_CLOAB/43-327---------------------------------------------------NNIYIN.KRG-..----------------
Q8TYB9_METKA/48-341---------------------------------------------------GNVIGT.IEG-..----------------
O26537_METTH/45-335---------------------------------------------------GNIIAV.KRG-..----------------
Q9CIH3_LACLA/44-336---------------------------------------------------GGIFVT.KTS-KV----------------
Q8RCI5_THETN/45-320---------------------------------------------------GNMICV.KKG-..----------------
Q98PJ2_MYCPU/53-348---------------------------------------------------GSLILKHEKS-KS----------------
Q8RCI7_THETN/44-328---------------------------------------------------GNLIFK.KKG-..----------------
Q9YCC1_AERPE/44-332---------------------------------------------------GNVVVN.PSG-..----------------
FRVX_ECOLI/43-333---------------------------------------------------GSFVAR.KGN-..----------------
Q8TJD6_METAC/42-336---------------------------------------------------GNLIAI.KEG-..----------------
Q8Y6S2_LISMO/46-337---------------------------------------------------GGIFGV.RHG-.A----------------
Y555_METJA/44-338---------------------------------------------------GNLIAK.RGN-..----------------
Q9RXS7_DEIRA/71-359---------------------------------------------------GSVYAE.LGP-..----------------
O28479_ARCFU/2-292---------------------------------------------------GNLICT.KNG-..----------------
Q9X0E0_THEMA/42-324---------------------------------------------------GNLIVW.KGS-..----------------
Q9HPS1_HALSA/46-335---------------------------------------------------GNAVAV.AEG-..----------------
Q8Y7Q5_LISMO/45-340---------------------------------------------------GSAVAK.KVG-.A----------------
Q8ZX44_PYRAE/36-306---------------------------------------------------GNVVVR.GS.-..----------------
Q9HYE5_PSEAE/53-341---------------------------------------------------GTIRAT.LQG-.R----------------
Q8Y8C6_LISMO/51-339---------------------------------------------------GGLIVT.LPG-.K----------------
Q8U3T6_PYRFU/43-324---------------------------------------------------GNLIVE.LGE-..----------------
A3DD15_CLOTH/42-319---------------------------------------------------GNLIAV.KKG-..----------------
YPDE_ECOLI/43-325---------------------------------------------------GSVLIR.LNE-..----------------
Q2FVF9_STAA8/45-340---------------------------------------------------GGIFGK.KNA-.E----------------
Q2FXI5_STAA8/49-339---------------------------------------------------GGFFGV.KKS-KN----------------
Q2FYS0_STAA8/45-333---------------------------------------------------GALLIT.VPG-.K----------------
Q8DNJ7_STRR6/45-333---------------------------------------------------GGIFGI.KHS-EA----------------
Q8DQQ2_STRR6/45-334---------------------------------------------------GGVNVT.IKG-.Q----------------

PF01546

Q7P4W2_FUSNV/78-489-----------------------------------------------------ILQGHMDM-VC-E..KELDS.NH....
F6E743_SINMK/91-555-----------------------------------------------------VMAGHFDT-VS-....TDNYHELKALA
B0R3D0_HALS3/106-420-----------------------------------------------------GLRVDIDA-LH-...ITESE.AD..DH
C9MJX8_HAEIF/104-420-----------------------------------------------------ALRFDIDC-VN-...VTETR.SP..EH
Q8ENA4_OCEIH/109-426-----------------------------------------------------ALRFDIDA-LP-...INEST.HQ..SH
Q8XLK9_CLOPE/110-427-----------------------------------------------------ALRFDIDG-VK-...VLECE.NN..EH
Q891H7_CLOTE/124-441-----------------------------------------------------AFRFDIDA-NE-...GIESN.SL..DH
Q8ELE6_OCEIH/107-424-----------------------------------------------------ALRFDMDA-LP-...IHESE.EA..NH
Q7N102_PHOLL/113-431-----------------------------------------------------AFRVDMDA-LD-...LNEEQ.TH..VH
IAAH_ENTAG/112-429-----------------------------------------------------AFRVDMDA-LD-...LNEDT.DG..HH
A0A017IRJ7_ECOLX/112-429-----------------------------------------------------AFRVDMDA-LD-...LSEEQ.DV..SH
Q98IQ8_RHILO/70-379-----------------------------------------------------LFRSELDA-LP-...IEELS..G..V.
Q44415_RHIRD/55-364-----------------------------------------------------LIRSELDA-LP-...IHEKS..E..A.
J7JID3_BACIU/68-369-----------------------------------------------------AVRADIDA-LW-....QEVN..G....
B7H7C6_BACC4/66-365-----------------------------------------------------AIRADMDA-LW-......QEVNG....
A0A028XUT5_STAEP/63-379-----------------------------------------------------AFRADIDA-LP-...IYEEN..D..I.
A0A008B390_STAAU/63-379-----------------------------------------------------AYRADIDA-LP-...ILEEN..D..V.
A9NBI9_COXBR/70-381-----------------------------------------------------AFHANMDA-LP-...LAETN..T..F.
Y4TI_RHISN/82-394-----------------------------------------------------AVRGDIDA-LP-...IQETR.DD..L.
Q8FLW7_COREF/70-397-----------------------------------------------------AFRADTDG-LP-...IKEDT..G..A.
Q8GGD4_CORST/76-395-----------------------------------------------------AFRADFDA-LP-...ITENT.GL....
Q8FMB2_COREF/72-389-----------------------------------------------------ALRGDIDA-LP-...VTEQT.GL....
Q8EMA9_OCEIH/73-390-----------------------------------------------------ALRADMDA-LP-...IQEQT..H..T.
Q8TRI4_METAC/86-410-----------------------------------------------------ALRTDTDG-LQ-...VQEEF.TE..RN
Q8PUV0_METMA/80-404-----------------------------------------------------ALRTDTDG-LQ-...VQEEP.AE..RN
DAPEL_OCEIH/64-370-----------------------------------------------------GFRADIDG-LP-...ILEQT..N..L.
A0A024I2K8_LISMN/64-370-----------------------------------------------------GYRTDIDA-LP-...ITEET..E..L.
E8VJS1_BACST/65-371-----------------------------------------------------AYRADIDA-LS-...IEEQT..G..L.
C2T584_BACCE/65-371-----------------------------------------------------GYRADIDG-LP-...ITEET..G..Y.
A0A021WGD8_LACPN/70-372-----------------------------------------------------GYRTDIDA-LP-...VTENT..G..L.
A0A038BMH8_ENTFL/79-386-----------------------------------------------------GWRADIDG-LP-...IQEEV..V..S.
I6TNL4_STRMG/66-373-----------------------------------------------------GWRTDIDA-LP-...VVEET..G..L.
A0A034X6D7_STREE/65-372-----------------------------------------------------GWRTDIDG-LP-...IVEQT..G..L.
Q7USI1_RHOBA/111-424-----------------------------------------------------AIRADIDA-LP-...IQTMV..Q..H.
A0A059MYA5_ENTFL/78-393-----------------------------------------------------LLRADIDA-LE-...LPDAT..G..A.
Q8FRQ2_COREF/75-384-----------------------------------------------------AFRADIDA-LP-...LTETT.GL....
Q82HY6_STRAW/97-413-----------------------------------------------------ALRADIDA-LP-...IPDAK.VD..C.
Q9AK43_STRCO/90-406-----------------------------------------------------ALRADIDA-LP-...IPDTK.SE..C.
Q8ENA3_OCEIH/73-389-----------------------------------------------------ALRADMDA-LP-...IQEET..D..V.
Q7W8K8_BORPA/72-383-----------------------------------------------------ILRADMDA-LH-...IAEAP..A..ED
Q984M2_RHILO/65-375-----------------------------------------------------ALRADMDA-LR-...ISEQS..S..A.
Q89RR4_BRADU/35-345-----------------------------------------------------GLRADMDA-LP-...ITEDT..G..L.
A3YNK2_CAMJU/72-380-----------------------------------------------------GLRADMDA-LP-...LQECT..N..L.
F3K8R3_PSESZ/71-384-----------------------------------------------------ALRADMDA-LP-...IQEEN..T..F.
A0A038FT89_9BRAD/73-382-----------------------------------------------------GLRADMDA-LP-....MEEN.TNLKW.
A9CF81_AGRT5/85-394-----------------------------------------------------GLRADMDA-LP-...MPEET..G..L.
A0A038HDZ5_BORBO/77-391-----------------------------------------------------GLRADMDA-LP-...MTEDN..D..F.
Q88JE5_PSEPK/77-391-----------------------------------------------------GLRADMDA-LP-...MGEKN..A..F.
Q7NW88_CHRVO/76-389-----------------------------------------------------GIRADMDA-LP-...IHEET..G..L.
A0A009DL60_ECOLX/71-385-----------------------------------------------------GLRADMDA-LP-...IYENS.GK....
M4MSU5_SINM2/76-388-----------------------------------------------------GIRADIDA-LP-...IQEET.GV....
Q7CSF2_AGRT5/83-392-----------------------------------------------------GIRADIDA-LP-...IHEET.GL....
A0A022P5B7_PSEAI/74-386-----------------------------------------------------GLRADMDA-LP-...IQEAT.GL....
A0A030R337_PSEAI/76-386-----------------------------------------------------GLRADMDA-LP-...IVEAT.GL....
F6C4J2_SINMB/72-385-----------------------------------------------------GLRADMDA-LA-...MPELA..D..R.
F3IK87_PSESL/68-380-----------------------------------------------------GIRADMDA-LP-...IQELG..D..S.
Q7NWU5_CHRVO/81-393-----------------------------------------------------GLRADMDA-LH-...LHEQG..E..L.
Q7W1K2_BORPA/73-390-----------------------------------------------------VLRADMDA-LP-...IHETN..T..F.
A0A038IB11_BORBO/72-394-----------------------------------------------------GLRADMDA-LP-...MPEHN..R..F.
Q8XVG0_RALSO/71-391-----------------------------------------------------GLRADMDA-LP-...LAEAN..Q..F.
A0A058UXQ3_BORPT/73-393-----------------------------------------------------GLRADMDA-LP-...MQEAN..T..F.
Q981W6_RHILO/74-384-----------------------------------------------------GLRADMDA-LP-...IHETP..G..K.
Q89IE8_BRADU/75-385-----------------------------------------------------GLRADMDA-LP-...ITETS..G..V.
A0A038FZH1_9BRAD/77-385-----------------------------------------------------GLRADMDA-LP-...VEEQT..N..L.
A9CGN8_AGRT5/61-370-----------------------------------------------------GFRSDMDA-LP-...ILETS..G..K.
A0A024EVG4_BRUCA/74-383-----------------------------------------------------GLRADMDA-LP-...ITETS..G..A.
F5J5Y5_9RHIZ/74-383-----------------------------------------------------GFRADMDA-LP-...ILEET..G..K.
Q98FX1_RHILO/74-383-----------------------------------------------------GLRADMDA-LP-...LNEIT..G..K.
F6BSJ5_SINMB/74-383-----------------------------------------------------GLRADMDA-LP-...ITEASGRA..W.
Q8KDJ8_CHLTE/87-402-----------------------------------------------------ALRADIDA-LP-...LQEEN..G..H.
C5EAE5_BIFLI/70-377-----------------------------------------------------GLRADIDG-LP-...IVEDS.GL....
B0RWU7_XANCB/97-429-----------------------------------------------------ALRADMDA-LP-...VTEQT..G..L.
Q7NHJ5_GLOVI/90-402-----------------------------------------------------GVRADMDG-LP-...IAEQT..E..L.
F7UTZ1_SYNYG/73-386-----------------------------------------------------AIRTDMDA-LP-...IEEMV..S..L.
Q8DMU8_THEEB/75-387-----------------------------------------------------AIRTDMDA-LP-...IQERT..G..L.
Q8YV79_NOSS1/124-437-----------------------------------------------------AIRTDMDA-LP-...IQERT..G..L.
Q7UZP5_PROMP/74-383-----------------------------------------------------GLRVDMDA-LP-...IYENT..N..L.
Q7V9Q6_PROMA/75-386-----------------------------------------------------GFRVDMDA-LP-...VEEKT..G..L.
Q7V908_PROMM/75-385-----------------------------------------------------GLRVDMDA-LP-...VEERT..G..L.
Q7U9W5_SYNPX/74-384-----------------------------------------------------GLRVDMDA-LP-...VEERT..G..L.
J0DWY9_STAEP/74-385-----------------------------------------------------ALRADFDA-LP-...VQELN..D..V.
A0A028YKF6_STAAU/73-384-----------------------------------------------------ALRAVFDA-LP-...VEELN..D..V.
Q891H8_CLOTE/88-404-----------------------------------------------------LLRADMDA-LP-...IEETT..D..L.
D5RAJ9_FUSNC/74-389-----------------------------------------------------LLRADMDA-LP-...ITEES..R..C.
Q7P6B6_FUSNV/81-400-----------------------------------------------------GLRADMDA-LP-...IEEET..G..L.
Q8RC51_THETN/70-383-----------------------------------------------------AIRADMDA-LP-...IQEEN..E..V.
Q8XL37_CLOPE/78-393-----------------------------------------------------ALRADIDG-LP-...MDDKK..T..C.
F0KAF7_CLOAE/71-388-----------------------------------------------------GLRGDMDA-LP-L..MENNE..N..R.
A0A028XGX8_STAEP/63-369-----------------------------------------------------AVRTDIDA-LP-...IEEQV..K..H.
A0A028WP48_STAAU/63-369-----------------------------------------------------AVRADIDA-LP-...IQELV..E..Q.
Q9A5J1_CAUCR/78-407-----------------------------------------------------ALRADMDA-LP-...VEEKT..G..L.
D2NV40_LISM1/75-390-----------------------------------------------------ALRADFDA-LP-...IEEQT..E..L.
I5BN32_STRAG/84-398-----------------------------------------------------ALRADFDA-LP-...IQEET..G..L.
C8JSG0_LISMN/79-393-----------------------------------------------------AIRADFDA-LP-...IQEET..G..L.
Q8NYT5_STAAW/74-386-----------------------------------------------------AIRADFDA-LP-...ITEDT..G..L.
A0A028XR85_STAEP/74-388-----------------------------------------------------AIRADFDA-LP-...IKEET..E..L.
M2D0S1_STRMG/65-371-----------------------------------------------------ALRADIDA-LP-...IIEKT..G..L.
G4ESH8_BACIU/99-404-----------------------------------------------------ALRADIDA-LP-....IEEKTGL....
L8ATH6_BACIU/69-374-----------------------------------------------------AIRADIDA-LP-...IQEQT.NL....
C2T4B5_BACCE/70-375-----------------------------------------------------AVRADIDA-LP-...IQEET.HL....
J7JLF4_BACIU/79-392-----------------------------------------------------ALRADFDA-LP-...IQDEK..D..V.
Q8ERY9_OCEIH/74-385-----------------------------------------------------ALRADFDG-LP-...IQDEK..N..V.
G2K553_LISMN/73-386-----------------------------------------------------ALRADMDA-LP-...VQELN.QD..L.
Q839D6_ENTFA/58-371-----------------------------------------------------ALRADMDA-LP-...VQELN.ED..L.
D0KPT8_SULS9/77-389-----------------------------------------------------ALRADMDA-LP-...VEETS..D..V.
Q97AQ8_THEVO/83-399-----------------------------------------------------GLRADMDA-LP-...VQEQT..G..L.
G7QPA7_LEPII/71-388-----------------------------------------------------LVRADMDA-LP-...IFEES..N..Q.
C2SYA4_BACCE/72-385-----------------------------------------------------AIRADIDA-LP-...IQEET..S..K.
B7HDC6_BACC4/72-385-----------------------------------------------------AIRADMDA-LP-...IHEEN..E..F.
Q7NNN7_GLOVI/86-399-----------------------------------------------------AVRADMDA-LP-...ILEGN..R..V.
L8AMZ5_BACIU/97-412-----------------------------------------------------AIRADMDA-LP-...VTEEN..E..V.
Q8DG76_THEEB/92-406-----------------------------------------------------AIRADMDA-LP-...VQEEN..N..K.
O58754_PYRHO/73-383-----------------------------------------------------ALRADMDA-LP-...IQEEN.DV....
O58453_PYRHO/75-385-----------------------------------------------------ALRADMDA-LP-...IQEEN.DV....
Q8U375_PYRFU/127-437-----------------------------------------------------ALRADMDA-LP-...IQEEN.EV....
A2XVL9_ORYSI/93-409-----------------------------------------------------ALRADMDA-LP-....VQEL.VE..W.
ILR1_ARATH/109-425-----------------------------------------------------GLRADMDA-LP-....LQEL.VE..W.
A2XNS9_ORYSI/85-406-----------------------------------------------------GLRADMDA-LP-....IQEM.VE..W.
ILL8_ORYSJ/116-436-----------------------------------------------------ALRADMDA-LP-....LQEL.VD..W.
ILL9_ORYSJ/112-431-----------------------------------------------------ALRADMDA-LP-....VQEL.VD..W.
ILL7_ORYSJ/127-444-----------------------------------------------------ALRADMDA-LP-....LQEL.VD..W.
Q0WNN8_ARATH/146-457-----------------------------------------------------AVRADMDA-LP-....IQEA.VE..W.
ILL1_ARATH/107-420-----------------------------------------------------ALRADMDA-LP-....IQEA.VE..W.
ILL4_ARATH/105-421-----------------------------------------------------ALRADMDA-LA-....MQEM.VE..W.
B7EYM8_ORYSJ/106-423-----------------------------------------------------ALRADMDA-LP-....MQES.VE..W.
LYSK_PYRAE/58-333-----------------------------------------------------WLHAHMDT-VP-..........G....
B8GVH2_CAUCN/98-396-----------------------------------------------------ILTGHYDT-VY-....PENS.......
Q89D44_BRADU/88-452-----------------------------------------------------LIYGHGDV-VD-...GMEGE.....WR
F3IC80_PSESL/90-456-----------------------------------------------------LSYGHGDV-VR-.....GYD.AQ..WQ
A0A038G1I8_9BRAD/85-459-----------------------------------------------------IFYGHYDV-QP-....VDPL.DL..WH
Q98GJ6_RHILO/84-458-----------------------------------------------------LFYGHYDV-QP-....VDPI.EL..WE
Q7D266_AGRT5/85-459-----------------------------------------------------LFYGHYDV-QP-....VDPL.EL..WE
A5VN62_BRUO2/87-465-----------------------------------------------------LFYGHYDV-QP-....VDPL.SL..WE
Q83F46_COXBU/98-471-----------------------------------------------------LLYGHMDK-QP-.........EMKGWD
A0A058WBJ1_BORBO/107-486-----------------------------------------------------LLYGHLDK-QP-.........EFSGWR
M1YBI8_STRAG/86-456-----------------------------------------------------IFYNHYDT-VP-.....ADEVEQ..WT
I6L916_STRMU/86-455-----------------------------------------------------IFYNHYDT-VP-...ADNDQ..I..WT
J1RS12_STREE/86-455-----------------------------------------------------IFYNHYDT-VP-...ADGDQ..V..WT
Q9Z6S9_CHLPN/119-487-----------------------------------------------------MLYNHYDV-QP-....AQLS.DG..WK
Q822A3_CHLCV/82-450-----------------------------------------------------LLYNHYDV-QP-.....ADLADG..WL
Q8FME3_COREF/102-468-----------------------------------------------------LLYSHFDV-VP-....AGPL.DL..WT
D6ETY2_STRLI/86-447-----------------------------------------------------LLYAHYDV-QP-....PLDE.AG..WA
Q83GM1_TROWT/81-442-----------------------------------------------------LLYAHHDV-QP-....AGDP.DK..WV
Q8G5E2_BIFLO/92-452-----------------------------------------------------LLYAHHDV-QP-...VPDPA..E..WN
A0A038FC93_MYCTX/102-459-----------------------------------------------------LLYAHHDV-QP-.....EGDRGQ..WV
Q974N2_SULTO/65-421-----------------------------------------------------LIYNHYDV-QP-....VEPL.DK..WN
D0KPI1_SULS9/67-433-----------------------------------------------------LIYNHYDV-QP-....VDPI.SE..WK
Q972L9_SULTO/72-422-----------------------------------------------------LVYNHYDV-QP-....VDPL.NE..WK
Q9RSV5_DEIRA/73-444-----------------------------------------------------LIYNHYDV-QP-.....EDPLEL..WD
Q8AWF8_XENLA/112-483-----------------------------------------------------CFYGHMDV-QP-.....AKQTDG..WL
CNDP1_MOUSE/103-477-----------------------------------------------------CFYGHLDV-QP-.....AQKDDG..WL
DUG1_SCHPO/95-470-----------------------------------------------------LIYNHFDV-QP-.....ASLEDG..WS
Q870Z2_NEUCS/93-468-----------------------------------------------------LVYGHYDV-QP-.....AEKSDG..WD
Q7QJQ9_ANOGA/101-476-----------------------------------------------------CLYGHLDV-QP-.....AILEDG..WA
O18000_CAEEL/95-469-----------------------------------------------------LVYGHLDV-QP-.....AAKSDG..WD
Q98AF9_RHILO/84-453-----------------------------------------------------LIYGHYDV-QP-.....PDPLDA..WV
Q82IQ8_STRAW/88-458-----------------------------------------------------LVYGHHDV-QP-.....AAREDG..WD
Q9K657_BACHD/82-451-----------------------------------------------------LIYGHYDV-QP-.....VDPINL..WE
Q8CUJ6_OCEIH/84-452-----------------------------------------------------LLYGHYDV-QP-.....VDPIEL..WD
Q7UJ49_RHOBA/95-464-----------------------------------------------------LVYGHYDV-QP-.....PEPLDL..WT
Q9RSU7_DEIRA/81-449-----------------------------------------------------LIYGHYDV-QP-.....EAPLEE..WH
Q8A601_BACTN/82-450-----------------------------------------------------LVYAHYDV-MP-.....AEPLEL..WK
I9PEM2_PORGN/81-449-----------------------------------------------------LVYAHYDV-MP-.....PEPLEL..WK
Q82IK8_STRAW/68-359-----------------------------------------------------ILAGHIDT-VP-...IADNV.......
Q9FBL9_STRCO/68-359-----------------------------------------------------ILAGHIDT-VP-...IAGNV.......
I0LIF7_CORGK/73-369-----------------------------------------------------MLAGHIDT-VP-...IADNL.......
Q8FQF3_COREF/51-354-----------------------------------------------------ILAGHLDT-VP-...IADNV.......
Q8ESD5_OCEIH/87-390-----------------------------------------------------VISAHLDT-VF-...............
Q9A411_CAUCR/97-405-----------------------------------------------------VIAAHLDT-VF-....PEGT.......
Q831D3_ENTFA/57-417-----------------------------------------------------AFDGHMDT-VG-....IGEM.SN..WK
A0A009ETB1_ECOLX/77-398-----------------------------------------------------AMDAHIDT-VG-....IGNI.KN..WD
Q9CI04_LACLA/65-368-----------------------------------------------------ILTGHVDT-VV-....SGHL.AD..WK
ARGE_DICDI/99-443-----------------------------------------------------FVGSHLDV-VP-...ADKTA.....WD
ARGE_ARATH/97-436-----------------------------------------------------FVGMHMDV-VT-...ANPDD.....WE
Q9FVL5_CUCPE/95-434-----------------------------------------------------FVGSHMDV-VP-...ADPSA.....WT
Q9MB49_CITLA/95-434-----------------------------------------------------FVGSHMDV-VP-.....ANR.DT..WE
YE48_SCHPO/193-589-----------------------------------------------------VLMGHQDV-VP-...VNQASLDR..WY
CBPS_YEAST/164-571-----------------------------------------------------LLMAHQDV-VP-...VNNETLSS..WK
Q8RTT1_9PROT/116-483-----------------------------------------------------LFTAHTDV-VP-...IEIGTEDG..WQ
A6AYV0_VIBPH/125-505-----------------------------------------------------VFMAHQDV-VP-...VAEESRSQ..WK
P20D1_MOUSE/121-489-----------------------------------------------------MLMAHIDV-VP-...APEEG.....WE
Q9AA70_CAUCR/101-467-----------------------------------------------------VLMAHQDV-VP-...VTPGSEGQ..WT
Q8XSI7_RALSO/130-504-----------------------------------------------------LLMAHQDV-VP-...VAPGTEGD..WT
B8H457_CAUCN/106-469-----------------------------------------------------LLLAHIDV-VE-......AKRED..WT
M4SXM5_LEGPN/102-463-----------------------------------------------------LLLAHTDV-VE-...AKASD.....WS
Q8TV20_METKA/71-376-----------------------------------------------------VLNAHLDT-VP-....PGDG.....WE
Q7X340_9BACT/107-429-----------------------------------------------------LLIGHLDT-VF-....EADS.......
Q88A71_PSESM/106-428-----------------------------------------------------LLIGHLDT-VF-......PQ.TS....
Q9WXY3_THEMA/60-350-----------------------------------------------------TLIGHLDT-VF-...PEGESKRR....
Q9CMA2_PASMU/70-369-----------------------------------------------------VLSGHMDT-VF-...KTGTVNER....
Q8XT42_RALSO/90-389-----------------------------------------------------LLMAHMDT-VF-...KDGTARAK....
Q880D7_PSESM/109-408-----------------------------------------------------LLMAHMDT-VF-...KEGSAAER....
A0A030QZM1_PSEAI/107-408-----------------------------------------------------LLMIHYDT-VF-A..AGSAA.KR....
Q884H3_PSESM/106-407-----------------------------------------------------LLMVHYDT-VF-...GPGTAARR....
CBPG_PSES6/108-410-----------------------------------------------------LLMSHMDT-VY-...LKGILAKA....
Q89NT5_BRADU/145-448-----------------------------------------------------MLIAHMDT-VY-...LKGMLKDQ....
Q8XUU2_RALSO/122-426-----------------------------------------------------MLIAHMDT-VY-...LKGMLAQQ....
Q89IN7_BRADU/140-435-----------------------------------------------------LIAGHMDT-VH-...LVGTIEKL....
Q89WA3_BRADU/87-383-----------------------------------------------------LVLSHLDT-VH-PLGFIERL.......
Q9RRJ7_DEIRA/74-369-----------------------------------------------------LVLTHADT-VW-PHGTLGRM.......
A0A058VEZ8_BORPT/77-375-----------------------------------------------------LILGHIDT-VH-...PIGTLQDN....
Q8D5L5_VIBVU/73-371-----------------------------------------------------MMIGHMDT-VF-...PVGTAAAR....
Q9KFW8_BACHD/72-371-----------------------------------------------------LLVAHMDT-VF-...PVGTAAAR....
Q882Q5_PSESM/82-379-----------------------------------------------------LLLGHRDT-VF-...PKGTTAIR....
Q89ER6_BRADU/82-381-----------------------------------------------------LLMGHRDT-VF-...GKGEAGRR....
Q9LPE9_ARATH/93-426-----------------------------------------------------LFNSHLDS-VP-...AESEK.....WT
Q9VCR0_DROME/75-396-----------------------------------------------------ILNSHMDV-VP-...VFRDK.....WT
Q9VCQ9_DROME/76-397-----------------------------------------------------VLNSHTDV-VP-...VFREK.....WT
Q9VCQ8_DROME/76-397-----------------------------------------------------ILSSHMDV-VP-...VFPEM.....WT
Q9VCR2_DROME/76-397-----------------------------------------------------ILNSHTDV-VP-...VFEEK.....WT
Q8T490_DROME/78-398-----------------------------------------------------ILNSHMDV-VP-...VFPEK.....WT
Q7QEF5_ANOGA/84-405-----------------------------------------------------ILNSHMDV-VP-...VYPER.....WT
Q9I7K3_DROME/76-397-----------------------------------------------------LLNSHMDV-VP-...VFPEN.....WT
Q17686_CAEEL/70-392-----------------------------------------------------MLYSHTDV-VP-...TFREY.....WT
Q17899_CAEEL/71-393-----------------------------------------------------MLYSHTDV-VP-...TFREH.....WT
Q17898_CAEEL/71-393-----------------------------------------------------MLYSHTDV-VP-...TFREH.....WT
ACY1_PIG/76-396-----------------------------------------------------LLNSHTDV-VP-...VFKEH.....WS
Q7ZVV2_DANRE/88-409-----------------------------------------------------VLNSHTDV-VP-...VYEEH.....WE
Q8XUB8_RALSO/98-420-----------------------------------------------------ALNAHGDV-VP-.........PGLGWT
O58880_PYRHO/64-349-----------------------------------------------------FFEVHMDT-ID-....PRAE.......
O29728_ARCFU/50-314-----------------------------------------------------IVSTHLDT-TP-.....VKA.......
Q8R5U3_THETN/61-363-----------------------------------------------------IVEVHYDV-VP-......SV.IE....
Q979Q6_THEVO/81-397-----------------------------------------------------WLIAHIDT-VP-....VGDP.SL..WT
O58003_PYRHO/93-411-----------------------------------------------------WILSHLDV-VP-....PGEG.....WT
O29358_ARCFU/84-400-----------------------------------------------------WIVAHLDV-VP-....EGDE.RL..WE
Q8NLV7_CORGL/76-438-----------------------------------------------------TLLGHTDV-VP-...VDLPK.....WT
Q9PEM8_XYLFA/67-363-----------------------------------------------------LFNVHLDT-VP-....DSPT.....WS
Q4UVI8_XANC8/68-364-----------------------------------------------------LFNVHLDT-VP-.........DSPHWS
C6IP45_9BACE/69-352-----------------------------------------------------LLNSHIDT-VK-......PV.NG..WR
Y1497_METJA/61-343-----------------------------------------------------ILNSHIDT-VK-.......I.QS....
LYSK_SULTO/63-340-----------------------------------------------------LLASHIDT-VP-...............
D0KRK8_SULS9/64-341-----------------------------------------------------LLASHVDT-VY-...............
LYSK_AERPE/68-345-----------------------------------------------------GLVGHLDT-VP-..........G....
LYSK_PYRAB/63-322-----------------------------------------------------LLAGHVDT-VP-.....GYI.......
LYSK_PYRHO/62-321-----------------------------------------------------LLAGHIDT-VP-.....GYI.......
LYSK_THET2/63-350-----------------------------------------------------VLLGHIDT-VP-G.QIPVRL.EG....
LYSK_DEIRA/65-358-----------------------------------------------------ALLGHMDT-VP-.....GDI.......
Q9ZBI7_STRCO/86-442-----------------------------------------------------LVHGHLDV-VP-...AEAAD.....WS
Q93RZ9_STRCO/83-441-----------------------------------------------------LVHGHLDV-VP-...ADAAE.....WR
Q79Z32_STRAW/84-440-----------------------------------------------------LIHGHTDV-VP-...ANAAD.....WT
D6EMR6_STRLI/88-444-----------------------------------------------------LIHGHTDV-VP-...ANADD.....WT
O30185_ARCFU/62-368-----------------------------------------------------MLTSHLDT-VP-....AGDELLN....
Q98L43_RHILO/88-418-----------------------------------------------------HFNSHIDV-VE-....AGDG.....WT
Q970S3_SULTO/66-380-----------------------------------------------------MLNGHYDV-VP-....TGDV.NK..WK
D0KTX4_SULS9/81-369-----------------------------------------------------HFNFHYDV-VP-P..GDG.......WL
Q96XG6_SULTO/80-366-----------------------------------------------------HFNFHYDV-VP-....PGDN.....WI
D0KVC4_SULS9/89-404-----------------------------------------------------AFNAHYDV-VP-....AGEG.....WS
Q9YEE4_AERPE/91-410-----------------------------------------------------HFNGHYDV-VP-.........GGPGWS
Q8ZVD7_PYRAE/78-394-----------------------------------------------------HFNGHYDV-VP-....PGPL.ES..WR
Q18621_CAEEL/72-345-----------------------------------------------------LLNTHLDT-VP-...............
YJ75_SCHPO/124-397-----------------------------------------------------VLTSHIDT-VN-...............
Q7S4G6_NEUCR/139-448-----------------------------------------------------LVTSHIDV-VP-...............
J7JWC8_BACIU/99-418-----------------------------------------------------ILNGHIDV-VP-....EGSV.KD..WK
C2R7T3_BACCE/97-416-----------------------------------------------------ILNGHIDV-VP-....EGDV.NQ..WE
Q9KE02_BACHD/99-417-----------------------------------------------------ILQSHVDV-VS-....PEPV.EH..WT
Q89MN6_BRADU/99-418-----------------------------------------------------ILQGHCDV-VP-....AGPL.EL..WD
Q986X8_RHILO/100-420-----------------------------------------------------ILNGHIDV-VP-....TGPL.DR..WV
DAPE_HELHP/72-381-----------------------------------------------------CFAGHIDV-VP-......TG.EG..WE
I0ZH66_HELPX/75-379-----------------------------------------------------CFAGHIDV-VP-......PG.NH..WQ
DAPE_WOLSU/62-362-----------------------------------------------------CLAGHIDV-VP-....PGEG.....WS
D5AYG5_RICPP/65-381-----------------------------------------------------CFVGHVDV-VP-....AGNY.EF..WH
DAPE_BRADU/67-385-----------------------------------------------------TFAGHTDV-VP-....AGDE.SA..WS
A0A024EXP0_BRUCA/70-392-----------------------------------------------------MFAGHTDV-VP-....PGDE.KD..WK
DAPE_AGRT5/69-390-----------------------------------------------------MFAGHTDV-VP-....VGDE.AA..WS
DAPE_RHILO/70-392-----------------------------------------------------MFAGHTDV-VP-....VGDE.AA..WT
DAPE_CAUCN/71-380-----------------------------------------------------CFAGHTDV-VP-....VGDD.AA..WT
DAPE_ZYMMO/70-373-----------------------------------------------------AYAGHSDV-VP-.........AGQGWS
DAPE_WIGBR/60-371-----------------------------------------------------LFAGHTDV-VH-....AGNV.KN..WK
DAPE_BLOFL/67-381-----------------------------------------------------LFAGHTDV-VP-....PGDI.HN..WQ
DAPE_COXBN/62-372-----------------------------------------------------IFAGHTDV-VP-....PGDE.TQ..WH
DAPE_XYLFA/62-372-----------------------------------------------------VLLGHTDV-VP-....PGPI.EA..WT
DAPE_BUCBP/63-373-----------------------------------------------------AFSGHTDV-VP-....IGNK.IL..WN
DAPE_BUCAI/62-372-----------------------------------------------------TFAGHTDV-VP-....IGQD.KD..WQ
DAPE_BUCAP/62-372-----------------------------------------------------TFAGHTDV-VP-....PGDY.KY..WN
E6MTY2_NEIMH/64-374-----------------------------------------------------CFAGHTDV-VP-....TGPV.EK..WD
DAPE_CHRVO/62-372-----------------------------------------------------CFAGHTDV-VP-....TGPL.DK..WD
DAPE_NITEU/63-373-----------------------------------------------------CFAGHTDV-VP-....TGPV.TQ..WD
DAPE_RALSO/70-380-----------------------------------------------------VFAGHTDV-VP-....TGPV.EQ..WR
A0A058V666_BORPT/64-374-----------------------------------------------------VFAGHTDV-VP-....PGPR.DK..WD
DAPE_HAEDU/63-373-----------------------------------------------------VFAGHTDI-VP-....TGDP.AQ..WQ
K0YT27_PASMD/63-373-----------------------------------------------------AFAGHTDV-VP-....VGDT.TQ..WQ
C9MHJ2_HAEIF/63-373-----------------------------------------------------AFAGHTDV-VP-....TGDE.NQ..WS
F3IH20_PSESL/69-380-----------------------------------------------------CFAGHTDV-VP-....TGPV.QD..WQ
DAPE_SHEON/71-381-----------------------------------------------------CFAGHTDV-VP-....TGDL.SR..WH
A0A016X5N4_VIBCL/64-374-----------------------------------------------------VFAGHTDV-VP-....AGPL.SQ..WH
A0A017IAP2_ECOLX/62-372-----------------------------------------------------AFAGHTDV-VP-....PGDA.DR..WI
DAPE_PHOLL/62-372-----------------------------------------------------AFAGHTDV-VP-....AGDE.SQ..WE
A9CL51_AGRT5/72-381-----------------------------------------------------AFNTHMDT-VP-.........AGDGWT
H3UQ43_STAEP/68-407-----------------------------------------------------GISGHMDV-VS-....EGNH.DD..WT
C7VXJ9_ENTFL/66-375-----------------------------------------------------GFSGHMDV-VS-....EGDE.SQ..WT
A0A028XUR5_STAEP/68-401-----------------------------------------------------AISGHMDV-VD-....AGDH.DD..WT
A0A028WMC8_STAAU/68-402-----------------------------------------------------ALSGHMDV-VD-....AGNQ.DN..WT
Q8TZ13_METKA/63-348-----------------------------------------------------CLTSHLDT-VP-....PDEM.EK....
Q7UM22_RHOBA/107-416-----------------------------------------------------AYFCHTDV-VP-.....ADR.....WG
A0A030YAR5_PSEAI/72-376-----------------------------------------------------VLAGHTDT-VP-...YDEAL.....WS
F3ID35_PSESL/72-376-----------------------------------------------------VLAGHSDT-VP-...FDEAL.....WK
Q88CJ5_PSEPK/72-376-----------------------------------------------------VLAGHSDT-VP-...YDEQL.....WA
ARGE_BUCAP/75-378-----------------------------------------------------LFSGHTDT-VD-...FDEHL.....WT
ARGE_BUCAI/75-378-----------------------------------------------------LLSGHSDT-VD-...FDEKK.....WT
A0A016XA35_VIBCL/72-375-----------------------------------------------------LLAGHSDT-VP-...FDEGR.....WN
ARGE_MORAB/74-378-----------------------------------------------------LLAGHTDT-VP-...FDDDL.....WT
ARGE_PASMU/75-378-----------------------------------------------------LLAGHTDT-VP-...FDEGR.....WQ
A0A017HYV7_ECOLX/76-379-----------------------------------------------------LLAGHTDT-VP-...FDDGR.....WT
ARGE_PHOLL/76-379-----------------------------------------------------LLCGHTDT-VP-...FDEGL.....WT
ARGE_MYXXA/75-375-----------------------------------------------------ALVGHSDC-VP-.........YDAAWT
B8H6F0_CAUCN/74-388-----------------------------------------------------VLSGHTDV-VP-...VDGQP.....WS
A9CF54_AGRT5/65-371-----------------------------------------------------ILSGHMDV-VP-...AGEPE.....WS
Q987H6_RHILO/65-371-----------------------------------------------------ILSGHTDV-VP-...AGEPQ.....WS
M4MKT9_SINM2/65-371-----------------------------------------------------IISGHMDV-VP-...AAETG.....WT
Q88AX7_PSESM/67-382-----------------------------------------------------LLSGHTDV-VP-...AAGQA.....WT
Q89J35_BRADU/90-405-----------------------------------------------------VLSGHTDV-VP-...VAGQD.....WS
A0A058V6Z1_BORPT/67-381-----------------------------------------------------VLSGHTDV-VP-...VDGQP.....WT
A0A022NQ63_PSEAI/66-380-----------------------------------------------------CLSGHTDV-VP-...ADGQA.....WS
Q88GZ4_PSEPK/73-387-----------------------------------------------------VLSGHTDV-VP-...VDGQA.....WT
Q7NVG4_CHRVO/67-384-----------------------------------------------------VLSGHSDV-VP-...VDGQD.....WS
F4LES6_BORPC/75-389-----------------------------------------------------VLSGHTDV-VP-...VDGQD.....WS
Q8XYW5_RALSO/75-389-----------------------------------------------------VLSGHTDV-VP-...VDGQR.....WS
G7QPH1_LEPII/112-477-----------------------------------------------------ILTNHIDV-VE-...ADPSE.....WD
Q82HL3_STRAW/71-409-----------------------------------------------------VTGSHLDS-VP-.........DG....
A0A038I678_BORBO/77-416-----------------------------------------------------MTGSHLDS-VP-.........RG....
A0A038IQT3_BORBO/79-416-----------------------------------------------------MTGSHLDS-VP-...............
Q880G9_PSESM/87-417-----------------------------------------------------LCGSHLDS-QP-.........SA....
Q89GU6_BRADU/77-406-----------------------------------------------------LAGSHLES-QN-.........YA....
D0KPG6_SULS9/71-398-----------------------------------------------------AIGSHMDS-VP-.........YG....
Q84FR8_9MICC/81-412-----------------------------------------------------VLGSHTDT-VE-.........RG....
Q893C9_CLOTE/76-402-----------------------------------------------------AMGSHCDS-VV-.........QG....
K4U164_BORBO/80-413-----------------------------------------------------ATGSHCDT-VM-.........AG....
Q7U3I0_SYNPX/107-432-----------------------------------------------------MTGSHLDT-VP-.........TG....
Q96W94_LACKL/110-445-----------------------------------------------------ATGSHLDT-QP-.........EA....
M4IPW1_RHIML/82-410-----------------------------------------------------LIGSHLDT-QI-.........NG....
Q984M3_RHILO/78-404-----------------------------------------------------LIGSHIDT-VI-...............
Q8VUL6_9PSED/86-408-----------------------------------------------------AMGSHLDT-QP-.........SG....
Q89R53_BRADU/83-410-----------------------------------------------------GIGSHLDT-QP-.........TG....
F6BN93_SINMB/83-410-----------------------------------------------------HIGSHLDT-QP-...............
Q7CX68_AGRT5/76-403-----------------------------------------------------YIGSHLDT-QP-.........TG....
G8NGR5_BRUSS/82-409-----------------------------------------------------YMGSHLDT-QP-...............
Q98K54_RHILO/83-410-----------------------------------------------------YVGSHLDT-QP-...............
Q88Q81_PSEPK/91-418-----------------------------------------------------MTGSHIDT-QP-.........TG....
Q88FQ3_PSEPK/88-415-----------------------------------------------------MTGSHIDT-QP-.........TG....
A0A038HB77_BORBO/82-413-----------------------------------------------------ATGSHIDT-QP-.........TG....
A0A058VEP1_BORPT/82-409-----------------------------------------------------MTGSHIDT-QP-.........TG....
Q89Q07_BRADU/80-408-----------------------------------------------------LLGSHLDS-QP-.........TG....
Q7CRI5_AGRT5/79-410-----------------------------------------------------LIGSHLDS-QP-...............
Q985I5_RHILO/80-409-----------------------------------------------------LIGSHLDS-QP-...............
Q8ELE3_OCEIH/73-408-----------------------------------------------------GLGSHLDT-VY-.........NG....
Q98LM4_RHILO/87-417-----------------------------------------------------VSGSHIDS-QT-...............
G4ERJ2_BACIU/80-409-----------------------------------------------------VTGSHIDT-VI-.........NG....
A0A017IX64_ECOLX/77-406-----------------------------------------------------LSGSHIDT-VV-...............
A0A037ZR73_ENTFL/75-403-----------------------------------------------------LTGSHIDT-VV-.........NG....
Q896S2_CLOTE/77-402-----------------------------------------------------LIGSHLDS-VI-.........NG....
Q7UHC4_RHOBA/118-448-----------------------------------------------------LVGSHIDT-VP-.........CA....
Q9CP93_PASMU/75-406-----------------------------------------------------AFGSHIDT-VV-.........NA....
A5UHB3_HAEIG/75-406-----------------------------------------------------AFGSHIDT-VV-.........NA....
Q9RV75_DEIRA/80-405-----------------------------------------------------YIGSHLDT-VP-NAGRYDGI.IGVVFG
Q8D176_YERPE/85-415-----------------------------------------------------LLGSHLDT-VR-.........NA....
Q7W1K0_BORPA/81-415-----------------------------------------------------MTGSHFDT-VR-.........DG....
Q89H48_BRADU/89-419-----------------------------------------------------MLGSHYDT-VR-.........DA....
B8H0E3_CAUCN/80-410-----------------------------------------------------IIGSHIDS-VR-.........NG....
Q4UZZ3_XANC8/86-416-----------------------------------------------------LIGSHLDS-VR-.........AA....
M4TP12_9XANT/86-416-----------------------------------------------------LIGSHLDS-VR-.........DA....
UAH_ARATH/134-472-----------------------------------------------------ATGSHIDA-IP-...............
HYUC_PSESN/79-412-----------------------------------------------------MIGSHIDS-VR-...............
Q9KET8_BACHD/83-411-----------------------------------------------------MTGSHIDS-VP-...............
Q9F464_ARTAU/78-409-----------------------------------------------------AVGSHFDS-VR-...............
Q8EKY8_OCEIH/76-404-----------------------------------------------------LIGSHFDS-VP-...............
C8JVD5_LISMN/76-406-----------------------------------------------------IVGSHFDS-VP-...............

PF00883

C6X5Z5_FLAB3/162-466-----------------------------------------------------....EWLN.KP-Q....NHKRIP----
M5A4B4_9ACTN/176-482-----------------------------------------------------.FARELAN.TP-P....TYLNAK----
R4UJY4_9MOLU/141-444-----------------------------------------------------NFARTLQD.TP-P....NLMYPE----
AMPA_CHRSD/184-489-----------------------------------------------------SLTRTLGN.LP-G....NVCTPR----
A4XA11_SALTO/200-511-----------------------------------------------------RFSRDWVN.AA-P....NELSPP----
Q5WDV6_BACSK/180-487-----------------------------------------------------NLARKLVN.MP-G....NLLTPS----
Q5NPD0_ZYMMO/149-450-----------------------------------------------------.LVRDLVD.TP-A....CDCGPA----
D6YW21_WADCW/173-481-----------------------------------------------------YLARNLIN.GN-A....DEINPQ----
V9TS62_9PROT/174-479-----------------------------------------------------FFTRDLVS.EP-A....NILFPS----
C9RPN1_FIBSS/167-484-----------------------------------------------------VLAKNLIN.TS-S....SDLTPA----
X4R7Y1_9ACTO/156-460-----------------------------------------------------.RVRDLVN.LA-P....NDLYPE----
A5UR62_ROSS1/172-479-----------------------------------------------------NLARDLAN.LP-P....NVLTPA----
AMPL_CAEEL/171-476-----------------------------------------------------RETARLID.TP-A....NILTTD----
AMPA_HERAR/186-492-----------------------------------------------------DLTKDLGN.LP-A....NVCTPT----
D5EGT3_AMICL/164-471-----------------------------------------------------.YARNLAN.EP-G....NVISPL----
F0YH16_AURAN/200-517-----------------------------------------------------RLAQRIVD.AP-P....NEMTTT----
C9YTR8_STRSW/193-500-----------------------------------------------------NRARDLIN.TP-P....NDLDPE----
K0C1Q1_CYCSP/186-488-----------------------------------------------------.SAKKLAN.LP-G....NICTPS----
F0YC00_AURAN/1-320-----------------------------------------------------.LARYLAA.LP-P....NVLTPG----
A9WJQ9_CHLAA/168-474-----------------------------------------------------AFARDLAN.GP-G....NDVTPA----
AMPA_HAEIN/179-483-----------------------------------------------------KAARDIAN.MP-P....NICNPA----
I4B0I8_TURPD/181-488-----------------------------------------------------AAMRQTQA.LP-G....NYLTPQ----
E1SVV7_FERBD/106-419-----------------------------------------------------...KDLTN.AT-P....EALSPE----
Q3IY25_RHOS4/151-451-----------------------------------------------------.LTRDLIN.TP-A....SDLGPQ----
Q0C004_HYPNA/195-503-----------------------------------------------------YFARDLIS.TP-S....NIKTPA----
F2I7D6_AERUA/155-462-----------------------------------------------------NATRDLVN.TP-S....NHLSPA----
R5EB48_9BURK/175-479-----------------------------------------------------QMAKQYGD.MP-A....NLCTPK----
G6CTF2_DANPL/360-666-----------------------------------------------------RLAARITD.TP-A....NIMDVD----
C5BET8_EDWI9/111-423-----------------------------------------------------..VRDTIN.TP-A....ENLGPT----
Q46JD4_PROMT/176-484-----------------------------------------------------KFARELVS.AP-P....NFLTPY----
B3SB51_TRIAD/171-484-----------------------------------------------------NFARRLMD.SP-S....NLMTPT----
C1EA64_MICSR/261-600-----------------------------------------------------RLASRVVD.TP-P....AAMDPD----
L0DW10_THIND/149-448-----------------------------------------------------RLARDLIN.TP-P....ADMMPV----
K1PGD2_CRAGI/175-480-----------------------------------------------------RLAAEIVD.KP-C....SHMNTD----
C7MYY8_SACVD/181-488-----------------------------------------------------TLARDLVN.TP-P....NDLFPA----
D2B4S6_STRRD/191-499-----------------------------------------------------SLVRDLVN.TP-P....SDLWPA----
B9L9L3_NAUPA/139-450-----------------------------------------------------NFVRDIIN.SV-P....DELTPA----
K9PC73_CYAGP/182-491-----------------------------------------------------ELARRLVA.AP-P....NKATPQ----
A3DKW9_STAMF/180-491-----------------------------------------------------NYARRIAE.SP-S....SIMNPA----
Q5HQM0_STAEQ/177-485-----------------------------------------------------NYARELSQ.MP-P....NILTPQ----
F9VM60_ARTSS/164-472-----------------------------------------------------NLTRDLVN.EP-S....NILTPE----
T1J675_STRMM/177-486-----------------------------------------------------QLTARIVD.AP-C....SEMHTD----
U5N957_9BURK/230-540-----------------------------------------------------EFAKDWAN.RP-A....NHATPR----
M4BQQ9_HYAAE/222-534-----------------------------------------------------QLAARLVD.AP-P....NELHSD----
G4T0U0_META2/183-486-----------------------------------------------------SLAKQLAD.LP-G....NICTPT----
D5UXQ0_TSUPD/187-495-----------------------------------------------------ALARDFVN.TP-P....NVLSPG----
K0RYY1_THAOC/174-477-----------------------------------------------------.LTKDIVN.AP-H....NVLNSE----
F7QIS5_9BRAD/148-448-----------------------------------------------------AMARDLIN.TP-A....NDMGPD----
AMPA_WIGBR/185-490-----------------------------------------------------IITKNLGN.MP-S....NFCDPH----
AMPA_RALSO/196-498-----------------------------------------------------ELTRDLGN.LP-S....NICTPT----
U6B4X9_9RHIZ/181-486-----------------------------------------------------NLTRDLVN.EP-S....NVLGTD----
F4CZP3_PSEUX/183-491-----------------------------------------------------ATARDLVN.TP-P....NDLFPD----
AMPA_TROWT/173-487-----------------------------------------------------.LAKDLVN.TT-G....DDLYPA----
R6H0E6_9FIRM/135-443-----------------------------------------------------.AVRNYVN.LP-A....NLLTPM----
A9A408_NITMS/173-482-----------------------------------------------------.FTKSIAN.LP-P....NECTPS----
E8V0T5_TERSS/199-509-----------------------------------------------------AFTQALVN.EP-G....NVLTPT----
Q2GLA3_ANAPZ/182-491-----------------------------------------------------FFTRSLIS.EP-A....NVLYPE----
K7X8P8_MYCHR/148-451-----------------------------------------------------NFARLFQN.TP-P....NICNSE----
E4WVA7_OIKDI/163-477-----------------------------------------------------NFARYLME.SP-A....NLMTPT----
V6DF53_9DELT/186-495-----------------------------------------------------NKSRYWCD.MP-P....SQFTPT----
M9R8Y2_9RHOB/149-449-----------------------------------------------------.LTRDLIN.TP-A....SDMGPD----
Q5SLN7_THET8/216-519-----------------------------------------------------YLARDLVN.EP-P....NLLTPE----
X2GUA7_9GAMM/109-419-----------------------------------------------------..CRDIVN.QQ-A....ETLSPL----
C5LBL7_PERM5/214-537-----------------------------------------------------.MSAALTD.MP-T....NFLNTT----
S6BD92_9GAMM/181-484-----------------------------------------------------RLARDLGN.LP-G....NICTPT----
B7PRX1_IXOSC/177-486-----------------------------------------------------NFARWLME.TP-A....NHMTPT----
A7SX56_NEMVE/212-520-----------------------------------------------------NFARQLMD.MP-A....NLMTPR----
M1MZ09_9CORY/185-492-----------------------------------------------------LLARDLVN.TP-A....SHLYPE----
B9JYU2_AGRVS/151-452-----------------------------------------------------FLARDLIN.TP-T....NDMGPA----
D8K0H4_DEHLB/177-486-----------------------------------------------------CTARDLAN.EP-S....NHMTPA----
J9Z8K7_LEPFM/221-528-----------------------------------------------------.LARDLGN.HP-A....NVATPS----
Q2W0Z6_MAGSA/176-482-----------------------------------------------------FLARDLTD.EP-A....NVLGPD----
D0LAY7_GORB4/199-505-----------------------------------------------------AIARDFVN.TP-P....SHLYPE----
AMPA_BLOFL/189-495-----------------------------------------------------NIAKNLGN.MP-S....NYCTPN----
AMPA_METRJ/187-492-----------------------------------------------------ILARDLVN.EP-P....NVLFPA----
R6S5R2_9CLOT/172-480-----------------------------------------------------MLARDLIN.HP-S....MYMTPE----
A6VMK6_ACTSZ/106-424-----------------------------------------------------.FVREIIN.LS-S....SVITPV----
U3U7T3_9BACT/185-490-----------------------------------------------------KIAKDISN.MP-P....NICNSE----
Q2GDT6_NEOSM/182-494-----------------------------------------------------KLTRDLIN.EP-A....NHLNPE----
G8NQH1_GRAMM/188-498-----------------------------------------------------NFARTLVN.EP-G....NILTPT----
F8GJ95_NITSI/172-475-----------------------------------------------------.LARGLTA.LP-A....NELTPK----
AMPA_SYNFM/185-493-----------------------------------------------------ILARDLVS.SP-A....NRATPA----
U3K842_FICAL/133-437-----------------------------------------------------RLAARIVD.TP-C....NEMNTD----
AMPA_LEPIN/176-485-----------------------------------------------------.GVRHIAH.LP-A....NHFTPE----
F8DZQ6_CORRG/278-588-----------------------------------------------------CFARDLVN.AP-A....NELYPE----
F0S3L9_DESTD/164-473-----------------------------------------------------NFTRDIVN.EP-G....NVVTPE----
C6CWC9_PAESJ/191-497-----------------------------------------------------KVARDLTN.LP-G....NQLVPE----
Q7KF27_LEIMA/242-557-----------------------------------------------------NEARNLGN.LR-E....DEGVPE----
S5XWQ0_PARAH/187-492-----------------------------------------------------FFTRDLTN.EP-S....NVLTTS----
AMPA_HALHL/185-488-----------------------------------------------------NFSRDLGN.TP-A....NICTPG----
AMPA_SYNE7/174-481-----------------------------------------------------ELARQLVA.AP-A....NVVTPV----
I3Y9V9_THIV6/185-488-----------------------------------------------------NLARELGN.LP-G....NLCTPT----
T1IEY7_RHOPR/164-479-----------------------------------------------------NIARRLAD.LP-S....NILTPY----
AMPA_HELPY/175-486-----------------------------------------------------NIVKDLVN.TP-P....MIGTPV----
Q9RWF2_DEIRA/172-475-----------------------------------------------------TFARELTS.AP-A....NVLNPA----
D5X603_THIK1/177-479-----------------------------------------------------RLTRELAN.LP-A....NYCTPT----
B7XIA6_ENTBH/168-480-----------------------------------------------------NIARFLGD.TP-A....NLMTPT----
G8PT59_PSEUV/147-444-----------------------------------------------------RLAKDLIN.TP-A....NDMGPE----
D5QH38_KOMHA/175-479-----------------------------------------------------.LCRDLVN.EP-A....NMLRPD----
G2IJP7_9SPHN/213-520-----------------------------------------------------TLSRDLAT.EP-A....NVIYPE----
AMPA_SYNPW/175-484-----------------------------------------------------ELARELVA.AP-P....NSVTPA----
A0C3G2_PARTE/167-475-----------------------------------------------------.YARDLAN.TR-.....QEGTPQ----
L0FUP6_ECHVK/162-470-----------------------------------------------------.VARDLVN.EP-V....IYLNAE----
D9T8V1_MICAI/185-493-----------------------------------------------------RLARDLTN.MP-S....STKNPE----
I1FZI3_AMPQE/175-480-----------------------------------------------------RLTQYIVD.AP-C....SEMHTD----
D0LFL6_HALO1/191-497-----------------------------------------------------.MARDFVN.EP-A....SYQTPS----
F2G2P1_ALTMD/197-500-----------------------------------------------------KVTKDVAN.MP-P....NICNPA----
F0YNB6_AURAN/156-471-----------------------------------------------------.LCRDLIN.AP-AGDMQRDMGPA----
D6X0X1_TRICA/181-508-----------------------------------------------------....DIGGADP-.....ERMSPP----
J9JWQ8_ACYPI/201-510-----------------------------------------------------NWSRKLTE.SA-S....NHMTPT----
AMPA_ACISJ/169-471-----------------------------------------------------EFAREWAN.RP-A....NHATPT----
AMPA_SYNP2/179-486-----------------------------------------------------IYARELVN.AP-A....NIINPV----
R7Y059_9ACTO/191-497-----------------------------------------------------..SRMLAS.VP-S....NLKTPA----
T0MZ46_9EURY/166-471-----------------------------------------------------NYARDFAN.MP-P....SEGTPS----
B4MSA4_DROWI/228-539-----------------------------------------------------NLARRLSD.AP-A....NQMTPT----
F3ZI02_9ACTO/182-489-----------------------------------------------------NRARDLVN.IP-A....NDLYPE----
A6W748_KINRD/196-506-----------------------------------------------------.LTRDLAA.TP-S....NLKDPA----
F2U656_SALR5/184-493-----------------------------------------------------.LARDLMN.ER-A....DVANPK----
C5J5J7_MYCCR/150-453-----------------------------------------------------NYARFYQN.MP-P....NIANSE----
C6XAH6_METGS/170-472-----------------------------------------------------.LVRQLTV.LP-P....NELTPA----
D7CD64_STRBB/197-504-----------------------------------------------------NRARDLIN.TP-S....NLLNPA----
D5BYS9_NITHN/186-489-----------------------------------------------------SLARDLGN.LP-G....NVCTPT----
F4KZQ6_HALH1/183-487-----------------------------------------------------....DLIN.AP-G....NKKHPA----
A1BB03_PARDP/167-482-----------------------------------------------------NRARAWVE.AP-A....NRLTPQ----
V4L747_9GAMM/184-490-----------------------------------------------------ELTRDLGN.LP-G....NICTPS----
X2H865_9GAMM/184-487-----------------------------------------------------.TTKTIAN.MP-S....NVCNAQ----
Q8EUM6_MYCPE/140-443-----------------------------------------------------.FCRNLQD.RP-S....SQIYPE----
N0B4F1_9BACI/184-491-----------------------------------------------------NSARTLVN.MP-G....NMLTAT----
B3MFP9_DROAN/211-522-----------------------------------------------------NLARRLAD.TP-A....NQMTPS----
R6ISD0_9PROT/163-464-----------------------------------------------------RYARDLGN.EP-P....NVLTPE----
D7BBW5_MEISD/175-481-----------------------------------------------------NYARDLVN.EP-P....NVLTPA----
Q5NMX7_ZYMMO/178-485-----------------------------------------------------.FTRMLVT.EP-G....NKLYPE----
E3F0E2_KETVY/155-457-----------------------------------------------------.LTRDLVN.TP-A....ADMGPA----
Q1GQH4_SPHAL/239-548-----------------------------------------------------RLSRDLAN.EP-A....NVIYPE----
E0VYD5_PEDHC/176-487-----------------------------------------------------NIARKMAD.CP-P....NCMTPA----
Q6LU55_PHOPR/107-421-----------------------------------------------------NWVREVIN.QS-A....DVVRPS----
K9YMB5_CYASC/177-484-----------------------------------------------------ILARELVN.AP-P....NEINPV----
D1CBV6_THET1/172-477-----------------------------------------------------NLARTLAN.EP-P....NVLTTR----
C7NIK9_KYTSD/196-515-----------------------------------------------------RYARDLVN.TP-A....NHLYPE----
Q98BF0_RHILO/179-479-----------------------------------------------------FLARDLVN.TP-T....SDMGPD----
R9AP41_WALI9/120-439-----------------------------------------------------NLARELME.MP-P....NYCTPT----
Q386R3_TRYB2/235-553-----------------------------------------------------QLCQRLVD.SP-C....NLLDTT----
M1M440_9PROT/203-510-----------------------------------------------------NLAKELGN.LP-S....NICTPT----
E8WYQ5_ACISM/196-505-----------------------------------------------------NFARHLVN.EP-G....NVLTPT----
M4NH77_9GAMM/183-487-----------------------------------------------------RFARELAN.LP-P....NICNPA----
H1Z7W8_MYROD/147-453-----------------------------------------------------.WARTMVN.EP-V....SFLTAT----
F0YJ08_AURAN/51-366-----------------------------------------------------RLAARLVD.TP-P....EQLTTT----
F9YSU1_CAPCC/154-461-----------------------------------------------------NIARDLVN.EP-V....STLNTT----
R5RS31_9FIRM/161-460-----------------------------------------------------NYARMLSD.TP-S....NLMTPD----
A0A023B3K4_GRENI/144-445-----------------------------------------------------....VLVD.LP-P....NVLNCQ----
Q4A6P7_MYCS5/150-452-----------------------------------------------------KSARFLQS.MP-E....NFLNSE----
E2SAP7_9ACTO/187-494-----------------------------------------------------ARARDWTN.TP-P....GDLRPA----
D3EQL7_ATETH/178-485-----------------------------------------------------IMARELVN.AP-A....NYINPI----
Q4P9A5_USTMA/210-531-----------------------------------------------------NWARELKE.TP-A....NLMTPT----
G7EAQ2_MIXOS/137-455-----------------------------------------------------...AELQE.LP-A....NLCTPT----
S5RM48_9PROT/187-493-----------------------------------------------------ELTKNLGN.LS-A....NICTPT----
B4S7K1_PROA2/199-505-----------------------------------------------------.VARDLVN.LP-G....NLLNAV----
F6EEL9_AMYSD/202-511-----------------------------------------------------ATARDFVN.TP-P....SHLFPG----
C7RP72_ACCPU/186-487-----------------------------------------------------.LSKNLAN.LP-A....NVCTPT----
S6B212_9PROT/171-471-----------------------------------------------------.LARELTM.LP-A....NELTPG----
AMPA_LEIXX/172-479-----------------------------------------------------.LVKDLVN.AP-P....LDLYPA----
D8M2T3_BLAHO/88-396-----------------------------------------------------..ARIWAN.EQ-S....SELNPR----
R5SAB2_9GAMM/159-460-----------------------------------------------------AFARNLAN.EP-A....QFATPT----
AMPA_GEOUR/182-488-----------------------------------------------------RFARDLVS.QP-G....NVLVPS----
S5TKP0_9CORY/185-492-----------------------------------------------------VLARDLVN.TP-S....SHLYPE----
J3PN70_PUCT1/199-517-----------------------------------------------------NLARELME.SP-A....NLMTPT----
AMPA_BACP2/179-486-----------------------------------------------------NSARTLVN.MP-P....NMLTSS----
M4RX46_9SPHN/181-487-----------------------------------------------------AFTRELVS.EP-A....NIIYPE----
E4U043_SULKY/160-469-----------------------------------------------------NFVRNLVN.QT-P....DDMTPQ----
D6ZH18_MOBCV/166-469-----------------------------------------------------.RVRDLVN.TS-P....LELYPD----
D5DLZ2_BACMD/181-488-----------------------------------------------------NSARTLVN.LP-S....NMLTAT----
AMPA_AQUAE/175-483-----------------------------------------------------NYARNLVN.EP-G....NVINPI----
V4ZFC8_TOXGO/464-768-----------------------------------------------------YFAQELVN.AP-A....NYCNPV----
B8IRW3_METNO/184-490-----------------------------------------------------VLARELVN.EP-P....NVLDPE----
Q5ZS85_LEGPH/143-444-----------------------------------------------------.LVRDLIN.TP-T....CDMGPE----
R7BWE7_9BURK/184-485-----------------------------------------------------.WARHLAE.LP-P....NICTPH----
D5BRH6_PUNMI/169-473-----------------------------------------------------ALARDLVF.EP-A....NKLYPE----
Q4FMQ4_PELUB/170-477-----------------------------------------------------.FARDLVS.EP-G....NVLHPD----
Q07Y04_SHEFN/105-419-----------------------------------------------------QFARKLIN.DT-P....EDLSPL----
E0VLX3_PEDHC/201-513-----------------------------------------------------NLARSLME.AP-A....NKMTPI----
AMPA_CHLT3/195-502-----------------------------------------------------AMVRDLVN.SP-S....NYMTAL----
E6TXJ7_BACCJ/181-488-----------------------------------------------------NVARNLVN.AP-G....NLMNAT----
D3P9Y1_DEFDS/180-487-----------------------------------------------------NMVRDLVN.LP-H....ADLTPQ----
A1AVP2_RUTMC/166-466-----------------------------------------------------.LTRYLGD.LP-P....NVCTPS----
PEPB_ECOLI/110-422-----------------------------------------------------..VRDTIN.AP-A....EELGPS----
E0WSA4_9ENTR/278-585-----------------------------------------------------KATKDIAN.QP-P....NICNAE----
K0PAL3_9BACT/230-542-----------------------------------------------------NLAKDLVN.AP-A....NHVTPS----
AMPA_CHLPD/190-496-----------------------------------------------------.MARDLVN.LP-G....NYLQAE----
F2J1L6_POLGS/184-489-----------------------------------------------------CLARDLVN.EP-P....NALGPV----
R5LTP6_9SPIR/174-479-----------------------------------------------------.WTRDMVN.EP-S....NVINSL----
H8GZR9_DEIGI/122-430-----------------------------------------------------GFARELVS.AP-A....NVLNPA----
AMPA_DESPS/190-495-----------------------------------------------------.AARDMAH.EP-G....NGWTPK----
Q7VM40_HAEDU/106-424-----------------------------------------------------.FARKIIN.EA-S....NTLTPE----
Q82WU2_NITEU/173-476-----------------------------------------------------.LARGLTI.LP-P....NELTPR----
Q2GH94_EHRCR/180-489-----------------------------------------------------FLARSFVS.EP-P....NILYPE----
C4L4U9_EXISA/166-471-----------------------------------------------------NVARTLTM.MP-A....NILTAE----
V5SD77_9RHIZ/199-506-----------------------------------------------------HFARDLVN.EP-A....NVLGPV----
Q5CMA4_CRYHO/215-514-----------------------------------------------------.FARDLTS.AP-P....NYCDPV----
D7B6K4_NOCDD/189-499-----------------------------------------------------ALARDLIN.TP-S....MVKDPA----
AMPA_CHRVO/185-488-----------------------------------------------------KLAKDLGN.LP-G....NVCTPS----
A0RQ42_CAMFF/163-473-----------------------------------------------------NYAKDIVN.EI-P....DIYTPQ----
AMPA_METCA/186-489-----------------------------------------------------TLARNLGN.LP-G....NVCTPA----
R4G463_RHOPR/199-512-----------------------------------------------------NLARKLED.TP-A....NLMTPT----
AMPA_THICR/183-486-----------------------------------------------------ALTQDLAN.MP-S....NYCTPT----
AMPA_MICLC/188-502-----------------------------------------------------.AVRDLVN.TA-P....SHLYPA----
E4U9Y1_OCEP5/170-477-----------------------------------------------------WLARDLVN.EP-P....NVLNPA----
R0KUY5_NOSB1/187-495-----------------------------------------------------NFARFLGD.TP-A....NQMTPT----
D2PYW4_KRIFD/180-490-----------------------------------------------------HQTRDWVN.MP-P....SDLHPA----
Q4U9B7_THEAN/215-519-----------------------------------------------------NMAKELTT.AP-P....NYANTV----
E5SDS1_TRISP/181-494-----------------------------------------------------NVVRRLSD.MP-A....NMLTPT----
Q17Q37_AEDAE/218-527-----------------------------------------------------NLARELQE.AP-A....NHMTPT----
B4REV0_PHEZH/188-496-----------------------------------------------------AFTRDLIT.EP-A....NVIYPE----
AMPA_MYCPN/135-436-----------------------------------------------------NMARQLQD.TP-S....DQLYPE----
AMPA_PARUW/180-488-----------------------------------------------------.YTRDLIN.GN-A....DEITPQ----
AMPA_VARPS/173-475-----------------------------------------------------ELAKEWGN.RP-G....NYCTPT----
D3VLN1_XENNA/111-423-----------------------------------------------------..VRDTIN.LP-A....EDLGPE----
L2GMV2_VITCO/158-466-----------------------------------------------------NIARFLGD.TP-A....NLMTPT----
M4V7H6_9DELT/180-491-----------------------------------------------------QWARHLVN.LP-P....NVVNPE----
G6CYR3_DANPL/330-635-----------------------------------------------------NWARHLTD.MP-P....NKMTPV----
F4HCP5_GALAU/107-425-----------------------------------------------------.FIREIIN.LP-A....EIITPT----
B3MHD9_DROAN/206-517-----------------------------------------------------NLARRVSD.AP-S....NCMTPT----
C3MBX4_RHISN/151-449-----------------------------------------------------FLARDLIN.TP-T....NDMGPE----
F6INC0_9SPHN/170-477-----------------------------------------------------AFTRELVT.EP-A....NTIYPE----
E6X1E4_NITSE/168-481-----------------------------------------------------NFVRDIVN.TA-P....DDCYPE----
R5R5C4_9FIRM/157-465-----------------------------------------------------LFARDMTN.MP-A....NYLYPE----
E8NEY0_MICTS/163-479-----------------------------------------------------ALVKDLVT.TP-A....EWLGPA----
A4HUX3_LEIIN/211-529-----------------------------------------------------QLCQRLVD.TP-P....CMLDTV----
F5XS17_MICPN/187-495-----------------------------------------------------VAAREWVN.IP-P....NLLFPA----
A9CKK0_AGRT5/151-453-----------------------------------------------------FLARDLIN.VP-A....NDMGPD----
F2G690_ALTMD/106-418-----------------------------------------------------.FTRQLVN.DT-P....EDLSPV----
T0MXV1_9EURY/133-438-----------------------------------------------------NFTRNIAN.LP-P....SIGTPS----
W0E1H2_MARPU/185-488-----------------------------------------------------ALARELGN.LP-G....NICTPS----
F9WSC7_TRYVY/221-536-----------------------------------------------------NDARTLGN.LR-E....DEGTPQ----
B7QLQ7_IXOSC/183-493-----------------------------------------------------QLTAKIVD.TP-C....QDMNTE----
B0VIY1_CLOAI/178-486-----------------------------------------------------NFARNLVN.EP-A....NVITPE----
AMPA_AZOVD/183-487-----------------------------------------------------ALTRDLGN.LP-P....NLCHPT----
S2JN84_MUCC1/199-544-----------------------------------------------------.VCKDIGNPDP-.....EIMSPI----
D3PR67_MEIRD/180-487-----------------------------------------------------NYARDLVN.EP-P....NVLTPS----
A8LMP2_DINSH/153-454-----------------------------------------------------.LTRDLIN.TP-A....NDMGPE----
M4V7I7_9DELT/189-499-----------------------------------------------------NFAKRLGD.MP-G....NFMTPT----
D2PN27_KRIFD/184-492-----------------------------------------------------.LARQFAT.TP-S....NEKDPA----
E4TI54_CALNY/171-478-----------------------------------------------------FLARDLIN.MP-P....NELTPQ----
W0DXA8_9GAMM/178-481-----------------------------------------------------ALTQDLGN.LP-S....NICTPG----
E8UCB5_TAYEM/187-490-----------------------------------------------------.LTMQLGD.LP-S....NICTPT----
C6W9E3_ACTMD/180-487-----------------------------------------------------TATRDLIN.TP-P....NDLYPA----
E1V5X9_HALED/184-489-----------------------------------------------------NATRTLGN.LP-G....NVCTPS----
D2V1Z3_NAEGR/233-549-----------------------------------------------------NFSAYLSE.LP-A....NYLTPK----
I0I8C4_CALAS/185-493-----------------------------------------------------NLARDLSN.EP-P....NVLYPV----
C6C244_DESAD/183-490-----------------------------------------------------.YARDLVN.LP-P....NVATPV----
C7R802_KANKD/104-417-----------------------------------------------------..MRSIVN.ET-P....EVLAPQ----
AMPA_BUCAI/183-487-----------------------------------------------------.STKNLSN.LP-P....NICNPL----
A6LX08_CLOB8/174-482-----------------------------------------------------KFARDLVN.EP-A....NVLYPE----
D5SX76_PLAL2/208-514-----------------------------------------------------NLTRELVN.RP-A....QEVNPV----
A6WWU8_OCHA4/146-449-----------------------------------------------------MLVRDLIN.TP-T....NDMGPD----
AMPA_ACIC5/192-496-----------------------------------------------------NLTRTLVN.EP-G....NRLTPT----
W4YD71_STRPU/229-542-----------------------------------------------------NFARTLME.MP-A....NKLTPT----
G4QJL9_GLANF/105-421-----------------------------------------------------QFTRRLVN.ET-P....EELSPE----
Q47SM6_THEFY/185-494-----------------------------------------------------AMARDLIN.TP-A....AEKSPA----
Q4A6P8_MYCS5/155-458-----------------------------------------------------NFARNLQI.LP-P....NIANSE----
I2ESW3_EMTOG/178-502-----------------------------------------------------....TLVD.AP-A....NYKYPQ----
E8R0I1_ISOPI/194-503-----------------------------------------------------VLARDLAN.TP-P....AEKPPV----
AMPA_WOLSU/164-473-----------------------------------------------------NLARELVN.TP-P....EDATPQ----
B0DV38_LACBS/161-480-----------------------------------------------------NLARTLTE.LP-A....NILTPT----
H5WNF3_9BURK/177-478-----------------------------------------------------.LTREVAN.RP-A....NHCTPR----
AMPA_PELCD/185-491-----------------------------------------------------ALARDLVN.QP-G....NVKSPE----
A5EXK4_DICNV/179-481-----------------------------------------------------.TARDLAN.LP-A....NICTPD----
W5USN8_9MOLU/148-451-----------------------------------------------------NFARHYQN.MP-P....NIANSE----
B5DJX6_DROPS/207-518-----------------------------------------------------NLSRRISE.AP-A....NCMTPT----
E8RT42_ASTEC/174-481-----------------------------------------------------ILARNLVS.EP-P....NVLYPE----
A0LB29_MAGSM/194-499-----------------------------------------------------.FCRDLCN.QP-G....NVLTPK----
J9D8M9_EDHAE/173-483-----------------------------------------------------NFARFLAD.TP-A....NLMTPS----
AMPA_PERMH/183-490-----------------------------------------------------NFTRDIVN.EP-G....NVITPE----
A5IZ30_MYCAP/146-446-----------------------------------------------------.KCRNLQV.MP-E....NYCNSV----
Q4DZJ3_TRYCC/206-513-----------------------------------------------------.LCQRLVD.AP-T....NLLNTA----
A1R5K5_ARTAT/185-496-----------------------------------------------------NTTRTLVN.QP-P....SHLYPE----
B9KYG7_THERP/177-483-----------------------------------------------------CFARDLTN.EP-A....NVLDPE----
E4XW90_OIKDI/148-462-----------------------------------------------------NLARELME.LP-G....NLLTPS----
B4QP73_DROSI/200-497-----------------------------------------------------NLARRMCD.TP-A....CCMTPT----
Q28W89_JANSC/147-447-----------------------------------------------------..IRDLIN.TP-A....EDMGPD----
G8R4P6_OWEHD/160-468-----------------------------------------------------YAARNLVN.EP-L....SYLTAV----
I0K7Q0_9BACT/169-473-----------------------------------------------------....DLAN.AP-S....NYKPPQ----
G0ECB4_PYRF1/174-480-----------------------------------------------------RVARDFAN.AP-S....SEMNPE----
M2RQN9_CERS8/164-479-----------------------------------------------------NLARTLME.LP-A....NMMTPT----
F0NXD6_WEEVC/164-470-----------------------------------------------------SLTKTLVN.EP-V....NYMDAL----
H3B4N2_LATCH/195-507-----------------------------------------------------NLARQLME.AP-A....SHLTPS----
E8RI95_DESPD/197-504-----------------------------------------------------.AARDMAN.QP-G....NGWTPA----
W0BCJ9_9GAMM/169-472-----------------------------------------------------RFSRTLAN.YP-A....NICTPT----
Q6F246_MESFL/141-443-----------------------------------------------------NYARDLQD.TP-P....NIGTSE----
AMPL_DICDI/199-512-----------------------------------------------------NFARVLME.TP-A....NLLTPT----
R5R1A9_9FIRM/125-432-----------------------------------------------------.YARMLGD.LP-N....NYLHTE----
F5ZA98_ALTSS/242-551-----------------------------------------------------.LARDLSH.MP-A....NLCTPV----
F4W9W6_ACREC/194-506-----------------------------------------------------NWARELSD.TP-A....NLMTPT----
D5MLF5_9BACT/186-494-----------------------------------------------------SFARDLVN.EP-A....NTLTPS----
R6FTW2_9CLOT/167-475-----------------------------------------------------NMAKDLVN.EP-A....NVIYPE----
A5IZE3_MYCAP/148-451-----------------------------------------------------NFARDLQI.MP-P....NICNSE----
C6W4G1_DYAFD/152-454-----------------------------------------------------....DLTN.AP-S....NYKKPA----
C5BZ54_BEUC1/205-517-----------------------------------------------------.WARLLAA.TP-S....NVKNPE----
B3DZ80_METI4/163-471-----------------------------------------------------NYVRAIGN.MP-A....NYVTPE----
B4SA59_PELPB/189-496-----------------------------------------------------KMVRDMVN.LP-G....NYLHAT----
AMPA1_SHEON/184-490-----------------------------------------------------FLARDLTN.AP-A....GNMYPE----
R6ITU2_9PROT/177-485-----------------------------------------------------RYARDLVN.EP-A....NFLTPE----
AMPA_SYNR3/175-484-----------------------------------------------------MLARELVA.AP-P....NVVNAL----
D8R1F7_SELML/221-528-----------------------------------------------------ISARQLVN.AP-A....NVLTPS----
B4J7G5_DROGR/196-507-----------------------------------------------------NLARRLSD.TP-A....NQMTPS----
AMPA_COLP3/186-488-----------------------------------------------------.TCKNVAN.MP-P....NICNPA----
AMPA_ALKMQ/186-492-----------------------------------------------------MIARDLVN.EP-G....NVLTPT----
V4IRZ9_9DELT/193-498-----------------------------------------------------.QARSMAN.EP-G....NIWIPQ----
I6XTI9_PROPF/181-489-----------------------------------------------------VQARDWIN.TP-P....NLLYPE----
G7E952_MIXOS/161-482-----------------------------------------------------NLCRELQE.LP-A....NLCTPT----
AMPA_SYNJB/189-497-----------------------------------------------------ILARELVA.AP-A....NIVTPL----
Q18BF9_PEPD6/171-478-----------------------------------------------------IIARNLVN.EP-S....NVIYPK----
D9SUB1_CLOC7/166-474-----------------------------------------------------TIARNLVN.EP-P....NVIYPE----
D3HKV1_LEGLN/143-446-----------------------------------------------------.LVRDLIN.KP-T....SDLGPK----
D5V326_ARCNC/154-465-----------------------------------------------------NKVRNFVN.TT-P....QDFYPE----
X4ZJT4_9BORD/185-496-----------------------------------------------------ELARTLGN.LP-G....NICTPT----
E1VX92_ARTAR/185-494-----------------------------------------------------.GTRDLIN.AP-A....NVLYPE----
R5Q810_9PROT/170-479-----------------------------------------------------YTARDLVN.EP-A....NFVTPS----
A7HYF8_PARL1/183-487-----------------------------------------------------.LTRDLVN.EP-A....NILFPG----
W5TCC4_9NOCA/188-493-----------------------------------------------------ATARDFVN.TP-P....NALYPA----
Q9A9K3_CAUCR/214-522-----------------------------------------------------.WARDVSN.EP-A....NVIYPE----
L0DIK8_SINAD/180-485-----------------------------------------------------NLARELTN.TP-P....SEKPPT----
F8E5W7_FLESM/181-487-----------------------------------------------------.KAKDLIN.YP-A....GDIVPD----
F6AB11_PSEF1/183-487-----------------------------------------------------ALTKDLGN.LP-P....NICHPS----
AMPA_WOLPM/179-489-----------------------------------------------------FLARSFIT.EP-P....NILYPE----
C7MD11_BRAFD/176-480-----------------------------------------------------DIVRDLVN.TP-P....NLLYPA----
D2NSD6_ROTMD/184-490-----------------------------------------------------.DARRLVN.LP-P....SHLYPE----
Q0RCV5_FRAAA/273-598-----------------------------------------------------YIARDLVN.TP-S....LVKSPE----
AMPA_CAMJE/162-472-----------------------------------------------------NFTKNIVN.EI-P....EIYTPL----
E1STI4_FERBD/167-498-----------------------------------------------------.AARDLCGGDP-.....EQMAPP----
C7R4U6_JONDD/177-482-----------------------------------------------------HRTRDLVN.MP-P....NDLFPA----
D5CN47_SIDLE/169-470-----------------------------------------------------.LCRELTV.LP-P....NELTPG----
M9R925_9RHOB/173-478-----------------------------------------------------VFTRDLTN.EP-A....NVLTTT----
F6SSX2_CIOIN/211-521-----------------------------------------------------NFARFLME.SP-A....NLMTPT----
E3I6V8_RHOVT/159-461-----------------------------------------------------WFARELIN.IP-A....NDLGPS----
AMPL2_ARATH/265-573-----------------------------------------------------IFTKELVN.SP-A....NVLSPA----
B8ET17_METSB/222-529-----------------------------------------------------ITARSLVN.EP-A....NILFPE----
C7JEN9_ACEP3/173-480-----------------------------------------------------VLTRDLVT.EP-A....NVLNPV----
Q5ZS88_LEGPH/181-484-----------------------------------------------------EFCRDLAN.MP-A....NICTPT----
U6GEA9_EIMAC/327-651-----------------------------------------------------HLARELVN.AP-A....NYCTTI----
A9GAY5_SORC5/197-513-----------------------------------------------------.LCRDITGTEP-.....ERMAPR----
D9SCE2_GALCS/183-485-----------------------------------------------------KLAKDLGN.LP-G....NICTPT----
C6X8L8_METGS/190-492-----------------------------------------------------SLTKDLGN.LP-P....NVCTPT----
G7V805_THELD/171-478-----------------------------------------------------NFVRDLVN.EP-G....NVINPV----
M5E291_9GAMM/177-481-----------------------------------------------------.YAKDLGN.MP-P....NICTPT----
E3F3S7_KETVY/173-480-----------------------------------------------------FFTRDLVN.EP-A....NILTTT----
B6A9G3_CRYMR/220-520-----------------------------------------------------.FARDLTT.AP-P....NYCNPV----
Q2G9Y8_NOVAD/169-475-----------------------------------------------------EFTRELVA.EP-A....NVIYPE----
K4EE31_TRYCR/195-509-----------------------------------------------------NEARSLGN.LR-E....DEGSPQ----
D3S987_THISK/147-450-----------------------------------------------------AMTRDLIN.TP-A....ADMMPA----
B4KSI3_DROMO/201-512-----------------------------------------------------NLARRLSD.TP-A....NQMTPS----
F2F7M2_SOLSS/184-491-----------------------------------------------------NEARTLIN.LP-P....NLLTAS----
AMPA_SYMTH/173-480-----------------------------------------------------NLARALAW.TP-G....NHLTAA----
M7WKL1_RHOT1/175-499-----------------------------------------------------NFARVLME.TP-A....NRMTPT----
Q0AQB7_MARMM/175-483-----------------------------------------------------DLAREVTN.LP-P....NILNPE----
AMPA_BURPS/193-494-----------------------------------------------------.LTRDLGN.LP-G....NVCTPT----
A1B5J7_PARDP/155-458-----------------------------------------------------.LARDLIN.TP-A....SDMGPG----
D4G860_RIEPU/187-496-----------------------------------------------------TWTKDLSN.MP-A....NICNST----
D4H1A9_DENA2/181-488-----------------------------------------------------YMAKDLIN.TP-P....ADMTPE----
B4KSH7_DROMO/205-516-----------------------------------------------------NLARRLSE.TP-A....NQMTPS----
K5XLD9_AGABU/165-484-----------------------------------------------------NWARTLME.LP-A....NMVTPT----
W5WRI5_9CORY/168-478-----------------------------------------------------.LSRDLAN.AP-A....NVKSPE----
D3B0J5_POLPA/205-516-----------------------------------------------------NFARYLAD.MP-A....NLMHPT----
Q2RSC2_RHORT/155-462-----------------------------------------------------.WARSLCA.EP-G....NRLNPT----
D7WEI6_9CORY/199-511-----------------------------------------------------ALARDLVN.TP-S....NLLYPA----
R5RDW2_9PROT/172-479-----------------------------------------------------RYARDLCN.EP-A....NYLTPE----
X5DUV3_9CORY/201-515-----------------------------------------------------TCARDLVN.AP-A....NILYPD----
B6K2U4_SCHJY/188-500-----------------------------------------------------NFARSLME.CP-A....NYMTSV----
E3I1T3_RHOVT/191-500-----------------------------------------------------YLARDLVN.EP-A....NILTPP----
D7FZ52_ECTSI/211-515-----------------------------------------------------SLCRDLVN.SP-P....NMLTPG----
D9SJW5_GALCS/164-466-----------------------------------------------------.LCRTLTV.TP-P....NELTPA----
I6YX94_MELRP/141-448-----------------------------------------------------FMARDLVN.EP-A....IKLTPL----
AMPA_RHISN/182-487-----------------------------------------------------FLARDLVN.EP-A....NVLGPV----
AMPA_HAHCH/182-485-----------------------------------------------------SLTKDLGN.LP-G....NVCTPD----
E6W4X8_DESIS/147-454-----------------------------------------------------NFTRELGD.LP-G....NIVTPA----
B0W8W4_CULQU/200-511-----------------------------------------------------NLARSLSD.AP-G....NQITPT----
Q2YN45_BRUA2/182-487-----------------------------------------------------IQARNLVN.EP-A....NILGPV----
B4MPH2_DROWI/216-527-----------------------------------------------------NLARRMTD.TP-A....NQMSPS----
AMPA_THEEB/182-489-----------------------------------------------------ILARELVN.AP-A....NEVTPV----
D1AQE2_SEBTE/158-465-----------------------------------------------------NTARDLVN.EP-S....NVLYPE----
G2J397_PSEUL/185-487-----------------------------------------------------NFAKDLGN.LP-G....NVCTPD----
Q7QFS4_ANOGA/187-496-----------------------------------------------------NFARVLME.TP-A....NHMTPT----
F4P0P5_BATDJ/216-557-----------------------------------------------------.IARDIGGSDP-.....ERMAPL----
YA55_SCHPO/195-507-----------------------------------------------------NLARSLME.CP-A....NYMTSL----
A4I996_LEIIN/205-519-----------------------------------------------------QLCQRLVD.AP-T....NLLDTV----
M1RK88_MORMO/110-422-----------------------------------------------------.WVRDVIN.TP-A....EELSPE----
C5C502_BEUC1/184-488-----------------------------------------------------.GTRDLVN.AA-P....ADLYPA----
B8DLW0_DESVM/205-514-----------------------------------------------------ALARDLVN.GP-P....NFVTPG----
D4Z454_SPHJU/164-471-----------------------------------------------------AFTRELVS.EP-A....NILYPE----
F8EHR8_RUNSL/172-474-----------------------------------------------------....DLMN.AP-S....NKKSPQ----
AMPA_TERTT/199-503-----------------------------------------------------NLTRQLGN.LP-G....NICTPA----
Q15NU9_PSEA6/106-421-----------------------------------------------------.FTRNQTN.AT-P....EDLSPE----
R7KKM4_9BURK/175-480-----------------------------------------------------NRAKVWGN.LP-A....NICTPS----
A4RXD3_OSTLU/134-442-----------------------------------------------------QLTKDLVA.AP-P....NVVTPT----
W6RWV3_9CLOT/167-475-----------------------------------------------------IIARNLVN.EP-A....NVIYPE----
A2BK45_HYPBU/176-483-----------------------------------------------------RVARDIAN.AP-A....NRLSPE----
G4QJ50_GLANF/180-512-----------------------------------------------------.IARDLCGTEP-.....ERMAPP----
AMPA_ALKEH/185-488-----------------------------------------------------SLARDLGN.LP-G....NVCTPS----
D3Q3W8_STANL/171-480-----------------------------------------------------TAARDWVN.TP-A....NLLRPP----
AMPA_DESAG/183-501-----------------------------------------------------FLTRDLVN.GP-A....NLVTPS----
F4HFB0_GALAU/185-489-----------------------------------------------------KETKDLAN.MP-P....NICTPR----
AMPA_PELLD/194-501-----------------------------------------------------EMARNLVN.LP-G....NHLQAE----
AMPA_PROMP/175-484-----------------------------------------------------ELARRLVA.AP-P....NSLTPL----
C9Z175_STRSW/161-472-----------------------------------------------------.LARDLVN.RP-A....GDLTPP----
L0RWS1_MYCC1/153-457-----------------------------------------------------NFARDLQI.TP-P....NILNSE----
AMPL_ENCCU/166-475-----------------------------------------------------NFARFLGD.TP-A....NLMNPT----
K9SKN0_9CYAN/189-506-----------------------------------------------------ILTRELVS.AP-A....NVITPE----
R4FK40_RHOPR/190-502-----------------------------------------------------NFARKIEE.TP-G....ILMTPS----
AMPA_PROMA/175-484-----------------------------------------------------ELARELVA.AP-P....NELTPA----
L0A482_DEIPD/149-454-----------------------------------------------------TLARDLVN.LP-F....SALDAR----
E6SCE6_INTC7/179-484-----------------------------------------------------.YTRDLVN.LP-P....NLLYPA----
Q00ZQ9_OSTTA/123-441-----------------------------------------------------...QALVD.AA-P....NDLTPC----
G0HE88_CORVD/203-511-----------------------------------------------------TCARDLVN.AP-A....SELTPE----
AMPA_CENSY/169-479-----------------------------------------------------AFARGLAN.MP-P....NECPPD----
D2SAD4_GEOOG/180-487-----------------------------------------------------AWARDLVN.TP-S....NTKDPA----
G4QFX6_GLANF/197-505-----------------------------------------------------HLTRDLAT.EP-G....KNMYPQ----
B5DV13_DROPS/629-926-----------------------------------------------------NLTRQLQE.MP-S....NLLTPT----
AMPA_PROAC/192-500-----------------------------------------------------YTARDWVD.AP-A....NLLYPK----
F8I5Z0_SULAT/196-502-----------------------------------------------------NLTRELGA.RP-S....NHLYPA----
Q47BU0_DECAR/170-473-----------------------------------------------------.LARSLTA.LP-P....NELTPS----
AMPA_BDEBA/182-493-----------------------------------------------------NFSRRLGD.LP-G....NLMTPT----
I3TLP7_TISMK/176-482-----------------------------------------------------DFTRELIS.EP-A....NVLTPR----
R4FLW1_RHOPR/187-495-----------------------------------------------------NLVRHLAE.AP-A....NFMTPR----
C7R5R0_KANKD/185-488-----------------------------------------------------SLTKDLAN.LP-G....NICNPS----
Q98QI6_MYCPU/151-453-----------------------------------------------------NTVRKLQI.YP-P....NICNSE----
T2GAT1_DESGI/202-513-----------------------------------------------------.LARDLVN.TP-A....NLATPA----
A7I263_CAMHC/164-474-----------------------------------------------------NFAKNIIN.EI-P....EIYTPE----
A4F8I7_SACEN/186-493-----------------------------------------------------ALARDLAN.SP-S....NVKDPD----
U1NWM0_ASCSU/192-485-----------------------------------------------------RTAARMID.TP-C....NELHTE----
M4A0E3_XIPMA/195-507-----------------------------------------------------NLARFLME.AP-A....NRITPT----
AMPA_CYAP7/178-485-----------------------------------------------------ILARELVN.GP-A....NSVTPI----
F2J2Q3_POLGS/160-462-----------------------------------------------------ALARDLIN.TP-S....NDMGPA----
F2IC15_FLUTR/150-458-----------------------------------------------------FWARDLVN.EP-V....SGLNAT----
Q5LM47_RUEPO/150-450-----------------------------------------------------.LTRDLIN.TP-A....QDMGPD----
E0TGB2_PARBH/152-450-----------------------------------------------------.LARDLVN.IP-A....EDMGPS----
F2NNU7_MARHT/171-475-----------------------------------------------------.YARDLVN.EP-P....NVLTPA----
Q6F245_MESFL/142-444-----------------------------------------------------NYARDLQD.FP-P....NIGTSD----
F4QAT3_DICFS/171-482-----------------------------------------------------NFARELAD.TP-S....NLMTPS----
A9TZ55_PHYPA/194-502-----------------------------------------------------IVAKQLVA.AP-A....NVLTPG----
AMPA_HAMD5/182-487-----------------------------------------------------NEAKNLAN.TP-P....NICNPA----
AMPA_RICPR/183-493-----------------------------------------------------FFTRDISN.EP-S....NIKTPQ----
D6Z206_DESAT/206-527-----------------------------------------------------CLARDMAN.EP-G....NGWTPT----
G6DLT9_DANPL/211-520-----------------------------------------------------NLARFLQE.MP-P....NILNPT----
F3ZPQ3_9BACE/148-455-----------------------------------------------------.WARDMVN.EP-V....CYLTAD----
A1SFY6_NOCSJ/208-513-----------------------------------------------------...RLLAT.VP-S....NLKNPP----
I5AYT2_9DELT/196-501-----------------------------------------------------.TARDMAN.EP-G....NHWTSA----
E3ITP1_FRASU/257-571-----------------------------------------------------LTARDLIN.TP-S....LVKSPE----
R7J977_9FUSO/158-460-----------------------------------------------------KFTRDLAN.TP-A....QIATPS----
K9RRM8_SYNP3/179-486-----------------------------------------------------ILARELVN.AP-A....NVITPV----
G2LIW2_CHLTF/182-492-----------------------------------------------------NFARTLAQ.EP-G....NKLTPA----
I0AJQ5_IGNAJ/184-498-----------------------------------------------------YFVRDLQN.EP-S....NELTPE----
H3F5P9_PRIPA/173-480-----------------------------------------------------RTTARLID.TP-A....NELTTD----
W5M2Y6_LEPOC/179-483-----------------------------------------------------RLAARIVD.TP-C....SEMSTD----
B8FAL5_DESAA/149-458-----------------------------------------------------..SRDLIN.DN-A....DNIFPE----
Q9PPY3_UREPA/141-446-----------------------------------------------------TITRTLQD.TP-A....NLMTPG----
B0USF2_HISS2/106-424-----------------------------------------------------.FVREIIN.LP-S....SIITPI----
G2Z7R6_FLABF/162-469-----------------------------------------------------..TMKLVD.LP-P....NVVTPK----
A0LTF0_ACIC1/177-494-----------------------------------------------------NRARDWVN.TP-P....ADLFPQ----
K1WDX7_TRIAC/255-571-----------------------------------------------------.RARDLVN.TP-P....NFLYPA----
Q8GZD8_SOLLC/260-568-----------------------------------------------------ILGRELVN.AP-A....NVLTPA----
Q2RX86_RHORT/182-487-----------------------------------------------------FLTRDLVS.EP-A....NVLYPE----
E9C5A6_CAPO3/246-558-----------------------------------------------------NFARTLAE.TP-S....NHMTPS----
H2G1P5_OCESG/185-489-----------------------------------------------------RVCRDVAN.MP-P....NVCNPA----
PEPB_VIBSL/109-423-----------------------------------------------------.WTRDIIN.KT-A....EEVAPR----
R5DBX5_9FIRM/171-480-----------------------------------------------------.IARDLIN.EP-P....TVLTPA----
A0KJ38_AERHH/112-425-----------------------------------------------------.WVREVTN.GC-P....QEIYPM----
X5DF70_9BACT/160-466-----------------------------------------------------.VARDLVN.EP-L....SFLTAT----
W8S936_9RHOB/173-474-----------------------------------------------------FFTRDLVN.EP-A....NVLTTT----
B8F6L7_HAEPS/106-423-----------------------------------------------------.FTRDIIN.EP-S....DRLTPE----
G2KP29_MICAA/230-551-----------------------------------------------------HVARDLTN.EP-P....NVIYPD----
H3B674_LATCH/182-487-----------------------------------------------------RLAARIVD.TP-C....NEMNTN----
F8L7J7_SIMNZ/175-485-----------------------------------------------------NFARDLIN.RN-A....LDITPQ----
F6EPW8_AMYSD/169-478-----------------------------------------------------AFARDLAN.LP-S....NLKSPR----
B4U7Z2_HYDS0/162-471-----------------------------------------------------.FSRNLVN.EP-G....CVINPI----
R6G8V1_9FIRM/171-478-----------------------------------------------------TTARDLVN.EP-A....NVMTPA----
U3GZP6_9CORY/207-512-----------------------------------------------------.LARDLVN.SP-S....NALYPE----
B3PDJ0_CELJU/218-521-----------------------------------------------------NLARYLGD.LP-G....NICTPS----
W8RR06_9RHOB/159-461-----------------------------------------------------.MTRDLVN.TP-A....EDMGPD----
R6BLJ7_9CLOT/158-466-----------------------------------------------------MMARDWVN.TP-G....NYMNPQ----
F7YJW2_VIBA7/185-489-----------------------------------------------------KASKDLGN.MP-P....NIANPA----
Q4JWD6_CORJK/243-553-----------------------------------------------------ALARDLVN.TP-S....NVLYPE----
D6Z9C1_SEGRD/192-502-----------------------------------------------------AAARDFVN.TP-P....NHLYPD----
B3PNE3_MYCA5/141-443-----------------------------------------------------NGARNLQI.TP-P....NVATSE----
E3PU38_CLOSD/184-490-----------------------------------------------------.VARTLVN.EP-A....NIMTPT----
F6FWZ5_ISOV2/182-490-----------------------------------------------------.GTRDLVN.MP-P....NDLYPA----
E0UT41_SULAO/152-461-----------------------------------------------------.YTRDIVN.VA-P....DDLNPP----
D6WAL0_TRICA/131-438-----------------------------------------------------NIARRLTD.TP-S....NHMTPT----
W0PG19_9BURK/185-496-----------------------------------------------------RLTRELGN.LP-A....NVCTPT----
B1VFT8_CORU7/180-490-----------------------------------------------------.LSRDLAN.AP-S....NVKSPE----
A6W2H4_MARMS/178-479-----------------------------------------------------.FARQLGN.LP-G....NVCTPS----
G8PQZ6_PSEUV/181-486-----------------------------------------------------.LARTLVD.EP-A....NTLGPV----
D3FYY3_BACPE/182-489-----------------------------------------------------NRARKLIN.IP-G....NLLTPT----
U5QKL8_9CYAN/187-494-----------------------------------------------------IFARELVS.AP-A....NYVTPT----
H0PS22_9RHOO/185-487-----------------------------------------------------ALAKDLGN.LP-G....NICTPT----
F9ZMI4_ACICS/188-489-----------------------------------------------------.WARDLAN.EP-G....NVCTPT----
Q57W67_TRYB2/229-544-----------------------------------------------------NDARNLGN.LR-E....DEGTPQ----
D7A7G9_STAND/187-492-----------------------------------------------------VIARDLVN.EP-A....NVLTPS----
E3NSS2_CAERE/168-471-----------------------------------------------------NFARDLGN.CP-P....NICFPE----
D3EEQ6_GEOS4/188-493-----------------------------------------------------.LARDLTN.LP-G....NKLLPE----
AMPA_DINSH/173-478-----------------------------------------------------FFTRDLVN.EP-A....NVLTTT----
Q39QA1_GEOMG/182-488-----------------------------------------------------SFVRDLVS.HP-C....NVATPA----
B0SJN3_LEPBP/176-485-----------------------------------------------------NGARHIAH.LP-A....NYFTPN----
E1Z575_CHLVA/23-331-----------------------------------------------------.VTRYLVE.AP-P....NVCTPT----
G0A3X5_METMM/182-485-----------------------------------------------------ALTKQLAD.LP-G....NICTPT----
F4R618_MELLP/177-506-----------------------------------------------------NLARELME.TP-A....NMMTPT----
D3F960_CONWI/165-472-----------------------------------------------------NRARDLQN.TP-A....NELTPE----
Q6MU78_MYCMS/143-446-----------------------------------------------------NFARTLQD.TP-P....NIATSE----
AMPA_SOLUE/165-472-----------------------------------------------------NFSRDLVN.EP-A....NLLTPL----
R5U7L0_9FIRM/152-457-----------------------------------------------------.WARNMVN.AP-G....NLFHPM----
F8DZJ7_CORRG/176-486-----------------------------------------------------.LARDLAN.AP-S....NVKSPE----
W0BCR4_9GAMM/142-444-----------------------------------------------------FLVRDLIN.RP-A....NDLGPV----
A1S368_SHEAM/193-499-----------------------------------------------------VLARDLVN.TP-A....GDMTPE----
AMPA_PSYIN/186-488-----------------------------------------------------.ACKDLAN.MP-P....NICTPL----
A9RWV3_PHYPA/208-514-----------------------------------------------------ILAKQLVN.AP-P....NVLLPS----
AMPA_SHELP/185-489-----------------------------------------------------QLCRDVAN.MP-P....NICNPA----
AMPA_CLOPE/178-485-----------------------------------------------------.LARDLVN.EP-A....NNMYPE----
H8N1H7_CORCM/189-504-----------------------------------------------------AFARDLAN.SP-A....TLLTAA----
A8L2E3_FRASN/289-603-----------------------------------------------------CLARDLIN.MP-S....LVKTPR----
K1P412_CRAGI/211-517-----------------------------------------------------NLSRRLME.MP-A....NLLTPT----
A8AAG8_IGNH4/142-445-----------------------------------------------------MFARDLAS.EP-P....NVLNPK----
T1HYN4_RHOPR/176-504-----------------------------------------------------..ARDVGGADP-.....ERMCAP----
AMPA_GEOSL/182-488-----------------------------------------------------SFARDLVS.QP-G....NVATPL----
X2GVW0_9BACI/185-492-----------------------------------------------------NEARSLIN.LP-P....NLLTAT----
M9WGL9_9MOLU/144-448-----------------------------------------------------NYARSLQD.TP-P....NIATSE----
C5ZXF9_9HELI/153-466-----------------------------------------------------NYTRDLVN.TP-P....KQATPE----
B4K8J9_DROMO/194-499-----------------------------------------------------RLAARIVD.TP-C....NEMNVD----
E1VLP9_9GAMM/186-489-----------------------------------------------------.RAKTLGN.LP-A....NVCTPT----
Q6LU54_PHOPR/107-420-----------------------------------------------------..VRQVVN.AT-P....EDMYPE----
Q6G5G4_BARHE/146-448-----------------------------------------------------FFVRDLIN.IP-A....NDMNPD----
S2J6I2_MUCC1/184-495-----------------------------------------------------NVARMLMT.SP-A....NLMTPK----
C9R3V1_AGGAD/184-488-----------------------------------------------------RFTKDVAN.CP-P....NVCTPN----
E4RZ16_LEAB4/139-441-----------------------------------------------------......GD.AP-G....NHKTPQ----
J7QAD0_METSZ/203-508-----------------------------------------------------MLARTLVN.EP-A....NVLTPP----
E6SK41_THEM7/258-567-----------------------------------------------------ITARQLGN.RP-A....NDLTPA----
AMPA_CHLTR/180-490-----------------------------------------------------YLTRDLVN.TN-A....DEVTPE----
AMPA_AERPE/167-481-----------------------------------------------------YLARDIAN.AP-P....HRLPPA----
W5XRS9_9CORY/176-483-----------------------------------------------------AFARTLTN.TP-S....NELYPE----
AMPA_XANP2/182-489-----------------------------------------------------LFARDLVN.EP-A....NVLDPP----
AMPA_NITEU/185-487-----------------------------------------------------KVTKDLGN.LA-P....NICTPS----
W8KTS6_HALHR/148-451-----------------------------------------------------SLVRDLIN.TP-A....EDMMPE----
D0LI38_HALO1/189-494-----------------------------------------------------.EAAQLVD.TP-P....SDLGPD----
D2W4E3_NAEGR/206-522-----------------------------------------------------.FSRYILE.LP-A....NYCTPI----
I4BTT2_ANAMD/168-476-----------------------------------------------------NYARDLAN.EP-P....NVINPI----
A9G6U3_SORC5/181-485-----------------------------------------------------.VARDLVN.EP-P....NEVYPE----
F2U729_SALR5/218-523-----------------------------------------------------...AALVD.TP-C....NELHSA----
AMPA_CHLTE/190-497-----------------------------------------------------NRARDLVN.LP-G....NHLSAE----
D6WIH3_TRICA/210-523-----------------------------------------------------NLARQLMD.TS-A....NYMTPT----
J7L7T9_NOCAA/185-493-----------------------------------------------------SLTRDLVN.TA-P....ADLVPE----
Q291T8_DROPS/204-515-----------------------------------------------------NLARRLCD.TP-A....NQMTPS----
B8C9H7_THAPS/5-310-----------------------------------------------------RLACRLVD.TH-P....EELTTT----
D0KZE1_HALNC/187-490-----------------------------------------------------HLTKNLAN.LP-P....NLCTPT----
F5XX90_RAMTT/169-471-----------------------------------------------------EFARELAN.LP-P....NHATPT----
C7R2A0_JONDD/214-523-----------------------------------------------------.FARDLTA.TS-S....NIKTPK----
M1PTI6_DESSD/195-501-----------------------------------------------------.TARDMAN.EP-G....NGWTAS----
A8ESP3_ARCB4/152-463-----------------------------------------------------NKARDMVN.SA-P....ADFYPQ----
AMPA_BUCBP/187-492-----------------------------------------------------KIARDLSN.MP-P....NICNSS----
T1IIZ4_STRMM/175-483-----------------------------------------------------NLARKLME.MP-S....NILTPS----
A4SWH7_POLSQ/227-529-----------------------------------------------------NLAKDLGN.LP-P....NICTPT----
C1A924_GEMAT/186-492-----------------------------------------------------AIAKRLGQ.MP-G....NVCTPD----
Q11BA5_CHESB/143-445-----------------------------------------------------FLARDLVN.TP-T....NDLGPD----
D6GTC0_FILAD/171-478-----------------------------------------------------TLARLLVD.EP-A....NLMKPK----
AMPA_TRIEI/184-491-----------------------------------------------------IFARELVA.AP-A....NSCTPI----
Q164G7_ROSDO/185-490-----------------------------------------------------.FTRDLVS.EP-A....NVLTTK----
J9Z153_9PROT/95-402-----------------------------------------------------NFLKELVS.EP-S....NIIYPD----
L0ETF4_LIBCB/178-484-----------------------------------------------------NLTRTLVN.EP-A....NILGTL----
D5E4U3_MYCCM/146-450-----------------------------------------------------NFARELQI.MA-P....NVCNSE----
F4GXG8_PUSST/184-492-----------------------------------------------------NLTRLLGD.LP-P....NVCTPT----
D4M7D9_9BACT/185-493-----------------------------------------------------.AARDLAN.EP-G....CVINPP----
D3UHD8_HELM1/158-466-----------------------------------------------------.AVRDKIN.TC-P....ADATPE----
J3Z5G2_9ENTR/111-423-----------------------------------------------------..VRNTIN.LP-A....NELGPK----
F7WZF7_9ENTR/188-492-----------------------------------------------------.RTKNLCN.MP-P....NLCNAE----
E7AD53_HELFC/175-484-----------------------------------------------------NLARDLVN.TP-P....DVANAP----
V2XB80_MONRO/154-469-----------------------------------------------------NFARTLME.LP-A....NVITPT----
R6H333_9FIRM/132-438-----------------------------------------------------..ARTLGN.LP-N....NYLHTE----
I1FVH4_AMPQE/220-534-----------------------------------------------------NFARWLME.TP-S....NHMTPT----
AMPA_DESDA/184-493-----------------------------------------------------MLARDLAS.TP-P....NLLYPE----
C7LNR8_DESBD/170-476-----------------------------------------------------.LARDLVN.TP-A....NVATPE----
L0B6A2_9PROT/183-485-----------------------------------------------------.LAKQLGN.LP-S....NICTPT----
H2XLM6_CIOIN/180-487-----------------------------------------------------QMAARIVD.TP-C....NIMNTT----
W6A9E7_9MOLU/141-443-----------------------------------------------------NFTRDLQD.TP-P....NLATSV----
D8P9W7_9BACT/190-497-----------------------------------------------------.LVRDLCN.HP-A....NVMTPT----
D2AXT5_STRRD/153-458-----------------------------------------------------TFARDLVN.TP-A....GDLVPM----
I1XKW3_METNJ/184-486-----------------------------------------------------NLARELGN.LP-G....NICTPS----
R5EKV4_9GAMM/130-439-----------------------------------------------------..FRKIAD.SD-S....KISTPE----
K7IU90_NASVI/179-509-----------------------------------------------------.VARDIGGSDP-.....ERMAPP----
K4KWM8_SIMAS/180-483-----------------------------------------------------NFTRELGN.LP-A....NICTPT----
E8N5J5_ANATU/160-468-----------------------------------------------------YLARDWAH.EP-A....NVINPV----
A7ZCG5_CAMC1/163-471-----------------------------------------------------NFTKDIVN.EI-P....EIYTPQ----
U5WAU4_9ACTO/156-464-----------------------------------------------------.LARDLTN.TP-S....AVKNPA----
K5W882_PHACS/174-491-----------------------------------------------------NLARTLME.LP-A....NMLTPT----
E9H1Y3_DAPPU/184-489-----------------------------------------------------RLSARIVD.TP-C....NEMNTD----
A0C414_PARTE/192-497-----------------------------------------------------...RELVPTRP-.....NIANTE----
E8SE88_STAPH/174-484-----------------------------------------------------NRARDLSN.TP-P....NIMTPA----
AMPA_FUSNN/162-470-----------------------------------------------------NIVKDLVN.EQ-A....EVLNPK----
M5C8J7_THACB/176-496-----------------------------------------------------NLSRELME.TP-A....NLLTPT----
F4F247_VERMA/172-480-----------------------------------------------------RLARDLTN.TP-S....SVKNPQ----
R5YNT4_9PROT/174-482-----------------------------------------------------RYARDLTN.EP-S....NELTPE----
AMPA_MYCLE/201-514-----------------------------------------------------ATARDLVN.TP-P....SHLFPA----
AMPA_CORGL/184-491-----------------------------------------------------LLARDLVN.TP-S....SHLYPE----
K4DYZ8_TRYCR/232-545-----------------------------------------------------QLCQRLVD.AP-T....NLLDTI----
AMPA_ALKOO/185-491-----------------------------------------------------IIARNLVN.EP-S....NVLTPT----
Q7RNC2_PLAYO/329-633-----------------------------------------------------.FASQLIS.AP-S....NYCNPV----
AMPA_NOSP7/178-485-----------------------------------------------------NLARELVA.AP-A....NAVTPI----
C9R376_AGGAD/107-425-----------------------------------------------------.FVREIIN.LP-A....AILTPE----
W8EYJ8_9BACT/166-472-----------------------------------------------------YLARDLVN.MP-Y....SHLNAT----
AMPA_TREDE/160-468-----------------------------------------------------FLTRDLVN.QP-A....NVIYPE----
D1BKL9_SANKS/211-519-----------------------------------------------------.LVRDLAA.TP-S....NIKSPE----
A4YT96_BRASO/182-487-----------------------------------------------------ILARDLVN.EP-P....NVLYPE----
V5X528_MYCNE/178-482-----------------------------------------------------..VRQLVE.AP-P....NALRPS----
F8GL52_NITSI/185-487-----------------------------------------------------NLAKDLGN.LA-P....NICTPT----
Q5NFC1_FRATT/167-471-----------------------------------------------------NYAKDLQN.LP-A....NICTTD----
C1CX12_DEIDV/141-444-----------------------------------------------------SLARELVS.AP-A....NVINPA----
Q3IGF0_PSEHT/197-499-----------------------------------------------------FLARDLTS.EV-A....THMTPV----
AMPA_ACIF2/187-489-----------------------------------------------------AWTRDMAN.EP-G....NICTPT----
D3DGZ8_HYDTT/170-478-----------------------------------------------------NYARDLVN.EP-G....NVINPI----
C5XSJ5_SORBI/217-528-----------------------------------------------------MLARDLVN.SP-A....NVLTPA----
S7XPV2_SPRLO/166-469-----------------------------------------------------.....LQE.TP-A....NYLTPT----
G0QTU9_ICHMG/188-495-----------------------------------------------------.YARQLSN.LR-A....NVVTTS----
PEPB_PECAS/115-428-----------------------------------------------------.WVRDTIN.LP-A....EDLGPE----
R5IH63_9FIRM/134-451-----------------------------------------------------.ETRDLVN.CP-A....NLLRPE----
A3QHP5_SHELP/107-420-----------------------------------------------------.FARQLIN.ET-P....ENLAPV----
AMPA_CLOTE/165-472-----------------------------------------------------FLARNLVN.EP-A....IYMTPT----
D3E5C0_GEOS4/167-476-----------------------------------------------------QLTRDLVN.ES-P....ETLNPE----
F0YD42_AURAN/8-314-----------------------------------------------------KLARDLVN.AP-P....NVLTPR----
C4XEL8_MYCFP/151-453-----------------------------------------------------NLVRNLQV.MP-E....NFCNSE----
AMPA_ACAM1/180-487-----------------------------------------------------ILTRELVA.AP-A....NVVTPS----
A9KJD8_CLOPH/156-463-----------------------------------------------------EFARDMVN.TP-G....NHLRPM----
B1VHG4_CORU7/223-532-----------------------------------------------------ALARDFVN.TP-A....NFLYPE----
I3TQI2_TISMK/153-457-----------------------------------------------------.HGRDLIN.TP-A....EDMGPH----
A6Q801_SULNB/167-476-----------------------------------------------------NFTRDIVN.TT-P....DDCYPE----
R4G7V9_RHOPR/195-505-----------------------------------------------------NIARKLEE.TP-A....NHMTPM----
AMPA_DECAR/185-486-----------------------------------------------------AMAKTLGN.LP-P....NICHPT----
F2I2F2_PELSM/172-479-----------------------------------------------------.ETRNLVT.LP-A....NILNPK----
Q2LTB4_SYNAS/209-516-----------------------------------------------------WFARDLVS.SP-G....NEMTPQ----
Q0BVD7_GRABC/167-472-----------------------------------------------------WLARDLIN.TP-P....NRLGPQ----
AMPA_PHYAS/175-482-----------------------------------------------------NLTKELVN.EP-A....NILGTN----
AMPA_RHOSR/187-495-----------------------------------------------------ATAREFVN.TP-P....SHLFPA----
B8GSN5_THISH/147-451-----------------------------------------------------.LVRDLVN.TP-A....QDMMPE----
E4NA06_KITSK/175-483-----------------------------------------------------NRARDLVN.TA-P....NDLNPK----
AMPA_IDILO/186-488-----------------------------------------------------.ICRNVAN.MP-P....NICTPR----
D2QMU2_SPILD/175-480-----------------------------------------------------....DLMN.AP-A....NYKKPQ----
U5VT53_9ACTO/195-506-----------------------------------------------------RLTRDWVN.TA-P....NDLRPP----
A6Q2V9_NITSB/164-474-----------------------------------------------------NLVRDIVN.TP-P....NEIYPE----
C5LFL0_PERM5/310-628-----------------------------------------------------.SAAALVD.LP-P....NCVNPI----
Q1GZJ7_METFK/170-472-----------------------------------------------------.LARSLTL.TP-P....NELTPA----
B3RJ17_TRIAD/181-484-----------------------------------------------------.TACYIVD.AP-C....NMMQTT----
AMPA_DESAH/194-500-----------------------------------------------------.EARNMAN.EP-A....NIWTAS----
A9AW38_HERA2/178-485-----------------------------------------------------NLARDLGN.NP-P....IVATPT----
Q6F247_MESFL/140-444-----------------------------------------------------NYARDLQD.TP-P....NIGTSE----
K9UJ96_9CHRO/179-486-----------------------------------------------------ILARELVA.AP-A....NVVTPM----
E1SUG1_FERBD/192-495-----------------------------------------------------FMARDMTN.AT-A....GDMYPG----
C6WKZ6_ACTMD/143-447-----------------------------------------------------.FNRDLAN.AP-S....NVKDPA----
C1D7G4_LARHH/187-489-----------------------------------------------------KLAKDLGN.LP-G....NVCTPE----
Q2IH05_ANADE/201-510-----------------------------------------------------AWARDLVNLGP-A....D.CTPE----
E0VTH6_PEDHC/186-508-----------------------------------------------------.....IGGPDP-.....ERMSAI----
A1TZ88_MARAV/189-492-----------------------------------------------------NYTKDLGN.TP-P....NICHPV----
C7LY66_ACIFD/135-442-----------------------------------------------------ALARDLVN.EP-P....SRMTPT----
I0HQ80_RUBGI/152-453-----------------------------------------------------.SVRDLVN.TP-A....EHMGPA----
D0MJD8_RHOM4/176-487-----------------------------------------------------MTARDLVN.LS-P....DEKTPT----
W8T135_EUBAC/181-489-----------------------------------------------------ILARNLTN.EP-A....NHMTPQ----
F0SRQ5_PLABD/174-479-----------------------------------------------------NLTRDLIN.RG-A....HEVSPA----
W5WYW6_BDEBC/193-504-----------------------------------------------------NLARHFVN.LP-P....NIINPS----
L0RV56_MYCC1/146-444-----------------------------------------------------NKARNLQI.MP-E....NFLNSE----
Q385B0_TRYB2/208-515-----------------------------------------------------.LCQRLVD.AP-P....NLLTTA----
Q3Z7Q3_DEHM1/181-487-----------------------------------------------------CSARDLIN.EP-S....SNMTPT----
AMPA_EXIS2/164-470-----------------------------------------------------NLARRLVT.MP-G....NLLTAP----
AMPA_HELHP/155-463-----------------------------------------------------NEVREIIN.TI-P....QVATPK----
A9H1J4_GLUDA/204-508-----------------------------------------------------.LARDLVS.EP-A....NVLRPP----
D7BNH5_ARCHD/180-485-----------------------------------------------------NAVRDLEN.TT-P....NYLNPV----
G4RGK4_PELHB/181-486-----------------------------------------------------ILARDLVN.EP-A....NLLGPS----
G0VPH0_MEGEL/169-474-----------------------------------------------------.TARDLVN.MP-S....NDLTPR----
Q2FZV6_STAA8/177-485-----------------------------------------------------NLARDFSN.MP-P....NVLTPQ----
K7SK34_GLUOY/178-483-----------------------------------------------------FLTRDLIS.EP-A....NILYPK----
G4T987_PIRID/149-478-----------------------------------------------------.....LME.LP-A....NMLTPT----
A9WS27_RENSM/184-495-----------------------------------------------------NATRTLVN.EP-P....SRLYPE----
B4LET1_DROVI/198-509-----------------------------------------------------NLARRLSD.AP-A....NCMTPT----
M4RKI0_BIBTR/181-483-----------------------------------------------------KFTKDVAN.CP-P....NVCNPR----
W5Y1W8_9CORY/201-508-----------------------------------------------------CVARDLVN.AP-S....SHLYPA----
I1F0D1_AMPQE/148-449-----------------------------------------------------.RVRDLIN.TP-A....CDMMPK----
E1WYU4_BACMS/188-500-----------------------------------------------------NVGRNFVN.EA-P....NILRST----
R7MC81_9CLOT/155-458-----------------------------------------------------KFTRNLAN.EP-A....AFATPT----
M9X503_PASHA/106-420-----------------------------------------------------.FVRELIN.KP-S....DKLTPE----
G2TKI9_BACCO/351-662-----------------------------------------------------NTARTLVN.TP-V....NIWTPV----
AMPA_ALCBS/176-482-----------------------------------------------------NVARDLGN.LP-P....NDCYPE----
Q3ILK4_PSEHT/109-424-----------------------------------------------------.WAREMVN.GT-A....DDIYPE----
AMPA_GEOSW/183-490-----------------------------------------------------NSARTLVN.TP-S....NLLTAA----
AMPA_VEREI/169-471-----------------------------------------------------EFAREWSN.RP-A....NHATPS----
Q0BQ02_GRABC/176-483-----------------------------------------------------FLTRDLVS.EP-A....NVLYPA----
E0TCR1_PARBH/179-485-----------------------------------------------------ALARDLVS.EP-P....NVLHPE----
G7UVR5_PSEUP/180-484-----------------------------------------------------RFTRELGN.LP-P....NLCTPA----
I4AP19_FLELS/170-477-----------------------------------------------------.LTRDLVN.EP-P....NFKKPS----
H1XNN0_9BACT/183-490-----------------------------------------------------YLARNLAN.QP-S....NIATPL----
AMPA_AGRT5/182-488-----------------------------------------------------ILARDLVN.LP-P....NVLGPV----
Q1GLN9_RUEST/161-462-----------------------------------------------------.FTRTLIN.TP-A....EHMGPA----
D1A8Z5_THECD/226-534-----------------------------------------------------TLVRDLVN.TP-P....SDLGPD----
F7XV17_MIDMI/175-484-----------------------------------------------------IVTRNLVS.EP-P....NNLFPI----
Q4A9M4_MYCHJ/148-451-----------------------------------------------------NYARYYQN.MP-P....NMASSE----
K0IP26_NITGG/178-489-----------------------------------------------------NFARDIGN.LP-P....NDCPPA----
R6P3P9_9CLOT/190-495-----------------------------------------------------NFARDLAN.EQ-P....AYATPS----
C4L7J6_TOLAT/112-424-----------------------------------------------------..IREITN.AT-P....ENLYPT----
C7QD45_CATAD/187-496-----------------------------------------------------NLARDLIN.TP-P....SHLYPA----
S6B1V4_9PROT/185-486-----------------------------------------------------NMAKDLGN.LP-G....NICTPA----
W4ZBJ1_STRPU/127-428-----------------------------------------------------..SARIVD.MP-C....NEMNTM----
F4P386_BATDJ/175-497-----------------------------------------------------NYARHFME.TP-A....NYMTPT----
E0VY84_PEDHC/143-452-----------------------------------------------------NIARRFAD.AP-A....NLMTPT----
X2H8V4_9NEIS/159-462-----------------------------------------------------NICKDLGN.AP-G....NICTPA----
M4Q2H1_LIBAS/179-484-----------------------------------------------------NLARDIIN.EP-A....NVLGTD----
AMPA_SACD2/191-494-----------------------------------------------------NAARELGN.LP-G....NICTPN----
R4G844_RHOPR/180-488-----------------------------------------------------REAAAIVD.TP-C....NLMNVT----
Q5NFW9_FRATT/157-462-----------------------------------------------------.LVRDMIT.TP-A....EDMGPA----
A8GFQ9_SERP5/151-457-----------------------------------------------------IAGRELMN.KP-A....NILYPE----
I1ECS0_AMPQE/117-418-----------------------------------------------------.LARDLGN.LP-G....NICTPE----
Q4JUE7_CORJK/177-487-----------------------------------------------------.LSRDLAN.AP-A....NVKSPE----
D1BTR9_XYLCX/183-491-----------------------------------------------------.GTRDLIN.TP-P....NVMFPA----
Q2N8X3_ERYLH/169-476-----------------------------------------------------EFTRHLVA.EP-A....NKLYPE----
F8JDL0_HYPSM/188-496-----------------------------------------------------NLARDLVN.EP-A....NILGPV----
C3ZTT6_BRAFL/137-448-----------------------------------------------------NFARRLME.MP-A....SHLTPT----
AMPA_BACSU/179-486-----------------------------------------------------NSARTLVN.MP-G....NMLTAT----
K9SQM3_9SYNE/183-493-----------------------------------------------------ILARELVA.AP-A....NIVTPQ----
D5V934_MORCR/183-496-----------------------------------------------------TTARDVAN.EA-P....NVLNPS----
W0RJB2_9BACT/177-481-----------------------------------------------------.VARRLAM.MP-G....NVCTPD----
D5ARI2_RHOCB/174-482-----------------------------------------------------TLARDLVN.FP-A....SHLHPD----
B0RC08_CLAMS/163-478-----------------------------------------------------.GTKDLVN.TP-P....LDLYPA----
V8NM62_OPHHA/226-552-----------------------------------------------------NLARYLME.GP-A....NHITPT----
E1WXC3_BACMS/175-481-----------------------------------------------------NQARHLVN.LP-P....NDLNPV----
Q74ME1_NANEQ/136-437-----------------------------------------------------.LARDLAN.EP-P....NVLNPE----
AMPA_RHOBA/194-500-----------------------------------------------------NHTRRLVN.EP-P....SIMNPT----
E3HCG5_ILYPC/163-471-----------------------------------------------------NITRDLVN.EP-A....NVIYPK----
I3EIT3_NEMP3/153-459-----------------------------------------------------NFARFLVD.TP-A....NKLTPT----
A8PX42_MALGO/206-528-----------------------------------------------------NWSRELQE.VP-A....NLMSPT----
D1AW21_STRM9/165-472-----------------------------------------------------FFARDLVN.MP-A....QDLYPE----
AMPA_PHYMT/180-487-----------------------------------------------------NLTKELVN.EP-A....NILGTE----
K9TP02_9CYAN/178-485-----------------------------------------------------NLARELVA.AP-S....NIVTPM----
Q5QVQ9_IDILO/110-426-----------------------------------------------------RFSRELTN.LS-A....EEIYPE----
A0KJ39_AERHH/105-419-----------------------------------------------------..VREMTN.AT-P....EQLGPL----
R4I1Z4_9ENTR/185-489-----------------------------------------------------KVAKDLSN.MP-P....NICNAS----
AMPA_DESVH/189-497-----------------------------------------------------.VARDLVN.GP-A....NIVTPA----
Q3J2C5_RHOS4/173-478-----------------------------------------------------FFTRDLVN.EP-A....NVLSTF----
I3Z9T1_BELBD/166-470-----------------------------------------------------....KLVD.LP-P....NTATPS----
A8AD96_CITK8/126-432-----------------------------------------------------.AARRLAD.TP-S....DCCTPQ----
D7DNN5_METV0/170-477-----------------------------------------------------.LCRELTI.TP-P....NELTPT----
I4EZZ6_MODMB/187-494-----------------------------------------------------TLVRDLVN.TP-P....NDLYPA----
D8U583_VOLCA/286-593-----------------------------------------------------.LTRYLVE.AP-P....NVCTPT----
Q3ASD6_CHLCH/214-521-----------------------------------------------------RMARELVN.LP-G....NYLNAE----
Q7K2S9_DROME/205-516-----------------------------------------------------NLARRLSD.TP-A....NMMTPS----
A7ATY9_BABBO/212-515-----------------------------------------------------HTTRELVT.AP-A....NYANTE----
C1MN89_MICPC/166-478-----------------------------------------------------ALTKQLVA.AP-P....NVVTPT----
I0HIE5_ACTM4/159-462-----------------------------------------------------.LARDLTN.TP-S....SVKNPE----
D5WQ91_KYRT2/162-467-----------------------------------------------------.LARDLAN.EP-A....NQLRPD----
W0ACZ9_9SPHN/174-480-----------------------------------------------------.LTRELVS.EP-P....NIIYPE----
Q30RI3_SULDN/154-464-----------------------------------------------------NFTRDIVN.KA-P....QEINPQ----
A9VE03_MONBE/184-491-----------------------------------------------------.QCARLVD.MP-C....NELPVS----
Q1AWY8_RUBXD/171-474-----------------------------------------------------.LARDLAN.EP-S....NTATPE----
H2FZB9_OCESG/110-424-----------------------------------------------------HWVREMIN.GT-P....EDVYPA----
W5JSJ5_ANODA/181-486-----------------------------------------------------RLAARIVD.AP-C....NEMNVS----
D9QLJ2_BRESC/175-480-----------------------------------------------------.FSRDLVA.EP-A....NVLYPA----
D1B198_SULD5/165-472-----------------------------------------------------NFAKEIVN.TI-P....NDMTPI----
T1I7W1_RHOPR/168-479-----------------------------------------------------NLARNFME.MP-A....NVLTPS----
Q1MQI7_LAWIP/195-504-----------------------------------------------------NLARTLDN.TP-A....NIMTPI----
C0ZKP7_BREBN/184-490-----------------------------------------------------NLARTLVN.EP-A....NYLTPR----
K5X0U2_AGABU/163-482-----------------------------------------------------NLARTLME.LP-A....NMVTPS----
W8L4C2_HALHR/185-488-----------------------------------------------------QLTRDLGN.RP-G....NVCTPV----
D3SCN2_THISK/182-485-----------------------------------------------------NRAKDLGN.TP-P....NVCYPE----
L0EC43_THECK/195-501-----------------------------------------------------AYARRLTN.LP-G....NMLTPE----
C6XKP4_HIRBI/172-480-----------------------------------------------------ELARDLVN.EP-P....NTLHPE----
T1HW61_RHOPR/144-452-----------------------------------------------------NLARQLCE.MP-G....NLLTPI----
I3ZET0_TERRK/196-505-----------------------------------------------------NFTRSLVN.EP-G....NVLTPT----
Q5F7F1_NEIG1/161-462-----------------------------------------------------.LCRDLGN.AA-P....NECTPE----
A5CE02_ORITB/213-539-----------------------------------------------------VLARNLIS.EP-P....NKLYPA----
AMPA_STACT/179-487-----------------------------------------------------KLARDFSN.IP-P....NILTPE----
I1CQB4_RHIO9/168-479-----------------------------------------------------NVARMLMT.SP-S....NLMTPK----
B6IN72_RHOCS/181-488-----------------------------------------------------CLTRDVVS.EP-G....NVIYPE----
D0N253_PHYIT/201-510-----------------------------------------------------IFARNLGN.GR-S....HIVDPA----
AMPA_BAUCH/184-488-----------------------------------------------------KAAKDLAN.MP-P....NICNSA----
G9K7V3_MUSPF/197-508-----------------------------------------------------NLARHLME.TP-A....NEMTPT----
Q98PJ6_MYCPU/147-450-----------------------------------------------------NFARDLQT.TP-P....NICNSE----
B9KGL3_ANAMF/215-524-----------------------------------------------------FFVRSLVS.EP-S....NVLYPE----
E1G7N5_LOALO/180-485-----------------------------------------------------.NTARLID.IP-Y....NELNTE----
A0KKV8_AERHH/174-479-----------------------------------------------------.LARHLAV.SP-A....SDLTAR----
T1KFN1_TETUR/255-562-----------------------------------------------------IIARRLAD.MP-A....NLMTPT----
Q65UT6_MANSM/106-424-----------------------------------------------------.FVREIIN.LP-S....SVITPL----
G0G4J3_AMYMS/162-466-----------------------------------------------------ALTRDLAN.TP-S....NVKTPA----
F2JNG0_CELLD/166-473-----------------------------------------------------IIARDLVN.EP-S....NVLYPE----
D5CMG4_SIDLE/182-485-----------------------------------------------------ELTKTLGN.LP-G....NICTPT----
I0DQ67_PROSM/110-423-----------------------------------------------------.WVRDVIN.AP-A....DELGPE----
D5ANE5_RHOCB/156-455-----------------------------------------------------.LARDLIN.TP-A....NDLGPD----
AMPA_POLSJ/172-473-----------------------------------------------------EFAKEWAN.RP-A....NHATPT----
F8AWG1_FRADG/240-556-----------------------------------------------------HLARDLIN.TP-S....LLKSPA----
D8QL11_SCHCM/159-478-----------------------------------------------------NLARTLME.LP-A....NMMTPT----
AMPA_KORVE/198-505-----------------------------------------------------NFTRDLVN.EP-G....NRMTPT----
Q22U45_TETTS/226-538-----------------------------------------------------.YARQLGN.LR-A....DIANTE----
S8ED96_FOMPI/198-516-----------------------------------------------------NLARTLSE.LP-G....NIITPT----
C8XH50_NAKMY/178-496-----------------------------------------------------AFARSLVN.SA-P....NDLFPA----
B2GJ82_KOCRD/188-498-----------------------------------------------------RLTRTLVD.LS-P....DTATPE----
Q6KHI1_MYCMO/148-452-----------------------------------------------------NYARKYQA.MP-P....NICNSE----
D1B8Y3_THEAS/161-468-----------------------------------------------------NYARDLAN.EP-G....NVITPS----
F8A3L6_CELGA/178-486-----------------------------------------------------HATRDLVN.TA-P....NDLYPA----
F4H8J8_CELFA/213-523-----------------------------------------------------.LARDLAA.TP-S....STKNPA----
G8ARD3_AZOBR/181-489-----------------------------------------------------AYTRDLVS.EP-A....NVLNPE----
E3FVV2_STIAD/205-514-----------------------------------------------------NWARDLVN.EP-A....NVVNPE----
B5EHT0_GEOBB/180-486-----------------------------------------------------CLARDLVS.HP-G....NVVTPG----
K3WWD2_PYTUL/216-529-----------------------------------------------------QLAVRLTD.AP-P....NELHSD----
M4UJA1_9GAMM/185-489-----------------------------------------------------KACKDLTN.MP-A....NICTPL----
AMPA_SHIDS/185-490-----------------------------------------------------KAAKDLGN.MP-P....NICNAA----
Q3SL83_THIDA/192-494-----------------------------------------------------ALAKDLGN.TP-S....NVCTPE----
H0UKX6_9BACT/164-472-----------------------------------------------------.RSRSLAN.EP-G....NVIGPA----
E3CW34_9BACT/172-479-----------------------------------------------------NYARDLAN.EP-G....NVVTPE----
Q2Y7L5_NITMU/178-480-----------------------------------------------------.LTRELTV.LP-P....NELTPG----
E9HJS0_DAPPU/84-399-----------------------------------------------------NLARWLME.MP-A....NHMTPT----
D9QBH7_CORP2/188-495-----------------------------------------------------MFARDLVN.AP-S....SHLYPE----
G4RFS9_PELHB/135-430-----------------------------------------------------.IARDLVN.IP-A....NDLGPD----
Q3SL12_THIDA/170-475-----------------------------------------------------.LTRSLTV.QG-P....DELTPG----
H8L6A0_FRAAD/182-486-----------------------------------------------------RFARELAN.LP-P....NICNPQ----
D2R8B5_PIRSD/204-511-----------------------------------------------------NLARHLVN.EP-P....SEIYPE----
C3ASC5_BACMY/178-485-----------------------------------------------------NSARTLVN.MP-P....NVLTAT----
AMPA_THISH/185-488-----------------------------------------------------KLTRDLAN.LP-G....NICNPT----
AMPA_CAUCR/177-483-----------------------------------------------------.FSRNLVS.EP-A....NILHPE----
Q2W0Z5_MAGSA/182-488-----------------------------------------------------FLTRDVVS.EP-A....NIIHPE----
D6WAL5_TRICA/203-514-----------------------------------------------------NLARRLSD.TP-A....NQMTPL----
AMPA_ACTP2/185-489-----------------------------------------------------AFAKNVAN.CP-P....NVCNPA----
A1SUJ1_PSYIN/109-425-----------------------------------------------------EWVRETIN.LG-P....EALAPN----

PF05450

NICA_MOUSE/273-498------------------------------------------------VV-VAA-------------------TRLD---
Q7PY38_ANOGA/276-510------------------------------------------------IV-LVS-------------------TRTD---
Q6Z743_ORYSJ/248-457------------------------------------------------II-MVT-------------------ASQD---
NICA_CAEEL/278-508------------------------------------------------YM-MVT-------------------ARMD---
NICA_ARATH/251-460------------------------------------------------VV-LTV-------------------ASMD---
Q7KS07_DROME/236-469------------------------------------------------FI-LVT-------------------CRLD---

PF04389

Q7UGZ5_RHOBA/466-676---------------------------------------KGGL.ADE.TV.VIG-------------------AHYD---
Q7UQS9_RHOBA/713-958---------------------------------------NSTDDVQFPVV.MVG-------------------AHID---
IAP_ECOLI/99-331---------------------------------------KA....PQ.QI.IIM-------------------AHLD---
Q7PX80_ANOGA/279-471---------------------------------------TTY..TDTSVV.VVS-------------------GHLD---
Q8A5P9_BACTN/127-331---------------------------------------KNT...KE.YV.IVG-------------------AHFD---
Q82DU6_STRAW/104-310---------------------------------------GNT...NQ.VV.MSG-------------------SHLD---
M28P1_SCHPO/127-317---------------------------------------KSK...DLFPI.LLS-------------------AHFD---
Q8EF07_SHEON/292-502---------------------------------------KSR..PDE.VV.MMH-------------------AHWD---
Q7PQQ4_ANOGA/155-351---------------------------------------RSESTSRH.AL.LLN-------------------CHFD---
Q97F97_CLOAB/215-408---------------------------------------KSS...KN.PV.VIS-------------------AHFD---
Q7RZ44_NEUCR/238-455---------------------------------------GDH...NN.VL.IVG-------------------GHSD---
Q9A3U5_CAUCR/179-398---------------------------------------AKR..PDE.TV.IFS-------------------GHWD---
Q8TL26_METAC/107-308---------------------------------------GNESGARK.LI.LVT-------------------AHLD---
YC52_SCHPO/139-332---------------------------------------GTEACKEE.AV.LIN-------------------AHVD---
Q86PD7_DROME/119-343---------------------------------------NA....ER.YL.VLS-------------------CHYD---
Q8PEF6_XANCP/320-540---------------------------------------STH..ADE.AV.LYM-------------------AHWD---
APE3_YEAST/295-497---------------------------------------GDP...DN.IV.ALG-------------------AHSD---
Q9A4J1_CAUCR/320-539---------------------------------------SDPTLKAQ.TI.ILS-------------------AHLD---
Q9HZQ8_PSEAE/277-492---------------------------------------GNP...NN.VV.MVG-------------------AHLD---
Q9VRQ9_DROME/96-322---------------------------------------QA....QN.FL.ALA-------------------CHYD---
Q9A578_CAUCR/245-463---------------------------------------SDPVLSKE.YV.VLT-------------------AHLD---
O67732_AQUAE/181-362---------------------------------------RGP......VL.LLV-------------------AHYD---
Q82VZ8_NITEU/814-1018---------------------------------------TNPQLAEQ.SL.VIG-------------------AHYD---
Q9KLD3_VIBCH/180-384---------------------------------------SEK..PDE.WV.IVG-------------------GHLD---
Q7ND13_GLOVI/294-511---------------------------------------SDPKLKNE.YI.VLS-------------------AHLD---
Q7QJV5_ANOGA/144-340---------------------------------------AQGSDPDN.YL.MLS-------------------SHFD---
Q9HNP7_HALSA/213-399---------------------------------------DT....PT.EV.VVI-------------------AHHD---
Q898V9_CLOTE/213-406---------------------------------------KNS...TE.PI.IIS-------------------GHFD---
M28P1_NEUCR/167-355---------------------------------------RN....AK.GLTLVN-------------------AHYD---
Q8A4P9_BACTN/106-327---------------------------------------ES....KK.RI.ALF-------------------AHWD---
Q7MT37_PORGI/106-324---------------------------------------EA....TG.RM.LLM-------------------AHWD---
Q7Q1Q7_ANOGA/119-344---------------------------------------NA....AR.NL.VLA-------------------CHYD---
QPCTL_MOUSE/151-377---------------------------------------GA....AR.HL.TLA-------------------CHYD---
Q9FBN5_STRCO/118-324---------------------------------------DA....ND.VY.MFG-------------------AHLD---
Q7X7Q3_ORYSJ/116-307---------------------------------------EAE...DN.LI.LVS-------------------SHID---
Q9VTH7_DROME/118-327---------------------------------------QT....QR.YL.MFG-------------------CHYD---
Q8MT48_DROME/136-331---------------------------------------KNA..TSEAAL.LIN-------------------SHFD---
YP67_CAEEL/153-348---------------------------------------KKGP.SGN.SL.LLN-------------------CHFD---
Q9HRR8_HALSA/209-394---------------------------------------PDT...DA.EL.LVT-------------------SHVD---
Q8EDI3_SHEON/300-522---------------------------------------SQQ..ADE.HI.LFT-------------------GHWD---
M28P1_YEAST/136-325---------------------------------------KNP...EEEGL.LLS-------------------AHFD---
Q8P3Z6_XANCP/285-504---------------------------------------SQH..PDE.TV.IFS-------------------AHWD---
Q9A369_CAUCR/106-296---------------------------------------RDR...SLPAI.LVM-------------------SHYD---
Q8CK35_STRCO/698-904---------------------------------------DA....NS.VY.MFG-------------------AHLD---
Q7UHT1_RHOBA/165-383---------------------------------------DA....PT.RF.LLC-------------------AHYD---
Q7MAY9_PHOLL/137-328---------------------------------------AP....EG.TL.LFV-------------------SHYD---
Q8XIF2_CLOPE/218-412---------------------------------------KNPF.LPP..L.VLT-------------------AHFD---
YFI8_YEAST/108-354---------------------------------------NA....SE.YL.VLA-------------------AHYD---
A0KMQ2_AERHH/300-500---------------------------------------SRY..PDE.VV.VLG-------------------GHLD---
A1ZBK1_DROME/141-334---------------------------------------KSSD.NEN.YL.LVN-------------------SHYD---
B1W291_STRGG/111-316---------------------------------------GDP...NK.VL.MAG-------------------AHLD---
F4HRW3_ARATH/131-323---------------------------------------MNSLDTDA.SV.LMN-------------------AHYD---
P96264_MYCTU/252-471---------------------------------------GSS...AN.VV.MAG-------------------AHLD---
Q65DH7_BACLD/234-429---------------------------------------KGVK.NPD.IV.YVT-------------------SHYD---
Q8P530_XANCP/298-511---------------------------------------STH..PDE.TL.IYS-------------------AHWD---
V5IL52_NEUCR/186-374---------------------------------------TS....SN.LV.IVS-------------------AHYD---

PF16254

E3I196_RHOVT/23-360---------------------------------------ITGDGVRE-TLRRLG-------------------RHIP...
Q72C97_DESVH/23-362---------------------------------------LTGDGVRT-TLDYLG-------------------NVMG...
V6F7J1_9PROT/5-345---------------------------------------LTGDGVRR-TLSYLA-------------------DLLP...
A8L141_FRASN/24-365---------------------------------------ITGSGVRA-TLDLVR-------------------AALPAQI
A4YXC9_BRASO/19-355---------------------------------------LTGAGVRR-TLEIVG-------------------RHVD...
D2B4H6_STRRD/11-348---------------------------------------ITGDGVRR-TLEIVG-------------------ESVP...
K9TUF6_9CYAN/28-366---------------------------------------ITGNGVRE-TLKILQ-------------------EHIP...
A9A1R6_NITMS/2-337---------------------------------------LVSIDYDE-SLEYIS-------------------KILP...
K9R692_9CYAN/22-359---------------------------------------ITGNGFRE-TLNIIN-------------------QHIP...
K8GK59_9CYAN/18-355---------------------------------------ITGNGVRK-TLHILQ-------------------QYIS...
D8PH49_9BACT/2-340---------------------------------------ITGQGIRD-TFGRIQ-------------------QHIP...
A6X4E0_OCHA4/24-360---------------------------------------LAGDGVRE-TLAVIG-------------------EHLP...
G0FP92_AMYMS/13-348---------------------------------------ITGDGVRQ-TLDIIG-------------------EHIS...
Q0P8W2_CAMJE/19-363---------------------------------------ITGQGFRD-SLEILN-------------------KTLGG.G
B8DNR6_DESVM/11-350---------------------------------------LTGDGVRE-TLRYLG-------------------DLLP...
E4TGF1_CALNY/8-350---------------------------------------LTGKGFRK-SLEIIK-------------------EYVS...
B8J2H8_DESDA/5-344---------------------------------------ITGNGVRQ-TLSILK-------------------EELP...
Q2J611_FRASC/47-388---------------------------------------ITGDGVRT-TLATVA-------------------RALGPEP
Q7CVW7_AGRT5/25-363---------------------------------------ITGKGVRD-TIDILK-------------------DYID...
B6IYF3_RHOCS/20-362---------------------------------------ITGPGLRE-TIQRIA-------------------GRIP...
C9YZ07_STRSW/8-345---------------------------------------ITGDGVRA-TLDIVG-------------------EYIP...
Q74B36_GEOSL/18-356---------------------------------------ITGDGVRE-TLRIIQ-------------------GQIP...
W8EZ41_9BACT/23-362---------------------------------------ITGDGVRQ-TLAILR-------------------EYLP...
K9UPJ0_9CHRO/224-561---------------------------------------ITGDGVRK-TLHILQ-------------------QFIP...
PBPAD_CLOAB/19-355---------------------------------------ITGNGVRK-TMDIIR-------------------KHIP...
F4KR41_HALH1/11-348---------------------------------------ITGDGVRE-SLSIIQ-------------------EYIP...

PF07454

G7M1H4_9CLOT/98-351PV.......N..........NTDST...........NSKIYDPSLKK..............................---
B7GKC2_ANOFW/97-371.............................................................................---
R7FHF1_9CLOT/95-400SN.......SGIKTEVVTPNPIAEN...........ANVQYGNVKIKNQTTYNLTEDILNP................---
E6TW22_BACCJ/104-380.............................................................................---
SP2P_BACSU/104-382.............................................................................---
W6RYD9_9CLOT/92-354EN.......GQVEPVSEEGNPLLEA...........TLNVFDERFV...............................---
R6Y5Z6_9CLOT/84-328.............................................................................---
R6FU89_9CLOT/96-359TE.......EEK........EAIAK...........ESPAYDESLKK..............................---
Q8EPW1_OCEIH/97-371.............................................................................---
L0KBT3_HALHC/114-380TG.......SNLDRRNNEKQKIEQE....................................................---
B2TLZ1_CLOBB/101-350SS..................NEKSL...........NSKIYDASLKK..............................---
A0Q1S0_CLONN/81-361NA.......NENKSDG....NGNMA...........SAPVFSKELQK..............................---
C0ZB23_BREBN/92-372AP...........................................................................---
A5N6L6_CLOK5/97-357SD.......TSSSNSQN.DLNLENK...........TVTLYDSSLKK..............................---
R6BH31_9FIRM/101-413KR.......KKNKKAQTEETKEQQE.....................TVNMEELQDFQTLVGNYYTVDASTTADPEQI---
R4K1D8_CLOPA/88-355DG.......SSTSNANNGSPNTESQ...........ISQAYNPKLKK..............................---
Q892Q3_CLOTE/90-343EK.......VVTKELNK.....................KIHNPSLKK..............................---
A5I646_CLOBH/92-358KA.......EEMKDGKE.DLNLENK...........VVNVQDPKLKK..............................---
A6TSM6_ALKMQ/126-409HL....QETSAQPEMDEDDKGERQE...........GVYLIDQHNII......................DSLAGDLE---
D5DKD3_BACMD/102-382.............................................................................---
F3ZZL9_MAHA5/110-385NS.......DEEVNIDINDVTDDLE...........DI.......................................---
Q892Q4_CLOTE/90-345E.........VKKEINK.....................KIHNPNLKK..............................---
Q0AWL6_SYNWW/52-337QL.......PEVEPEPLEESRDIDY....................................................---
Q81RH8_BACAN/96-373.............................................................................---
Q5WHG7_BACSK/96-380AE...........................................................................---
Q8XIS4_CLOPE/83-353SE.......EESKESAELEASKNSE..............VYDPSLKK..............................---
F4LT33_TEPAE/61-306KQ.......DTLKT...............................................................---
B2A1M1_NATTJ/95-352ET...GLDLSELPEEPIEDSPQIVA....................................................---
E3E9H1_PAEPS/109-393DP...........................................................................---
R5SWF7_9CLOT/86-332.............................................................................---
B8CXL6_HALOH/74-346EA.......DNIKKAVE............................................................---
C8VZ23_DESAS/71-308.............................................................................---
F2JQY0_CELLD/81-394QN.......DRTSQVQEKVSIEALK...........DPQYVFNRYMTASAEMEFGVDMIKEW...............---
I0JP55_HALH3/103-369R............................................................................---
R4KD37_CLOPA/91-359TG.......NSDS.SNNANLNLPNQ...........TYQVYNSKLKK..............................---
Q3AF15_CARHZ/59-322YA................................................LWLLTGARVNDPYSLMLAGYPVLNGGE---
A8MFA4_ALKOO/132-419KNIDGEYYIDKETVKDEEDLGELDE...........GIYVLGQEDLI......................DSLNPVAA---
D9QV82_ACEAZ/112-379QT.......EPSQKTEKFD..........................................................---
Q8RB76_THETN/91-376RK.......EEKKEPSGEEK.........................................................---
R5KZW5_9CLOT/103-377NN.......VQVQNKIPSDFYSLNI...........KELLNQKADLK..............................---
R6L1N6_9FIRM/117-447EK.......DSEKETDKSQQDKPATVIPEVTQTILASNSIQPAPRIDLSPQTLADYDYLMNQFFIVDSQTTTNADQL---
R6QET5_9FIRM/92-366.........VKNQFYDLEDNEQSGV...........RVDEVPAKKTVFNSKKWNDPNYLRKYIYQVDSTTMVTNSEI---
C5D4U7_GEOSW/103-381.............................................................................---
R6G2S5_9CLOT/93-364TE.......E..........EINSG...........ESDAYNEALKK..............................---
R4K976_CLOPA/94-363ST.......NNSSGDSS...NPSNQ...........TFQIYNPKLKK..............................---
Q81NS4_BACAN/93-365NK...........................................................................---
A6LRM7_CLOB8/99-348QV..................NTDSK...........NTPIYDPSLKK..............................---
I3VX26_THESW/94-382AN.......ETPKESETTATATNAS....................................................---
C3AKV3_BACMY/56-328DA...........................................................................---
X5A281_9BACL/111-398DS...........................................................................---
D3FXK3_BACPE/103-378.............................................................................---
R6PS90_9CLOT/86-357IF.......ENVKVKNTTDTKPLDI...........EKVLAEPLEL...............................---
N0B327_9BACI/103-379.............................................................................---
D3E4Y7_GEOS4/111-412KGEDAPDQGGKDEPGSKNEPGSTSK....................................................---
R5Y996_9FIRM/99-374KN.......VQVQSKIPEDFYSLDI...........ERLLQEKADLK..............................---
R7IMN7_9FIRM/105-428QQ.......ENGQTVEEQTSAGGGQ...........PSGVQETFSPAFSLDQLKNYDFLRSNLYIVPERASVLPQDL---
A8FFD8_BACP2/104-382.............................................................................---
U5LAD6_9BACI/47-322.............................................................................---
K0J3S0_AMPXN/101-371PA...........................................................................---
K0B2K4_CLOA9/112-386KP.......NAI.................................................................---
A6TS45_ALKMQ/55-322EE.......GEEGEGEGERPG........................................................---
Q97JJ8_CLOAB/89-349TS.......GSVQNE.....PLKNI...........NENIYDPKLKK..............................---
R6B5M3_9CLOT/98-368HA.......STNLETQVIDSAVPNK...........YTNDYHGVEIKNGTNYTLTDDILNYD...............---
G2TNJ2_BACCO/102-380.............................................................................---
U5RWI9_9CLOT/89-351GS.......TSKSNTQN.DLNLENK...........DVTVYNPKLKK..............................---
Q9KBM3_BACHD/93-368.............................................................................---
Q65H48_BACLD/103-380.............................................................................---
A8MH52_ALKOO/53-307NS.......GKE.................................................................---
U5LDU1_9BACI/103-376.............................................................................---

PF01520

Q18AN8_PEPD6/486-667--------------------------------------------------------------------------------
A9BFG0_PETMO/246-450--------------------------------------------------------------------------------
A8MFT2_ALKOO/8-185--------------------------------------------------------------------------------
B8I4Q9_CLOCE/815-990--------------------------------------------------------------------------------
A9KSW1_CLOPH/279-457--------------------------------------------------------------------------------
A8MIX1_ALKOO/49-238--------------------------------------------------------------------------------
B8I0V7_CLOCE/52-254--------------------------------------------------------------------------------
A8ZXB5_DESOH/55-253--------------------------------------------------------------------------------
Q7NKW3_GLOVI/183-391--------------------------------------------------------------------------------
Q0P8Y7_CAMJE/436-653--------------------------------------------------------------------------------
Q8XP50_CLOPE/109-309--------------------------------------------------------------------------------
Q65J97_BACLD/4-173--------------------------------------------------------------------------------
A6LWT5_CLOB8/185-363--------------------------------------------------------------------------------
Q89VV6_BRADU/18-229--------------------------------------------------------------------------------
A6TNB4_ALKMQ/3-181--------------------------------------------------------------------------------
Q898S7_CLOTE/57-230--------------------------------------------------------------------------------
Q2RL42_MOOTA/469-652--------------------------------------------------------------------------------
A5I6J1_CLOBH/742-945--------------------------------------------------------------------------------
Q0S524_RHOSR/65-279--------------------------------------------------------------------------------
Q213N5_RHOPB/201-418--------------------------------------------------------------------------------
Q65GR1_BACLD/351-520--------------------------------------------------------------------------------
Q3B4P2_PELLD/11-205--------------------------------------------------------------------------------
E0TDU6_PARBH/209-421--------------------------------------------------------------------------------
Q03S01_LACBA/51-222--------------------------------------------------------------------------------
Q2LTS4_SYNAS/37-231--------------------------------------------------------------------------------
A6GWP0_FLAPJ/28-200--------------------------------------------------------------------------------
A4CK99_ROBBH/34-251--------------------------------------------------------------------------------
A6VP10_ACTSZ/21-216--------------------------------------------------------------------------------
Q899C4_CLOTE/144-318--------------------------------------------------------------------------------
Q1GIB7_RUEST/182-398--------------------------------------------------------------------------------
Q5WE61_BACSK/4-182--------------------------------------------------------------------------------
Q73LZ8_TREDE/115-329--------------------------------------------------------------------------------
Q8ETR2_OCEIH/45-230--------------------------------------------------------------------------------
A0ZJD3_NODSP/4-182--------------------------------------------------------------------------------
Q1MPK0_LAWIP/382-592--------------------------------------------------------------------------------
Q1D594_MYXXD/56-271--------------------------------------------------------------------------------
Q187L1_PEPD6/3-170--------------------------------------------------------------------------------
AMIB_BUCAI/7-226--------------------------------------------------------------------------------
A6M0K3_CLOB8/58-252--------------------------------------------------------------------------------
A5N4X3_CLOK5/47-233--------------------------------------------------------------------------------
Q6MJS0_BDEBA/26-247--------------------------------------------------------------------------------
Q9RRC5_DEIRA/161-334--------------------------------------------------------------------------------
Q1ATQ5_RUBXD/173-345--------------------------------------------------------------------------------
A4J7N3_DESRM/56-235--------------------------------------------------------------------------------
A8F7U0_THELT/27-198--------------------------------------------------------------------------------
A6LTJ0_CLOB8/6-175--------------------------------------------------------------------------------
Q1INP2_KORVE/300-482--------------------------------------------------------------------------------
Q67SM9_SYMTH/5-211--------------------------------------------------------------------------------
O67592_AQUAE/134-352--------------------------------------------------------------------------------
Q82B44_STRAW/116-328--------------------------------------------------------------------------------
Q5WG95_BACSK/210-375--------------------------------------------------------------------------------
Q2J4A8_FRASC/242-415--------------------------------------------------------------------------------
B4EFF6_BURCJ/51-248--------------------------------------------------------------------------------
E3E7W5_PAEPS/339-510--------------------------------------------------------------------------------
F0LNP9_VIBFN/125-343--------------------------------------------------------------------------------
O51610_BORBU/108-323--------------------------------------------------------------------------------
Q04G91_OENOB/125-301--------------------------------------------------------------------------------
Q0WI21_YERPE/190-404--------------------------------------------------------------------------------
Q183X8_PEPD6/3-169--------------------------------------------------------------------------------
Q2FYD8_STAA8/181-363--------------------------------------------------------------------------------
Q31QC3_SYNE7/389-561--------------------------------------------------------------------------------
Q6LSI5_PHOPR/4-180--------------------------------------------------------------------------------
Q816X3_BACCR/105-303--------------------------------------------------------------------------------
Q8F0Q8_LEPIN/141-356--------------------------------------------------------------------------------
Q8NL57_CORGL/209-386--------------------------------------------------------------------------------
Q8RE04_FUSNN/127-333--------------------------------------------------------------------------------
R5KJW1_9CLOT/62-237--------------------------------------------------------------------------------
R5TN65_9FIRM/5-172--------------------------------------------------------------------------------
R5TUS7_9FIRM/59-235--------------------------------------------------------------------------------
R5U1F0_9BACE/144-352--------------------------------------------------------------------------------
R6MZX5_9CLOT/5-182--------------------------------------------------------------------------------
R7FPN2_9FIRM/5-173--------------------------------------------------------------------------------

PF00246

Q7QC23_ANOGA/57-339--------------------------------------.GQSREGVPLSVLEIRPNVN...................---
Q7QC23_ANOGA/466-752--------------------------------------.GKSVQGRDLWVMEVTEQPG...................---
Q7PRP0_ANOGA/83-361--------------------------------------.GKSAQGRDLWVLVVSASPY...................---
Q7PSV3_ANOGA/117-396--------------------------------------.GTSYEGRPIRGVKLSRR.....................---
CBPB2_HUMAN/129-411--------------------------------------.GSSFEKYPLYVLKVSGK.....................---
CBPA3_HUMAN/125-404--------------------------------------.GSTVEDNPLYVLKIGEK.....................---
AEBP1_MOUSE/561-887--------------------------------------.GKSSRGLKIYAMEISDNPG...................---
Q23318_CAEEL/147-446--------------------------------------.GTTSEGRPIQGIKIGSQV....................---
Q9W477_DROME/334-625--------------------------------------.GVTRNKRPLEVIRVSNG.....................---
Q7Q316_ANOGA/128-403--------------------------------------.GESYEGREIRGVKVSY......................---
CBPB1_BOVIN/125-404--------------------------------------.GTTFLGNTIYLLKVGKP.....................---
CBPE_BOVIN/63-363--------------------------------------.GRSFEGRELLVLELSDNPG...................---
CBPA1_ANOGA/137-415--------------------------------------.GRSHQNRTMKGVKLSY......................---
CBPA1_DROME/131-415--------------------------------------.GKTYQGRSILGVKITKGGE...................---
Q9VLZ1_DROME/129-409--------------------------------------.GQSYEGRTIRGIKISY......................---
CBPD_ANAPL/54-375--------------------------------------.GRSVEGRPLWVLRLTAGLPELPEARQDGEKKKKE.EEE---
CBPD_ANAPL/942-1212--------------------------------------.GQSVEFRQIWSLEISNKPN...................---
Q9VCM8_DROME/185-464--------------------------------------.GVSAQGRPILGVQIAFD.....................---
O17754_CAEEL/46-351--------------------------------------.GQSVEGRPLVVIQFSTTPG...................---
CBPD_RAT/70-372--------------------------------------.GNSVEGRPLWVLRLTAGLGPPPTPAA............---
CBPD_RAT/509-784--------------------------------------.GKSVESRELYVMEISDNPG...................---
YBJ7_SCHPO/189-484--------------------------------------.GITAEGRTILGLKLNGRHPSD.................---
CBPA1_BOVIN/128-406--------------------------------------.GRSYEGRPIYVLKFSTG.....................---
CBPN_HUMAN/31-330--------------------------------------.GRSVEGRHLYVLEFSDHPG...................---
CBPA2_RAT/127-404--------------------------------------.GSSFENRPMNVLKFST......................---
CBPB1_RAT/123-402--------------------------------------.GTTFEGRNMYVLKIGKT.....................---
ECM14_YEAST/127-417--------------------------------------.GRTFEGRELKALHISGNKP...................---
CBPD_DROME/46-327--------------------------------------.GRSLEGRNLLALQISRNTR...................---
CBPD_DROME/462-752--------------------------------------.GKSVQGRDLWVLEIFATPG...................---
P73902_SYNY3/17-361--------------------------------------.GQSYAGRDIWVAIATNQAT...................---
P91359_CAEEL/84-366--------------------------------------.GKSVEGRELWVLIISDKPK...................---
Q22825_CAEEL/64-346--------------------------------------.GQSVQGRELWVLVVSRYPI...................---
Q7NMK5_GLOVI/121-539--------------------------------------.GKTAEGRPQLMAILTSPENHKKLGRYQEIARK....LA---
A8BM27_GIAIC/624-987--------------------------------------.TKSIGGNDVDMLTITSSSTS..................---
Q7S312_NEUCR/128-414--------------------------------------.GTSVNGNAITGIRFWGSA....................---
CBPA1_MOUSE/128-406--------------------------------------.GSTFEGRPINVLKFSTG.....................---
Q829W4_STRAW/126-404--------------------------------------.GKTLNGQDILALKLTKGAK...................---
CBPA4_HUMAN/129-408--------------------------------------.GHSFENRPMYVLKFSTG.....................---
Q897X5_CLOTE/135-416--------------------------------------.GKSVLGRELYYLKLG.......................---
Q8ESH0_OCEIH/55-359--------------------------------------.GTSVEGRPIHLVRVGFPEPP..................---
Q8IMH9_DROME/186-465--------------------------------------..KSLQNRNVDLLTIDHVTAKQR................---
Q8PAS3_XANCP/44-407--------------------------------------.GTTPEGRPMKALVVSTSGALD.................---
CBPA5_MOUSE/145-423--------------------------------------.GKSFENRSILVLKFSTG.....................---
Q8TK20_METAC/106-433--------------------------------------PHQSWENRTSHAVRVRAG.....................---
Q961J8_DROME/129-406--------------------------------------.GKSYENRDIKTITITNGD....................---
Q9A9J5_CAUCR/82-489--------------------------------------.GKSEEGRSMWMAIVSSPANLAKLDQYKTIARK....LA---
Q9BL88_CAEEL/131-431--------------------------------------.GTTHEGRQIPLIKITNKR....................---
Q9TZC6_CAEEL/153-440--------------------------------------.ATSSEGRSIYGVKIHPPG....................---
Q9VRZ3_DROME/121-402--------------------------------------.GNSYEGRPIRGVKISY......................---
Q9VS63_DROME/44-354--------------------------------------.GHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI---
Q9VS67_DROME/133-412--------------------------------------.GRSYEGRWLKTITITNGD....................---
Q9VX86_DROME/1095-1422--------------------------------------.GRSFEGRPLIVVKIESKQTAAAANNDGL..........---
Q9W475_DROME/827-1104--------------------------------------.GYSVEKRPLKILKISNG.....................---
Q9W478_DROME/154-431--------------------------------------.GQTAEGRDLKVLRISEN.....................---
Q9XU75_CAEEL/167-465--------------------------------------.GATHEGKPIEGLKIGAR.....................---
B1W3W4_STRGG/138-427--------------------------------------.GKTYQGRDVIAVKVSDNV....................---
C4QKW6_SCHMA/144-418--------------------------------------.GYTAEGRPMKGVMISSD.....................---
E9EJD9_METAR/109-392--------------------------------------.GTTGDGNTITGLHIFGS.....................---
F5HE64_PORGI/124-385--------------------------------------.GKSVKDRKLMICKLTSS.....................---
G3QW16_GORGO/122-429--------------------------------------.GKSHQGLKLYAVEISDHPG...................---
H3C3M9_TETNG/129-405--------------------------------------.GQSYQGRALNVLKFSTG.....................---
I3JV32_ORENI/42-340--------------------------------------.GESFEGRELLVLEMSDNPG...................---
Q0E9F9_DROME/159-437--------------------------------------.GSSTQGNAIKGVKLTSN.....................---
Q16RZ2_AEDAE/130-406--------------------------------------.GHSFENRSIKGVKVSYK.....................---
Q1K5C5_NEUCR/204-501--------------------------------------.GDSYEGRPIHSFRIGDHSGD..................---
Q9VL87_DROME/126-405--------------------------------------.GQSYEGRELLGLRINHN.....................---
Q9VLZ2_DROME/128-406--------------------------------------.GKSYEGRTIRGIKISH......................---
Q9VS64_DROME/153-428--------------------------------------.GRSNEGRHIAALSISLN.....................---
Q9VS66_DROME/130-410--------------------------------------.GWSYEQRVLKTITITNG.....................---
Q9VS80_DROME/44-327--------------------------------------.ARTYENRALKMAIITNG.....................---

PF04952

ASTE_ECOLI/42-322--------------------------------------------------------------------------------
ASTE_PSESM/48-330--------------------------------------------------------------------------------
ACY3_HUMAN/10-301--------------------------------------------------------------------------------
Q88EN1_PSEPK/47-329--------------------------------------------------------------------------------
ACY2_BOVIN/10-301--------------------------------------------------------------------------------
A9CH33_AGRT5/52-333--------------------------------------------------------------------------------
ASTE_SALTY/42-322--------------------------------------------------------------------------------
ASPA_SYNY3/5-284--------------------------------------------------------------------------------
Q87RV7_VIBPA/50-319--------------------------------------------------------------------------------
ACY3_MOUSE/10-300--------------------------------------------------------------------------------
ASTE_SHEON/52-339--------------------------------------------------------------------------------
Q987A0_RHILO/66-347--------------------------------------------------------------------------------
Q92SQ8_RHIME/30-339--------------------------------------------------------------------------------
ASTE_VIBCH/52-331--------------------------------------------------------------------------------
ASPA_NOSS1/3-288--------------------------------------------------------------------------------
ASTE_PSEPK/48-330--------------------------------------------------------------------------------
Q87HF0_VIBPA/56-331--------------------------------------------------------------------------------
Q9HNH1_HALSA/42-314--------------------------------------------------------------------------------
ASPA_PROMA/2-289--------------------------------------------------------------------------------
ASTE_YERPE/42-323--------------------------------------------------------------------------------
ASTE_PSEAE/48-331--------------------------------------------------------------------------------
Q89N67_BRADU/46-333--------------------------------------------------------------------------------
Q98JD4_RHILO/49-329--------------------------------------------------------------------------------
Q8EGL7_SHEON/48-317--------------------------------------------------------------------------------
A9CLI1_AGRT5/46-332--------------------------------------------------------------------------------
Q8EAC2_SHEON/33-365--------------------------------------------------------------------------------
Q92WC2_RHIME/47-328--------------------------------------------------------------------------------
Q98AA0_RHILO/43-328--------------------------------------------------------------------------------
Q3INS5_NATPD/45-316--------------------------------------------------------------------------------
Q7MEW4_VIBVY/56-329--------------------------------------------------------------------------------
ASTE_VIBVY/53-329--------------------------------------------------------------------------------

PF10994

A0L457_MAGSM/24-365-----------------------.....RHMAYVHPL.RGSRGEELAMDVVRLGHA------------------------
A4XNS7_PSEMY/6-345-----------------------.....AVESHVHPL.PGRDGEQLAIDVARLGAA------------------------
Q4DHE8_TRYCC/47-382-----------------------.....EWKQHTVLQ...EEGFEYSIDTAFVRGK------------------------
Q0RN36_FRAAA/3-356-----------------------.....HLESFPLGELRGARGESLSTDVARIGAS------------------------
A4HIN1_LEIBR/48-391-----------------------.....ETEHHLITK...RGNVEYYMDTAFFPGK------------------------
Q213B6_RHOPB/13-353-----------------------.....ALSQYRHPTKTGPDGEALLIDVARLGDP------------------------
Q7VZV3_BORPE/14-354-----------------------.....SLTQYLHEGRTGPDGRPLHTDVARFGRA------------------------
A7HS30_PARL1/18-367-----------------------.....RLRHYENQHAKGPGETRLFTDTAWFGPA------------------------
A1VW91_POLNA/13-355-----------------------.....HVTSYPLAL.PGRDGEALAVDAAWQGPR------------------------
A1W380_ACISJ/8-351-----------------------.....ALQPQVHPL.CGPNGETLALDVVREGPL------------------------
Q12BQ5_POLSJ/8-351-----------------------.....KVDSHLHPE.PGRDGEVLAMDVVLDGSL------------------------
Q2KVE6_BORA1/8-348-----------------------.....DLSTHLLPGRLGAQGEALAMDLAYLGPP------------------------
A9BGZ8_PETMO/4-348-----------------------YYSTVSNDSYSI.......EEDSYIDSFLCQNE------------------------
Q0K9X8_CUPNH/4-344-----------------------.....ALAQFPHPTKRGSAGEDLAIDVALAGPA------------------------
Q586Z8_TRYB2/47-385-----------------------.....EVKRAVIAS...RDGVEYTLDTAFLRGK------------------------
Q118U2_TRIEI/12-348-----------------------.....KLETIELYS.QNCPNNSLYTDIAWLGNS------------------------
A1TK81_ACIAC/8-351-----------------------.....AVESHPHPL.PGREGEPLAMDVVRDGPA------------------------
A9KLP9_CLOPH/53-407-----------------------A..GYLSEAYNYPI...DEEDGLYIDTILCDSK------------------------
A5V6N1_SPHWW/7-348-----------------------.....DVATSVHPL.QGPAGQALATDTLRIGPA------------------------
A7HTE6_PARL1/10-349-----------------------.....RVNHHEHPM.AGPDGEKLATDVARLGPD------------------------
Q1LB58_RALME/20-354-----------------------.....DVESHELPL.DGAHGETLATDVVRDGPL------------------------
Q1LNH9_RALME/10-350-----------------------.....ALTEFPHPTETGNEGEALAMDVAWVGAA------------------------
B2UCT3_RALPJ/7-346-----------------------.....RIERHLHPDVVGPSGEQLSIDTALLAPA------------------------
Q7VV37_BORPE/7-348-----------------------.....DIHSYCHDTQRGPDGEALYLDVARLGGA------------------------
Q8XVM7_RALSO/9-348-----------------------.....AIERAVHPHALGPAGEPLSIDTACFLPD------------------------

PF17033

O25708_HELPY/1-227--------------------------------------------------------------------------------
D3UGK0_HELM1/1-188--------------------------------------------------------------------------------

PF02127

DNPEP_MOUSE/22-460-----VPGNG-------------------------F---SLIGAHTDSPCLRVK--RKSRRS.QVGYHQ----VGVE---
APEA_BORBU/28-456-----PIEDG-------------------------M---NFIVSHTDSPRLDAK--PSPISE.ENELTF----IKTN---
AMPL_YEAST/59-501-----RAEKG-------------------------V---GVIGSHVDALTVKLK--PVSFKDTAEGYGR----IAVA---
DNPEP_YEAST/25-478-----EPGNP-------------------------I---AITGAHTDSPALRIK--PISKRV.SEKYLQ----VGVE---
DNPEP_SCHPO/15-453-----KPGNG-------------------------F---SIIATHTDSPTLRLK--PKSQKS.AYGYLQ----VGVE---
APEB_MYCLE/11-421-----KAHAP-------------------------F---RIVGAHTDSPNLRVK--QHPDLL.VAGWRV----VALQ---
DNPEP_CAEEL/22-459-----KPGSG-------------------------F---SIVVGHTDSPCLRVK--PISHQK.SDKFLQ----VGVS---
APEB_BORBU/15-419-----KKYEP-------------------------F---LIAAAHTDSPGLKLK--IDATEK.VSGVFY----NHIE---

PF05343

Q8R656_FUSNN/53-342-----DSNY.-------------------------K---KMISAHVDTLGAVVK--KIKKSA------R----LEVT---
Q8U0N9_PYRFU/45-335-----.EGP.-------------------------K---VMIAAHMDQIGLMVT--HIEKNG------F----LRVA---
Q8XLP6_CLOPE/50-337-----SDEK.-------------------------V---IGLAAHVDTLGAMVR--SITPNG------T----LKFD---
Q9A1S8_STRP1/45-336-----EKAP.-------------------------R---ILVAAHMDEVGFMVS--DIKVDG------T----LRVV---
Q97MI2_CLOAB/40-324-----GK...-------------------------K---IMLDAHMDEVGFIIT--SINEDG------T----IKFA---
Q8RCI6_THETN/40-326-----KEKP.-------------------------K---VMLAAHMDEVALMVK--SVNEDG------T----LSFS---
SGCX_SALTY/46-346-----PDAL.-------------------------R---LMIFAHMDEVGFMVR--KIEPSG------F----LRFE---
YSDC_BACSU/48-342-----ENGP.-------------------------K---IMIAGHLDEVGFMVT--QITDKG------F----IRFQ---
Q9K874_BACHD/48-342-----EDGP.-------------------------K---IMVAGHLDEIGFMVT--SIDDKG------F----LRFQ---
Q9PQL1_UREPA/50-344-----NKGP.-------------------------K---ILIATHMDEVGFVVQ--QILDNG------Q----LLLS---
YHFE_BACSU/48-336-----DTSR.-------------------------H---RMLTAHVDTLGAMVK--EIKADG------R----LKID---
P70801_NOSS1/49-337-----NSDI.-------------------------A---VAITAHKDEIGAIVK--NIGDAG------K----VEVR---
Q92W97_RHIME/53-341-----AERP.-------------------------A---RGIVSHLDTLGAQVK--ALKENG------R----LELV---
Q9X0D8_THEMA/46-324-----.KGIG-------------------------K---LAFFAHVDEIGFVVS--KVEGQ.------F----ARLE---
YTOP_BACSU/46-337-----EDAP.-------------------------R---IMVAGHMDEVGFMVT--SITDNG------L----LRFQ---
Q9K7V2_BACHD/46-337-----EQGP.-------------------------K---VMVAGHMDEVGFMVT--SINEKG------L----IRFQ---
Q97L72_CLOAB/48-335-----NSSF.-------------------------E---RTISAHLDTLGAMVK--EIKSNG------T----LSLT---
AMPK_PYRFU/45-331-----.SAP.-------------------------K---VMVAAHMDKIGLMVN--HIDKDG------Y----LRVV---
Q9X0D9_THEMA/40-324-----DSSK.-------------------------K---LLVSAHMDEVGFVVS--KIEKDG------K----VSFL---
Q8ZX99_PYRAE/45-340-----ASNY.-------------------------R---AMVAAHIDEIGLIID--HIEKEG------F----LRFR---
Q97MI3_CLOAB/43-327-----.KGAG-------------------------K---IALMAHGDEIFLMIS--GFEKNG------F----LKFK---
Q8TYB9_METKA/48-341-----.SEY.-------------------------E---VMVAAHMDEVGFIVK--SIDKNG------F----IRFA---
O26537_METTH/45-335-----.SGP.-------------------------S---IMLAAHMDEIGLMVR--HIDKKG------F----IRFS---
Q9CIH3_LACLA/44-336-----ANAP.-------------------------R---IMIAAHMDEVGFMVS--SIKADG------T----FRVV---
Q8RCI5_THETN/45-320-----.KGK.-------------------------K---IMVAAHADEIGIMVT--HIEEEG------F----LRFT---
Q98PJ2_MYCPU/53-348-----N.SP.-------------------------R---IMVAAHMDEVGYTLR--EVETNG------Q----VRLS---
Q8RCI7_THETN/44-328-----LKGKY-------------------------K---VMLAAHLDEIGLMVK--DIDEKG------F----IKFT---
Q9YCC1_AERPE/44-332-----.GEP.-------------------------R---LLAAAHMDELGFVIT--GVGDDG------L----LAFR---
FRVX_ECOLI/43-333-----.KGP.-------------------------K---VAVVGHMDEVGFMVT--HIDESG------F----LRFT---
Q8TJD6_METAC/42-336-----.KGP.-------------------------S---VMLAAHMDEIGLMVR--YIDENG------F----LRFV---
Q8Y6S2_LISMO/46-337-----EEGP.-------------------------R---VLVAAHMDEVGFMVT--QITDNG------L----LRFQ---
Y555_METJA/44-338-----.KGK.-------------------------K---IMIAAHMDEIGLMVK--YIDDNG------F----LKFT---
Q9RXS7_DEIRA/71-359-----ENGP.-------------------------A---IALMGHLDEIGLIVS--HVDDKG------H----LSVL---
O28479_ARCFU/2-292-----.GEP.-------------------------E---IMVAAHMDEIGFAVK--YIDDKG------F----IRIA---
Q9X0E0_THEMA/42-324-----.GEK.-------------------------K---VILDAHIDEIGVVVT--NVDDKG------F----LTIE---
Q9HPS1_HALSA/46-335-----.GAP.-------------------------A---VAFTGHADEIGFAVA--EITEGG------F----VRIA---
Q8Y7Q5_LISMO/45-340-----EDGP.-------------------------K---IMIAGHLDEVGFMVT--QIDDKG------F----IKFQ---
Q8ZX44_PYRAE/36-306-----.....-------------------------K---VAFVAHMDEVGLLVT--NIEEDG------R----LKFR---
Q9HYE5_PSEAE/53-341-----LNTP.-------------------------D---RAVSAHLDTIGALVR--EIKPNG------R----LGLA---
Q8Y8C6_LISMO/51-339-----DETK.-------------------------H---RMLTAHVDTLGAMVK--EIKADG------R----LLLT---
Q8U3T6_PYRFU/43-324-----.GEV.-------------------------K---AVFMAHMDEIGLLIT--GITQDG------K----LRFR---
A3DD15_CLOTH/42-319-----.KGK.-------------------------K---IMVAAHMDEIGVMVT--YIDDKG------F----LRFS---
YPDE_ECOLI/43-325-----STGP.-------------------------K---VMICAHMDEVGFMVR--SISREG------A----IDVL---
Q2FVF9_STAA8/45-340-----NGQY.-------------------------S---IMISGHMDEVGFMVT--KIDKHG------F----ISFT---
Q2FXI5_STAA8/49-339-----PNAK.-------------------------R---VMIAAHMDEIGFMIT--NITKNG------M----IQFT---
Q2FYS0_STAA8/45-333-----NDEV.-------------------------Q---RCITAHVDTLGAMVK--EIKEDG------R----LAIE---
Q8DNJ7_STRR6/45-333-----VDAP.-------------------------R---VLVASHMDEVGFMVS--EIKPDG------T----FRVV---
Q8DQQ2_STRR6/45-334-----NDEQ.-------------------------H---RYVTAHVDTLGAIVR--AVKPDG------R----LKMD---

PF01546

Q7P4W2_FUSNV/78-489.....NFKTD................GLDLIIDGKY...LRANKTTLGADNGIA--VAMG--------L....AILE---
F6E743_SINMK/91-555CD...SLALKDALIESLSARTGRSEQEERALQDLASGDFLPGRGLLDMKSGLAV--AIAC--------L....EQFA---
B0R3D0_HALS3/106-420H....PAAAGFR.........SEHD.G........C...MHACGHDGHATIGVG--VLAA--------V....AD..---
C9MJX8_HAEIF/104-420I....PNKEGFA.........SIND.G........F...MHACGHDSHITIGLG--VALW--------I....AQNK---
Q8ENA4_OCEIH/109-426I....PASEAFN.........SINS.R........V...MHACGHDGHITIGLG--VAKY--------I....YEHQ---
Q8XLK9_CLOPE/110-427F....PFKNGFS.........SLNR.G........I...MHACGHDGHIAIGLG--VAEG--------I....IRFK---
Q891H7_CLOTE/124-441R....PVKEGFA.........SIND.G........A...MHSCGHDGHISIGLI--LAKT--------L....MNIK---
Q8ELE6_OCEIH/107-424I....PNKEGYR.........SKVP.N........T...MHACGHDSHTAMGLG--LATL--------I....AENK---
Q7N102_PHOLL/113-431R....PYAEGFS.........SCNT.H........M...MHACGHDGHTAIGLG--LACI--------L....KKYE---
IAAH_ENTAG/112-429R....PFREDFA.........SCNP.G........M...MHACGHDGHTAIGLG--LAHV--------L....KQYA---
A0A017IRJ7_ECOLX/112-429R....PYRDGFA.........SCNA.G........M...MHACGHDGHTAIGLG--LAHT--------L....KQFE---
Q98IQ8_RHILO/70-379.....PHASQ.............VP.G........K...SHMCGHDGHTAILAA--LGRQ--------L....GRER---
Q44415_RHIRD/55-364.....DYRSR.............TD.G........K...GHLCGHDGHSTILTA--LALG--------L....SRQR---
J7JID3_BACIU/68-369.....TFRAN..............................HSCGHDSHMTMALG--TLML--------L....KKQP---
B7H7C6_BACC4/66-365.....EFKAN..............................HSCGHDAHMTIVMG--LILQ--------L....KNMR---
A0A028XUT5_STAEP/63-379.....DFKSK.............ND.N........V...MHACGHDGHTTALML--FVKR--------C....KALY---
A0A008B390_STAAU/63-379.....PYRSQ.............SD.H........V...MHACGHDGHTTALML--FVQR--------C....KDMQ---
A9NBI9_COXBR/70-381.....HHKSK.............HK.N........V...MHACGYDGHTAILLT--IGAA--------L....AIHK---
Y4TI_RHISN/82-394.....PYQSH.............VE.G........V...MHACGHDLHASIAMG--VALA--------F....HRMR---
Q8FLW7_COREF/70-397.....EYASTATGFL....PDGQEV.P........V...MHGCGHDTHVATALA--AARR--------F....HEER---
Q8GGD4_CORST/76-395.....DYSAD.............PELG........M...MHACGHDLHTTALLG--AVRA--------L....VENK---
Q8FMB2_COREF/72-389.....DYASE..............AHG........V...MHACGHDFHITTLLS--AVDV--------F....ASNR---
Q8EMA9_OCEIH/73-390.....PYESQ.............NP.G........V...MHACGHDAHTAILLG--AAKV--------I....SVLA---
Q8TRI4_METAC/86-410E....GYISR.............ND.G........V...MHACGHDGHMAMLFG--AARL--------F....VE.N---
Q8PUV0_METMA/80-404R....EYISR.............TE.G........V...MHACGHDGHMAMLFG--AARM--------F....ME.N---
DAPEL_OCEIH/64-370.....PYASL.............HE.G........R...MHACGHDLHMTIALG--ALEK--------L....IQDP---
A0A024I2K8_LISMN/64-370.....PFASK.............HP.G........N...MHACGHDLHMSIALG--VLTH--------F....ASKP---
E8VJS1_BACST/65-371.....PFASE.............HH.G........N...MHACGHDLHMTIALG--IIDH--------F....VHHP---
C2T584_BACCE/65-371.....EFASI.............HE.G........M...MHACGHDVHTTIGLG--LLTK--------A....VSER---
A0A021WGD8_LACPN/70-372.....PFAST.............HP.G........V...MHACGHDIHMSVALG--ILSY--------F....AENR---
A0A038BMH8_ENTFL/79-386.....AFQSK.............RP.G........F...MHACGHDFHMTIGLG--VLKE--------L....SQQQ---
I6TNL4_STRMG/66-373.....AFASQ.............HE.G........R...MHACGHDMHMTIALG--LLDT--------M....VQVQ---
A0A034X6D7_STREE/65-372.....PFASQ.............HQ.G........R...MHACGHDFHMTIALG--CLER--------A....LEEQ---
Q7USI1_RHOBA/111-424.....EYASG.............TD.Q........V...MHACGHDAHAAMAYG--AAAI--------L....TELA---
A0A059MYA5_ENTFL/78-393.....AYASK.............NP.G........L...NHACGHDGHAAALLG--AAKV--------L....KKHQ---
Q8FRQ2_COREF/75-384.....DYSST..............VPG........V...AHSCGHDIHTVIALA--LACA--------L....NSID---
Q82HY6_STRAW/97-413.....AYRST.............VP.D........R...AHACGHDVHTTVVLG--AGLV--------L....AELH---
Q9AK43_STRCO/90-406.....AYRSQ.............VP.D........R...AHACGHDVHTTVVLG--TGLV--------L....AALH---
Q8ENA3_OCEIH/73-389.....SFKSK.............KA.D........I...MHACGHDAHTAMLLG--AGYI--------L....KQMQ---
Q7W8K8_BORPA/72-383R....PHASR.............ND.G........Y...MHACGHDGHTTMLLG--AAQL--------L....AQ.N---
Q984M2_RHILO/65-375.....PYRSG.............NP.G........V...MHACGHDGHTAMLLG--AAKL--------L....AS.E---
Q89RR4_BRADU/35-345.....PYAST.............TS.G........V...MHACGHDGHTASLLG--AAAL--------L....AA.D---
A3YNK2_CAMJU/72-380.....PYKSK.............KE.N........V...MHACGHDGHTTSLLL--AAKY--------L....A..S---
F3K8R3_PSESZ/71-384.....AHRSR.............HD.G........W...MHACGHDGHITMLLG--AASS--------L....AA.D---
A0A038FT89_9BRAD/73-382.....SSKIP................G........R...FHGCGHDGHTTMLLG--TARY--------L....AETR---
A9CF81_AGRT5/85-394.....PYTSV.............YP.G........K...FHGCGHDVHTTILLG--TARY--------L....AE.T---
A0A038HDZ5_BORBO/77-391.....GHKST.............KP.G........L...MHGCGHDGHTAVLIG--AAKY--------L....AQ.T---
Q88JE5_PSEPK/77-391.....AHASK.............IP.G........R...MHACGHDGHTAILLA--AAAQ--------L....AA.T---
Q7NW88_CHRVO/76-389.....PYASK.............LP.G........K...MHACGHDGHTAILLA--AARH--------L....AE.T---
A0A009DL60_ECOLX/71-385.....PWASK.............HP.G........L...MHACGHDGHTTILLG--AARY--------F....AETR---
M4MSU5_SINM2/76-388.....AYAST.............KP.G........L...MHACGHDGHTAMLLG--AARA--------L....AERR---
Q7CSF2_AGRT5/83-392.....AYASE.............TS.G........I...MHACGHDGHTTVLLA--AARY--------L....AETS---
A0A022P5B7_PSEAI/74-386.....PYASQ.............VD.G........V...MHACGHDGHTAMLLA--AARH--------L....VESP---
A0A030R337_PSEAI/76-386.....GYSSC.............HG.G........R...MHACGHDGHTAMLLG--AARY--------L....AATR---
F6C4J2_SINMB/72-385.....PYKST.............VA.G........K...MHACGHDGHTTMLLG--AARH--------L....AA.T---
F3IK87_PSESL/68-380.....LHKSA.............HK.G........C...MHACGHDGHTAILLA--TARH--------L....SE.T---
Q7NWU5_CHRVO/81-393.....PYRSQ.............HA.G........R...MHACGHDGHCAMLLG--AARH--------L....AE.S---
Q7W1K2_BORPA/73-390.....GHASR.............HA.G........R...MHACGHDGHTAMLLG--AARY--------L....QR.H---
A0A038IB11_BORBO/72-394.....AHRST.............IE.G........R...MHGCGHDGHTAMLLG--AAQY--------L....AA.H---
Q8XVG0_RALSO/71-391.....THRSR.............HE.G........K...MHACGHDGHTAMLLG--AAHY--------L....AR.H---
A0A058UXQ3_BORPT/73-393.....EHASR.............NP.G........K...MHACGHDGHTAMLLA--AARF--------L....SQ.Q---
Q981W6_RHILO/74-384.....DWASK.............TP.G........K...MHACGHDGHTSMLLG--AAKY--------L....AG.K---
Q89IE8_BRADU/75-385.....PYASK.............VP.G........K...MHACGHDGHTAMLLG--AAKY--------L....AE.T---
A0A038FZH1_9BRAD/77-385.....PYASK.............NP.G........K...MHACGHDGHTAMLLG--AARY--------L....AE.T---
A9CGN8_AGRT5/61-370.....PWASK.............VP.G........K...AHSCGHDGHTAMLLG--AAQY--------L....AE.T---
A0A024EVG4_BRUCA/74-383.....EWASQ.............NP.G........K...AHSCGHDGHTAMLLG--AAQY--------L....AE.T---
F5J5Y5_9RHIZ/74-383.....PWASK.............TA.G........A...MHACGHDGHTAMLLG--AAKY--------L....TE.T---
Q98FX1_RHILO/74-383.....PYAST.............VP.G........K...MHACGHDGHTAMLLG--AAKY--------L....AE.T---
F6BSJ5_SINMB/74-383.....SSTAP................G........K...MHACGHDGHTAMLLG--AAKY--------L....SETR---
Q8KDJ8_CHLTE/87-402.....DFCST.............VE.R........C...MHACGHDMHTAMLLG--AATV--------L....SGMK---
C5EAE5_BIFLI/70-377.....EFSSV..............NEG........V...MHGCGHDLHMTGLLG--AAFW--------L....AEHR---
B0RWU7_XANCB/97-429.....PFASK.............AT.SQYRGETVGV...MHACGHDAHTAILLG--VAEA--------L....VGMR---
Q7NHJ5_GLOVI/90-402.....PYRSQ.............VR.G........V...MHACGHDLHTAIGLG--TAMV--------L....ASLR---
F7UTZ1_SYNYG/73-386.....PFASR.............HP.G........V...MHACGHDIHTTLGLG--TAMV--------L....SQMG---
Q8DMU8_THEEB/75-387.....EFSSK.............HA.G........V...MHACGHDVHTTVGLG--TAMV--------L....AALK---
Q8YV79_NOSS1/124-437.....EYASR.............TD.G........I...MHACGHDIHTTVGLG--AAMV--------L....SQMT---
Q7UZP5_PROMP/74-383.....SFSSK.............ID.G........I...MHACGHDLHTCIGLG--VAKI--------I.....K.D---
Q7V9Q6_PROMA/75-386.....SFASL.............RQ.G........V...MHACGHDIHICIGIG--LARL--------L....AE.H---
Q7V908_PROMM/75-385.....VYASR.............RD.G........V...MHACGHDLHTCIGLG--VARV--------L....AK.E---
Q7U9W5_SYNPX/74-384.....SFAST.............RQ.G........V...MHACGHDLHTCIGLG--VARL--------L....GA.R---
J0DWY9_STAEP/74-385.....PYRSK.............NK.G........C...MHACGHDGHTAILLG--VAEI--------V....HEHR---
A0A028YKF6_STAAU/73-384.....PYKSK.............NP.G........C...MHACGHDGHTAILLT--VAEI--------L....DEHK---
Q891H8_CLOTE/88-404.....PFKSK.............NK.G........V...MHACGHDVHTSILLG--AAKV--------L....VQLK---
D5RAJ9_FUSNC/74-389.....TFKST.............HD.G........K...MHACGHDGHTAGLLG--AGMI--------L....NELK---
Q7P6B6_FUSNV/81-400.....EFSST.............HK.G........C...MHACGHDGHTAMLLG--AAKI--------L....NENR---
Q8RC51_THETN/70-383.....EYASK.............IP.G........K...MHACGHDVHTAILLG--TAKV--------L....SRIK---
Q8XL37_CLOPE/78-393.....SYSSK.............VK.G........R...MHACGHDAHTTILLG--AAKL--------L....SRHR---
F0KAF7_CLOAE/71-388.....SYCSK.............VN.G........R...MHACGHDAHTTILMG--AAKL--------L....NKMK---
A0A028XGX8_STAEP/63-369.....EFTSK.............YQ.G........A...MHACGHDIHMASILA--TGIQ--------L....KEIE---
A0A028WP48_STAAU/63-369.....DFKSE.............NE.G........V...MHACGHDIHMASILA--TAVK--------L....KEIE---
Q9A5J1_CAUCR/78-407.....PFASK.............VK.ATWEGRTVPV...MHACGHDTHVAMLLG--AATV--------L....AGMK---
D2NV40_LISM1/75-390.....PFKSK.............NP.G........V...MHACGHDGHTAYLLV--LADC--------L....IQLK---
I5BN32_STRAG/84-398.....SFASK.............TA.G........V...MHACGHDAHTAYLLI--LAES--------L....IELK---
C8JSG0_LISMN/79-393.....AFASK.............NP.G........V...MHACGHDGHTAYMLI--LGET--------L....IEMK---
Q8NYT5_STAAW/74-386.....SFASQ.............NK.G........V...MHACGHDAHTAYMLV--LAET--------L....AEMK---
A0A028XR85_STAEP/74-388.....PYASK.............NE.G........V...MHACGHDAHTAYMLI--LGET--------L....IEMK---
M2D0S1_STRMG/65-371.....AYASK..............N.G........A...MHACGHDFHQTSLLG--AAQI--------L....KERK---
G4ESH8_BACIU/99-404.....PYASK..............HKG........I...MHACGHDFHTAALLG--AAFL--------L....KENQ---
L8ATH6_BACIU/69-374.....PFASK.............VD.G........T...MHACGHDFHTASIIG--TAML--------L....NQRR---
C2T4B5_BACCE/70-375.....SYASK.............VR.G........K...MHACGHDFHTAAILG--TAFL--------L....KERE---
J7JLF4_BACIU/79-392.....PYASK.............VP.G........V...MHACGHDGHTAALLA--VAKV--------L....HQNR---
Q8ERY9_OCEIH/74-385.....PYKSK.............VP.G........V...MHACGHDGHTATLLV--LAKV--------M....QQHQ---
G2K553_LISMN/73-386.....PYKST.............ED.G........K...MHACGHDAHTAMLIT--AAKA--------L....VEIK---
Q839D6_ENTFA/58-371.....AYKSL.............EA.G........K...MHACGHDSHTAMLVT--VAKV--------L....KEIQ---
D0KPT8_SULS9/77-389.....EFKSK.............VK.G........V...MHACGHDTHVAMLLG--GAYL--------L....VKNK---
Q97AQ8_THEVO/83-399.....PFASK.............NS.G........V...MHACGHDSHVAMLIG--AAYV--------L....SKHG---
G7QPA7_LEPII/71-388.....EYKSV.............HE.G........V...MHACGHDAHTSILMG--LATE--------I....KENI---
C2SYA4_BACCE/72-385.....SYTSV.............NK.G........M...MHACGHDAHAAILLS--TAEV--------L....SNIK---
B7HDC6_BACC4/72-385.....DFIST.............YK.G........V...MHACGHDGHIAILLG--VVHK--------L....VEER---
Q7NNN7_GLOVI/86-399.....EYASE.............NT.G........I...MHACGHDGHVAIALG--TARW--------L....AEHR---
L8AMZ5_BACIU/97-412.....DYRSL.............HP.G........K...MHACGHDGHTAIALG--TAQY--------L....AAHR---
Q8DG76_THEEB/92-406.....PYRSL.............HE.G........K...MHACGHDGHTAIALG--TAKY--------L....ATHR---
O58754_PYRHO/73-383.....PYKSR..............VPG........K...MHACGHDAHTAMLLG--AAKI--------L....AEMK---
O58453_PYRHO/75-385.....PYKSR..............VPG........K...MHACGHDAHTAMLLG--AAKI--------I....AEHS---
Q8U375_PYRFU/127-437.....PYKSR..............VPG........K...MHACGHDAHTAMLLG--AAKI--------I....AEHE---
A2XVL9_ORYSI/93-409.....EHKSK.............VD.G........V...MHACGHDVHTAMLLG--AAKL--------L....SERK---
ILR1_ARATH/109-425.....ESKSK.............VD.G........K...MHACGHDTHVAMLLG--AAKL--------L....QTTK---
A2XNS9_ORYSI/85-406.....EFKSL.............ED.G........K...MHACGHDVHVAMLLG--AAKL--------L....QSRR---
ILL8_ORYSJ/116-436.....EFKSQ.............EK.G........K...MHACGHDAHVTMLLG--AAKL--------L....QSRK---
ILL9_ORYSJ/112-431.....EHKSQ.............EN.G........K...MHACGHDAHTAMLLG--AAKL--------L....QKRK---
ILL7_ORYSJ/127-444.....EHKSE.............ES.G........K...MHACGHDAHTTMLLG--AAKL--------L....QSQK---
Q0WNN8_ARATH/146-457.....EHISK.............VA.G........K...MHACGHDAHVTMLLG--AAHI--------L....KARE---
ILL1_ARATH/107-420.....EHKSK.............NP.G........K...MHACGHDGHVAMLLG--AAKI--------L....QQHR---
ILL4_ARATH/105-421.....EHKSK.............VP.G........K...MHACGHDAHTTMLLG--AAKL--------L....KEHE---
B7EYM8_ORYSJ/106-423.....EHKSK.............VP.G........K...MHGCGHDAHVAMLLG--SARI--------L....QEHR---
LYSK_PYRAE/58-333.....PLPVK.............REGG........V...VWGRGAVDDKGPLVA--YLKA--------F......LD---
B8GVH2_CAUCN/98-396.....PFQAVS...........TRSDG........A...LHGPGIADMKGGISV--MLAA--------L....AAFE---
Q89D44_BRADU/88-452DGR.DPWRTT..............VAG.......TR...LYGRGTADNKGQHSI--NMAA--------L....RAVR---
F3IC80_PSESL/90-456AGL.SPWKVV.............ERGD........R...WYGRGTADNKGQHLI--NLTA--------L....EQTL---
A0A038G1I8_9BRAD/85-459RP...PFEPAVT..........DHADG........RK.IIVARGAEDDKGQVMT--FVEA--------C....RAWK---
Q98GJ6_RHILO/84-458ND...PFAPAV............KEVGPD....HKV...ITGRGSADDKGQLMT--FVEA--------C....RAWK---
Q7D266_AGRT5/85-459ND...PFEPAIK..........DIGAG........RK.VITGRGTADDKGQLMT--FVEA--------C....RAYK---
A5VN62_BRUO2/87-465ND...PFDPAI............KDVGDASNGGRKI...LTGRGTSDDKGQLMT--FVEA--------C....RAYK---
Q83F46_COXBU/98-471ADL.GPWKPV.............IKED........K...LYGRGGADDGYAAFA--SLTA--------I....AMLQ---
A0A058WBJ1_BORBO/107-486ADL.GPWTPK.............YENG........K...LYGRGGADDGYAIYA--SLTA--------I....MALD---
M1YBI8_STRAG/86-456ED...PFTLS.............LRYG........K...MYGRGVDDDKGHITA--RLSA--------V....KKYL---
I6L916_STRMU/86-455DN...PFKLT.............LRKG........Y...MYGRGVDDDKGHITA--RLTA--------V....RKYI---
J1RS12_STREE/86-455ED...PFTLS.............VRNG........F...MYGRGVDDDKGHITA--RLSA--------L....RKYM---
Q9Z6S9_CHLPN/119-487GD...PFILR.............EENG........N...LYARGASDNKGQCFY--TLKA--------L....QHYY---
Q822A3_CHLCV/82-450AD...PFTMR..............REG.......ER...LIARGASDNKGQCFY--TWKA--------L....EHYY---
Q8FME3_COREF/102-468TD...PFTLTER..........ETENG.......VR...WFGRGAADCKGNLVM--HLAA--------L....RAVD---
D6ETY2_STRLI/86-447TP...PFELT.............ERDG........R...WYGRGAADCKGGVLM--HLLA--------L....RALK---
Q83GM1_TROWT/81-442TP...AFSPD.............ERDG........R...LYGRGAADDKVAIAM--HLAS--------V....RILK---
Q8G5E2_BIFLO/92-452TD...PFVAT.............EIDG........R...LYGRGSADDGGGIAI--HSGA--------L....KALG---
A0A038FC93_MYCTX/102-459SP...PFEPT.............ERGG........R...LYGRGTADDKAGIAT--HVAA--------F....WAHG---
Q974N2_SULTO/65-421TD...PFTPT.............IKEG........K...IFARGVGDDKGTLMA--RLQA--------I....IELM---
D0KPI1_SULS9/67-433RA...PFSAT.............IEND........R...IYARGASDNKGTLMA--RLFA--------I....KHLL---
Q972L9_SULTO/72-422YP...PFSAI.............IENG........H...IYGRGASDNKGVLIA--RLIA--------F....SKYK---
Q9RSV5_DEIRA/73-444TP...PFELT.............ERGG........R...LYGRGASDDKGELAS--RLAA--------V....RAVR---
Q8AWF8_XENLA/112-483TE...PYTVVE............KDDN............LYGRGTSDDKGQVLA--LLHA--------L....ESVN---
CNDP1_MOUSE/103-477TD...PYTLT.............EVDG........K...LYGRGATDNKGPVLA--WINA--------V....STFR---
DUG1_SCHPO/95-470TD...PFTLTV............DNKG........R...MFGRGATDDKGPLIG--WISA--------I....EAHK---
Q870Z2_NEUCS/93-468TE...PFDLTV............KEDG........R...MCGRGATDDKGPVLG--WLNA--------I....EAHK---
Q7QJQ9_ANOGA/101-476TE...PFVLT.............EKDG........K...LFGRGSSDDKGPVLG--WLHA--------I....EGFQ---
O18000_CAEEL/95-469TE...PFELV.............EKDG........K...LFGRGSSDDKGPVLC--WFHA--------I....RAAQ---
Q98AF9_RHILO/84-453TP...PFEPT.............IRDG........R...LYARGASDDKGSTAI--ALET--------I....AAFL---
Q82IQ8_STRAW/88-458TE...PFEPV.............IRDN........R...LYARGAADDKGQVFF--HTLG--------V....RAHL---
Q9K657_BACHD/82-451TP...PFEPS.............IREG........K...IFARGATDDKGQTFM--HIKA--------L....EALL---
Q8CUJ6_OCEIH/84-452SD...PFKPE.............LRDG........R...IFARGSSDDKGQVFM--HLAV--------F....EAYL---
Q7UJ49_RHOBA/95-464SP...PFEPV.............VRDG........K...VFARGATDDKGQVLT--HIHS--------V....CDWL---
Q9RSU7_DEIRA/81-449TP...PFEPT.............VRDG........R...IYARGSTDDKGQAFA--HLKG--------V....ELLL---
Q8A601_BACTN/82-450SQ...PFEPE.............VRDG........Y...IWARGADDDKGQSFI--QVKA--------F....EYLV---
I9PEM2_PORGN/81-449SE...PFEPV.............IRDG........H...IWARGADDDKGQGMI--QVKG--------F....ETAL---
Q82IK8_STRAW/68-359.....PSRLD..............ENG........V...LWGCGTCDMKSGVAV--QLRI--------A....ATVP---
Q9FBL9_STRCO/68-359.....PSRLD..............EDG........V...LWGCGTCDMKAGVAV--QLRI--------A....ATVP---
I0LIF7_CORGK/73-369.....PSRVE...............DG........I...MYGCGTVDMKSGLAV--YLHT--------F....ATLA---
Q8FQF3_COREF/51-354.....PGHRAP............NADGV......DT...LYGCGTVDMKSGLAV--YLHT--------F....ASLA---
Q8ESD5_OCEIH/87-390.....PEGTDTT.........VSEKEG........K...YFAPGIGDDTRGLAE--VLSL--------V....RALT---
Q9A411_CAUCR/97-405.....DVKVR..............REG.......TK...LMAPGIGDDTRALST--LLAY--------V....RAMD---
Q831D3_ENTFA/57-417FD...PYDGYE............TETE............IGGRGTSDQEGGIVS--AIYG--------A....KIMK---
A0A009ETB1_ECOLX/77-398FD...PYEGM.............ETDE........L...IGGRGTSDQEGGMAS--MVYA--------G....KIIK---
Q9CI04_LACLA/65-368FS...PTDAR.............VEEG........K...LFGLGASDMKGGDVG--NLLA--------A....ASFI---
ARGE_DICDI/99-443RN...PFQLI..............IEG.......DK...LYGRGTTDCLGHVAL--LTDL--------F....IQLA---
ARGE_ARATH/97-436FD...PFSLS..............IDG.......DK...LRGRGTTDCLGHVAL--VTEL--------M....KKLG---
Q9FVL5_CUCPE/95-434FD...PFSLS..............ISG.......DQ...LRGRGTTDCLGHVAL--LTEL--------L....KKLA---
Q9MB49_CITLA/95-434.F..DPFSLS.............IDGD........K...LRGRGTTDCLGHVAL--LTEL--------L....KKIA---
YE48_SCHPO/193-589FP...PFSAT.............YHNG........H...VYSRGAADDKNSVVA--ILEA--------L....EILA---
CBPS_YEAST/164-571FP...PFSGHY...........DPETD........F...VWGRGSNDCKNLLIA--EFEA--------I....EQLL---
Q8RTT1_9PROT/116-483HP...PFAGV.............IENN........N...LYGRGTLDDKQGVLS--LLEA--------T....ETLL---
A6AYV0_VIBPH/125-505ED...PFSGA.............IKDG........Y...IWGRGVLDDKNQIHA--ILEA--------A....EMKI---
P20D1_MOUSE/121-489VP...PFSGL.............ERNG........F...IYGRGALDNKNSVMA--ILHA--------L....ELLL---
Q9AA70_CAUCR/101-467HP...PFAGV.............VADG........K...VWGRGAIDDKGSLVT--IFEA--------L....ESVA---
Q8XSI7_RALSO/130-504EP...PFAGV.............VKDG........M...VWGRGAWDDKGNLIA--QMEA--------A....ELLA---
B8H457_CAUCN/106-469RD...PFKLV.............EENG........Y...FYGRGTSDDKAQAAI--WVDS--------L....IRLK---
M4SXM5_LEGPN/102-463MD...PFQLT.............EKEG........Y...FYGRGTLDDKAQAAI--WIAN--------L....IQYK---
Q8TV20_METKA/71-376VT..DPFDPT.............IRNG........K...LYGRGAADCKGGLAA--ATAA--------V....VQGY---
Q7X340_9BACT/107-429.....PFQKYE...........RINAD........T...ARGPGVIDMKGGNVV--IVHA--------L....KALA---
Q88A71_PSESM/106-428.....RFQTFA...........YLDGG.......KK...AKGPGVIDDKGGVVT--MLYA--------L....QALK---
Q9WXY3_THEMA/60-350.....PFTIE................G.......NI...AKGPGVCDMKGGVVI--LLES--------L....KRFL---
Q9CMA2_PASMU/70-369.....PFRIE...............QD........K...AFGPGIADMKAGLLA--GFYA--------C....KQLT---
Q8XT42_RALSO/90-389.....PFYIK...............DK........R...AYGPGVMDDKGGIVA--GLYA--------M....KILQ---
Q880D7_PSESM/109-408.....PFHIK...............DG........R...AYGPGVMDDKGGIVA--AIYA--------L....KVLH---
A0A030QZM1_PSEAI/107-408.....PFRED..............A.E........R...AYGPGVADAKGGVAM--VLHA--------L....ALLR---
Q884H3_PSESM/106-407.....PFRLD...............SE........R...AYGPGVADAKGGVAM--ILHS--------L....KLLQ---
CBPG_PSES6/108-410.....PFRVE................G.......DK...AYGPGIADDKGGNAV--ILHT--------L....KLLK---
Q89NT5_BRADU/145-448.....PFRVD................G.......DK...AYGLGIADDKQGVAL--ILHT--------V....AMLQ---
Q8XUU2_RALSO/122-426.....PFRID................G.......DR...AYGLGIADDKNGVAV--ILHT--------V....SILQ---
Q89IN7_BRADU/140-435.....KWRRE................G.......SK...CYGPGICDMKGGNYL--SLEA--------I....RQLA---
Q89WA3_BRADU/87-383.....PFKVE................G.......DS...AFGPGIYDMKGGAYI--AHHA--------F....RALC---
Q9RRJ7_DEIRA/74-369.....PWRED................G.......ER...LYGPGTYDMKGGVVG--LFHA--------L....RSLG---
A0A058VEZ8_BORPT/77-375.....PCRID................G.......DR...LYGPGSYDMKAGIYL--ALSA--------L....RGLP---
Q8D5L5_VIBVU/73-371.....PMSLD..............AEK............AYGPGVSDMKSGLLN--IVYA--------M....RNLD---
Q9KFW8_BACHD/72-371.....PFQLI................G.......TR...AYGPGVIDMKGSLVA--CLYA--------I....KALV---
Q882Q5_PSESM/82-379.....GYTND...............SE........L...AYGPGVADMKGGLVL--NCFA--------L....KALK---
Q89ER6_BRADU/82-381.....PFTIR...............DN........R...AYGPGVADMKSGVVM--NIFV--------A....TAFH---
Q9LPE9_ARATH/93-426YP...PFSAHK...........TID.G........H...IYARGAQDDKCIGVQ--YLES--------I....RNLK---
Q9VCR0_DROME/75-396HD...PFAADI............DEEG........R...IFARGTQDMKSVGTG--YLGA--------I....RLLK---
Q9VCQ9_DROME/76-397HE...PFSADI............DEEG........R...IFARGTQDMKSVGTQ--YLGA--------I....RLLK---
Q9VCQ8_DROME/76-397HE...PFSADI............DEEG........R...IFARGAQDMKSVGTQ--YLGA--------I....RLLR---
Q9VCR2_DROME/76-397HG...PFSADL............DAEG........R...IFARGSQDMKCVGTQ--YLGA--------V....RALK---
Q8T490_DROME/78-398HE...PFGAHI............DAQG........R...IYARGAQDMKSVGCQ--YMAA--------V....RALK---
Q7QEF5_ANOGA/84-405HA...PFGAEM............DHEG........R...IYARGAQDMKCVGMQ--FLAA--------I....RAMR---
Q9I7K3_DROME/76-397HP...PFGADI............DEEG........R...IFARGTQDMKSVGMQ--HLAA--------V....RALK---
Q17686_CAEEL/70-392HD...PYSAFK............DEDG........N...IFARGAQDMKCVGVQ--YMEA--------L....RNWF---
Q17899_CAEEL/71-393HD...PYSAFK............DEDG........N...IFARGAQDTKCLGVQ--HVEA--------F....RNLF---
Q17898_CAEEL/71-393HD...PYSAFK............DEDG........N...IFARGAQDMKCVGVQ--QMEA--------L....RNLF---
ACY1_PIG/76-396HD...PFEGFK............DADG........Y...IYGRGAQDMKCVSIQ--YLEA--------V....RRLK---
Q7ZVV2_DANRE/88-409HH...PFAAVK............DADG........N...IYARGAQDMKSVTIQ--YIEA--------I....RRLK---
Q8XUB8_RALSO/98-420HD...PYGGEI............VETE........HGPTMFGRGVAVSKSDFAT--YTWA--------L....LALI---
O58880_PYRHO/64-349.....PFVRG................N........I...VYGTGASDIKGGIAS--ILLM--------L....EQLR---
O29728_ARCFU/50-314.....PFSTD................G.......VY...AYGTGVCDAKASVAA--ILEA--------A........---
Q8R5U3_THETN/61-363.....GYQTKE...........GEENG........R...IYGRGTSDVLGGVAI--LLEV--------L....KRLG---
Q979Q6_THEVO/81-397KP...PFELT..............VEG.......DK...MYGRGTEDDGQAVFT--ALLI--------L....RDLK---
O58003_PYRHO/93-411VT..EPFKPI.............VKDG........K...VYGRGSEDNGQAIVS--SLYA--------V....KALM---
O29358_ARCFU/84-400TP...PFKGI.............VKNG........R...IYGRGSEDNGQSLVS--SLYA--------A....KAIV---
Q8NLV7_CORGL/76-438KD...PFGAE.............ISDG........Q...IWGRGSVDMLFITAT--QAAV--------T....RQVA---
Q9PEM8_XYLFA/67-363AD...PHVMR.............RAVD........R...VIGLGVCDIKGAAAA--LLAA--------V.......Q---
Q4UVI8_XANC8/68-364AD...PHVMR.............RTED........R...VIGLGVCDIKGAAAA--LVAA--------A.......N---
C6IP45_9BACE/69-352KD...PFTPR.............EENG........K...LYGLGSNDAGASVVS--LLQV--------F....LQLC---
Y1497_METJA/61-343.....NFKKD..............DNN............FYGTGVIDAKGNVVL--MIHA--------F......LN---
LYSK_SULTO/63-340.....GFIQPK............IEGE........V...IYGRGAVDAKGPLIA--MLLA--------.....TYIL---
D0KRK8_SULS9/64-341.....GYIEPK............IENE........L...IYGRGAVDAKGPLIS--MIIA--------.....TWLL---
LYSK_AERPE/68-345.....RLEAR..............LEG........Y..TLWGRGAVDAKGPLAA--MILG--------L....HLAS---
LYSK_PYRAB/63-322.....PVRIE................G.......DI...LWGRGSVDAKGPLSA--LLFA--------M.......V---
LYSK_PYRHO/62-321.....PVRIE................G.......EV...LWGRGSVDAKGPLAT--LFFS--------T.......I---
LYSK_THET2/63-350..........................G........R...LFGRGAVDAKGPFVA--MIFA--------A....AGLS---
LYSK_DEIRA/65-358.....PVRVD..............EAG........V...LHGRGSVDAKGSLCT--FIAA--------V....SALP---
Q9ZBI7_STRCO/86-442VH...PFSGE.............IRDG........V...VWGRGAVDMKNMDAM--ILAV--------V....RDWA---
Q93RZ9_STRCO/83-441VP...PFSGE.............IQDG........Y...LWGRGAIDMKDTVAV--MLAT--------A....RHFA---
Q79Z32_STRAW/84-440HH...PFSGE.............IADG........C...VWGRGAVDMKDMDAM--TLAV--------V....RDRL---
D6EMR6_STRLI/88-444HH...PFSGE.............VADG........C...VWGRGAVDMKDMDAM--TLAV--------V....RDRL---
O30185_ARCFU/62-368.....PVIVD................G........K...LYGRGSCDAKGCVAA--ICSA--------S....QIEP---
Q98L43_RHILO/88-418VD...PFAGI.............VRDG........R...VYGRGACDMKGGLAA--SIIA--------A....EAFM---
Q970S3_SULTO/66-380YN...PFSGK.............IIDD........K...VYGRGSTDMKGGLAV--FMKV--------F....TEIA---
D0KTX4_SULS9/81-369TN...PFELK.............VVDN........K...AYGRGTSDMKGSIVS--LYLA--------L....SRFN---
Q96XG6_SULTO/80-366TE...PFKLK.............IIDN........K...AFGRGTSDMKGAIVS--LYLA--------L....LRFN---
D0KVC4_SULS9/89-404VD...PYKGI.............EKDG........K...IYGRGASDMKSGIVA--QIYA--------I....EMLR---
Q9YEE4_AERPE/91-410VT..EPFKPV.............VKDG........K...LYGRGAIDMKGGIAA--ALGA--------F....KALH---
Q8ZVD7_PYRAE/78-394VT..MPFEPV.............YREG........R...VYGRGAVDMKGGLTS--IILA--------V....EKAA---
Q18621_CAEEL/72-345.....PYFPPT...........QDEQN............IYGNGSNDAKGQLAA--MVTA--------A....TIIS---
YJ75_SCHPO/124-397.....PFLPYY............IEGD........K...IHGRGSCDAKSSVAA--QIFA--------M....LELM---
Q7S4G6_NEUCR/139-448.....PFIPYHI..........NTPGGSDQVTSDTF...ISGRGSVDAKASVAA--QIVA--------V....EELI---
J7JWC8_BACIU/99-418YE...PYQAV.............EENG........K...IYGRGSTDMKGGNTA--LLFA--------L....EALH---
C2R7T3_BACCE/97-416HH...PYSGE..............KIG.......NR...IYGRGTTDMKGGNVA--LMLA--------M....EAII---
Q9KE02_BACHD/99-417YD...PWGAT.............IVEN........R...MYGRGIQDMKSGLAA--MIFA--------Y....RALQ---
Q89MN6_BRADU/99-418TP...PFSPV.............IKDG........K...MFGRGACDMKSGTIG--ALYA--------L....DAIK---
Q986X8_RHILO/100-420RD...PYDPA.............IEDG........W...MHGRGAGDMKAGLSA--CLYA--------L....AALR---
DAPE_HELHP/72-381FE...PFCGT.............QDEK........Y...IYGRGTQDMKGGISA--FICA--------V....CNIL---
I0ZH66_HELPX/75-379SD...PFKPV.............IKEG........F...LYGRGAQDMKGGVGA--FLSA--------S....LNFN---
DAPE_WOLSU/62-362VD...PFGAE.............LKEG........Y...LYGRGAQDMKSGVAA--MISA--------L....AKID---
D5AYG5_RICPP/65-381NS..NPFKFH.............EQDG........K...IYGRGTVDMKGAIAC--FLAA--------S....LNFI---
DAPE_BRADU/67-385VG...AFSGE.............VKDG........F...LHGRGAVDMKGGIAC--SVAA--------V...LEHLA---
A0A024EXP0_BRUCA/70-392HP...PFAAA.............IEDG........V...MYGRGAVDMKGGIAC--FVAA--------V...ARHIE---
DAPE_AGRT5/69-390HP...PFSAD.............IAGG........E...MYGRGAVDMKGGIAC--FVAA--------I...ARHIG---
DAPE_RHILO/70-392HP...PFAAE.............IANG........E...MYGRGAVDMKGGIAC--FVAA--------I....ARHV---
DAPE_CAUCN/71-380AG...PFEAE.............IKEG........V...LYGRGAVDMKSAIAA--FVAA--------V....ANVP---
DAPE_ZYMMO/70-373SD...PFTPT.............IKDG........Y...LVGRGAVDMKSSVAA--FIAA--------A....SRYT---
DAPE_WIGBR/60-371YP...PFSSK.............LKDG........I...LYGRGSADMKGALAA--MLIA--------A....KKFF---
DAPE_BLOFL/67-381YP...PFSGTV............HN.N........I...IYGRGSSDMKGALAA--MLVA--------T....KSFI---
DAPE_COXBN/62-372SP...PFTPTE............KN.G........Y...IYGRGAADMKSGLAA--MVVA--------A....ENFV---
DAPE_XYLFA/62-372SD...PFIPQR............RE.G........K...LYGRGAADMKGSVAA--FVIA--------A....ERFL---
DAPE_BUCBP/63-373SP...PFSPTV............DK.G........V...LFGRGSADMKGALAA--MVIA--------V....ERFV---
DAPE_BUCAI/62-372TD...PFQPVI............RS.G........Y...LFGRGSADMKGALAA--MITA--------A....ERFV---
DAPE_BUCAP/62-372DD...PFNPVI............KN.G........L...LFGRGSSDMKGALAS--MLIA--------S....ERFI---
E6MTY2_NEIMH/64-374SP...PFEPAE............RD.G........R...LYGRGAADMKTSIAC--FVTA--------C....ERFV---
DAPE_CHRVO/62-372SP...PFEPTV............RN.G........L...LYGRGAADMKASLAA--FVTA--------C....ERFV---
DAPE_NITEU/63-373SD...PFTPVV............RD.G........F...LYGRGAADMKTSLAA--FVTA--------I....EEFI---
DAPE_RALSO/70-380SD...PFEPTH............RD.G........K...LYGRGAADMKTSIAG--FVVA--------A....EEFV---
A0A058V666_BORPT/64-374SD...PFVPTE............RD.G........F...LYGRGAADMKSSIAA--FVVA--------A....EEFV---
DAPE_HAEDU/63-373YP...PFSAII............VD.E........M...LHGRGAADMKGSLAA--LVIA--------A....ENFV---
K0YT27_PASMD/63-373YP...PFSAQL............VD.N........V...LYGRGAADMKGSLAA--MVVA--------A....EHYV---
C9MHJ2_HAEIF/63-373SP...PFSAEI............ID.G........M...LYGRGAADMKGSLAA--MIVA--------A....EEYV---
F3IH20_PSESL/69-380ND...PFDALI............DEHG........M...LCGRGAADMKGSLAA--MLVA--------A....ERFV---
DAPE_SHEON/71-381TP...PFEPTI............ID.G........Y...LYGRGAADMKGSLAA--MVVA--------T....ERFV---
A0A016X5N4_VIBCL/64-374TP...PFEPTV............ID.G........F...LHGRGAADMKGSLAC--MIVA--------V....ERFI---
A0A017IAP2_ECOLX/62-372NP...PFEPTI............RD.G........M...LFGRGAADMKGSLAA--MVVA--------A....ERFV---
DAPE_PHOLL/62-372YP...PFEPTI............RN.G........M...LYGRGAADMKGSLAA--MIVA--------A....ERFV---
A9CL51_AGRT5/72-381TD...AFILR.............EDDG........K...LFGRGACDCKGPLIA--MIEA--------M....RMLA---
H3UQ43_STAEP/68-407YD...PFTLT.............ENQG........Y...LYGRGAADMKSGLAA--LAIA--------L....IEIK---
C7VXJ9_ENTFL/66-375FP...PFAAH..............IEG.......NK...LYGRGATDMKSGLVA--MVLA--------M....IELK---
A0A028XUR5_STAEP/68-401FP...PFELT.............DKDG........K...LFGRGTTDMKGGLMA--MVIA--------M....IELK---
A0A028WMC8_STAAU/68-402YP...PFQLT.............EKAG........K...LYGRGTTDMKGGLMA--LVIT--------L....IELK---
Q8TZ13_METKA/63-348.....PFEPR.............IVDG........K...LYGRGACDAKANLAV--YATL--------A....EIW.---
Q7UM22_RHOBA/107-416GPGGNPFEAV.............IEDN........R...LYGRGACDMKGSLAA--MLAA--------I....DGLD---
A0A030YAR5_PSEAI/72-376SD...PLRLD.............ERDG........R...WYGLGSCDMKGFFPL--AIEA--------L....LPLL---
F3ID35_PSESL/72-376TD...PLKLT.............EVDG........R...WVGLGSCDMKGFFAL--VIEA--------V....RGLV---
Q88CJ5_PSEPK/72-376SD...PLKLI.............ETDG........R...WVGLGSCDMKGFFAL--VIEA--------V....IPLL---
ARGE_BUCAP/75-378KD...PFKLT.............EKNN........K...LYGLGTVDMKGFFAF--ILDA--------L....CSIN---
ARGE_BUCAI/75-378KD...PFKLT.............ETNN........K...FYGLGAVDMKGFFAL--ILEV--------I....SSIN---
A0A016XA35_VIBCL/72-375YN...PHALT.............QVNN........R...FYGLGTADMKGFFAF--IYEA--------V....KNVD---
ARGE_MORAB/74-378KD...PFKLT.............EKDD........K...WYGLGTIDMKGFFAF--VLEA--------C....KNID---
ARGE_PASMU/75-378FD...PFKLT.............EKDG........K...FYGLGTADMKGFFAF--VIDA--------V....SQLD---
A0A017HYV7_ECOLX/76-379RD...PFTLT.............EHDG........K...LYGLGTADMKGFFAF--ILDA--------L....RDVD---
ARGE_PHOLL/76-379KD...PFTLT.............ERDN........K...LYGLGTADMKGFFAF--IIDA--------L....RDID---
ARGE_MYXXA/75-375D....ALRLT.............EKDG........R...LYARGACDTKGFIAC--ALHA--------A....LNAE---
B8H6F0_CAUCN/74-388TD...PWTLT.............ERDG........R...LYGRGTCDMKGFLAL--ALAA--------A....PDLA---
A9CF54_AGRT5/65-371SD...PFMLR..............AKG.......ER...LYGRGTTDMKGFLAT--VLAA--------A....PAFS---
Q987H6_RHILO/65-371SA...PFALR..............REG.......EQ...LYGRGTTDMKGFLAA--VLAA--------V....PTLA---
M4MKT9_SINM2/65-371SD...PFRLR..............VEA.......DR...LYGRGTTDMKGFLAA--VLAA--------V....PKLA---
Q88AX7_PSESM/67-382MP...PFQAT.............LRDG........R...IYGRGTCDMKGFIAL--AIDA--------M....LNAA---
Q89J35_BRADU/90-405HD...PFKLV.............ERDG........R...LYGRGTTDMKGFVAV--CLAM--------V....PDMV---
A0A058V6Z1_BORPT/67-381TD...PFCLT.............EKDG........R...LHGRGTADMKGFIAA--VLAA--------V....PALV---
A0A022NQ63_PSEAI/66-380VP...PFRLS.............ERDG........R...LYGRGTADMKGYLAC--VLAA--------V....PAFL---
Q88GZ4_PSEPK/73-387VE...PFALS.............ERDG........R...LYGRGTADMKGFIAS--VLAA--------V....PAFL---
Q7NVG4_CHRVO/67-384YP...PFQLTD............GGDG........R...LYGRGSADMKGFIAC--VLAR--------V....PDFV---
F4LES6_BORPC/75-389AD...PFALR.............EQEG........R...LYGRGSCDMKGFIAA--SLAL--------V....PAFL---
Q8XYW5_RALSO/75-389SD...PFAPE.............VRDG........R...LYGRGTCDMKGFIAA--SLAL--------V....PSVL---
G7QPH1_LEPII/112-477EA...PFSGV..............RKG.......DR...IYGRGAVDMKGLGIM--ELYA--------F....FLIH---
Q82HL3_STRAW/71-409..........................G........A...FDGP......LGVVS--SFAA--------L....DELR---
A0A038I678_BORBO/77-416..........................G........N...YDGA......AGVVA--GMAV--------L....AGWA---
A0A038IQT3_BORBO/79-416.........................................AGGNFDGAAGVVA--GLAV--------L....AGWR---
Q880G9_PSESM/87-417..........................G........R...FDGV......YGVLA--GAVA--------VSSLARQMR---
Q89GU6_BRADU/77-406..........................G........W...LDGP......LGVVY--ALEA--------A....RVLN---
D0KPG6_SULS9/71-398..........................G........K...YDGF......YGVMA--GLEV--------L....RSIK---
Q84FR8_9MICC/81-412..........................G........R...FDGI......VGVLG--ALEV--------A....QRIK---
Q893C9_CLOTE/76-402..........................G........N...YDGI......LGVLT--AMEV--------A....ETIV---
K4U164_BORBO/80-413..........................G........R...FDGI......IGVLA--GIEV--------A....HTLH---
Q7U3I0_SYNPX/107-432..........................G........R...FDGV......LGVLA--GLEV--------C....RSLQ---
Q96W94_LACKL/110-445..........................G........K...YDGI......LGVLA--GLEV--------L....RTFK---
M4IPW1_RHIML/82-410..........................G........R...FDGI......AGVLS--GLEV--------I....RTLN---
Q984M3_RHILO/78-404........................DAG........I...YDGC......YGVLA--GLEV--------I....ETLK---
Q8VUL6_9PSED/86-408..........................G........R...FDGI......LGVLA--GIEV--------L....RALH---
Q89R53_BRADU/83-410..........................G........K...YDGI......LGTLG--ALEV--------I....RTLN---
F6BN93_SINMB/83-410.........................TG................GKFDGVLGVLS--GLEA--------V....RTMN---
Q7CX68_AGRT5/76-403..........................G........K...FDGV......LGVLA--GLEV--------V....RSLN---
G8NGR5_BRUSS/82-409.........................TG................GKFDGVLGVLG--GLEV--------M....RTLN---
Q98K54_RHILO/83-410.........................TG................GKYDGVLGVLG--GLEI--------V....RSLN---
Q88Q81_PSEPK/91-418..........................G........K...FDGC......YGVMA--GLEV--------M....RTLN---
Q88FQ3_PSEPK/88-415..........................G........K...FDGC......FGVMA--GLEV--------I....RTLN---
A0A038HB77_BORBO/82-413..........................G........K...FDGC......FGVLA--GLEV--------M....RTLQ---
A0A058VEP1_BORPT/82-409..........................G........K...FDGC......YGVLA--GLEV--------M....RTLD---
Q89Q07_BRADU/80-408..........................G........K...FDGA......AGVMA--ALEA--------A....VSLA---
Q7CRI5_AGRT5/79-410.........................AG................GRFDGALGTLC--AFEV--------L....ETLD---
Q985I5_RHILO/80-409.........................TG................GRFDGALGTLS--AFEV--------L....EALE---
Q8ELE3_OCEIH/73-408..........................G........G...FDGV......AGVLT--AFGA--------I....KLLK---
Q98LM4_RHILO/87-417.....P....................G................GRYDGALGAIA--ALVA--------V....DALA---
G4ERJ2_BACIU/80-409..........................G........K...YDGA......YGVLA--AMLA--------L....KQLK---
A0A017IX64_ECOLX/77-406.........................NG................GNLDGQFGALA--AWLA--------I....DWLK---
A0A037ZR73_ENTFL/75-403..........................G........T...LDGQ......YGVIA--SMTA--------V....QYLL---
Q896S2_CLOTE/77-402..........................G........R...YDGV......AGVIA--GLMI--------L....KWAK---
Q7UHC4_RHOBA/118-448..........................G........A...LDGT......LGVVA--GLEC--------L....RCLK---
Q9CP93_PASMU/75-406..........................G........K...LDGP......LGSVA--GLEI--------L....FQLC---
A5UHB3_HAEIG/75-406..........................G........K...FDGP......LGSVA--GLEI--------L....LQLC---
Q9RV75_DEIRA/80-405YALVEALRERELPFHL.EVLGFSEEEG........V...RYGVSFIGSRALVGT--ADEL--------L....TVSD---
Q8D176_YERPE/85-415..........................G........R...YDGM......LGVLT--ALEV--------V....GYLH---
Q7W1K0_BORPA/81-415..........................G........R...YDGR......LGILL--PVAV--------A....GALR---
Q89H48_BRADU/89-419..........................G........K...WDGP......LGVIT--AIAC--------V....ADLN---
B8H0E3_CAUCN/80-410..........................G........R...YDGP......LGIML--GIDV--------V....EALH---
Q4UZZ3_XANC8/86-416..........................G........R...YDGP......LGVLL--GIEC--------V....AALH---
M4TP12_9XANT/86-416..........................G........R...YDGP......LGILL--GIEC--------V....AALH---
UAH_ARATH/134-472.........................YS................GKYDGVVGVLG--AIEA--------I....NVLK---
HYUC_PSESN/79-412.........................NG................GKFDGVIGVLA--GIEI--------V....HAIS---
Q9KET8_BACHD/83-411.........................HG................GRFDGTLGVLG--AIEA--------V....RTMK---
Q9F464_ARTAU/78-409.........................NG................GMFDGTAGVVC--ALEA--------A....RVML---
Q8EKY8_OCEIH/76-404.........................NG................GSYDGPAGVVA--GLEV--------A....ALFN---
C8JVD5_LISMN/76-406.........................NG................GAFDGPAGVIT--GLEV--------A....SVFH---

PF00883

C6X5Z5_FLAB3/162-466-----QITQFFHSVAEK...................---.........YGLKIS..VFDR-------------QKCL---
M5A4B4_9ACTN/176-482-----DIAD....K..A......VA.......L.GS---DAG........LTVE..VFNK-------------DQLE---
R4UJY4_9MOLU/141-444-----MFAN..........................K---IKEMAAGIP.NLTVK..ILDK-------------KEIE---
AMPA_CHRSD/184-489-----YLAD....Q.AQ......R........L.AD---GAD......GALNVE..ILDE-------------DALE---
A4XA11_SALTO/200-511-----AFAD....S..V......AS.......A.AR---AAG........LEVE..VLDE-------------VALR---
Q5WDV6_BACSK/180-487-----DLAN....E.SE......A........L.AK---KYG......F..SFN..VLER-------------EDME---
Q5NPD0_ZYMMO/149-450-----ELQK....A.VE...............EIAT---IFQ........AIVT..TTHG-------------KEL.---
D6YW21_WADCW/173-481-----KLAD....V.AK......E........I.AK---KHA.......AMKAT..VFDK-------------KRIE---
V9TS62_9PROT/174-479-----EFAK....R.VD......L........M.TS---L.G......L..QID..ILEE-------------KEIA---
C9RPN1_FIBSS/167-484-----EFVE...........................---NANTIAKYTPGLSIK..VRNM-------------KQLE---
X4R7Y1_9ACTO/156-460-----VLAQ....I.AE......EE.......A.SA---AG.........CSVT..IYRD-------------EELA---
A5UR62_ROSS1/172-479-----QLAE....R.AR......E........L.AI---AFD......L..PVT..ILGP-------------AEMR---
AMPL_CAEEL/171-476-----ALVD....E.AV......KV.......GNAT---GS........KI..T..VIRG-------------EELL---
AMPA_HERAR/186-492-----YLAN....T.AK......K........M.AK---EFK......L..QVE..VLDR-------------KQLQ---
D5EGT3_AMICL/164-471-----TMAS....F.AK......E........I.AT---RHG........MEIT..VFDE-------------HEIQ---
F0YH16_AURAN/200-517-----RLVA....E.AR......DV.......AARL---RA.....AGVAVDEE..VLAG-------------AALR---
C9YTR8_STRSW/193-500-----AFAA....V..A......QT.......A.AK---EHG........IKVT..VLDE-------------KALA---
K0C1Q1_CYCSP/186-488-----YLAE....T.AK......E........L.GK---QHA......SL.KVT..ILDE-------------AKME---
F0YC00_AURAN/1-320-----AFRE....ALRR...............V.AE---AEG........FAYD..ELDV-------------DGLE---
A9WJQ9_CHLAA/168-474-----FLGQ....T.AL......A........L.GE---RYG......L..KTM..VLDK-------------AQLI---
AMPA_HAEIN/179-483-----YLAE....Q.AK......N........L.AE---NS.......TALSLK..VVDE-------------EEMA---
I4B0I8_TURPD/181-488-----TMDA....R.SQ......E........I.AT---RYK........LTRK..SFGR-------------ADLT---
E1SVV7_FERBD/106-419-----VLADEVAER..................LSGL---AP.....D..HITSR..RIVG-------------DALL---
Q3IY25_RHOS4/151-451-----ELED....A.FL...............ALAD---RFG........AETA..VIRG-------------DKLL---
Q0C004_HYPNA/195-503-----WFAD....Q.VV......AK.......F.DG---VPN......V..SVT..VLDE-------------TQIE---
F2I7D6_AERUA/155-462-----QMAD....Q.AK......D........L.LT---ELG......V..EVE..IFDK-------------KQIE---
R5EB48_9BURK/175-479-----FMAE....E.CM......K........L.AG---SLG......L..DVT..VFDE-------------KAME---
G6CTF2_DANPL/360-666-----AFIQ....E.AI......NL.......AKEL---EI.........PPPT..IIRG-------------EELK---
C5BET8_EDWI9/111-423-----QLAQRAVDL..................LCAQ---AC.....D..SIHYR..IIKG-------------DDLR---
Q46JD4_PROMT/176-484-----QMSK....E.AE......K........L.AT---DYD........LDLK..VLDR-------------KECE---
B3SB51_TRIAD/171-484-----IFAS....T.VE......KTMA....GF...---.........NNITIT..SYDK-------------EWAE---
C1EA64_MICSR/261-600-----ALVG....E.AA......AV.......AAEL---AG.....PTHGLDVSWDALRY-------------DALK---
L0DW10_THIND/149-448-----HLAL....A.AR...............ELAE---EFG........AGLR..VISD-------------DEAL---
K1PGD2_CRAGI/175-480-----DFVK....E.AE......VV.......GREL---QI..........TPF..IVRG-------------EELK---
C7MYY8_SACVD/181-488-----SFAD....R..A......KE.......L.AN---ANG........LDIE..VLDE-------------KALK---
D2B4S6_STRRD/191-499-----RFAE....I..A......EQ.......T.GS---AAG........LSVE..VLDD-------------KALK---
B9L9L3_NAUPA/139-450-----KLAS....I.AE......DV.......A..K---TNK........LECN..IYDE-------------NYLF---
K9PC73_CYAGP/182-491-----SLAD....E.AA......A........I.AD---AFG........LELK..VLER-------------ADCE---
A3DKW9_STAMF/180-491-----KIEE....E.AR......KL.......A.EQ---Y.G........LKIK..VFHK-------------EDLE---
Q5HQM0_STAEQ/177-485-----YFAE....E.IK......K........H.FE---GSS........VSVD..IKDH-------------RKII---
F9VM60_ARTSS/164-472-----EFGNRCIEQ.VK...................---..........GLDVEINVYDE-------------NWIK---
T1J675_STRMM/177-486-----GFLQ....E.IY......NV.......GKTL---GI..........TPL..VIQG-------------EDLN---
U5N957_9BURK/230-540-----MLAR....A.AA......S........L.KC---YAR......I..TCK..VLDA-------------GDAH---
M4BQQ9_HYAAE/222-534-----AFIA....E.AQ......AV.......AART---SS..........RTT..IVQG-------------EELR---
G4T0U0_META2/183-486-----YLAE....Q.AQ......S........I.AE---RFT......SM.SVD..ILEE-------------ADME---
D5UXQ0_TSUPD/187-495-----EFAD....R..A......QR.......L.GA---EAG........LQVE..VFDE-------------EYLA---
K0RYY1_THAOC/174-477-----SLAD....T.AR......R........I.AE---ESG......GCITAE..ILGK-------------KECE---
F7QIS5_9BRAD/148-448-----ELAQ....A.AQ...............TLAE---KFG........AKYS..AIVG-------------DDLL---
AMPA_WIGBR/185-490-----YLSH....Q.SY......I........L.KD---KYS......EKISVE..IMDH-------------KKIK---
AMPA_RALSO/196-498-----YLAN....T.AR......Q........I.AK---DFK......L..KVE..VLGR-------------KQIE---
U6B4X9_9RHIZ/181-486-----EFCD....K.AK......Q........L.SS---L.G......V..EVD..ILDK-------------KAME---
F4CZP3_PSEUX/183-491-----SFAR....R..A......RE.......L.GE---AAG........LEVE..VLDD-------------AALA---
AMPA_TROWT/173-487-----QFAS....F.VA......KD.......L.EG---IDH........ISVE..SWDE-------------KRLQ---
R6H0E6_9FIRM/135-443-----DFAA..........................R---LTALAQGL..PIETA..VYDR-------------QQLE---
A9A408_NITMS/173-482-----TLAN....F.AK......T........I.SK---NKM.........KCK..IISK-------------PELK---
E8V0T5_TERSS/199-509-----VLGE....R.AL......A........M.CT---EFG......I..QCK..VYST-------------AKLK---
Q2GLA3_ANAPZ/182-491-----EYAK....R.VH......AE.......L.TP---L.G......V..EVE..ILDE-------------ERIR---
K7X8P8_MYCHR/148-451-----FLAD..........................K---IVEKLSTNA.NLKIR..VLGK-------------TQIQ---
E4WVA7_OIKDI/163-477-----IFCE....K.VT......ERL.....NP...---.........LGIKCT..THGK-------------DFIL---
V6DF53_9DELT/186-495-----IFAS....K.AQ......E........I.AK---EYN........LSYK..IFNE-------------EEII---
M9R8Y2_9RHOB/149-449-----ELAD....A.AQ...............ILAA---QHG........ATMV..IIQG-------------DDLL---
Q5SLN7_THET8/216-519-----ALAE....R.AL......E........L..R---ALG......V..EVE..VLDE-------------KAIA---
X2GUA7_9GAMM/109-419-----ELATQSAKL..................ISNY---SS........DISYN..IISG-------------EVLK---
C5LBL7_PERM5/214-537-----TYVT....F.ME......HL.......VAGL---KA.....MGRDVDMK..VIKG-------------QDLE---
S6BD92_9GAMM/181-484-----YLAE....Q.AH......K........L.AR---GQR......KL.KVT..VLEE-------------KDME---
B7PRX1_IXOSC/177-486-----RFAG....A.AA......ETL.....EK...---.........KGVKVI..PRDK-------------KWIE---
A7SX56_NEMVE/212-520-----IFAD....T.VG......LRLD....KL...---.........SNVEFN..IREK-------------SWAE---
M1MZ09_9CORY/185-492-----AYAG....I..L......AA.......A.GR---DAG........LDVE..VLDE-------------DALE---
B9JYU2_AGRVS/151-452-----DLEK....T.FR...............ALAD---HYK........AEVS..VVIG-------------DELL---
D8K0H4_DEHLB/177-486-----VMAE....T.AL......S........I.GE---EEN......I..EVE..VIER-------------ETMA---
J9Z8K7_LEPFM/221-528-----MIAQ....T.AS......V........E.CQ---KRG......I..HFV..SYDR-------------EKLE---
Q2W0Z6_MAGSA/176-482-----EFVR....R.AR...............L.LE---ALG........VEVT..VLDE-------------AALA---
D0LAY7_GORB4/199-505-----EFAA....R..A......RT.......L.GS---KAG........LGVE..ILDD-------------TELE---
AMPA_BLOFL/189-495-----YLSN....K.VQ......E........L.SN---YNT......DL.DIE..IINE-------------LQLK---
AMPA_METRJ/187-492-----EFAR....R.AS......E........L.AK---L.G......V..EIE..VLEP-------------ARMR---
R6S5R2_9CLOT/172-480-----KLGA..........................E---AKTLAAEL..GIDVT..VYDK-------------NQIE---
A6VMK6_ACTSZ/106-424-----ELVQRAVDF..................ICRQ---AEQVELES..AVKFE..IISG-------------EALC---
U3U7T3_9BACT/185-490-----YLSL....H.AR......Q........L.AN---EFS......TNINTR..VINE-------------EQMK---
Q2GDT6_NEOSM/182-494-----TYAN....A.VK......E........I.TK---T.APN....L..KVE..ILDE-------------KGMQ---
G8NQH1_GRAMM/188-498-----ELGK....R.TA......A........M.CS---EFG......L..QCE..VHSI-------------DKIL---
F8GJ95_NITSI/172-475-----TYRQ....QIKK...............L.AE---NEG........WKYQ..EYDI-------------NKLK---
AMPA_SYNFM/185-493-----FLAD....C.AR......RL.......A.DR---.DG........CRIE..VIGL-------------EKAE---
U3K842_FICAL/133-437-----TFLE....E.IK......KV.......GKDL---GI..........TPT..IIRD-------------EELK---
AMPA_LEPIN/176-485-----EFVS....R.SK......E........I.AK---DNG........LKIT..VFDE-------------PQLK---
F8DZQ6_CORRG/278-588-----SYAA....I..A......AE.......Q.AK---EFG........IESE..ILDE-------------QQLE---
F0S3L9_DESTD/164-473-----KLAE....I.AK......E........L.SE---KYG......F..KCK..VFKE-------------KELE---
C6CWC9_PAESJ/191-497-----SLAA....H.AE......E........L.AR---EWD......L..DIE..VLDE-------------WAAI---
Q7KF27_LEIMA/242-557-----FYAEWAKKYMIP...................---.........EGIKVR.KVLRG-------------QQLE---
S5XWQ0_PARAH/187-492-----DFAD....R.LL......A........M.QE---I.G......I..EVE..VLDE-------------PELA---
AMPA_HALHL/185-488-----YLGE....Q.AE......A........L.AQ---RFD......GV.RAE..ILGP-------------AELE---
AMPA_SYNE7/174-481-----TMAD....T.AQ......E........L.AA---ELG........LELE..ILEA-------------DECE---
I3Y9V9_THIV6/185-488-----YLAD....Q.AV......E........L.GG---RCD......AL.KVE..VLDE-------------DAMA---
T1IEY7_RHOPR/164-479-----KFAE....A.TM......DYL.....CP...---.........CGITVV..IRDR-------------YWIE---
AMPA_HELPY/175-486-----YMAE....V.AQ......KV.......A..K---ENH........LEIH..VHDE-------------KFLE---
Q9RWF2_DEIRA/172-475-----TLAR....E.AR...............G.LA---SEH........LQVE..IWDE-------------SDIQ---
D5X603_THIK1/177-479-----YLAE....M.AK......K........M.AK---FHG......L..DCK..VLGR-------------PEME---
B7XIA6_ENTBH/168-480-----IFIE....Y.AK......DILQ....NY...---.........NDIELR..VLEE-------------NDIQ---
G8PT59_PSEUV/147-444-----ELAA....A.AS...............QLFE---DHG........GNAK..VIMG-------------D.VL---
D5QH38_KOMHA/175-479-----TFEA....R.IT......K........L.RD---L.G......V..EVE..VLDR-------------EAMH---
G2IJP7_9SPHN/213-520-----SFVE....R.TR......TA.......L.AG---VPG......V..SIE..VLDE-------------PAMR---
AMPA_SYNPW/175-484-----ELAR....T.AS......H........L.AH---EHG........LELT..ILER-------------SDCE---
A0C3G2_PARTE/167-475-----FFVN...........................---EVKTLFKDNPNVEIK..ILEG-------------QQLQ---
L0FUP6_ECHVK/162-470-----QLGN....E.IE......K........L.GK---SYG........FSTE..ILDE-------------SKIS---
D9T8V1_MICAI/185-493-----WFAA....Q.VA......EA.......A.SG---RPG........LHLR..VRGP-------------EELA---
I1FZI3_AMPQE/175-480-----GFLE....Q.IK......EV.......GAKL---GL..........TPF..VIRG-------------ENLR---
D0LFL6_HALO1/191-497-----QCAS....D.AR......A........L.AK---KHG........LGIR..VLGR-------------KECE---
F2G2P1_ALTMD/197-500-----YLWQ....Q.AQ......E........L.AS---QY.......DSVTAE..VVDE-------------TQMA---
F0YNB6_AURAN/156-471-----ELEA....V.AR...............RLAA---AYG........AAVA..TVEG-------------DALL---
D6X0X1_TRICA/181-508-----NVEK....YILD...............VFSG---SN.........IKVQ..VVKD-------------PEQF---
J9JWQ8_ACYPI/201-510-----VFSK....E.VQ......DVL.....GK...---.........LGVNVI..VRDK-------------CWAE---
AMPA_ACISJ/169-471-----LVAN....A.AK......T........L.AK---YPG......V..QCQ..VLGP-------------AEVA---
AMPA_SYNP2/179-486-----TLAA....S.VE......S........L.AS---TYG........LELN..ILEE-------------ADCE---
R7Y059_9ACTO/191-497-----WLAE....Q.AE.......E.......F.AA---AAG........LDVT..IWDE-------------QRLA---
T0MZ46_9EURY/166-471-----YFEK....L.AR......E........L...---.KN......V..NIS..VIEK-------------DKFK---
B4MSA4_DROWI/228-539-----IFAQ....S.TV......DAL.....CP...---.........CGVSVE..IRSM-------------DWIE---
F3ZI02_9ACTO/182-489-----SFAA....L..V......QG.......L.AK---DYG........VKVT..VLDE-------------KALT---
A6W748_KINRD/196-506-----WMVA....Q.VH.......E.......V.AA---AAR........LKVE..VRDA-------------DRLR---
F2U656_SALR5/184-493-----GIHDVAERVAAD...................---.........FNLNCH.SIVGI-------------PALD---
C5J5J7_MYCCR/150-453-----FLAK..........................E---IQSKLSDNK.NLTVK..VLGM-------------QEIK---
C6XAH6_METGS/170-472-----LYRD....RIAE...............L.AA---KHG........WDHE..SFDM-------------KKLG---
D7CD64_STRBB/197-504-----IFAA....A..V......LD.......A.AK---EHG........LKTE..VLDE-------------KALK---
D5BYS9_NITHN/186-489-----YLAD....E.AR......K........L.AK---EYK......PL.KVK..ILEQ-------------EDME---
F4KZQ6_HALH1/183-487-----KMAE....F..A......RE.......S.GQ---RGN........FSVR..VMEK-------------AELE---
A1BB03_PARDP/167-482-----VWAA....E.LP......A........IFE.---PLG........ATLR..IFDS-------------GALQ---
V4L747_9GAMM/184-490-----YLAE....Q.AT......A........L.GE---RYA......AL.SVE..VLEE-------------ADME---
X2H865_9GAMM/184-487-----YLAD....Q.AK......Q........L.GK---KH.......SSLKIS..CLGE-------------KELA---
Q8EUM6_MYCPE/140-443-----SFVE..........................E---VKKLFADVQDKVSIS..VLNK-------------EDLK---
N0B4F1_9BACI/184-491-----DMAD....Y.AT......D........L.AW---KYN......F..DVE..ILEK-------------EEIE---
B3MFP9_DROAN/211-522-----IFAQ....A.TV......DAL.....CP...---.........CGVSVE..VRTM-------------DWIE---
R6ISD0_9PROT/163-464-----VMAL....D.LK......RL.......E...---........YLDIKVE..LLDR-------------DFIV---
D7BBW5_MEISD/175-481-----ELAE....R.AR......E........L.GR---ETG......L..QVM..VWDE-------------RQIQ---
Q5NMX7_ZYMMO/178-485-----TFVE....Q.CK......S........L.TD---L.G......I..EIE..ILDE-------------KALE---
E3F0E2_KETVY/155-457-----QLAN....V.AV...............ALAD---LHG........GTSG..VTVG-------------DALL---
Q1GQH4_SPHAL/239-548-----SFVA....R.VR......AA.......F.AG---VPG......V..SIE..VLDE-------------AAMR---
E0VYD5_PEDHC/176-487-----VFAQ....T.VI......DLL.....CP...---.........CGVQIE..VRDK-------------DWLE---
Q6LU55_PHOPR/107-421-----QLAARAGEF..................VKSL---AP.....E..HVTYK..IIKG-------------NDLI---
K9YMB5_CYASC/177-484-----TLTQ....V.VE......D........L.AT---EYN........LELK..ILER-------------EECE---
D1CBV6_THET1/172-477-----EFAR....R.AQ......S........L.CE---VNG........LTCE..ILEE-------------EDLR---
C7NIK9_KYTSD/196-515-----SFVA....S..V......QA.......A.AP---AG.........IEVE..VMDD-------------TQLR---
Q98BF0_RHILO/179-479-----DLEM....A.VR...............TLAA---AHK........AEVS..VTKG-------------DDLL---
R9AP41_WALI9/120-439-----YFTE....R.AK......KEFS....GL...---.........DNIDLQ..IFDK-------------EWAE---
Q386R3_TRYB2/235-553-----TFTEIAAGH.IA......KL.......KNKL---KR........NVSID..IISG-------------EDLR---
M1M440_9PROT/203-510-----YLAN....E.AI......K........L.EK---EFK......NI.KVN..VLNI-------------EEVQ---
E8WYQ5_ACISM/196-505-----VLGA....R.TK......A........M.CD---EVG......L..ACE..VYST-------------SKLE---
M4NH77_9GAMM/183-487-----YIAA....Q.AQ......A........F.AE---AQG......KV.SCS..VLDE-------------AAMA---
H1Z7W8_MYROD/147-453-----QLAK....E.IE......L........L.GN---EAQ........FAVK..ALGK-------------NEIE---
F0YJ08_AURAN/51-366-----AFVG....E.AR......AV.......AARL---QA.....LGRDVTVD..VIAG-------------EALR---
F9YSU1_CAPCC/154-461-----RFSE....E.ML......A........L.GN---QFG........FEVN..VLNK-------------TQIS---
R5RS31_9FIRM/161-460-----TLVD....E.AI......K........LSQK---YPQ........LECT..ILNK-------------SNLE---
A0A023B3K4_GRENI/144-445-----LFAR....I.AE...............HEAK---SRP.......SVSFE..VFDE-------------HACA---
Q4A6P7_MYCS5/150-452-----QLAH..........................Y---VAKDLKQIP.EIQVT..VFTK-------------SNIE---
E2SAP7_9ACTO/187-494-----DFAE....S..I......TE.......F.AG---DH.........VKVA..VWDE-------------KRLA---
D3EQL7_ATETH/178-485-----TFTE....V.AK......K........L.AN---EYD........LEIE..ILEQ-------------DECA---
Q4P9A5_USTMA/210-531-----IFGQ....R.VT......AAFK....NV...---.........PNTTVI..VHDE-------------DWAR---
G7EAQ2_MIXOS/137-455-----IFCE....R.AQ......ELFK....DH...---.........SSVTVN..VHDA-------------DWAK---
S5RM48_9PROT/187-493-----YLEN....I.SK......K........L.SF---DYK......M..DIE..IINR-------------EQMQ---
B4S7K1_PROA2/199-505-----DIAR....Y..A......SE.......S.AE---KHG........YTAT..VFDK-------------DAID---
F6EEL9_AMYSD/202-511-----EFAD....R..A......RI.......L.GE---AAG........LAVE..VLDE-------------TELA---
C7RP72_ACCPU/186-487-----YLAE....A.AQ......R........M.AA---EHK.......I.ECQ..VLER-------------DDMA---
S6B212_9PROT/171-471-----LYRE....RVSK...............L.AK---ENG........WKCV..EYDM-------------KKLR---
AMPA_LEIXX/172-479-----TFAE....R..V......EA.......L.AA---DLP........VSVE..VWDE-------------TRLA---
D8M2T3_BLAHO/88-396-----ALELLCRRICER...................---.........DNVEFK..VLQA-------------PDLQ---
R5SAB2_9GAMM/159-460-----ELAN.......................I.AC---DFG........LDTV..VYNR-------------EECE---
AMPA_GEOUR/182-488-----YLAE....K.GR......E........I.AA---RYG......L..SCT..VLER-------------EEMA---
S5TKP0_9CORY/185-492-----SYAE....L..L......SA.......E.GT---KNG........LKVE..VLDE-------------KELE---
J3PN70_PUCT1/199-517-----LFCE....R.IT......KEFQ....GI...---.........KNVDIH..VHDK-------------SWAE---
AMPA_BACP2/179-486-----DLAS....Y.AA......E........L.AY---KYE......F..EIE..ILDK-------------EQME---
M4RX46_9SPHN/181-487-----SFVA....R.CQ......P........L.KD---L.G......V..EIE..VLDA-------------DQMA---
E4U043_SULKY/160-469-----QMAI....T.AD......AL.......A..E---SND........LECT..ILDV-------------NGLE---
D6ZH18_MOBCV/166-469-----SMAQ....A.FK......KA.......S.KN---LP.........VSF