Sequence alignment for CL0043

PF01903

P71751_MYCTU/53-151--------HGS.KD.PRSAANARAIA.G---RLARMRP.GLD----------------------------V.RVAFCE--
Q7UNS6_RHOBA/42-150--------HGT.RD.QRGTDEFFELG.D---RLANHLAGQSI----------------------------V.QPCLLE--
Q82UF1_NITEU/52-144--------EEI.RD.AFASFSANHPA.A---LVFVTDE....----------------------------........--
CBIX_METJA/9-138--------HGS.RL.PYSKELLVKLA.E---KVKERNL.FPI----------------------------V.EIGLME--
Q7V242_PROMP/174-278--------RGS.SD.PDANSNVSKIT.R---MVVEGVG.LGW----------------------------G.ETVFSG--
CBIX_HALSA/9-130--------HGS.HLNPGSSEPAYTHA.D---TIRESGA.FDE----------------------------V.REAF.W--
CBIX_HALSA/152-263--------HGTERN.ENSAKAIYYHA.D---QIREMGV.FGE----------------------------V.QAVFMD--
Q81FY5_BACCR/9-114--------HGS.RL.KTAKEEAIQFI.T---SCMSCIE.ATI----------------------------Q.EVCFLE--
Q8FM68_COREF/9-112--------HGS.RK.PSAAAGITALT.A---ATGRMLQ..VD----------------------------A.VEAHLE--
Q8CN68_STAES/9-113--------HGM.RK.GNQNEALEEFI.G---TLLKDEQ..YY----------------------------Y.ELAFLE--
CBIX_ARCFU/10-119--------HGS.QL.NHYREVMELHR.K---RIEESGA.FDE----------------------------V.KIAFAA--
CBIX_SULTO/9-108--------HGS.KI.KEWQDVAIQYA.N---LLRKYFD...L----------------------------V.EYGFIE--
Q9X2M7_STACA/9-114--------HGM.RR.GKQNQLLMEEL.E---HVGKQVN..GE----------------------------F.DVAFIE--
Q8TKD6_METAC/3355-3469--------HGS..D.ENWNQRVRESV.A---EVEV..P..YP----------------------------V.ELGFLD--
Q7U7Z1_SYNPX/16-120--------HGS.RN.RLAVEEFAQMV.E---ALRPKLA.PMT----------------------------V.EHGYLE--
Q7VCD4_PROMA/148-252--------RGS.SD.PDANSNVSKLT.R---MLVESFG.FAW----------------------------G.ETVYSG--
P74414_SYNY3/23-131--------AET.WR.AYYSGGLLTEV.N---QGKQLEP...P----------------------------V.FSASLE--
Q8NV21_STAAW/9-113--------HGM.RH.GRQNQALEAFI.S---ELVKDDI..HH----------------------------Y.DIAFLE--
Q8EXP3_LEPIN/11-115--------HGS.RE.SSYDREFEQFV.Q---GYHKLHP.EYE----------------------------I.KTAYVE--
Q7V757_PROMM/20-124--------HGS.RN.RLAVEEFAQLV.K---ALKPKFP.TIP----------------------------V.EYGYLE--
CBIX_BACME/14-118--------HGS.RD.PEGND..REFI.S---TMKHDWDASIL----------------------------V.ETCFLE--
Q82BN1_STRAW/64-163--------HGS.RD.PRALSTVRTLI.D---RVRELRP.HLP----------------------------V.HLGHIE--
Q9RZD7_DEIRA/3-101--------RHA.RA..............---.........VR----------------------------A.QGLFDE--
Q96ZL1_SULTO/11-123--------HGS.RR.NTFVEDMVNLA.R---YIEEKLE..VP----------------------------V.FLSHNE--
Q8XWQ5_RALSO/11-116--------HGA.RD.ARWREPFDRLR.A---RLAARQP.EVD----------------------------V.RLAFLE--
SIRB_BACSU/10-115--------HGS.RV.KKAQQEAAAFL.E---GCKAHIS..VP----------------------------VQEISFLE--
Q7NDP2_GLOVI/28-133--------HGT.RD.ADGRETFLEFA.A---AYQHFDP.ARP----------------------------V.VPCFLE--
Q7NXQ9_CHRVO/13-118--------HGS.RD.PDGVNEFMQLV.D---ALKARAG.ERP----------------------------V.AHGFLE--
Q81FY5_BACCR/133-233--------RGS.SD.PEVLRDINWIA.S---LFQTKEK.VKK----------------------------V.EVCYLA--
Q7NXQ9_CHRVO/143-247--------RGT.SD.PDANSEISKLA.R---MLEEGLG.FAA----------------------------S.FVCYSG--
CBIX_METKA/9-134--------HGS.RL.PYSRQVVEKIA.E---YVEEMGD.FET----------------------------V.EVGFME--
Q7VCD4_PROMA/20-124--------HGS.RN.SHATDEFATLA.E---RIKASLS.NIP----------------------------V.EYGYLE--
Q8DJ31_THEEB/165-269--------RGS.SD.PDANGDVFKLA.R---MLWEGSG.YKT----------------------------V.EVCFIG--
Q829K6_STRAW/144-248--------RGS.TD.PDANAEVHKAA.R---LLWEGRG.YAG----------------------------V.ETAFVS--
CBIX_METTH/18-137--------HGS.RL.PYGEEVINGIA.D---IYRQEAD..HP----------------------------V.AVGFMN--
Q8DHP8_THEEB/20-121--------HGS.PA.PEPQQAMAFLC.Q---QLTPLGI....----------------------------...LSWGT--
Q81E58_BACCR/9-114--------HGS.RL.QEGNEQFIQFI.Q---SVMKERN.ERI----------------------------Q.KIAFLE--
CBIX_SULSO/9-118--------HGS.KI.PEWKDVGIKYA.E---YLSKYFS...L----------------------------V.EFGFLE--
Q82L75_STRAW/11-113--------HGS.RD.PRHAATVHALV.R---RVRAMRP.GLR----------------------------V.ETGFLD--
Q7UNS6_RHOBA/198-298--------RGR.LK.QSHRSCIAD....---.LYAIDA..DG----------------------------L.RTTFYA--
Q8DJ31_THEEB/33-138--------HGT.RD.PEGRQAFLDFA.Q---AYYQLDA.CRP----------------------------I.FPCFLE--
P74414_SYNY3/149-243--------HGS.KR.AGGNLAIATVA.E---KLGARAA....----------------------------........--
Q7U7Z1_SYNPX/145-249--------RGS.SD.PDANSNVAKVT.R---MLVEGFG.FGW----------------------------G.ETVYSG--
Q8YZE1_NOSS1/3-102--------QIA.GL.VAEKLHLPE....---.........KL----------------------------V.GTGYLE--
Q8EXP3_LEPIN/133-237--------RGA.SD.ADSNGDFYKAV.R---FFEESSS.FLF----------------------------V.KPSFIG--
Q9L2E8_STRCO/21-118--------HGS.RD.PRALSTVRALL.D---RVRALRP.ALP----------------------------V.HLGHVE--
Q8YZE1_NOSS1/117-213--------HGS.RR.PGSQQPVETMA.A---YIGG.......----------------------------...VAAYW--
Q7NHF8_GLOVI/27-130--------HGS.SD.RRSCLAFGELV.E---RFRRYSN..FR----------------------------I.VSGTLE--
Q9KCS3_BACHD/144-248--------RGS.SD.PDANSDLVKIS.R---LLWEHVP.VME----------------------------V.EVCFLA--
Q82L75_STRAW/135-230--------AGS.TD.PEAIAVIGDIA.R---EWRRTGW..CA----------------------------V.RPAFAS--
SIRB_BACSU/134-236--------RGS.SD.PDVKRDVTGIA.N---LLQEMVP.VKE----------------------------V.IPCFLT--
Q9L2E8_STRCO/140-233--------AGS.RD.PESRADTARTA.A---ALAARLG..VP----------------------------V.VPAYAS--
Q9RS86_DEIRA/9-126--------HGS.HH.HGESARATQQV.A---EALRGRG..LA----------------------------G.HLPYDE--
Q84JH7_ARATH/89-194--------HGS.RR.RESNLMLEEFV.K---MFKEKTG.YPI----------------------------V.EPAHME--
CBIX_SYNY3/164-268--------RGS.SD.PDANGDVYKMA.R---MLWEGSG.YQT----------------------------V.ETCFIG--
Q8EQN8_OCEIH/9-114--------HGS.RI.PEATADAIAFI.N---QVKKQIG.IPL----------------------------Q.ETCFLE--
Q7V242_PROMP/46-150--------HGS.RN.KLAITEFQELT.R---LIQKKFP.SIL----------------------------V.EFGFLE--
Q9RZD7_DEIRA/122-231--------HGTGRD.RQSQQAIEQAA.A---ALRGRGR....----------------------------.....FAE--
P95216_MYCTU/123-221--------AGA.SD.RRARADLHTTR.T---LVSELTG..SW----------------------------V.DMGFAG--
Q8ZZB2_PYRAE/8-112--------HGS.RR.GDFNKLMEEWA.A---ELSRRLG..VK----------------------------A.VVGYNE--
Q8NLX3_CORGL/9-112--------HGS.RK.KSAAAGITALT.H---EAGRMLE..TP----------------------------A.VEAHLE--
Q93IF7_PROFR/147-251--------RGA.LT.TRANAEHYRLT.R---YVGEEVG.FAG----------------------------A.FPSFIQ--
Q8TKD6_METAC/423-539--------HGS.PE.DEWNQPVRDAV.E---GIDC..P..YP----------------------------V.ELGFLE--
CBIX_BACME/141-245--------RGG.SD.PDANSDLYKIT.R---LLWEKTN.YKI----------------------------V.ETSFMG--
Q82BN1_STRAW/189-282--------AGS.RD.PESAVDTRRIA.Q---LLAERLG..VP----------------------------V.VPAYAS--
Q93IF7_PROFR/12-121--------HGT.RD.AQGLAQTRAFA.D---EVRAALP.GVH----------------------------V.ELGFVE--
CBIX_SYNY3/32-137--------HGT.RD.EDGRQTFLDFV.A---QYQALDH.SRP----------------------------V.IPCFLE--
CBIX_METMA/12-124--------HGS.KL.PYNKEVVTQIA.N---YIAQKHS.DVV----------------------------V.RAGFME--
Q9KCS3_BACHD/9-115--------HGS.RV.EEGNEQLRAFVKK---AIERKRD.IPI----------------------------Q.TIGFIE--
Q8EQN8_OCEIH/134-236--------RGS.RS.PQTKKDIEQIA.S---NLQMKMN..VH----------------------------V.DVCYLA--
P95216_MYCTU/8-105--------HGT.RR.PSGVAMIADIA.A---QVSALVD..RT----------------------------V.QVAFVD--
Q829K6_STRAW/13-118--------HGT.RD.EAGAEAFRDFV.R---ELGRRHP.ELP----------------------------V.AGGFIE--
Q7NDP2_GLOVI/156-260--------RGS.SD.PDANGDACKMA.R---LLWEGSG.YLG----------------------------V.EVCFIG--
Q7NHF8_GLOVI/150-253--------HGS.RR.EEANRLVQDIA.D---GVWENLG..GP----------------------------L.VTAAFW--
Q8XS58_RALSO/22-127--------HGS.RD.PDGVAEFLALV.A---LLRERAG.GRT----------------------------V.AHGFLE--
Q97WC4_SULSO/14-126--------HGS.RR.ETYNSDIENMI.N---YLKEKIS..SP----------------------------I.YLTYNE--

PF06180

Q8Y7R9_LISMO/3-255-KAILVVSFGT-SY-PETREKTIEACEK---RVAHEFP-DYT----------------------------V-FRAFTSNK
Q8KFD8_CHLTE/13-299-KAILLAHFGT-TY-PSALP.SLENIRR---QVRARIP-GIE----------------------------V-RHCFTSNM
Q8R628_FUSNN/14-265-KALFMVHFGT-TH-NDTKELTIDKMNK---KFADEFK-DYD----------------------------S-FTAYTSRI
Q97JB3_CLOAB/3-262-KAILIISFGT-TY-ENTRKLTIDAIEE---KVKDEFK-DYE----------------------------I-RRAFTSYK
Q8XL14_CLOPE/3-261-KAILVVSFGT-SH-LDALNNSIKKIED---SIQENFK-EYD----------------------------V-FRSFTSHM
Q57MX2_SALCH/3-257-KALLVVSFGT-SY-HDTCEKNIVACER---DLAASCP-DRD----------------------------L-FRAFTSGM
Q9RMI6_PORGN/31-292-EATLLVTFGS-SY-KAPRE.TYAKIEK---TFAAAYP-DQR----------------------------I-SWTYTSSI
Q97LH8_CLOAB/3-263-KGILIVGFGT-IY-KDARACTIDKIKE---EVCKQFP-DYE----------------------------V-LQAFTSSK

PF00762

HEMH_COXBU/19-351KIGVLLINLGT-PD-EPSVPAVRRYLRQ...FL..SDPKVID...VP..SL..VRWIIVHLCILPFRPK.RSAKLYQK--
HEMH_RHIEC/19-340KIGVLLVNLGT-PD-GTDYTSMRRYLKE...FL..TDRRVIE...WS..PW..KWYPILFGIVLNTRPQ.KVGKAYEL--
HEMH_CAUCR/4-317KLAVVLFNLGG-PD-GP..DAVRPFLFN...LF..RDPAIIG...AP...A..LIRYPLAALISTTREK.SAKANYAI--
HEMH_METFK/17-337RTGILVMNLGT-PE-APTAKALRPYLRQ...FL..SDRRVIE...LP..RP..LWWFILNGVILVLRPR.QSAHKYAT--
HEMH_FRATW/10-329KQAILLVNLGT-PD-NYDTKSIKRYLKE...FL..SDPRVIE...AN..PV..LWKIILNLIILPIRAK.KNVHTYKT--
HEMH_RHOBA/7-309YDSFLLVSFGG-PE-GQ..DDVMPFLEN...VL..RGKNVPR.......................ERML.EVAEHYKH--
A7JUM6_PASHA/6-320QIGILLANLGT-PD-EPTPSAVKRYLKQ...FL..SDPRVID...LP..KF..KWQAILNCIILPRRSP.KVAKLYQS--
Q3A6H8_PELCD/15-332KTALISLNMGG-PD-RP..ESVAPFLRN...LF..SDRELIR...LP.GGA..WLQRPFARLMARLRAP.KARRAYEA--
A0JYM7_ARTS2/30-358YDAVLLASFGG-PE-GQ..DDVIPFLRN...VT..RGRGIPD.......................ERLE.EVSHHYRA--
A7GM50_BACCN/4-305KIGLLVMAYGT-PE-SL..EDVEAYYTH...IR.........................HGCKPSAEALE.DLIMRYKA--
Q1N3F6_9GAMM/5-324KIGVLLVNLGT-PE-APTAKAVRKYLAE...FL..WDRRVVD...VP..RP..IWWLILNGIILRFRPG.RVAKGYQS--
Q2IPY0_ANADE/3-312HTAVFLMNLGG-PR-NL..AEVEPYLYE...LF..SDPLVIT...AP..FG..PFRKPIAKLISRTRAP.SSAEKYQL--
HEMH_LEGPC/2-331RRGLLLLNLGT-PD-NADIRAVKLYLRE...FL..TDKRVID...LP..TI..PRYILVYCLILPFRSP.KSAQAYQS--
A3I3M0_9BACI/5-305K.GLLVMAYGT-PY-KE..EDIEPYYTH...IR.........................HGRKPSEEHLE.DLRSRYEA--
HEMH_STAAN/4-307KMGLLVMAYGT-PY-KE..SDIEPYYTD...IR.........................HGKRPSEEELQ.DLKDRYEF--
Q1GQW0_SPHAL/14-327RVAVLLVNLGT-PD-APDPPSVRRYLRQ...FL..SDRRVVE...IP..PI..LWQPILRGIILTTRPK.KSAHAYAQ--
A6W899_KINRD/11-329YDALLLLSFGG-PE-GP..DDVMPFLEN...VT..RGRGIPR.......................ERLE.AVAEHYLH--
A7T926_NEMVE/2-249KTGILLLNLGG-PE-KQ..EDVHGFLLR...LF..SDKDLIP...LP.......AQKQLAAWIAKRRTP.KIKEQYQK--
A0NNM3_9RHOB/33-355KVGVLLVNLGT-PD-GTDYWPMRRYLRE...FL..SDKRVIE...WP..RA..IWYPILYGIVLMTRPG.KSGKAYEE--
Q0YS02_9CHLB/6-332KIAVILAAHGE-AE-TNLFTENYRVTRQ...TL.AHASLVMP...IP.........ALLQRTIAVSSSL.KKIIRART--
A6ELJ2_9BACT/3-339KKGVLLVNLGS-PD-STKPKDVKKYLDE...FL..MDPRVID...VP..RW..ARILLVRGIILNTRPK.QSAAAYAK--
HEMH_PSEPW/3-337DHALLLVNLGS-PA-STSVADVRRYLNQ...FL..MDPYVVD...LP..WP..VRRLLVSLILIK.RPE.QSAHAYAS--
A1SXP1_PSYIN/19-339KTGILLTNLGS-PD-AATAKALRIYLRE...FL..SDRRIVE...IP..RL..LWMMILHGIILRTRPK.RSAKLYES--
Q0G0T3_9RHIZ/27-348KVGVLLVNLGT-PD-GTEFKPMRRYLKE...FL..SDSRVIE...WP..KI..AWYPILYGIVLNTRPK.KSGAAYAE--
A4A641_9GAMM/16-336SIGVLVTNLGT-PQ-APEKSALRPYLKQ...FL..SDPRVVE...VP..RL..LWWFILNGIILNVRPA.RSAEAYKT--
A6GNF2_9BURK/14-338KTAVLLVNLGT-PD-NADTPSLRRYLKE...FL..SDPRVVE...IP..KL..VWWIILNCIILQIRPK.KSAAKYAT--
A3ZL09_9PLAN/3-305YDALLVQSFGG-PE-GP..DDVIPFLEN...VL..RGKNVPR.......................ERLL.EVAEHYQH--
Q5KFH8_CRYNJ/49-370PTAVLMMNMGG-PS-TV..PEVHDFLSR...LF..HDNDLIP...LP.......FQPLLAPLIAKRRTP.SIEEQYSA--
Q47NJ1_THEFY/4-317YDAFLLISFGG-PE-KR..EDVIPFLEN...VT..RGRGIPR.......................ERLA.EVGEHYYL--
A6EVP6_9ALTE/16-336KTGVLITNLGT-PD-APTTSALRRYLGE...FL..WDPRVVE...VP..RP..IWWLILHGVILRLRPS.RSAKAYAG--
Q3SU51_NITWN/22-343RVGVLLVNLGT-PD-TADARGVRVYLKE...FL..SDPRVIE...KQ..SL..GWKLVLNGIILNTRPR.RKALDYLK--
Q6AB01_PROAC/16-329YSAVLVVSFGG-PR-SP..EEVMPFLRR...VS..HGR.IPE.......................ERLA.DVARHYDR--
HEMH_ZYMMO/13-326KIGVLLVNLGT-PD-APNAKALRRYLGQ...FL..SDQRVIE...LP..AV..FWQIILRGIILPFRAP.RSARAYQK--
HEMH_WOLSU/2-314KKAVILLNMGG-PS-SL..LEVDMFLKN...MF..NDPRILP...IK..SP..FFRSLVASFIANRRSE.TAKANYRK--
A6VPL9_ACTSZ/8-324KLGVLLINLGT-PD-EPTPKAISRYLEQ...FL..TDPRIID...LA..RW..KWLPLLKGIILPSRSR.RISHNYQS--
Q2Y6A8_NITMU/15-335RTGVLLINLGT-PD-APTPEALRPYLKQ...FL..SNPRVIE...LP..QW..LWWPILNGIILNTRPK.KSAEKYAQ--
Q26GH9_FLABB/2-337KKGVLMVNLGS-PD-SPSPKDVKKYLDE...FL..MDERVID...LP..YI..LRAILVKGIILNTRPK.KSAEAYGK--
HEMH_RALPJ/16-344RTAILLVNLGT-PD-GTSPREVGRYLRQ...FL..SDPRVVE...IP..RA..VWWFILNVLIVPLRSR.ASAHKYES--
HEMH_THICR/16-340AVGVLITNLGT-PD-APTKEALRPYLKE...FL..MDPRVVE...PPPARW..LWKLILNLIILNTRPA.KSAEAYQE--
A4X999_SALTO/20-328YDAMVLVSFGG-PE-RP..EDVMPFLQN...VT..RGRGVPP.......................ERLA.EVAEHYQH--
HEMH_PSEA6/16-336KIGVLITNLGT-PE-APEKGALKRYLRE...FL..SDTRVVE...VP..KL..IWWMILNLVILNIRPK.RSAHAYST--
HEMH_CHLAB/4-308T..YLLANFGG-PR-HS..HDVEVFLTS...LL..TDRDVTGGCLPS......FLHKRLFSFIAKKRAP.KVVPQYNC--
A3TKF4_9MICO/13-330YDAVLLLSFGG-PE-AP..DEVVPFLRR...VT..AGRDVPE.......................ERLE.EVAKHYHH--
HEMH_CHRVO/19-339KTGVLLINLGT-PD-APTAQALRPYLKQ...FL..SDPRVIE...IP..RL..PWWLILNGIILNTRPK.QSAKKYAS--
HEMH_GEOBB/4-316KTALLLLQMGG-PD-SL..DAVHPFLMN...LF..TDRDIIK...IG..PA..FLQPFIARRIVNKRAP.KVEEYYRQ--
A8L1D5_FRASN/20-328VDALLLVSFGG-PE-GP..EDVLPFLRN...VT..RGRGVPE.......................ARLA.EVAAHYDR--
Q1DC34_MYXXD/7-344KRGLLLVNLGT-PD-APQTGPVRRYLRE...FL..NDPRVID...IH..PL..GRWALLNFIILPMRPA.KSAEAYRK--
A0Z184_9GAMM/16-336LTGVLVTNLGT-PQ-APTAKALRPYLKQ...FL..SDPRVVE...VP..RL..IWWLILNGIILNTRPK.RSAEAYSE--
HEMH_PHOLL/5-320KFGVLLVNLGT-PD-KPTTAAIRRYLAE...FL..SDKRVID...LS..RF..IWKPILYGFVLPFRSS.RVAKLYQK--
A5DAX3_PICGU/50-370GTGVVFMNMGG-PS-KV..KETYDFLLR...LF..SDGDLIP...FG......IFQKPLAKFIAKRRTP.SIEKNYQD--
Q2VYH0_MAGSA/8-320KTAVVLFNLGG-PD-SL..DAVKPFLFN...LF..NDPAIIG...AP...A..LIRWLLAKYISAKRAP.TARGIYQM--
A3EV75_9BACT/12-335TRGVLLFNLGG-PE-TL..EDVYPFLLN...LF..SDPDIFR...VP...R..LIQPLLARIIARRRAP.KSREYYRQ--
B1YKJ8_EXIS2/3-305TLGLLVMAYGT-PY-KP..EDIERYYTH...IR.........................RGRKPSPEALA.ELTERYEA--
A6F7X3_9GAMM/3-322KQSILLVNLGT-PE-SATPAGVKAFLKP...FL..SDPRVVS...IP..RL..FWLPLLNGVILPLRCK.RVAKAYQS--
A0YYR5_LYNSP/3-322RVGVLLLNLGG-PE-QL..EDVRPFLYN...LF..SDPEIIR...LP..FR..WLQKPLAWLISTLRYT.KSQENYKA--
HEMH_THEVO/2-285KTAVLLLSYGS-PE-KM..SDIDEYLSK...IF..GGKPVPK........................GVAEENYRKYEM--
Q1V1A3_PELUQ/2-316KKAVILFNLGG-PD-KI..ENVEPFLFN...LF..NDPAILN...LP...T..ILRYPLAKLISNRRAP.VAKKIYKE--
Q2GCY1_NEOSM/3-304KVAVVLLNLGG-PD-SL..DAVRPFLFN...LF..CDRRIIN...LP...N..PFRFCLAWWISRKRFR.EACKIYSK--
Q7QG25_ANOGA/28-351RTAVVMLNMGG-PQ-NT..DQVHDYLHR...IM..TDRDMIQ...LP.......VQSKLGPWIAKRRTP.EVQKKYSE--
Q118M8_TRIEI/24-354RVAVLLMGYGE-VE-SY..EDFANYNEQALNLL..TAKFAPV.......PT..WIYPPLAKLLAIFDLH.EWSHQHGN--
Q1NVN4_9DELT/7-321RIGVVLLNMGG-PE-KL..DEVEPFLRN...LF..NDREIIRLGPFP......WLQKLIAGRIVKKRAP.KSREAYRR--
HEMH_CHLPN/3-309TPAYLLANFGG-PR-HA..KDLQEFLIS...LL..TDRDVTGT.FLP...R..VLHRHLFTFIAKKRVP.KVLPQYQS--
HEMH_ACIAD/8-328KVTVILANLGT-PD-VPTASAVRAFLKQ...FL..SDQRVIE...IP..KL..LWKIILYSFVLPFRPK.RVAHAYAS--
B3E8G1_GEOLS/3-313DTAIILLQMGG-PD-SL..EAVRPFLLN...LF..SDREIIK...IG..PA..WLQPLIARMIVRRRTP.AVMEKYRE--
HEMH_AQUAE/2-309KKGVILINLGG-PD-SL..EAVEPFLYN...LF..SDPDIFS...LP.......FQKVLAKIIAKLRAK.KTRHYYEL--
B4SCY0_PELPB/6-328KIAVILAAHGE-AE-TTRFIENYRVASH...TL.AHAALVMP...IP.........KPLQRAIALTSSL.KKKLRATA--
A4ETD1_9RHOB/25-348KTGVLLANLGT-PD-DYSYWPMRRYLSE...FL..SDKRVID...YP..AW..KWQPLLQLIILTKRPF.ASGAAYKS--
HEMH_THEAC/2-283KSALLLLSYGS-PE-RI..EDLDEYLKN...IF..NGKPVPE........................SVREENLRKYEM--
HEMH_CHLMU/1-303MTVYLLANFGG-PR-IS..QEIPSFLHA...LL..TDQDVTGGRIPP......WLHRPLFSYIAKRRAH.RVAEQYAY--
A2VI04_MYCTU/3-299FDAVLLLSFGG-PE-GP..EQVRPFLEN...VT..RGRGVPA.......................ERLD.AVAEHYLH--
HEMH_GLUOX/17-337RTGILLINLGT-PD-DTGYFSVRRYLSE...FL..SDRRVIE...SP..PL..IWQPILQSIILTKRPF.ASGANYAR--
HEMH_HERAR/16-335KTAVLLVNLGT-PD-APTTSAVRTYLNE...FL..SDPRVVE...IP..RV..IWWFILKLIILPFRSG.KSAKKYAA--
HEMH_DICDI/45-386KTGILMLNLGG-PS-KL..EEVEPFLTR...LF..TDKEIFK...LP.......FQKYTGTLIAKRRSN.AVMKLYEA--
Q65DD6_BACLD/5-307KVGLLVMAYGT-PY-QE..EDIIPYYTH...IR.........................HGKRPSDDMIE.DLKKRYKH--
A0L8B7_MAGSM/5-325ETAILLVQLGT-PD-QPTEEAVRRYLRQ...FL..SDRRVVD...MN..RL..LWWPLLHGIILRSRPS.KSAKLYKK--
HEMH_CAMC1/2-313KKALLLLNMGG-AN-SL..DDVEIFLTN...MF..NDPYILG...IK..NK..FLRKFVAFMITKGRLK.TAKHNYEQ--
Q5PA48_ANAMM/8-324KVAVVLLNLGG-PG-SL..CEVEKFLFS...LF..SDRRILG...LP...Y..PLRMLVAMIISKLRAR.SARKIYSL--
Q2GL73_ANAPZ/4-320KIAVVLFNLGG-PA-SL..REVESFLFN...MF..NDSHIVS...AP...R..PFRYFLAKAISKLRAR.SSREIYTL--
HEMH_STRM5/6-319DTAVLAVNLGT-PE-TPTAPAVRRYLAE...FL..SDPRVVS...IP..AL..LWQPLLRGLILPLRSS.RSAAKYAQ--
A7A2C1_YEAS7/38-357PTGIVLMNMGG-PS-KV..EETYDFLYQ...LF..ADNDLIP...IS.....AKYQKTIAKYIAKFRTP.KIEKQYRE--
Q0F558_9RHOB/16-336KIGVLISNLGT-PE-APTKQALKPYLKQ...FL..SDPRVVE...VP..KL..IWWCILNLIILNIRPK.RSAEAYAT--
A4U0X7_9PROT/2-312KTAIILFNLGG-PG-SL..EAVKPFLFN...LF..NDKAIIG...AP...N..PIRWLLAKYISAKRAP.IAREIYRQ--
HEMH_PELPD/5-317RTAVLLLQMGG-PD-SI..EAVEPFLRN...LF..SDRDIIR...IG..PA..FLQPLIARLIARRRSK.RVAEQYRQ--
HEMH_STRP2/2-294KKAILMMTFGS-PE-EITFEGVADFFTN...IR.........................RGVRPQDHEIQ.TLYDNYVR--
A4SLY2_AERS4/4-323KTGILLVNLGT-PA-APTTAAVKAFLSQ...FL..HDPRVVD...LP..RY..LWCPLLHFIILPTRSP.RVAKLYQQ--
HEMH_SYNSC/3-326RVGVVLLNLGG-PE-RI..QDVGPFLYN...LF..ADPEIIR...LP..SP..ALQKPLAWLISTLRSG.KSQEAYRS--
Q0AKE0_MARMM/7-318KLAVVLFNLGG-PD-GQ..ESVQPFLRN...LF..RDPAIIQ...AP...G..LIREALAWFISTTRAK.EAKANYAK--
Q0AHZ2_NITEC/18-338RVGVLLINLGT-PD-APNAKSLRTYLRQ...FL..SEPRIVE...FP..RW..LWWLILNGIILNIRPG.KSAKKYAQ--
A1SKT0_NOCSJ/8-323YDAVLLVSFGG-PE-RP..EDVVPFLEN...VT..RGRGIPR.......................ERLE.EVGQHYYE--
B4S8P2_PROA2/4-319RIAVILAAHGE-AE-TAGFFDNFSMNRH...TL.AHAGEVMN...LP.........AALQLMIAVAGGA.KNMVQFRK--
HEMH_HYPNA/4-317RIAVVLFNLGG-PD-TG..NDVQPFLKN...LF..RDPAIIR...AP...L..PVRWLVARLISTLRAP.VVKQNYAM--
A5EXB1_DICNV/10-330RGGVLLVNLGS-PK-SSNTIAVWQYLAQ...FL..SDKRIID...IP..RW..RWLPILYGAILPLRAK.RVAKRYRL--
Q3AEU4_CARHZ/2-291K.AVVLVAFGC-PD-CL..ENIGPFMER...IM..GRT.......PP............PALIAAVRSR......YEK--
HEMH_LEPBI/8-339T..LILVNLGG-PR-TP..SEIEVFLRD...LF..SDPFVFD...LP.LPE..FLRLRLARFIAKKRAP.KVQKSYES--
HEMH_BURXL/16-340RVAVLLINLGT-PD-APTPRAVRRYLAQ...FL..SDPRVVE...IP..AL..LWQIILRLLILPFRGS.ASAKKYAA--
HEMH_ALCBS/16-336KVGVLITNLGT-PD-APETGALRRYLRE...FL..SDPRVVE...IP..RF..IWFFILNLVILVIRPR.KSAEAYKS--
HEMH_MANSM/5-321KTGILLANLGT-PD-TPSPKAISRYLKE...FL..SDPRVVD...LP..RW..KWLPLLNGIILPIRSR.RIAKNYGA--
HEMH_MYCAV/3-298FDAVLLLSFGG-PE-GP..SRFGRSWRTSPGAAACRGTSRPRRRTLP..........AFRRGVADQRHQPRADRAAAG--
HEMH_VIBF1/5-319KTGVLLVNLGT-PT-APTAAAVKQFLSE...FL..HDKRVVD...MN..RF..IWCPLLHGVILPIRAP.KVAKLYES--
Q2RN84_RHORT/3-322RIAVVLFNLGG-PD-SP..EAVRPFLFN...LF..NDPAIIE...GP...S..LTRWVLARLISWRRAP.IAREIYGH--
A5VF70_SPHWW/15-329KVGVLIVNLGT-PD-APTPGAVRRYLGE...FL..SDRRVVE...IP..PI..AWQPILRGIILNVRPR.KSAHAYAQ--
HEMH_SCHPO/32-352PTAVVMMNMGG-PS-NL..DEVGPFLER...LF..TDGDIIP...LG......YFQNSLGKFIAKRRTP.KVQNHYSD--
HEMH_THIDA/16-336CAGVLLVNLGT-PE-APTAAALRPYLKE...FL..SDPRVVE...IP..RA..LWWLVLNGIILNTRPR.KSAEKYAA--
A7HSJ5_PARL1/7-322KVAVVLFNLGG-PD-KP..EAVEPFLFN...LF..IDPAIIR...VP...Q..PFRWLIAKLVSKRRAP.VAKEIYAA--
A7I208_CAMHC/3-312KKAVLLLNMGG-PG-KL..EEVEIFLKN...MF..NDPFILS...IK..SS..FCRKILAFIITFFRKK.KAEENYLQ--
HEMH_PSEAB/3-337ENALLLLNLGS-PD-STRVEDVRRYLDQ...FL..MDPYVVD...LP..WP..LRRLLVSLILIK.RPA.ESAHAYSS--
HEMH_POLSJ/20-339ATAILLCNLGT-PD-APTAPALRRYLAE...FL..SDPRVVE...IP..RP..IWWLILHGIILRLRPK.KSATKYAS--
A3HXU8_9BACT/6-342KTGVLLVNLGT-PD-STATGDVRKYLRE...FL..MDGRVID...IP..AV..SRWMLVNLIIAPFRAP.KSAAEYRK--
Q21PI6_SACD2/17-337KVGVLITNLGT-PD-APTPSALRRYLKE...FL..SDPRVVE...IP..RL..IWLLILHLIILRIRPA.KSAKTYAS--
Q1YSP8_9GAMM/17-337RRGVLLCNLGT-PD-APKTAELRRYLKE...FL..SDPRVVE...VP..RL..LWWMILNLIILRIRPS.RSAKLYAS--
B3EI90_CHLL2/10-337RYAVIIVTYGE-VE-KLTLRNLWPSSRR...ILKVITSQIVK...VP.........KILVYFIADFRST.RHFINWRL--
Q2RZ44_SALRD/6-342TVGVVLLNLGG-PD-GE..ESVEPFLYN...LF..MDPAIIDFSEVVYFQARGRVRQAFSKIISYFRSQ.SVAEDYKE--
Q11PE0_CYTH3/9-344KTAVFLINLGT-PD-SPNTPDVRKYLRQ...FL..MDRRVID...IP..WL..NRWLLINMIIAPFRAP.KSAHEYKK--
HEMH_HELPY/20-333KEAVILLNMGG-PN-SL..YEVGVFLKN...MF..DDPFILT...IK..NN..FMRKMVGKMIVNSRIE.KSKKIYEK--
B4U5Z6_HYDS0/3-310KTAVVLLNMGG-PD-SM..SAIRPFLYN...LF..SDHDIVQ...IP...R..SIQKPVAFLISTFRAK.KTEYYYKI--
HEMH_DESPS/5-316PTGVILLNMGG-PT-QT..KDVRPFLYN...LF..SDREIIP...LG..PR..LMQKPLAWLIAKRRAP.KSAATYER--
HEMH_DEIRA/9-312PLGVLFMAYGG-PE-NL..GEMPGYLAD...IR..........................AGRVTSQAILDEITNNYRL--
HEMH_NOCFA/3-313VEALLLLSFGG-PE-RP..EDVMPFLEN...VT..RGRGVPR.......................ARLE.EVAQHYLH--
A4BNN9_9GAMM/7-327ATGVLLTNLGT-PA-APTPQALRRYLAE...FL..WDHRVVE...LP..RP..LWWLVLNGVILWIRPR.RSAAAYQR--
Q6L0G9_PICTO/3-286R..LILLSYGS-PE-SI..DELGEYLSM...VF..YGNPVPE........................RIYNENRKKYEL--
HEMH_SYMTH/3-318KTAVLLVNLGT-PS-APEPDAVRPYLAE...FL..GDWWVID...KP..RW..QWLPILHGIILRVRPP.RVAKIYQK--
A3WGM8_9SPHN/19-340SIGVLLVNLGT-PD-GPDAGSVKRYLKQ...FL..SDRRVIE...IP..AI..AWQPILRGIILNTRPQ.KSAQAYSK--
Q6C140_YARLI/28-348GTAVVLVNMGG-PS-TV..PETYDFLLR...LF..SDKDLIP...LG......PFQGPLAKFIAWRRTP.VIEKHYGE--
A4SGR5_PROVI/4-322KVAVILAAHGE-AE-TDSFPENFSMIRH...TF.AHAGAVMN...IP.........FPLQLAASVFGGL.KNLVEFRS--
HEMH_STRCO/10-330YDALLLLSFGG-PE-GP..DDVVPFLEN...VT..RGRGIPK.......................ERLK.EVGQHYFL--
A1BDR1_CHLPD/6-328TIAVVLVAHGE-AE-TSGFLENYRVSRH...TL.EHAARVMP...IA.........KPLQTLISLSSSL.KKKIRPGN--
Q8IFR0_PLAFA/26-346KIGILITNLGS-PE-KLTYWSLYKYLSE...FL..TDPRVVK...LN..RF..LWLPILYTFVLPFRSG.KVLSKYKS--
A6DEA9_9PROT/2-294KRAIILHNMGG-AR-NK..DELREFLLN...MF..KDKRILN...SP.......FRKIIAPIIANLRYK.KVWENYKK--
HEMH_LACRD/3-310KNGLLLVNLGS-PD-TPTTPDVKRYLKE...FL..SDRNVIE...MP..PA..LWQPLLRGIILPTRSW.RSATFYRN--
A1F5I4_VIBCL/10-324KLGILLANLGT-PQ-APTSQAVKAFLSQ...FL..HDQRVVD...MS..RW..LWCPLLHGIILPTRSP.KVAKLYQS--
A5PCT0_9SPHN/19-336SVGVLIVNLGT-PD-APEPGPVKRYLAE...FL..SDRRVVE...IP..PI..AWQPILRGIILNTRPK.KSAHAYSQ--
HEMH_LACLS/4-313KKGILLVALGT-PR-SCETEDVREYLKE...FL..GDPLVIQ...KP..RW..LWLPILNGIILKVRPQ.KSAEMYKQ--
HEMH_STRMU/5-319KIGVLLVNLGT-PE-HPTAPAIRKFLKP...FL..ADSRVID...YP..KF..LWKPILYSFILPFRPR.KVKPLYQH--
HEMH_RICCN/4-312RIAIVLFNLGG-PK-NL..KSVKPFLFN...LF..YDKAIIN...LP...N..PLRYIIAKIISITREK.KSQKIYSL--
Q0AAP6_ALHEH/23-343RLGVLVTNLGT-PD-APTTPALRRYLHE...FL..WDPRVVE...AP..RW..IWWLILNGIVLRTRPK.KSAAAYRE--
Q7SA94_NEUCR/50-383GTAMVFLNMGG-PS-TL..DEVGDFLSR...LF..ADADLIP...LG......RLQNYLGPLISKRRTP.KIQKQYGA--
A4SZS0_POLSQ/11-336KTAILLLNLGT-PS-APTPKAVRAYLKE...FL..SDPRVVE...IP..RI..IWWCILNGIILPIRSG.ASAKKYAS--
A6FYS2_9DELT/7-354RTGILLVNLGT-PD-APEAGPVRRYLRE...FL..SDPRVID...IN..PV..ARWLLLNLIILPTRPA.KSAAAYRE--
A3QF47_SHELP/11-331KLGVLLVNLGT-PD-TPTPKDVKQFLKQ...FL..SDPRVVD...LN..PW..IWKPILNGIILNTRPK.AVAKLYES--
A5V0K6_ROSS1/8-309QTGVLVLEYGE-PA-TL..DDIVPYLTA...HYHGHPPSPED...IA.......................YMRERCQR--
Q487H7_COLP3/23-348TTAVLLTNLGS-PD-EPTTSAVRRYLRE...FL..SDTRVVE...IP..RL..IWLLILHGIILRIRPA.KSAKLYQT--
Q02A99_SOLUE/3-300YDAILFVSFGG-PE-KV..ADVIPFLEN...VL..RGRNVPR.......................ERML.QVAEHYYH--
A7BEQ8_9ACTO/4-371YDAIMLLSYGG-PN-GP..DDVLPFMRN...AT..RGRGIPD.......................ERLL.QVAAHYKR--
Q4P8W9_USTMA/429-755PTGVLLMNMGG-PS-TSTHEEVGDFLSR...LF..HDRELIQ...LP.......FQSRLAPLIARRRTP.KIVDQYEK--
HEMH_BORPA/35-354RVGVLLVNLGT-PD-EPTRGAIRRYLGE...FL..SDPRVIE...IP..RY..LWMPILHGLVLAMRPK.KLAPRYAG--
A0LUR9_ACIC1/11-319YDALLIVSFGG-PE-GP..DDVMPFLRD...VT..AGRGVPE.......................ERLA.EVAQHYYH--
A5G1D4_ACICJ/11-329RTAIVLFNLGG-PD-GP..DSIKPFRVN...LF..SDPAIIR...AP...V..FVRFWLARLIARSAQK.KAEEGYAL--
HEMH_NITOC/16-335RIGVLVASLGT-PE-APTASAVRRFLAS...FL..SDPRVVE...LP..RP..LWWLILHGIILRIRPS.PVARLYQS--
Q2S1S2_SALRD/34-360RVGVVLFNLGG-PS-TL..GEVEPFLYR...LL..MDPLLLD...VP.VGG..RMRRWLARSVAYLRAG.TLREHYEL--
HEMH_YERPS/5-320KPGVLMVNLGT-PD-APTSKAIKRYLAE...FL..SDRRVVD...TS..PL..LWWPLLHGVILPLRSP.RVAKLYQS--
A6CG01_9PLAN/5-308YDAIMVVSFGG-PE-GP..DDVIPFLEN...VL..RGKNVPR.......................ERML.EVAEHYQH--
A4SF51_PROVI/10-337RYAVVVVTYGE-VE-KLTLRNLWPSSRR...ILKVITSQIVK...VP.........SFLIYLIADYRSM.KHFINWRW--
HEMH_LISMO/4-307KVGLLVMAYGT-PY-KD..EDIERYYTD...IR.........................HGHKPSEEMIA.DLRGRYHA--
Q4JSM9_CORJK/13-376DSGLLLLSFGG-PE-KA..EDVVPFLEN...VT..RGRGIPR.......................ARLE.KVGEHYFA--
HEMH_PSYCK/8-328RIAVLLVNLGT-PD-EPTAPAVRRYLKQ...FL..SDPRVIE...IP..KF..LWAIILNLFVLPSRPK.RVAEAYAS--
A1W6G8_ACISJ/26-346STAILLCNLGT-PD-APTAPALRRYLAQ...FL..GDPRVVE...IP..RA..LWLPLLYGIILRTRPA.KSAAKYAS--
Q0BPC0_GRABC/29-346KLAVVLFNLGG-PD-SP..AAIRPFLLN...LF..KDPAILR...VP...F..FVRPILARIIAKARVK.PASENYAL--
HEMH_BACSK/5-306KIGLLVMAYGT-PR-KK..EEIEPYYTH...IR.........................HGRKPSEEALA.DLQERYEA--
HEMH_WOLTR/2-340KKAVVLLNLGG-PD-SL..SAVRPFLFN...LF..YDKRIIN...LP...N..PFRFFLAKFISAKREN.NARKIYEQ--
HEMH_OCEIH/5-307KIGLLVMAYGT-PY-KE..EDIEPYYTH...IR.........................HGRKPDPEALQ.DLKERYEA--
HEMH_PROFF/4-311FDALLVAGFGG-PE-SM..AEVPDFLQR...V...SGGHIPP.......................DRLA.EVEHHYAR--
A8H1M0_SHEPA/18-337KTGVLLVNLGT-PD-EPTPSALRRYLAE...FL..ADPRVVE...IP..KL..VWMLILHGIILRVRPA.KSAALYKQ--
Q2GH68_EHRCR/9-323KVAVVLFNLGG-PQ-SL..CEVRPFLFN...LF..YDKNIIN...IS...N..PLRFILATLLSFFRKR.KAIEIYKH--
A5CDS3_ORITB/6-318KIAIVLLNLGG-PD-KI..ESVKQFLFN...LF..YDKHIVQ...LP...N..PFRFLVAKIIASVRNK.SSQKIYNK--
Q01W09_SOLUE/2-280KSAVLLLAHGA-PE-RI..EDVERYLAF...VR..........................GGQVVSPRVLEEVTSRYAA--
HEMH_SYNJB/3-322KSGVLLLNLGG-PE-TQ..ADVQPFLYN...LF..ADPELIR...LP..FP..FLQRAFAWAISTLRAE.KSRRNYAA--
HEMH_DECAR/17-339TTAVVLVNLGT-PD-APTAPALKRYLKE...FL..SDPRVVE...IP..KP..VWWLILNGIILNIRPK.KSAAKYAS--
Q2G302_NOVAD/14-333KVGVLLVNLGT-PD-APDAGAVKRYLKE...FL..SDRRVVE...IP..AL..VWQPILRGIILNTRPR.KSAHAYAQ--
HEMH_BDEBA/3-335KKGLLLINIGS-PK-SYQVNDVKKYLSE...FL..MDEDVIT...LP..YV..LRWPLVNLLIVPRRAP.FSAENYKK--
Q3B6N8_PELLD/15-332RVAVILVAHGE-AE-GAGFFENYSMIRH...TL.DHAAEVMA...LP.........GTVRLVASVVGGM.KNCVAFRV--
HEMH_GEOSL/4-316KTAVLLLQMGG-PD-SL..DAVEPFLLN...LF..SDRDIIR...IG..PA..FLQPFIARLIAKRRSP.GVERKYEE--
HEMH_WIGBR/4-320NIGIIISNVGT-PS-HPNKKSVKKYLSE...FL..SDKRVID...IS..RF..FWIPYLHLYFLPLKSY.KSVNLYKK--
A6QAW0_SULNB/5-315KQALLLLNMGG-PN-TI..EEVELFLRN...MF..ADRNILT...MN...P..VMRKFIANIIISKRLE.DVKENYRL--
A4NSJ5_HAEIF/6-322KIGVLLANLGT-PD-SPTPKSISRYLWQ...FL..TDPRVVD...LP..RC..KWYPLLKAIILPLRSK.RIAKNYQA--
Q2BIY0_9GAMM/6-329KTAVVLVNLGT-PD-KAEKGAVRRYLKE...FL..SDDRVVEGKGLR..RL..LWLSVLNGIILNVRPG.KVAKAYAS--
HEMH_LEIXX/21-347YDAILLAGFGG-PE-GQ..DDVIPFLRN...VT..RGRGILD.......................ERLE.EVAQHYRH--
B3EFT0_CHLL2/12-332RIAVILAAHGE-AE-TSRFAENYRVSRR...TL.EHAAAVMG...VP.........PVLQIGISLFSAL.KKKLNPRR--
HEMH_PARUW/4-338RTGILLVNLGT-PK-TPRPKDVYRYLNE...FL..TDGRVID...LP..WL..KRQLLVRCIIVPFRYK.QSSMLYQK--
HEMH1_BACC1/4-307KIGLLVMAYGT-PY-KE..EDIERYYTH...IR.........................RGRKPSPEMLE.DLTERYRA--
HEMH_SALTI/5-320KTGILLANLGT-PD-APTPEAVKRYLKQ...FL..SDRRVVD...TP..RL..LWWPLLRGVILPLRSP.RVAKLYQS--
HEMH_GLOVI/3-322EVGVLLLNLGG-PD-KQ..EDVRPFLYN...LF..ADPEIIR...IP..VP..PLQKPLAWLISTLRAP.KSRKNYQA--
Q8IFK5_9APIC/26-346KIGILLTNLGS-PA-KPTFWSLYKYLSQ...FL..RDPRVIK...VN..RF..IWFPILYSYVLPFRSR.KSALKYKN--
B7KUA6_METC4/33-352RVGVLLMNLGT-PE-GTSYWPMRRYLKE...FL..SDRRVIE...VP..RL..IWWPLLNLIILTKRPG.PKGRDYAS--
HEMH_ENTFA/3-313RTGILLVNLGT-PK-DSSKTEVRKYLKT...FL..SDRRVIK...IH..PI..IWKPILNGIILNIRPK.KSAKLYQK--
Q1K4G8_DESAC/5-319KKALVLLNMGG-PD-SV..EAVEPFLYQ...LF..SDRDLIQ...LP.LGA..LLQKPFAKMISHFRAK.TVRENYRR--
HEMH_SULDN/3-316KEAIILLNMGG-PN-NL..EEVEVFLTN...MF..NDKNIIT...VK..SS..LLRKLIATLITFSRTE.KSQEIYNQ--
B0T6D4_CAUSK/5-319KIAVVLFNLGG-PD-GP..DAVRPFLFN...LF..RDPAIIG...VP...A..LLRYPLAALIAGTRAK.LAKENYAL--
HEMH_NEIG1/17-332RTAVLLLNLGT-PD-APTAQAVRPYLKS...FL..TDRRIVE...LP..KW..LWYPILHGLVLTFRPK.KSAHAYEK--
Q544X6_MOUSE/67-388KTGILMLNMGG-PE-TL..GEVQDFLQR...LF..LDRDLMT...LP.......IQNKLAPFIAKRRTP.KIQEQYRR--
A3J3F3_9FLAO/2-336K.GVLLVNLGS-PE-SPTAKDVKPYLDE...FL..MDKYVID...VP..FL..LRALLVRGIILQTRPK.KSAEAYAR--
A1ZL88_9BACT/9-355KTGVLIVNLGT-PD-NPKTPAVRRYLRE...FL..MDGRVID...IP..YI..PRFLLVNGIISTFRAP.KSAKEYQK--
HEMH_TROWT/30-349YDAVVLLSFGG-PE-GP..EDVVPFLKK...VT..SGRGVPD.......................ERLY.EVAEHYNH--
HEMH_LACC3/3-312K.GLLIVNLGS-PV-SPETKDVRRYLRE...FL..SDQNVIT...MP..KA..LWQPILRGFILPFRSW.RSATFYKH--
A3UYB0_VIBSP/6-320KQGVLLVNLGT-PD-SATPAGVRRFLSE...FL..HDKRVVN...LT..RW..LWCPILHGVILPIRAP.KVAKLYQS--
A7C270_9GAMM/16-336TTGILLVNLGT-PD-APTPAALRDYLGE...FL..ADPRITE...MP..RW..LWWLILHGIILRVRPR.RSAQKYQK--
Q8GKR2_CORGT/9-320FDALLVLSFGG-PE-GH..EEVRPFLEN...VT..RGRGIPP.......................ERLD.DVAVHYHH--
HEMH_METCA/7-321RTGVLLINLGT-PE-APTPKAVRRYLRE...FL..SDPRVVE...IP..RV..LWWPILNLVVLRTRSR.KSAHAYRT--
HEMH_CAMFF/2-314KKVVILLNMGG-AD-DL..SQVELFLKN...MF..NDPYILG...IK..NR..KIRSVLAWLITKMRLK.SATRNYTE--
Q1NA21_9SPHN/14-328MVGVLLINLGT-PD-APDPVSVRRYLAE...FL..SDRRVVE...IP..PF..LWQPILRGAILTTRPK.KSAHAYQQ--
B3EK40_CHLPB/21-336RIAVILAAHGE-AE-TAGFFDNFSMTRH...TL.AHAGEVMN...LP.........VPLQLMISVAGGL.KNMVKFKK--
HEMH_LEUMM/3-312KKGLLLVNLGT-PD-SPHPDDVKAYLKE...FL..SDTNVIQ...MP..RL..LWQPILRGKILPKRSF.KSAELYQK--
HEMH_LACPL/2-311HPGLLLVNLGS-PA-SPRTKDVKAYLQE...FL..SDPSVIE...MP..AA..LWQPLLRGIILPTRSW.RSATFYQD--
A3UIC5_9RHOB/4-317RIAVVLFNLGG-PD-KP..ENVRPFLRN...LF..RDPAIIG...AP...G..LIREFLAWLISTTRTR.EATENYAK--
A7NKU7_ROSCS/7-309PTGIFLLAYGT-PE-SL..DDVEPYFTH...IR.........................GGRTPSPEAVA.NLRERYRL--
Q6BFD7_PARTE/32-353QTAILMLNLGG-PN-SY..QEISPFLVR...FF..EDTTVIR...IP.........FGLGPYIARLRGPAKINKQYEK--
A1AWG9_RUTMC/9-331KIGILLTNLGT-PD-APTKAALRRFLSE...FL..SDPRVID...PP.NKL..IWWLALNVVILNIRPK.RLAKNYAK--
Q9ATG7_9CHLO/62-386KLGVFLLNMGG-PS-TV..KDVEPFLYN...LF..NDPDIIR...MPPVAN..MFQPIVAKIISSTRAS.KSAKGYES--
HEMH_LEPBJ/4-338R..ILLINLGG-PR-DT..SEIEKFLID...LF..EDPLVFD...LP.LPE..WIRKPLGKWVAKKRAP.KVAQTYKS--
B4S748_PROA2/5-331KYAVVIATYGE-VE-KLTLRNLWPSSRR...IVKVITRQIVK...VP.........KLLIYFIADYRST.RHYIDWRL--
HEMH_AZOSB/17-335RTGILLVNLGT-PV-APTAAALRPYLQQ...FL..SDPRVVE...IP..RA..VWLPLLNGVILNTRPR.KSAAKYAS--
Q00YL8_OSTTA/64-389RVGVLLLNLGG-PE-TL..DDVQPFLYN...LF..ADPDIIR...LPGPVQ..FLQGFLANVLSAQRAP.KSREAYES--
Q0FE11_9RHOB/14-337KIGVILANLGT-PD-ATDYWSMRKYLSQ...FL..SDKRVVD...YS..AW..LWQPLLQGIILTRRPF.SSGEAYRS--
Q1ITV1_KORVE/3-296KNAVLLLAHGS-PE-NV..ADIPEYMKY...VT..G.......................GRGLPESVVK.EVQHRYGL--
A4BAF4_9GAMM/14-332RVGVLLVNLGT-PD-DLSVRSVRRYLRE...FL..SDSRVVE...IP..KP..IWWLILNGIVLNTRPK.KSVAAYAK--
HEMH_BRUA2/27-348KVGVLLVNLGT-PD-GTSYGPMRRYLAE...FL..SDRRVIE...WS..RL..IWYPILYGIVLNTRPR.RSGRLYDR--
Q0YQ48_9CHLB/46-338K..........-..-..............................VP.........TALIYFIADYRST.KHYINWKL--
HEMH_CORDI/12-330VDAILVLSFGG-PE-GQ..QDVIPFLEN...VT..RGRGIPR.......................ERLE.EVAVHYRH--

PF01903

P71751_MYCTU/53-151--------------------------------------------------------------------------------
Q7UNS6_RHOBA/42-150--------------------------------------------------------------------------------
Q82UF1_NITEU/52-144--------------------------------------------------------------------------------
CBIX_METJA/9-138--------------------------------------------------------------------------------
Q7V242_PROMP/174-278--------------------------------------------------------------------------------
CBIX_HALSA/9-130--------------------------------------------------------------------------------
CBIX_HALSA/152-263--------------------------------------------------------------------------------
Q81FY5_BACCR/9-114--------------------------------------------------------------------------------
Q8FM68_COREF/9-112--------------------------------------------------------------------------------
Q8CN68_STAES/9-113--------------------------------------------------------------------------------
CBIX_ARCFU/10-119--------------------------------------------------------------------------------
CBIX_SULTO/9-108--------------------------------------------------------------------------------
Q9X2M7_STACA/9-114--------------------------------------------------------------------------------
Q8TKD6_METAC/3355-3469--------------------------------------------------------------------------------
Q7U7Z1_SYNPX/16-120--------------------------------------------------------------------------------
Q7VCD4_PROMA/148-252--------------------------------------------------------------------------------
P74414_SYNY3/23-131--------------------------------------------------------------------------------
Q8NV21_STAAW/9-113--------------------------------------------------------------------------------
Q8EXP3_LEPIN/11-115--------------------------------------------------------------------------------
Q7V757_PROMM/20-124--------------------------------------------------------------------------------
CBIX_BACME/14-118--------------------------------------------------------------------------------
Q82BN1_STRAW/64-163--------------------------------------------------------------------------------
Q9RZD7_DEIRA/3-101--------------------------------------------------------------------------------
Q96ZL1_SULTO/11-123--------------------------------------------------------------------------------
Q8XWQ5_RALSO/11-116--------------------------------------------------------------------------------
SIRB_BACSU/10-115--------------------------------------------------------------------------------
Q7NDP2_GLOVI/28-133--------------------------------------------------------------------------------
Q7NXQ9_CHRVO/13-118--------------------------------------------------------------------------------
Q81FY5_BACCR/133-233--------------------------------------------------------------------------------
Q7NXQ9_CHRVO/143-247--------------------------------------------------------------------------------
CBIX_METKA/9-134--------------------------------------------------------------------------------
Q7VCD4_PROMA/20-124--------------------------------------------------------------------------------
Q8DJ31_THEEB/165-269--------------------------------------------------------------------------------
Q829K6_STRAW/144-248--------------------------------------------------------------------------------
CBIX_METTH/18-137--------------------------------------------------------------------------------
Q8DHP8_THEEB/20-121--------------------------------------------------------------------------------
Q81E58_BACCR/9-114--------------------------------------------------------------------------------
CBIX_SULSO/9-118--------------------------------------------------------------------------------
Q82L75_STRAW/11-113--------------------------------------------------------------------------------
Q7UNS6_RHOBA/198-298--------------------------------------------------------------------------------
Q8DJ31_THEEB/33-138--------------------------------------------------------------------------------
P74414_SYNY3/149-243--------------------------------------------------------------------------------
Q7U7Z1_SYNPX/145-249--------------------------------------------------------------------------------
Q8YZE1_NOSS1/3-102--------------------------------------------------------------------------------
Q8EXP3_LEPIN/133-237--------------------------------------------------------------------------------
Q9L2E8_STRCO/21-118--------------------------------------------------------------------------------
Q8YZE1_NOSS1/117-213--------------------------------------------------------------------------------
Q7NHF8_GLOVI/27-130--------------------------------------------------------------------------------
Q9KCS3_BACHD/144-248--------------------------------------------------------------------------------
Q82L75_STRAW/135-230--------------------------------------------------------------------------------
SIRB_BACSU/134-236--------------------------------------------------------------------------------
Q9L2E8_STRCO/140-233--------------------------------------------------------------------------------
Q9RS86_DEIRA/9-126--------------------------------------------------------------------------------
Q84JH7_ARATH/89-194--------------------------------------------------------------------------------
CBIX_SYNY3/164-268--------------------------------------------------------------------------------
Q8EQN8_OCEIH/9-114--------------------------------------------------------------------------------
Q7V242_PROMP/46-150--------------------------------------------------------------------------------
Q9RZD7_DEIRA/122-231--------------------------------------------------------------------------------
P95216_MYCTU/123-221--------------------------------------------------------------------------------
Q8ZZB2_PYRAE/8-112--------------------------------------------------------------------------------
Q8NLX3_CORGL/9-112--------------------------------------------------------------------------------
Q93IF7_PROFR/147-251--------------------------------------------------------------------------------
Q8TKD6_METAC/423-539--------------------------------------------------------------------------------
CBIX_BACME/141-245--------------------------------------------------------------------------------
Q82BN1_STRAW/189-282--------------------------------------------------------------------------------
Q93IF7_PROFR/12-121--------------------------------------------------------------------------------
CBIX_SYNY3/32-137--------------------------------------------------------------------------------
CBIX_METMA/12-124--------------------------------------------------------------------------------
Q9KCS3_BACHD/9-115--------------------------------------------------------------------------------
Q8EQN8_OCEIH/134-236--------------------------------------------------------------------------------
P95216_MYCTU/8-105--------------------------------------------------------------------------------
Q829K6_STRAW/13-118--------------------------------------------------------------------------------
Q7NDP2_GLOVI/156-260--------------------------------------------------------------------------------
Q7NHF8_GLOVI/150-253--------------------------------------------------------------------------------
Q8XS58_RALSO/22-127--------------------------------------------------------------------------------
Q97WC4_SULSO/14-126--------------------------------------------------------------------------------

PF06180

Q8Y7R9_LISMO/3-255I..IKKLKTRDN............MHINTPSQALNQLKELGYKEVIIQSLHIISGGEFEKITAQV.........EKFKPD
Q8KFD8_CHLTE/13-299VRNIWSARRRDPQRWLAEGVADEFLNVQGFLGAIGNLQDGNYRTIIVQPTHMYHGEQFEDLKSYVSALQSIRTIKRVWSP
Q8R628_FUSNN/14-265V..LKRLKDRGE............V.FSTPIRVLNSLADQGYEELIVQTSHVIPGIEYENLVREV.........NSFSNK
Q97JB3_CLOAB/3-262I..IKVLKERDK............IIVDTPGMALSRLKREGFEKVIVQPLHIIPGEEYDFVKRVV.........NEYSYD
Q8XL14_CLOPE/3-261I..VRKLKEKHN............MEVLFPEDALKKLGEEGYEEVIVQPLHIIPGEEFDYIKHMV.........KEYEPC
Q57MX2_SALCH/3-257I..IRKLRQRDG............IDIDTPLQALQKLAAQGYQDVAIQSLHIINGDEYEKIVREV.........QLLRPL
Q9RMI6_PORGN/31-292I..RKKLAQQ.G............IYIDAPDEALEKLARLGYKKINVQSLHVIPGREYDEMIDFV.........NKFKAA
Q97LH8_CLOAB/3-263I..IEKIKETEG............IDFDTPQKALHKFKNKAYREVIIQPIYMIPGYEYEKLIGTV.........DKYLKD

PF00762

HEMH_COXBU/19-351--------------------------------------------------------------------------------
HEMH_RHIEC/19-340--------------------------------------------------------------------------------
HEMH_CAUCR/4-317--------------------------------------------------------------------------------
HEMH_METFK/17-337--------------------------------------------------------------------------------
HEMH_FRATW/10-329--------------------------------------------------------------------------------
HEMH_RHOBA/7-309--------------------------------------------------------------------------------
A7JUM6_PASHA/6-320--------------------------------------------------------------------------------
Q3A6H8_PELCD/15-332--------------------------------------------------------------------------------
A0JYM7_ARTS2/30-358--------------------------------------------------------------------------------
A7GM50_BACCN/4-305--------------------------------------------------------------------------------
Q1N3F6_9GAMM/5-324--------------------------------------------------------------------------------
Q2IPY0_ANADE/3-312--------------------------------------------------------------------------------
HEMH_LEGPC/2-331--------------------------------------------------------------------------------
A3I3M0_9BACI/5-305--------------------------------------------------------------------------------
HEMH_STAAN/4-307--------------------------------------------------------------------------------
Q1GQW0_SPHAL/14-327--------------------------------------------------------------------------------
A6W899_KINRD/11-329--------------------------------------------------------------------------------
A7T926_NEMVE/2-249--------------------------------------------------------------------------------
A0NNM3_9RHOB/33-355--------------------------------------------------------------------------------
Q0YS02_9CHLB/6-332--------------------------------------------------------------------------------
A6ELJ2_9BACT/3-339--------------------------------------------------------------------------------
HEMH_PSEPW/3-337--------------------------------------------------------------------------------
A1SXP1_PSYIN/19-339--------------------------------------------------------------------------------
Q0G0T3_9RHIZ/27-348--------------------------------------------------------------------------------
A4A641_9GAMM/16-336--------------------------------------------------------------------------------
A6GNF2_9BURK/14-338--------------------------------------------------------------------------------
A3ZL09_9PLAN/3-305--------------------------------------------------------------------------------
Q5KFH8_CRYNJ/49-370--------------------------------------------------------------------------------
Q47NJ1_THEFY/4-317--------------------------------------------------------------------------------
A6EVP6_9ALTE/16-336--------------------------------------------------------------------------------
Q3SU51_NITWN/22-343--------------------------------------------------------------------------------
Q6AB01_PROAC/16-329--------------------------------------------------------------------------------
HEMH_ZYMMO/13-326--------------------------------------------------------------------------------
HEMH_WOLSU/2-314--------------------------------------------------------------------------------
A6VPL9_ACTSZ/8-324--------------------------------------------------------------------------------
Q2Y6A8_NITMU/15-335--------------------------------------------------------------------------------
Q26GH9_FLABB/2-337--------------------------------------------------------------------------------
HEMH_RALPJ/16-344--------------------------------------------------------------------------------
HEMH_THICR/16-340--------------------------------------------------------------------------------
A4X999_SALTO/20-328--------------------------------------------------------------------------------
HEMH_PSEA6/16-336--------------------------------------------------------------------------------
HEMH_CHLAB/4-308--------------------------------------------------------------------------------
A3TKF4_9MICO/13-330--------------------------------------------------------------------------------
HEMH_CHRVO/19-339--------------------------------------------------------------------------------
HEMH_GEOBB/4-316--------------------------------------------------------------------------------
A8L1D5_FRASN/20-328--------------------------------------------------------------------------------
Q1DC34_MYXXD/7-344--------------------------------------------------------------------------------
A0Z184_9GAMM/16-336--------------------------------------------------------------------------------
HEMH_PHOLL/5-320--------------------------------------------------------------------------------
A5DAX3_PICGU/50-370--------------------------------------------------------------------------------
Q2VYH0_MAGSA/8-320--------------------------------------------------------------------------------
A3EV75_9BACT/12-335--------------------------------------------------------------------------------
B1YKJ8_EXIS2/3-305--------------------------------------------------------------------------------
A6F7X3_9GAMM/3-322--------------------------------------------------------------------------------
A0YYR5_LYNSP/3-322--------------------------------------------------------------------------------
HEMH_THEVO/2-285--------------------------------------------------------------------------------
Q1V1A3_PELUQ/2-316--------------------------------------------------------------------------------
Q2GCY1_NEOSM/3-304--------------------------------------------------------------------------------
Q7QG25_ANOGA/28-351--------------------------------------------------------------------------------
Q118M8_TRIEI/24-354--------------------------------------------------------------------------------
Q1NVN4_9DELT/7-321--------------------------------------------------------------------------------
HEMH_CHLPN/3-309--------------------------------------------------------------------------------
HEMH_ACIAD/8-328--------------------------------------------------------------------------------
B3E8G1_GEOLS/3-313--------------------------------------------------------------------------------
HEMH_AQUAE/2-309--------------------------------------------------------------------------------
B4SCY0_PELPB/6-328--------------------------------------------------------------------------------
A4ETD1_9RHOB/25-348--------------------------------------------------------------------------------
HEMH_THEAC/2-283--------------------------------------------------------------------------------
HEMH_CHLMU/1-303--------------------------------------------------------------------------------
A2VI04_MYCTU/3-299--------------------------------------------------------------------------------
HEMH_GLUOX/17-337--------------------------------------------------------------------------------
HEMH_HERAR/16-335--------------------------------------------------------------------------------
HEMH_DICDI/45-386--------------------------------------------------------------------------------
Q65DD6_BACLD/5-307--------------------------------------------------------------------------------
A0L8B7_MAGSM/5-325--------------------------------------------------------------------------------
HEMH_CAMC1/2-313--------------------------------------------------------------------------------
Q5PA48_ANAMM/8-324--------------------------------------------------------------------------------
Q2GL73_ANAPZ/4-320--------------------------------------------------------------------------------
HEMH_STRM5/6-319--------------------------------------------------------------------------------
A7A2C1_YEAS7/38-357--------------------------------------------------------------------------------
Q0F558_9RHOB/16-336--------------------------------------------------------------------------------
A4U0X7_9PROT/2-312--------------------------------------------------------------------------------
HEMH_PELPD/5-317--------------------------------------------------------------------------------
HEMH_STRP2/2-294--------------------------------------------------------------------------------
A4SLY2_AERS4/4-323--------------------------------------------------------------------------------
HEMH_SYNSC/3-326--------------------------------------------------------------------------------
Q0AKE0_MARMM/7-318--------------------------------------------------------------------------------
Q0AHZ2_NITEC/18-338--------------------------------------------------------------------------------
A1SKT0_NOCSJ/8-323--------------------------------------------------------------------------------
B4S8P2_PROA2/4-319--------------------------------------------------------------------------------
HEMH_HYPNA/4-317--------------------------------------------------------------------------------
A5EXB1_DICNV/10-330--------------------------------------------------------------------------------
Q3AEU4_CARHZ/2-291--------------------------------------------------------------------------------
HEMH_LEPBI/8-339--------------------------------------------------------------------------------
HEMH_BURXL/16-340--------------------------------------------------------------------------------
HEMH_ALCBS/16-336--------------------------------------------------------------------------------
HEMH_MANSM/5-321--------------------------------------------------------------------------------
HEMH_MYCAV/3-298--------------------------------------------------------------------------------
HEMH_VIBF1/5-319--------------------------------------------------------------------------------
Q2RN84_RHORT/3-322--------------------------------------------------------------------------------
A5VF70_SPHWW/15-329--------------------------------------------------------------------------------
HEMH_SCHPO/32-352--------------------------------------------------------------------------------
HEMH_THIDA/16-336--------------------------------------------------------------------------------
A7HSJ5_PARL1/7-322--------------------------------------------------------------------------------
A7I208_CAMHC/3-312--------------------------------------------------------------------------------
HEMH_PSEAB/3-337--------------------------------------------------------------------------------
HEMH_POLSJ/20-339--------------------------------------------------------------------------------
A3HXU8_9BACT/6-342--------------------------------------------------------------------------------
Q21PI6_SACD2/17-337--------------------------------------------------------------------------------
Q1YSP8_9GAMM/17-337--------------------------------------------------------------------------------
B3EI90_CHLL2/10-337--------------------------------------------------------------------------------
Q2RZ44_SALRD/6-342--------------------------------------------------------------------------------
Q11PE0_CYTH3/9-344--------------------------------------------------------------------------------
HEMH_HELPY/20-333--------------------------------------------------------------------------------
B4U5Z6_HYDS0/3-310--------------------------------------------------------------------------------
HEMH_DESPS/5-316--------------------------------------------------------------------------------
HEMH_DEIRA/9-312--------------------------------------------------------------------------------
HEMH_NOCFA/3-313--------------------------------------------------------------------------------
A4BNN9_9GAMM/7-327--------------------------------------------------------------------------------
Q6L0G9_PICTO/3-286--------------------------------------------------------------------------------
HEMH_SYMTH/3-318--------------------------------------------------------------------------------
A3WGM8_9SPHN/19-340--------------------------------------------------------------------------------
Q6C140_YARLI/28-348--------------------------------------------------------------------------------
A4SGR5_PROVI/4-322--------------------------------------------------------------------------------
HEMH_STRCO/10-330--------------------------------------------------------------------------------
A1BDR1_CHLPD/6-328--------------------------------------------------------------------------------
Q8IFR0_PLAFA/26-346--------------------------------------------------------------------------------
A6DEA9_9PROT/2-294--------------------------------------------------------------------------------
HEMH_LACRD/3-310--------------------------------------------------------------------------------
A1F5I4_VIBCL/10-324--------------------------------------------------------------------------------
A5PCT0_9SPHN/19-336--------------------------------------------------------------------------------
HEMH_LACLS/4-313--------------------------------------------------------------------------------
HEMH_STRMU/5-319--------------------------------------------------------------------------------
HEMH_RICCN/4-312--------------------------------------------------------------------------------
Q0AAP6_ALHEH/23-343--------------------------------------------------------------------------------
Q7SA94_NEUCR/50-383--------------------------------------------------------------------------------
A4SZS0_POLSQ/11-336--------------------------------------------------------------------------------
A6FYS2_9DELT/7-354--------------------------------------------------------------------------------
A3QF47_SHELP/11-331--------------------------------------------------------------------------------
A5V0K6_ROSS1/8-309--------------------------------------------------------------------------------
Q487H7_COLP3/23-348--------------------------------------------------------------------------------
Q02A99_SOLUE/3-300--------------------------------------------------------------------------------
A7BEQ8_9ACTO/4-371--------------------------------------------------------------------------------
Q4P8W9_USTMA/429-755--------------------------------------------------------------------------------
HEMH_BORPA/35-354--------------------------------------------------------------------------------
A0LUR9_ACIC1/11-319--------------------------------------------------------------------------------
A5G1D4_ACICJ/11-329--------------------------------------------------------------------------------
HEMH_NITOC/16-335--------------------------------------------------------------------------------
Q2S1S2_SALRD/34-360--------------------------------------------------------------------------------
HEMH_YERPS/5-320--------------------------------------------------------------------------------
A6CG01_9PLAN/5-308--------------------------------------------------------------------------------
A4SF51_PROVI/10-337--------------------------------------------------------------------------------
HEMH_LISMO/4-307--------------------------------------------------------------------------------
Q4JSM9_CORJK/13-376--------------------------------------------------------------------------------
HEMH_PSYCK/8-328--------------------------------------------------------------------------------
A1W6G8_ACISJ/26-346--------------------------------------------------------------------------------
Q0BPC0_GRABC/29-346--------------------------------------------------------------------------------
HEMH_BACSK/5-306--------------------------------------------------------------------------------
HEMH_WOLTR/2-340--------------------------------------------------------------------------------
HEMH_OCEIH/5-307--------------------------------------------------------------------------------
HEMH_PROFF/4-311--------------------------------------------------------------------------------
A8H1M0_SHEPA/18-337--------------------------------------------------------------------------------
Q2GH68_EHRCR/9-323--------------------------------------------------------------------------------
A5CDS3_ORITB/6-318--------------------------------------------------------------------------------
Q01W09_SOLUE/2-280--------------------------------------------------------------------------------
HEMH_SYNJB/3-322--------------------------------------------------------------------------------
HEMH_DECAR/17-339--------------------------------------------------------------------------------
Q2G302_NOVAD/14-333--------------------------------------------------------------------------------
HEMH_BDEBA/3-335--------------------------------------------------------------------------------
Q3B6N8_PELLD/15-332--------------------------------------------------------------------------------
HEMH_GEOSL/4-316--------------------------------------------------------------------------------
HEMH_WIGBR/4-320--------------------------------------------------------------------------------
A6QAW0_SULNB/5-315--------------------------------------------------------------------------------
A4NSJ5_HAEIF/6-322--------------------------------------------------------------------------------
Q2BIY0_9GAMM/6-329--------------------------------------------------------------------------------
HEMH_LEIXX/21-347--------------------------------------------------------------------------------
B3EFT0_CHLL2/12-332--------------------------------------------------------------------------------
HEMH_PARUW/4-338--------------------------------------------------------------------------------
HEMH1_BACC1/4-307--------------------------------------------------------------------------------
HEMH_SALTI/5-320--------------------------------------------------------------------------------
HEMH_GLOVI/3-322--------------------------------------------------------------------------------
Q8IFK5_9APIC/26-346--------------------------------------------------------------------------------
B7KUA6_METC4/33-352--------------------------------------------------------------------------------
HEMH_ENTFA/3-313--------------------------------------------------------------------------------
Q1K4G8_DESAC/5-319--------------------------------------------------------------------------------
HEMH_SULDN/3-316--------------------------------------------------------------------------------
B0T6D4_CAUSK/5-319--------------------------------------------------------------------------------
HEMH_NEIG1/17-332--------------------------------------------------------------------------------
Q544X6_MOUSE/67-388--------------------------------------------------------------------------------
A3J3F3_9FLAO/2-336--------------------------------------------------------------------------------
A1ZL88_9BACT/9-355--------------------------------------------------------------------------------
HEMH_TROWT/30-349--------------------------------------------------------------------------------
HEMH_LACC3/3-312--------------------------------------------------------------------------------
A3UYB0_VIBSP/6-320--------------------------------------------------------------------------------
A7C270_9GAMM/16-336--------------------------------------------------------------------------------
Q8GKR2_CORGT/9-320--------------------------------------------------------------------------------
HEMH_METCA/7-321--------------------------------------------------------------------------------
HEMH_CAMFF/2-314--------------------------------------------------------------------------------
Q1NA21_9SPHN/14-328--------------------------------------------------------------------------------
B3EK40_CHLPB/21-336--------------------------------------------------------------------------------
HEMH_LEUMM/3-312--------------------------------------------------------------------------------
HEMH_LACPL/2-311--------------------------------------------------------------------------------
A3UIC5_9RHOB/4-317--------------------------------------------------------------------------------
A7NKU7_ROSCS/7-309--------------------------------------------------------------------------------
Q6BFD7_PARTE/32-353--------------------------------------------------------------------------------
A1AWG9_RUTMC/9-331--------------------------------------------------------------------------------
Q9ATG7_9CHLO/62-386--------------------------------------------------------------------------------
HEMH_LEPBJ/4-338--------------------------------------------------------------------------------
B4S748_PROA2/5-331--------------------------------------------------------------------------------
HEMH_AZOSB/17-335--------------------------------------------------------------------------------
Q00YL8_OSTTA/64-389--------------------------------------------------------------------------------
Q0FE11_9RHOB/14-337--------------------------------------------------------------------------------
Q1ITV1_KORVE/3-296--------------------------------------------------------------------------------
A4BAF4_9GAMM/14-332--------------------------------------------------------------------------------
HEMH_BRUA2/27-348--------------------------------------------------------------------------------
Q0YQ48_9CHLB/46-338--------------------------------------------------------------------------------
HEMH_CORDI/12-330--------------------------------------------------------------------------------

PF01903

P71751_MYCTU/53-151--------------------------------------------------------------------------------
Q7UNS6_RHOBA/42-150--------------------------------------------------------------------------------
Q82UF1_NITEU/52-144--------------------------------------------------------------------------------
CBIX_METJA/9-138--------------------------------------------------------------------------------
Q7V242_PROMP/174-278--------------------------------------------------------------------------------
CBIX_HALSA/9-130--------------------------------------------------------------------------------
CBIX_HALSA/152-263--------------------------------------------------------------------------------
Q81FY5_BACCR/9-114--------------------------------------------------------------------------------
Q8FM68_COREF/9-112--------------------------------------------------------------------------------
Q8CN68_STAES/9-113--------------------------------------------------------------------------------
CBIX_ARCFU/10-119--------------------------------------------------------------------------------
CBIX_SULTO/9-108--------------------------------------------------------------------------------
Q9X2M7_STACA/9-114--------------------------------------------------------------------------------
Q8TKD6_METAC/3355-3469--------------------------------------------------------------------------------
Q7U7Z1_SYNPX/16-120--------------------------------------------------------------------------------
Q7VCD4_PROMA/148-252--------------------------------------------------------------------------------
P74414_SYNY3/23-131--------------------------------------------------------------------------------
Q8NV21_STAAW/9-113--------------------------------------------------------------------------------
Q8EXP3_LEPIN/11-115--------------------------------------------------------------------------------
Q7V757_PROMM/20-124--------------------------------------------------------------------------------
CBIX_BACME/14-118--------------------------------------------------------------------------------
Q82BN1_STRAW/64-163--------------------------------------------------------------------------------
Q9RZD7_DEIRA/3-101--------------------------------------------------------------------------------
Q96ZL1_SULTO/11-123--------------------------------------------------------------------------------
Q8XWQ5_RALSO/11-116--------------------------------------------------------------------------------
SIRB_BACSU/10-115--------------------------------------------------------------------------------
Q7NDP2_GLOVI/28-133--------------------------------------------------------------------------------
Q7NXQ9_CHRVO/13-118--------------------------------------------------------------------------------
Q81FY5_BACCR/133-233--------------------------------------------------------------------------------
Q7NXQ9_CHRVO/143-247--------------------------------------------------------------------------------
CBIX_METKA/9-134--------------------------------------------------------------------------------
Q7VCD4_PROMA/20-124--------------------------------------------------------------------------------
Q8DJ31_THEEB/165-269--------------------------------------------------------------------------------
Q829K6_STRAW/144-248--------------------------------------------------------------------------------
CBIX_METTH/18-137--------------------------------------------------------------------------------
Q8DHP8_THEEB/20-121--------------------------------------------------------------------------------
Q81E58_BACCR/9-114--------------------------------------------------------------------------------
CBIX_SULSO/9-118--------------------------------------------------------------------------------
Q82L75_STRAW/11-113--------------------------------------------------------------------------------
Q7UNS6_RHOBA/198-298--------------------------------------------------------------------------------
Q8DJ31_THEEB/33-138--------------------------------------------------------------------------------
P74414_SYNY3/149-243--------------------------------------------------------------------------------
Q7U7Z1_SYNPX/145-249--------------------------------------------------------------------------------
Q8YZE1_NOSS1/3-102--------------------------------------------------------------------------------
Q8EXP3_LEPIN/133-237--------------------------------------------------------------------------------
Q9L2E8_STRCO/21-118--------------------------------------------------------------------------------
Q8YZE1_NOSS1/117-213--------------------------------------------------------------------------------
Q7NHF8_GLOVI/27-130--------------------------------------------------------------------------------
Q9KCS3_BACHD/144-248--------------------------------------------------------------------------------
Q82L75_STRAW/135-230--------------------------------------------------------------------------------
SIRB_BACSU/134-236--------------------------------------------------------------------------------
Q9L2E8_STRCO/140-233--------------------------------------------------------------------------------
Q9RS86_DEIRA/9-126--------------------------------------------------------------------------------
Q84JH7_ARATH/89-194--------------------------------------------------------------------------------
CBIX_SYNY3/164-268--------------------------------------------------------------------------------
Q8EQN8_OCEIH/9-114--------------------------------------------------------------------------------
Q7V242_PROMP/46-150--------------------------------------------------------------------------------
Q9RZD7_DEIRA/122-231--------------------------------------------------------------------------------
P95216_MYCTU/123-221--------------------------------------------------------------------------------
Q8ZZB2_PYRAE/8-112--------------------------------------------------------------------------------
Q8NLX3_CORGL/9-112--------------------------------------------------------------------------------
Q93IF7_PROFR/147-251--------------------------------------------------------------------------------
Q8TKD6_METAC/423-539--------------------------------------------------------------------------------
CBIX_BACME/141-245--------------------------------------------------------------------------------
Q82BN1_STRAW/189-282--------------------------------------------------------------------------------
Q93IF7_PROFR/12-121--------------------------------------------------------------------------------
CBIX_SYNY3/32-137--------------------------------------------------------------------------------
CBIX_METMA/12-124--------------------------------------------------------------------------------
Q9KCS3_BACHD/9-115--------------------------------------------------------------------------------
Q8EQN8_OCEIH/134-236--------------------------------------------------------------------------------
P95216_MYCTU/8-105--------------------------------------------------------------------------------
Q829K6_STRAW/13-118--------------------------------------------------------------------------------
Q7NDP2_GLOVI/156-260--------------------------------------------------------------------------------
Q7NHF8_GLOVI/150-253--------------------------------------------------------------------------------
Q8XS58_RALSO/22-127--------------------------------------------------------------------------------
Q97WC4_SULSO/14-126--------------------------------------------------------------------------------

PF06180

Q8Y7R9_LISMO/3-255FDSI..IVSQPLLD.......SMEDYEKAIEAIRHQMPPLK.EQEALILMGHGSKHHAFSAYACLDHMLLN.E...PIYL
Q8KFD8_CHLTE/13-299FEKV..VLSRPALGTCGVEHDYTEDIKEVAALFDDDVERARQLDAALVYVAHGNDFFSSGVFRETGDVMRSRYPGAQIHI
Q8R628_FUSNN/14-265FKSV..KIGKPLLYY.......IDDYKKCVKALADEYVPKN.KKEALVLVCHGTDSPLATSYAMIEYVFDE.YGYDNVFV
Q97JB3_CLOAB/3-262FKEI..KLGRPVLYYKGITGEFPDDYEIMVNSIKSIIP....RDEIVILMGHGSTHSSNACYSCLQLVLRD.NDFGNVFV
Q8XL14_CLOPE/3-261FKKI..EIGRPIFHYEGFE.SGPDDYSYFVDTMKDLI....EKNSPCVFVGHGSAHPSNAVYGCLQSVLID.KDYEDVFV
Q57MX2_SALCH/3-257FTRL..TLGVPLLS.......SHNDYVQLMQALRQQMPSLR.QTEKVVFMGHGASHHAFAAYACLDHMMTA.QRFP.ARV
Q9RMI6_PORGN/31-292HSDITVKVGRPLFDT.......DEDMREVAEILHKRFQQTIEKGEAIVFMGHGTEHAANDRYARINKIMKN.YS.KFMIV
Q97LH8_CLOAB/3-263FERL..KIGRPVLYFKGNNKNEPNDYEIFLEKIKDMIP....KDKITVFMCHGTMHESNEYYLKLDSFIKK.HGFTSVVI

PF00762

HEMH_COXBU/19-351-------------IWMP..E....GSPLLVYSEMLRERVGETLGD............................D.FCVAL
HEMH_RHIEC/19-340-------------IWNKEKN....ESYLRTYTRNQAELMAKRLH.DL........................AN..VKVDW
HEMH_CAUCR/4-317-------------M..G..G....GSPLLPETEKQARALEAALALAMP......................GVE..AKCFI
HEMH_METFK/17-337-------------IWDK..E....GPPLMVNSQKQARLLEGYLHEAIS.......................SP..YAVEL
HEMH_FRATW/10-329-------------VWNKQHN....KSPLLFYTENLADKLDKKLD............................N..YIVDY
HEMH_RHOBA/7-309-------------F..G..G....VSPINEQNRQLIAALQKRFDANG........................ID..LPIYW
A7JUM6_PASHA/6-320-------------VWSE..E....GSPLLAISRQQQRAVQRYFDAKG........................KN..VVVEL
Q3A6H8_PELCD/15-332-------------I..G..G....ASPLRIWTECQTRAIGRLLGEE.............................WRTAV
A0JYM7_ARTS2/30-358-------------N..G..G....ISPINQQNRELKAGIEAELSARG........................IN..LPVFW
A7GM50_BACCN/4-305-------------I..G..G....ISPLAKITKEQARQLTASLNEKFT......................DYE..FVCYL
Q1N3F6_9GAMM/5-324-------------IWTE..D....GSPLMAISKRQQRALQDALDQQG........................LD..IPVEL
Q2IPY0_ANADE/3-312-------------I..G..G....KSPLVEGTEAQARALQAALGPG.............................YSCHL
HEMH_LEGPC/2-331-------------IWTE..K....GSPLLYHSQNLVTKLQSAL.KD..........................E..YKIAL
A3I3M0_9BACI/5-305-------------I..G..G....LSPLAAATQAQAEALCARLNEVQD......................AVE..YKLFI
HEMH_STAAN/4-307-------------I..G..G....LSPLAGTTDDQADALVSALNKAYA......................DVE..FKLYL
Q1GQW0_SPHAL/14-327-------------VWTG..D....GSPLAAITRAQAAALQGALGE...........................G..VAVAY
A6W899_KINRD/11-329-------------F..G..G....RSPINDQNKELLAQLRVELDARGL.......................AG..LPLLW
A7T926_NEMVE/2-249-------------I..G..G....GSPIKMWTEKQGQGMVELLDQLSPE.....................TAP..HKFYV
A0NNM3_9RHOB/33-355-------------IWNKEKD....ESPLRTITRSQSDKLTEMMGDSD........................GR..LKIDW
Q0YS02_9CHLB/6-332-------------D..P..R....CSPQNRITRDQAAALQHYLDISAFQ....................DLPD..FEVHA
A6ELJ2_9BACT/3-339-------------IWWE..E....GSPLIVLSERLQKKVQSKL.............................N..IPVGL
HEMH_PSEPW/3-337-------------IWWD..E....GSPLVVLTRRLQAAMVEHW..P..........................H..GPVEI
A1SXP1_PSYIN/19-339-------------VWTK..D....GSPLTHMTRVQSDKLSAFLKEKGY.......................EN..TEVVM
Q0G0T3_9RHIZ/27-348-------------IWNNEMN....ESPLRTFTRSQGEKLKTRMA.MH........................AN..VVVDW
A4A641_9GAMM/16-336-------------VWTD..E....GSPLLIHTRNQALGLQKRLNDEHG.......................GQ..VIVEF
A6GNF2_9BURK/14-338-------------VWTD..E....GSPLMAIGKRQVRVLSEAFKVRR........................WD..VRVEL
A3ZL09_9PLAN/3-305-------------F..G..G....VSPINQQNRDLIAALRVELAAHG........................ID..LPIYW
Q5KFH8_CRYNJ/49-370-------------I..G..G....GSPILKWTQVQGAAMCSLLDELNPK.....................SAP..HKPYV
Q47NJ1_THEFY/4-317-------------F..D..G....VSPINQQCRDLIAALRDDFAANG........................VE..LPIYW
A6EVP6_9ALTE/16-336-------------VWQP..E....GSPLLIHTARQAEAIRKQLQAKHG.......................NN..LLVGF
Q3SU51_NITWN/22-343-------------IWNTELD....ESPLKTITRSQSDKLTAALE.GH........................DH..VVVDW
Q6AB01_PROAC/16-329-------------F..G..G....VSPINDATDVFVNAIGNELRRHG........................VR..VPVLL
HEMH_ZYMMO/13-326-------------IWTN..E....GSPLAAITKKQAQGLQKRMP............................N..ITVDY
HEMH_WOLSU/2-314-------------I..G..G....KSPLIGHTFNLIQKLQSLDPS..............................RFYTY
A6VPL9_ACTSZ/8-324-------------VWTE..Q....GSPLLAYSKGQKTALQARLQTLG........................ID..AQVEI
Q2Y6A8_NITMU/15-335-------------VWMP..E....GSPLKVHTARQTRLLQDFLGKRLH.......................SA..PVVQY
Q26GH9_FLABB/2-337-------------IWWD..E....GSPLIVLSERLQEKIDEFT.............................S..VPIAL
HEMH_RALPJ/16-344-------------IWLR..EANMTGSPLLVYSERQAHALQQLLNAQG........................HD..VVVAC
HEMH_THICR/16-340-------------VWGKYGD....GSPLLDISNRQLMDIEEKVRAHFS.......................GR..VEFAL
A4X999_SALTO/20-328-------------F..G..G....VSPINQQCRDLLAAVRDDFAANG........................VD..LPIYW
HEMH_PSEA6/16-336-------------VWTD..R....GSPLMFHTQDQTNALATSMQQKYG.......................DK..VVVDF
HEMH_CHLAB/4-308-------------I..G..G....YSPIYQDTEALAKTLSSHLDAP...............................VIT
A3TKF4_9MICO/13-330-------------F..G..G....VSPINGQNRELLAALEAELVRRG........................SA..VPVLW
HEMH_CHRVO/19-339-------------IWTK..E....GSPLLLHTRSQAKLLKGQLGEMGL.......................HN..LAVDY
HEMH_GEOBB/4-316-------------I..G..G....KSPIRELTEAQGEGLQQLLGED.............................FRSFV
A8L1D5_FRASN/20-328-------------F..G..G....RSPINDQNRALLAALRERLAP..............................MPVYW
Q1DC34_MYXXD/7-344-------------IWMK..E....GSPLLVYSQALAAQVAERL.AG..........................E..YEVVL
A0Z184_9GAMM/16-336-------------VWTD..R....GSPLLYHLMDQVSGIEERLKSRVG.......................DH..VMVRG
HEMH_PHOLL/5-320-------------IWTD..E....GSPLLVYGRRQQKLLAERLA............................G..IPVEL
A5DAX3_PICGU/50-370-------------I..G..G....GSPIRYWSEYQCKKVCEILDKNRPQ.....................SAP..HKPYV
Q2VYH0_MAGSA/8-320-------------L..G..G....RSPLVPETEAQGRALEHVLGHG.............................FRCFI
A3EV75_9BACT/12-335-------------I..G..G....GSPLRKITDDQARLLEETLNREET......................NVH..WKVRV
B1YKJ8_EXIS2/3-305-------------I..G..G....VSPLAQVTIDQAEELHRQLTEKYAG.....................EIE..FKLYL
A6F7X3_9GAMM/3-322-------------IWFD..D....GSPLLHYSLLQQKALSSLFEEAG........................QN..VNVEL
A0YYR5_LYNSP/3-322-------------I..G..G....GSPLRRITEEQAVALQERLTQKG........................HD..VQIYV
HEMH_THEVO/2-285-------------F..G..G....LSPSNRIIQSIRDRLQKRFDQSG.........................D..VDVFT
Q1V1A3_PELUQ/2-316-------------L..G..G....SSPILKLTMEQSKALETKLNQTEI......................DSE..YKCFI
Q2GCY1_NEOSM/3-304-------------M..G..G....KSSILPETNMQAKLLGDLLGPQ.............................YEVFV
Q7QG25_ANOGA/28-351-------------I..G..G....GSPILKWTNVQGELMCKQLDKLSPE.....................TAP..HKHYV
Q118M8_TRIEI/24-354-------------F..........ISPHNAIFESQRAGIEKNLQDKWG.......................DR..VKVFK
Q1NVN4_9DELT/7-321-------------I..G..G....GSPLARISAEQGRALADRLNGKED.......................GV..HMVRC
HEMH_CHLPN/3-309-------------L..Q..N....WSPIYFDTETLAKTLSEILRAP...............................VIP
HEMH_ACIAD/8-328-------------VWGQ.......DSPMREILFAQTDALKRQLISHYP......................QLD..LNIVP
B3E8G1_GEOLS/3-313-------------I..G..G....RSPIQELTRAQADTLAAKLG...............................IPCHV
HEMH_AQUAE/2-309-------------M..G..G....KSPQYEQTLEQAKALQERLGED.............................YKVVV
B4SCY0_PELPB/6-328-------------D..T..Q....ASPQNSITRDQAAALQRQLNHSPAA....................ALFD..FEVHA
A4ETD1_9RHOB/25-348-------------IWNHDKG....ESPLMTITRDQTAKMAGVMAQRYG.......................DQ..VMVDF
HEMH_THEAC/2-283-------------F..G..G....RSPSNRIIESIARKLHEKIGDD.............................MDVIL
HEMH_CHLMU/1-303-------------L..G..G....RSPIFQDTEKLAQNLSQELQAP...............................VIS
A2VI04_MYCTU/3-299-------------F..G..G....VSPINGINRTLIAELEAQQE...............................LPVYF
HEMH_GLUOX/17-337-------------IWHKEEN....ASPLRVYTRRQAEGLAERLRAD..........................G..VPVEW
HEMH_HERAR/16-335-------------IWSN..E....GSPLRVHTEKQAKLLTGYLGARG........................HE..VRVEY
HEMH_DICDI/45-386-------------I..G..G....GSPIRKWTEKQGELLSSMMDKISPE.....................TAP..HKHYI
Q65DD6_BACLD/5-307-------------I..G..G....ISPLAKITLAQAKELEKTLNERQD......................KVE..YVMYL
A0L8B7_MAGSM/5-325-------------IWRDDKT.....SPLLHYTRALQQEMARRFQGRHS.......................SG..VRVDF
HEMH_CAMC1/2-313-------------I..G..G....KSPLCELTAKLCEKISSLKSEF.............................DAVDF
Q5PA48_ANAMM/8-324-------------M..G..G....KSTILEETEHQASALEKRLNSSAA......................GKI..YKVFV
Q2GL73_ANAPZ/4-320-------------M..G..G....KSIVEQETAKQAIALEELLNKNAET.....................GCS..YKVFT
HEMH_STRM5/6-319-------------VWLP..D....GSPLMVYTRQLAQAMQALLP............................S..LTVRH
A7A2C1_YEAS7/38-357-------------I..G..G....GSPIRKWSEYQATEVCKILDKTCPE.....................TAP..HKPYV
Q0F558_9RHOB/16-336-------------VWTE..D....GSPLLTHTKNQAAALQAKFDAYSP.......................GK..YIVGY
A4U0X7_9PROT/2-312-------------L..G..G....KSPLLEQTQDQAAALQKLLGND.............................FKVLI
HEMH_PELPD/5-317-------------I..G..G....GSPLRKLTEQQAAELEKVLGEG.............................YRCFV
HEMH_STRP2/2-294-------------I.....G....GTPLQKITRQEVTLVEARLGNE.............................YSVYF
A4SLY2_AERS4/4-323-------------VWTE..Q....GSPLMVISKQQRAALEQELKR.EG.......................VD..VPVEL
HEMH_SYNSC/3-326-------------I..G..G....GSPLRRITEQQARELQSLLRQRG........................ID..ATSYV
Q0AKE0_MARMM/7-318-------------M..G..G....GSPLLPETIRQANMLAEQLGTRWP......................DHD..VRVWT
Q0AHZ2_NITEC/18-338-------------IWTP..E....GSPLKIHTERQTELVAALLKKQLN.......................SV..PIVEY
A1SKT0_NOCSJ/8-323-------------F..G..G....RSPINDQNRAFLAALRDDLAGAG........................LD..LPVYW
B4S8P2_PROA2/4-319-------------K..N..F....RSPQNEITRKQAGLLAEKLARQAE......................EIE..FEVHA
HEMH_HYPNA/4-317-------------MDAG..G....GSPLLRETKKQADALQAELAKKLP......................GDE..VRCFI
A5EXB1_DICNV/10-330-------------IWTE..N....GAPLVDITQQQTQALKILLAKTGH.......................QN..IVVDY
Q3AEU4_CARHZ/2-291-------------I..G..G....KSPLTEITSQQARALKTLLGS...........................E..FLVDF
HEMH_LEPBI/8-339-------------MGFG..G....GSPLVEETAKQAHALELALNERSS.......................EQ..WNVKV
HEMH_BURXL/16-340-------------VWMP..E....GSPLRVYTEKQVEGLRHLLQLND........................YT..VLVDY
HEMH_ALCBS/16-336-------------VWTE..E....GSPLLVYSLAQGEGIRQRLQSKYG.......................DD..VVVRV
HEMH_MANSM/5-321-------------IWTE..Q....GSPLFAITQKQKALLTEFFQQRQ........................QN..VIIEI
HEMH_MYCAV/3-298-------------R..........PEPARLLRQPQLGALRRRHGE...................................
HEMH_VIBF1/5-319-------------VWME..E....GSPLLVYSQRQVKALEARLS...............................MPVAL
Q2RN84_RHORT/3-322-------------L..G..G....RSPLLEQTEGQARALEKALSERG........................HD..ARCLI
A5VF70_SPHWW/15-329-------------VWSE..E....GSPLAAITARQAAALQARFGG...........................R..AIVDH
HEMH_SCHPO/32-352-------------I..G..G....GSPILHWTRIQGSEMCKILDKKCPE.....................SAP..HLPFV
HEMH_THIDA/16-336-------------IWTS..E....GSPLKVHTEKQAKLLKGWLGEHAA.......................AP..VVVDY
A7HSJ5_PARL1/7-322-------------L..G..G....GSPIVPLTRDQGQALEAALAGGE........................SE..FRSFI
A7I208_CAMHC/3-312-------------I..G..G....TSPINALTISLVNKMKALAPNY.............................VCVDF
HEMH_PSEAB/3-337-------------IWWD..E....GSPLIVLSRRLQEAMKPHW..P..........................H..GPVEL
HEMH_POLSJ/20-339-------------IWTP..E....GSPLKVWTQKQALMLRGYLGA.RG.......................HT..VEVRY
A3HXU8_9BACT/6-342-------------LWEG..R....GSPLLFHTVDVTEKLKSKLDSS..........................E..YVVSM
Q21PI6_SACD2/17-337-------------VWTD..Q....GSPLAFHTRDQADKLRQQLQAQHG.......................DN..LVVDY
Q1YSP8_9GAMM/17-337-------------VWSE..G....GSPLMVHCKAQTAGVKKILDEKFN.......................DD..VPVAL
B3EI90_CHLL2/10-337-------------N..G..Y....RSRLLSINRAQTKAVSHCLSESCDPV..................FDVVD..VAVID
Q2RZ44_SALRD/6-342-------------ISDD..G....GSPINPLTRDQADNLEQTLNEQYAAE...................TGAT..FKTYM
Q11PE0_CYTH3/9-344-------------LWTE..Q....GSPLMFHGVAVKELLQQAL.GD..........................E..YKVVL
HEMH_HELPY/20-333-------------L..G..G....KSPLTPITFALTERLNKLDPS..............................RFYTY
B4U5Z6_HYDS0/3-310-------------M..G..G....KSPQKEQTILQKNALQQALGQD.............................YIVEI
HEMH_DESPS/5-316-------------I..G..G....GSPLKQITEAQAEALEKSLQAHG.........................N..FTVTY
HEMH_DEIRA/9-312-------------I..G..G....KSPLPEFTRAQVEATMEQLASTG........................RP..LKAYI
HEMH_NOCFA/3-313-------------F..G..G....VSPINALNRDIIAGVERELDEAG........................ID..LPVYF
A4BNN9_9GAMM/7-327-------------IWTQ..Q....GSPLLTISQQQAARLAERLNEQHS.......................SQ..FKVAL
Q6L0G9_PICTO/3-286-------------Y..N..G....RSPSNDILKCIEEKLKKALREY..........................D..FDVTQ
HEMH_SYMTH/3-318-------------IWLP..E....GSPLLHYSRLQQAALQQRLEPE..........................G..IRVAL
A3WGM8_9SPHN/19-340-------------IWTD..R....GSPLADITARQAEAIADDFGE...........................N..VIVDY
Q6C140_YARLI/28-348-------------I..G..G....GSPIRKWSELQAAEACKKLDTLSPE.....................TAP..HKPYV
A4SGR5_PROVI/4-322-------------S..G..Y....RSPQKHITRMQAERLGDELRRQSPG....................DDTL..YEVSA
HEMH_STRCO/10-330-------------F..G..G....VSPINDQNRALLDALRKDFAEHG........................LD..LPVYW
A1BDR1_CHLPD/6-328-------------S..G..K....GSPQNGITRKQAEVLQNHLDVLSDE....................TDLA..FRVIA
Q8IFR0_PLAFA/26-346-------------IWIK..D....GSPLCVNTHNQCLALKKILNEKYN.......................NK..VVISY
A6DEA9_9PROT/2-294-------------I.....G....GSRIYTITENLCNEMQKYTD...............................YEVVY
HEMH_LACRD/3-310-------------CWTK..D....GSPLIVYTERLVAKVQGLMP............................E..WVVKM
A1F5I4_VIBCL/10-324-------------IWMD..E....GSPLMVYSRRQRDKLAELSQ...............................RPVEL
A5PCT0_9SPHN/19-336-------------VWTE..D....GSPLAVITRQQAEAMQVRLGD...........................G..VTVDW
HEMH_LACLS/4-313-------------IWTD..E....GSPLMSYTIAQTEQLQGLRE............................D..FDVRF
HEMH_STRMU/5-319-------------VWTN..E....GSPLYANAIGQEKALQAHFDQSE........................HG..VLVRA
HEMH_RICCN/4-312-------------I..G..G....KSSLLQETEEQKLALTEKLKQLIK.......................ED..FAIFI
Q0AAP6_ALHEH/23-343-------------VWTE..E....GSPLLIIGRKQTRGILERLQSRLQ.......................GP..VVAEL
Q7SA94_NEUCR/50-383-------------I..G..G....GSPIRKWSEYQCEEMCKILDQISPE.....................TAP..HKPYV
A4SZS0_POLSQ/11-336-------------IWLP..K...LGSPLMHYSRLQAKELGEKFSQQG........................HT..VLVDL
A6FYS2_9DELT/7-354-------------VWTE..A....GSPLLVHGQALTEALRARI..D..........................E..HPIEL
A3QF47_SHELP/11-331-------------IWWP..E....GSPLMVISERQREALSAILKARHG.......................SD..IPVEL
A5V0K6_ROSS1/8-309-------------VWSGTSG....DSAARRLAAALDDELRQRYGSR.............................FQVVL
Q487H7_COLP3/23-348-------------VWQD..D....GAPLISITAAQKEKMATKIKSQYG.......................DN..VIVDF
Q02A99_SOLUE/3-300-------------F..G..G....RSPINDQCRDLIAALR.....PA........................ID..LPIYW
A7BEQ8_9ACTO/4-371-------------F..G..G....VSPINACNQRLIADLSAELARRG........................HD..IPVGW
Q4P8W9_USTMA/429-755-------------I..G..G....GSPILRWTRTQGKAMTELLDELHPE.....................TAP..HKVYV
HEMH_BORPA/35-354-------------IWME..E....GSPLLVYSQRQAAGVRQGLAARG........................VH..AEVEL
A0LUR9_ACIC1/11-319-------------F..G..G....ISPINAQNRALLAAVRADFAATG........................VN..LAVYW
A5G1D4_ACICJ/11-329-------------M..G..G....KSPLLDLTRQQADALESALPG..............................AKCFI
HEMH_NITOC/16-335-------------IWRE..D....GSPLLSFARRVGQSLQAELDSRG........................RS..IEIRL
Q2S1S2_SALRD/34-360-------------I..G..G....ASPVPRLAREQATVLQDHLDARYGGP...................AGVG..VRVYS
HEMH_YERPS/5-320-------------VWME..E....GSPLLVYSRRQQKALAARMP............................D..IPVEL
A6CG01_9PLAN/5-308-------------F..G..G....VSPINEQNRALIRALEQELAEHG........................PQ..LPVYW
A4SF51_PROVI/10-337-------------N..G..Y....ESSLLSTNRAQTKRLRCELESNAATL..................PSGVD..VDVFD
HEMH_LISMO/4-307-------------I..G..G....LSPLAKITEAQAYGLEKALNDSQD......................EVE..FKAYI
Q4JSM9_CORJK/13-376-------------L..G..G....RSPINDQNKQLIRNIEAELARRD........................ID..LPVYF
HEMH_PSYCK/8-328-------------IWDG.......DSPMRNILNAQVEMLDKRLADRAA......................PFR..VSVHA
A1W6G8_ACISJ/26-346-------------IWTE..E....GSPLAVWTAKQAVMLRGWLGE.AG.......................QP..VRVLP
Q0BPC0_GRABC/29-346-------------L..G..G....KSPLLELTQEQARTLEQALPEF..........................E..ARCFI
HEMH_BACSK/5-306-------------I..G..G....TSPLARITDEQANGLAAVLNEQQE......................DIV..FVPYL
HEMH_WOLTR/2-340-------------I..G..G....KSPILENTKMQAEALERELNRSVFCHPSSVTLGPRKENWIPVSRIGMTSKLTKVFI
HEMH_OCEIH/5-307-------------I..G..G....ISPLAKITEEQTKALEKKLNANQD......................QYE..FKAYI
HEMH_PROFF/4-311-------------F..G..G....VSPVNAQHRALAAALGEALVARG........................ID..VPIAN
A8H1M0_SHEPA/18-337-------------VWTE..Q....GSPLMDITRRQAQKLAEHFEKSG........................ED..VSVDF
Q2GH68_EHRCR/9-323-------------L..N..G....QSPILSETKIQASSLEHILNNHNE.......................NQ..YKVFI
A5CDS3_ORITB/6-318-------------I..G..G....KSPILFQTTLQAEALRIKLKNKLL.......................HP..YKIFI
Q01W09_SOLUE/2-280-------------I..G..G....SSPLTLWTRAQAEALETMLG...............................IPVFF
HEMH_SYNJB/3-322-------------I..G..G....GSPLRRITAEQARELQAHLVAEG........................YD..VPVYV
HEMH_DECAR/17-339-------------VWMP..E....GSPLRVHTERQAKLLKGLLGQRG........................HH..LTVTS
Q2G302_NOVAD/14-333-------------VWTD..E....GSPLAAITAAQARALQARLGE...........................S..AIVRH
HEMH_BDEBA/3-335-------------VWMK..E....GSPIAVYTRRFAALLQEEL.KD..........................Q..FVVKV
Q3B6N8_PELLD/15-332-------------S..G..Y....RSPQNRITRQQGALLKEHLRIGCDG....................LHAE..YEVYS
HEMH_GEOSL/4-316-------------I..G..G....KSPIRELTESQARALEDVLGDG.............................YRCFV
HEMH_WIGBR/4-320-------------IWEK..D....GSPLMINSLNQRNYLINKFP............................N..FKIEL
A6QAW0_SULNB/5-315-------------L..G..G....KSPLPELTERLIAKLKTRLD...............................LPVYP
A4NSJ5_HAEIF/6-322-------------IWTE..Q....GSPLLAISRQQKDALQAYLDKQN........................ID..TQVEI
Q2BIY0_9GAMM/6-329-------------IWEE.......DSPMRIILDKQVSELQLVLQSHHG......................EHS..PDVFA
HEMH_LEIXX/21-347-------------F..G..G....VSPINDQNRALKAALEAELASRG........................ID..LPVLW
B3EFT0_CHLL2/12-332-------------......K....GSPHNRISREQARELQNYLGERSGN....................GRIV..FDVHA
HEMH_PARUW/4-338-------------LWTA..E....GSPLLVHGIAVQTKLQMIL.GE..........................S..FQVEL
HEMH1_BACC1/4-307-------------I..G..G....ISPLATITLEQAKKLEKRLNEVQD......................EVE..YHMYL
HEMH_SALTI/5-320-------------IWMD..G....GSPLMVYSREQQQALAARLP............................D..TPVAL
HEMH_GLOVI/3-322-------------I..G..G....GSPLRAITNQQGRVLKKALAARG........................LD..IEVYV
Q8IFK5_9APIC/26-346-------------IWTE..K....GSPLCVNTHNQYLALKKRLFEKYN.......................DK..VEISY
B7KUA6_METC4/33-352-------------IWNNERD....EGPLKTITRGQCEKLQAAMGD...........................S..VVVDW
HEMH_ENTFA/3-313-------------ICTE..N....GFPLLEYTEKQMENLKNICPE..............................VEVTI
Q1K4G8_DESAC/5-319-------------I..G..G....KSPLLHWSRLQAEKTCDKLGED.............................WQAFV
HEMH_SULDN/3-316-------------I..G..G....KSPIVGHTKKLVEKLQNRVGEN.............................IIVDF
B0T6D4_CAUSK/5-319-------------M..G..G....GSPLLPETREQAKALEADLAARFP......................DAE..TRCFI
HEMH_NEIG1/17-332-------------IWFK..E....GSPLEVYTARQAAALAERMP............................D..LIVRH
Q544X6_MOUSE/67-388-------------I..G..G....GSPIKMWTSKQGEGMVKLLDELSPA.....................TAP..HKYYI
A3J3F3_9FLAO/2-336-------------IWTD..E....GSPLIVISKKMHQKVQKLV.............................D..VPVAL
A1ZL88_9BACT/9-355-------------LWTE..E....GSPIKIYGFEVEKLLQEAL.GD..........................N..FIVSL
HEMH_TROWT/30-349-------------F..S..G....ISPINDCNRRLRGALEKELFSRG........................IR..IPVLW
HEMH_LACC3/3-312-------------EWTQ..A....GSPLIAYTQVTRDRLRERLP............................D..WDVQM
A3UYB0_VIBSP/6-320-------------VWMD..E....GSPLLVYSQRQADKLQKKLE...............................MPVAL
A7C270_9GAMM/16-336-------------IWTD..T....GSPLLKISHAQQKALQQAVDTHFT.......................GP..LKIAI
Q8GKR2_CORGT/9-320-------------F..G..G....ISPINALNREIIANVEKELASRN........................RE..LPVYF
HEMH_METCA/7-321-------------IWTE..R....GSPLLAYTQDLRDRLAADGRF..............................AAVEI
HEMH_CAMFF/2-314-------------L..G..G....KSPIGDITRSLIDKLNIKFGNE..........................N..LTFDY
Q1NA21_9SPHN/14-328-------------VWMT..E....GSPLAVHTRATAQALQDAMGG...........................G..VLVDW
B3EK40_CHLPB/21-336-------------K..N..Y....RSPQNRITRKQAALLAEKLAGQAE......................AIR..YDVHA
HEMH_LEUMM/3-312-------------IWRK..D....GSPLMVYAKKQVEQVQQLQPN..............................WIVRC
HEMH_LACPL/2-311-------------SWLP..Q....GSPLIVYSQAICQQVQAALP............................D..WNVRL
A3UIC5_9RHOB/4-317-------------M..G..G....GSPIVPETEKQAQALTAALRERLGA.....................DDE..VRCFL
A7NKU7_ROSCS/7-309-------------V..G..G....RTPLKDLTFAVADRLQARLDAQSP.......................GR..YRVYV
Q6BFD7_PARTE/32-353-------------I..G..G....FSPLFKWTMVQGILMSKPQGSG...............................FLP
A1AWG9_RUTMC/9-331-------------IWNKIGI....GSPLLSITKLQLEGVKKILLEQH........................EN..LVFEM
Q9ATG7_9CHLO/62-386-------------I..G..G....GSPLYPLTKDQGDALQNSLEKRG........................IS..AKMYI
HEMH_LEPBJ/4-338-------------MGFG..G....GSPLVSETSKQANAIAKALEKITG.......................EK..WEGNI
B4S748_PROA2/5-331-------------H..N..Y....ESTLVETNRIQTGLIASRLRKSDHPV..................FSSVD..VEIKE
HEMH_AZOSB/17-335-------------IWTD..E....GSPLAVHTRRQAELIAARFASRD.........................D..VRVDW
Q00YL8_OSTTA/64-389-------------I..G..G....GSPLRAITDAQAEALREAIERRG........................IE..ANTYV
Q0FE11_9RHOB/14-337-------------IWNNELN....ESPLLTTTRLQASAVKKEVKKNYG.......................DD..VIVDF
Q1ITV1_KORVE/3-296-------------I.....G....ISPLRCHTVGQQTGVQRETG...............................VSTYI
A4BAF4_9GAMM/14-332-------------IWRHDDQ....ESPLRYFTRAQSEKLATHWP............................E..LVVDF
HEMH_BRUA2/27-348-------------IWNHENN....ESPLRTYTRAQGEKLAKALSDQP.........................N..VVVDW
Q0YQ48_9CHLB/46-338-------------N..R..Y....RSKLIAINRAQTKTLEAALDRYGSGF..................LAKAD..VRVFD
HEMH_CORDI/12-330-------------F..G..G....ISPLNALNREIIGNIIEVLSSRG........................LE..IPVYF

PF01903

P71751_MYCTU/53-151--LN-S.PNL-VDVL....N.R...-......CR-----GA-----A.......VVTPLLL.ADA.YHARV---------
Q7UNS6_RHOBA/42-150--FQ-S.PTI-DEGW....R.RLLD-A.....GA-----ER-----I.......TVSPLLL.FAA.GHAKS---------
Q82UF1_NITEU/52-144--RT-R.QTL-QSGL....A.SLHQ-Q.....NI-----GR-----I.......VVLPLFI.SAA.EPRYQ---------
CBIX_METJA/9-138--FS-E.PTI-PQAV....K.KAIE-Q.....GA-----KR-----I.......IVVPVFL.AHG.IHTTR---------
Q7V242_PROMP/174-278--VT-F.PLV-EPGL....R.NVVR-L.....GY-----KN-----I.......IIFPYFL.FSG.VLVTR---------
CBIX_HALSA/9-130--KE-E.PSF-RNVL....R.TL..-......ES-----DE-----V.......YVVPLFI.SEG.YFTEQ---------
CBIX_HALSA/152-263--.E-D.PEV-DDVT....D.FF..-......DT-----DD-----I.......VVVPLFV.SDG.FHTQE---------
Q81FY5_BACCR/9-114--LA-N.PSI-EDGF....R.TCVK-R.....GA-----TE-----I.......IAIPVFL.LAA.GHVKK---------
Q8FM68_COREF/9-112--LA-D.PSL-DEVV....G.QLAE-Q.....GV-----TR-----A.......ALVPLLF.TDA.FHNKI---------
Q8CN68_STAES/9-113--SE-T.QNL-EIIM....E.KMIK-Q.....GI-----TK-----F.......RIVPLLI.FSA.MHYIS---------
CBIX_ARCFU/10-119--RK-R.RPM-PD......E.AIRE-M.....NC-----DI-----I.......YVVPLFI.SYG.LHVTE---------
CBIX_SULTO/9-108--FN-Q.PSI-TEAA....K.KLAS-N.....GV-----DT-----I.......IVVPLLF.AAG.THFKR---------
Q9X2M7_STACA/9-114--SD-E.LSL-PQVI....R.KYLA-E.....GE-----HY-----F.......TIVPLLL.FSG.RHYLE---------
Q8TKD6_METAC/3355-3469--AE-T.ENI-AMAV....Q.ALEE-K.....GV-----KR-----I.......VAVPIFVCSAS.SHMEE---------
Q7U7Z1_SYNPX/16-120--FA-R.PIL-RDGL....E.SLRQ-Q.....GV-----TR-----V.......LAIPAML.FAA.GHAKN---------
Q7VCD4_PROMA/148-252--VT-F.PLV-EPGL....R.KLVK-L.....GF-----SR-----I.......VVFPYFL.FSG.VLVSR---------
P74414_SYNY3/23-131--AQ-A.LPL-HQQLVNLAE.NLIP-Q.....GV-----KR-----I.......VILPLFL.LMG.VHTCE---------
Q8NV21_STAAW/9-113--SE-H.QDL-ETVM....T.TLIQ-S.....GV-----DH-----F.......KIVPLLI.FSA.MHYLK---------
Q8EXP3_LEPIN/11-115--LS-K.SDV-KTAL....R.ELSK-......TH-----NK-----I.......LIFPLFL.FAS.NHVKN---------
Q7V757_PROMM/20-124--FA-R.PVL-REGL....D.RLLE-Q.....GV-----KR-----V.......LAVPAML.FAA.GHAKN---------
CBIX_BACME/14-118--FE-R.PNV-SQGI....D.TCVA-K.....GA-----QD-----V.......VVIPIML.LPA.GHSKI---------
Q82BN1_STRAW/64-163--LN-E.PLL-PDTL....A.AL..-Q.....DD-----SR-----A.......VLVPLLL.SRG.YHVKQ---------
Q9RZD7_DEIRA/3-101--VL-E.GSW-KEEP.SLRQ.LLRL-A.....RF-----RD-----V.......TVVPLFV.SEG.YFTGT---------
Q96ZL1_SULTO/11-123--YT-E.PNW-RNIV....S.ELLS-K.....GI-----NH-----I.......VFALAFL.GRG.NHVAK---------
Q8XWQ5_RALSO/11-116--LM-A.PDL-PGTI....D.ALAA-D.....GV-----RD-----I.......TVVPVFF.GQG.GHLRR---------
SIRB_BACSU/10-115--LQ-E.PTI-ETGF....E.ACVK-Q.....GA-----TH-----I.......AVVPLLL.LTA.AHAKH---------
Q7NDP2_GLOVI/28-133--LT-A.PSI-QAGV....D.RCIE-L.....GY-----RD-----L.......TAVPLLL.FAA.RHNKF---------
Q7NXQ9_CHRVO/13-118--FA-R.PTI-DEAV....Q.QVIA-A.....GA-----KT-----V.......VMVPGVL.LAA.THAKN---------
Q81FY5_BACCR/133-233--AA-E.PKF-EEKL....K.EVVE-R.....KE-----KN-----I.......VVLPYLL.FTG.LLMKH---------
Q7NXQ9_CHRVO/143-247--TA-K.PLV-ADGL....R.AAAM-L.....GY-----RR-----I.......VVLPYFL.FDG.VLVKR---------
CBIX_METKA/9-134--LC-E.PTV-QEAV....K.KAAE-S.....GV-----DK-----I.......VVVPVFL.AHG.VHTKR---------
Q7VCD4_PROMA/20-124--FS-C.PTI-ANAL....D.TLRG-N.....SV-----KK-----V.......IALPAML.FAA.GHAKN---------
Q8DJ31_THEEB/165-269--IT-H.PRL-PVGF....T.RANF-Y.....QP-----RR-----I.......IVLPHFM.FTG.ALVKK---------
Q829K6_STRAW/144-248--LA-A.PDV-PSGL....D.RCVK-L.....GA-----RR-----I.......VVLPYFL.FTG.ILPDR---------
CBIX_METTH/18-137--MS-R.PSI-PEAI....N.ELAA-M.....GV-----EK-----I.......IVTPVFL.AHG.VHTKH---------
Q8DHP8_THEEB/20-121--LE-G.APL-PKQI....C.QFSQ-EAH.SQGA-----EG-----M.......VILPLFL.LPG.NHVVV---------
Q81E58_BACCR/9-114--LT-T.PTI-SDAV....T.ETII-E.....GV-----TE-----I.......MIVPVLL.FAA.AHYKR---------
CBIX_SULSO/9-118--FN-K.PTL-SEAL....S.NLLA-K.....GA-----DK-----I.......VVVPLLF.ATG.THFRR---------
Q82L75_STRAW/11-113--FN-V.PSV-NGVL....E.SLAA-E.....GV-----RE-----V.......VALPLLL.TRA.FHAKA---------
Q7UNS6_RHOBA/198-298--MA-Q.PRL-PDTL....D.QIAA-S....GRF-----GR-----V.......IVQPHLL.FSG.RLYDA---------
Q8DJ31_THEEB/33-138--LT-E.PSI-FEVL....S.QCAA-A.....GY-----RE-----L.......SVLPVLL.FAA.RHNKF---------
P74414_SYNY3/149-243--..-...YW-KGGI.SLNT.VLGE-I....KTP-----GE-----V.......VILPYFL.FAG.GLTDL---------
Q7U7Z1_SYNPX/145-249--VT-F.PLV-EPGL....R.QLVK-L.....GF-----HR-----I.......VVVPYFL.FSG.VLVSR---------
Q8YZE1_NOSS1/3-102--VV-S.EPL-HEQI....R.NFAQ-IAV.TFGC-----HH-----L.......KIIPLFL.LPG.VHVMT---------
Q8EXP3_LEPIN/133-237--IT-K.PLL-QESL....E.MCIK-L.....RP-----EH-----I.......LILPYFL.FYG.KLIKK---------
Q9L2E8_STRCO/21-118--LN-E.PLL-PDTL....T.AL..-......GD-----GA-----A.......VLVPLLL.SRG.HHVKR---------
Q8YZE1_NOSS1/117-213--SV-A.PSL-ESRV....Q.ELIA-I.....GY-----RE-----I.......AILPYFL.FSG.GITDA---------
Q7NHF8_GLOVI/27-130--FS-E.RLL-DEQI......ALQV-A.....PG-----HR-----F.......VLLPLFL.APG.MHVGE---------
Q9KCS3_BACHD/144-248--AT-R.PSL-DEGL....E.KVIR-L.....AG-----KK-----V.......YLLPYLL.FSG.VLMNS---------
Q82L75_STRAW/135-230--AS-L.PRT-EDAV....R.ELRA-L.....GC-----ER-----I.......AVAPYVL.APG.FLPDR---------
SIRB_BACSU/134-236--AC-G.PNY-KEVF....S.EL..-E.....KD-----DG-----IT.....TFIVPYLL.FTG.MLMNE---------
Q9L2E8_STRCO/140-233--AA-A.PTV-PEAV....R.ALTD-R.....GH-----RR-----I.......ALASCFT.APG.RFATQ---------
Q9RS86_DEIRA/9-126--VL-E.GYW-QQEP.GLRQ.VLRT-V.....AY-----SD-----V.......TVVPVFL.SEG.YVTET---------
Q84JH7_ARATH/89-194--LA-E.PSI-KDAF....S.LCVQ-Q.....GA-----KR-----V.......VVSPFFL.FPG.RHWHT---------
CBIX_SYNY3/164-268--IS-H.PRL-EEGF....R.RARL-Y.....QP-----KR-----I.......IVLPYFL.FMG.ALVKK---------
Q8EQN8_OCEIH/9-114--IS-E.PDV-GQGI....N.KLLK-K.....GA-----TK-----I.......AIVPVLL.LRA.GHYYQ---------
Q7V242_PROMP/46-150--FA-K.PSL-TDAL....D.KLRN-S.....SI-----KK-----V.......IAIPAML.FAA.GHVKN---------
Q9RZD7_DEIRA/122-231--VQ-A.LYL-DQAP......RVDD-WAA.LTRA-----PD-----V.......VIVPFFA.SEG.WHTQD---------
P95216_MYCTU/123-221--TG-G.PDV-RTAV....Q.RARD-RAEANRGA-----RR-----V.......AVASFLL.AEG.LFQER---------
Q8ZZB2_PYRAE/8-112--YA-E.PNW-RDLL....K.R..A-E.....GP-----VI-----I.......ALA..FL.GAG.NHVVR---------
Q8NLX3_CORGL/9-112--LA-E.PSL-DQVV....A.TLSA-E.....GV-----TR-----A.......ALVPLLF.SNA.YHAKI---------
Q93IF7_PROFR/147-251--VV-R.PSV-PEAL....T.MAVD-A.....GA-----TQ-----L.......LVGPNFL.FRG.RLRTW---------
Q8TKD6_METAC/423-539--FV-EGEDI-GTAV....A.SLEE-Q.....GV-----EH-----I.......ITVPIFV.ASASGHIEE---------
CBIX_BACME/141-245--VT-A.PLI-DEGV....E.RCLK-L.....GA-----KK-----V.......VILPYFL.FTG.VLIKR---------
Q82BN1_STRAW/189-282--AA-A.PTV-PAAL....R.ALAA-R.....GR-----HR-----V.......AVASYFT.APG.RFATA---------
Q93IF7_PROFR/12-121--LA-E.PDV-AGAV....H.NALA-H.....IP-----DA-----VPSDEPELVVLPLML.NTG.GHVNS---------
CBIX_SYNY3/32-137--LT-E.PNI-QAGV....Q.QCVD-Q.....GF-----EE-----I.......SALPILL.FAA.RHNKF---------
CBIX_METMA/12-124--NS-E.PTL-EEAI....E.GFSG-T.....GV-----TK-----I.......SAVPVFL.ASG.VHITK---------
Q9KCS3_BACHD/9-115--LA-E.PSI-EEAI....D.ECVA-M.....GA-----TD-----I.......AIVPVLL.LAA.GHAKV---------
Q8EQN8_OCEIH/134-236--AC-S.PSF-EQGL....RSSLEE-E.....GY-----SR-----V.......FVLPYLW.FTG.VLFQS---------
P95216_MYCTU/8-105--VL-G.PSP-SEVL....S.AL..-......SC-----RP-----A.......IVVPAFL.SRG.YHVRT---------
Q829K6_STRAW/13-118--LS-P.PPL-TEAV....G.ELVE-R.....GV-----RR-----F.......AAVPLML.VSA.GHAKG---------
Q7NDP2_GLOVI/156-260--IT-H.PRL-EQGF....E.RAWT-W.....GA-----KR-----V.......VVLPYFL.FTG.LLVKR---------
Q7NHF8_GLOVI/150-253--KI-Q.PDL-RHTL....R.ELVH-P.....SI-----RR-----V.......LILPYFL.FEG.GMTDR---------
Q8XS58_RALSO/22-127--FA-T.PTL-DEAV....D.AVVA-D.....GA-----GT-----V.......VMVPGVL.LAA.THAKN---------
Q97WC4_SULSO/14-126--FA-K.PDW-RSLL....N.NVVR-E.....GY-----RR-----I.......VIGLVFL.GRG.NHVFR---------

PF06180

Q8Y7R9_LISMO/3-255CAVE-SYPGL-DQVI----E-RLQQ-A-----DI-----KK.....A-------HLMPFML-VAG-DHATN---------
Q8KFD8_CHLTE/13-299GMIE-GRPGV-EEIV----A-EVTG-K-----GC-----TT.....V-------LLRPFMI-TAG-DHAHN---------
Q8R628_FUSNN/14-265VCTK-AYPLM-DTLL----K-KLRK-N-----GI-----EE.....V-------RLAPFMF-VAG-EHAKN---------
Q97JB3_CLOAB/3-262ANVE-GYPDL-NNVL----R-YIEN-H-----ET-----RK.....V-------TLIPLML-VAG-NHAVI---------
Q8XL14_CLOPE/3-261GTVE-GYPNF-SNVL----K-KAKK-K-----DI-----KE.....I-------TIIPLMV-VAG-DHAKN---------
Q57MX2_SALCH/3-257GAVE-SYPEV-DILI----D-SLRD-E-----GV-----TG.....V-------HLMPLML-VAG-DHAIN---------
Q9RMI6_PORGN/31-292GTVE-SDPSI-NDVI----A-ELKE-T-----GA-----TA.....V-------TMMPLMS-VAG-DHATN---------
Q97LH8_CLOAB/3-263ATLE-GFPKV-EDVI----E-YMEK-N-----KF-----KEKYKGEV-------KIIPLLV-TAG-KHVKK---------

PF00762

HEMH_COXBU/19-351GMRY.GKPSI.ETAL----K-KLQE.A..---QC.....RQ-----L-------IVLPLFPQYST-STTASALEEVRAKN
HEMH_RHIEC/19-340AMRY.GTPSI.ASRI----E-TLKQ.E..---GC.....DR-----I-------LLFPLYPQYAA-ATTATVNDKAFQKL
HEMH_CAUCR/4-317AMRY.WHPLT.DETA----R-QVAA.F..---AP.....DQ-----V-------VLLPLYPQFST-TTTGSSLKAWKKTY
HEMH_METFK/17-337GMRY.GSPSI.ASAL----G-KLKA.K..---NC.....NR-----I-------LLFPLYPQYAA-SSSASALDEAMRTL
HEMH_FRATW/10-329AMRY.GNPSI.ESKI----K-SLQD.Q..---GA.....TE-----I-------IIFPLYPQYSA-TTTATVYDEVYRVL
HEMH_RHOBA/7-309GNRN.WDPYF.ADTL----R-QMKA.D..---GK.....KR-----S-------LAFFTSMFSCY-SGCRQYRENIIQAR
A7JUM6_PASHA/6-320GMSY.GNPSI.ESAT----D-NLIK.Q..---GV.....ER-----I-------IVLPLYPQYSS-TTTASVFDAFANGL
Q3A6H8_PELCD/15-332IMRY.WEPRA.KEVL----T-HLRR.E..---GV.....KR-----A-------MVLSLYPHFTA-ATSGSSINDFCRHA
A0JYM7_ARTS2/30-358GNRN.WDPYI.PQTL----Q-DVYD.A..---GH.....RK-----V-------LMVTTSAYSCY-SSCRQYREDIGMAL
A7GM50_BACCN/4-305GLKH.IAPFI.EDAV----A-DMKR.E..---GI.....EK-----A-------ISIVLAPHYST-FSIQAYNDRAIHAS
Q1N3F6_9GAMM/5-324AMTY.GEPSM.ETAG----R-NLRQ.K..---GV.....EK-----M-------LVLPLYPQFSA-STTGAVFDRLAKGL
Q2IPY0_ANADE/3-312AMRC.GHPNT.EEGV----R-DALA.A..---GA.....TR-----A-------VALPLYPQYAN-ATTRSSLLELRRLW
HEMH_LEGPC/2-331GMRY.GTPSI.TTAL----A-ELKD....---.C.....HS-----L-------TILPLFPQYSS-AATGSAIEKTLSYL
A3I3M0_9BACI/5-305GLKH.IHPFI.EDAI----E-QMVA.E..---GI.....KE-----A-------VSIVLAPHFST-FSIKSYNGRAVEAA
HEMH_STAAN/4-307GLKH.ISPFI.EDAV----E-QMHN.D..---GI.....TE-----A-------ITVVLAPHYSS-FSVGSYDKRADEEA
Q1GQW0_SPHAL/14-327AMRY.GEPAI.GRAI----D-ALTA.A..---GC.....RR-----I-------LVAPLYPQYCA-ATTATVVDAAADHL
A6W899_KINRD/11-329GNRN.WEPYV.TDVL----R-EAHE.A..---GA.....RR-----V-------LTVFTSAYSSY-SSCRQYREDLGKAL
A7T926_NEMVE/2-249GFRY.ATPLT.EDAI----E-QMERYT..---LV.....LE-----V-------WRNAQFPQWS.-..............
A0NNM3_9RHOB/33-355AMRY.GQPSI.PDRL----K-ALKD.E..---GC.....DR-----I-------LVFPLYPQYSA-TTTATVNDVVCKTL
Q0YS02_9CHLB/6-332AFSA.SPPYA.ESVI----E-ETR.....---DC.....SG-----Q-------IIISMAPVDSS-LSCGLLCSWLKSSR
A6ELJ2_9BACT/3-339AMRY.GSMTL.KKGI----Q-ELVD.Q..---GC.....TE-----I-------KTIPLYPQFAM-ATTETIDVKVDEIV
HEMH_PSEPW/3-337AMRY.GEPAL.PQVL----E-RLAA.Q..---GV.....RK-----V-------TLAPLYPQFAD-STVTTVVALANQTV
A1SXP1_PSYIN/19-339AMRY.GNPSI.EAGL----E-ELRE.K..---GF.....TR-----I-------VVFPLYPQYSS-PTIGSTFDAVAKVL
Q0G0T3_9RHIZ/27-348AMRY.GQPSI.AERT----D-ALME.A..---GC.....ER-----V-------LVFPLYPQYSA-STTATVNDKFFEHM
A4A641_9GAMM/16-336AMRY.GEPSI.GHAL----Q-SLMD.R..---GA.....RQ-----L-------LVLPMYPQYSG-PTGGSTFDAVAEDL
A6GNF2_9BURK/14-338AMRY.GNPSV.ASRM----D-QLRK.D..---GY.....DR-----V-------LVFPLYPQYAA-ATTASVFDAVFDWA
A3ZL09_9PLAN/3-305GNRN.WAPYL.VDAM----T-QMKN.D..---GV.....ES-----A-------LVFVTSVFSSY-SGCRQYREDLTKAQ
Q5KFH8_CRYNJ/49-370AFRY.AKTLT.EDAL----A-EMKQ.D..---GV.....QR-----A-------VAFSQYPQYSS-STTGSSLNELYKQV
Q47NJ1_THEFY/4-317GNRN.WDPYL.EDTV----A-EMAR.N..---GV.....RR-----A-------VALATSAYSNY-SSHRQYLEDIERAR
A6EVP6_9ALTE/16-336AMRY.GNPGI.SKVL----D-EMQA.Q..---GV.....RR-----L-------LVLPLYPQYSA-STSASTFDAIAHNF
Q3SU51_NITWN/22-343AMRY.GNPSM.QSRI----A-AMAA.Q..---GC.....DR-----L-------LVVPLYPQYSA-TTSATVCDEAFRIL
Q6AB01_PROAC/16-329GNRN.GTPFL.EEAL----T-DMHA.H..---GV.....RR-----V-------LAVVTSAYASY-SGCRQYREEIATAL
HEMH_ZYMMO/13-326AMRY.GTPSI.SSRL----E-KLIA.S..---GC.....RR-----I-------LLAPLYPQYSA-ASTATVQDEAYRYL
HEMH_WOLSU/2-314AMRY.TPPMT.DMAV----R-ELAQ.K..---EI.....EE-----V-------TLFSLYPQYST-TTTLSSIEEFHKQC
A6VPL9_ACTSZ/8-324GMTY.GNPSV.QQAL----E-NLLN.A..---RV.....ER-----I-------VALPLYPQYSS-TTTAAAFDAFARAL
Q2Y6A8_NITMU/15-335AMNI.GNPSV.AEML----E-RFRE.Q..---GC.....DR-----L-------LVLPLYPQYAA-SSTASAFDEIFAQL
Q26GH9_FLABB/2-337GMRY.GSMSI.EKGL----K-ELND.K..---GV.....DE-----V-------LIIPLYPQFAM-ATTETILVLAEELR
HEMH_RALPJ/16-344AMRY.GNPSI.PSVM----Q-ALRK.Q..---GV.....ER-----I-------LVLPMYPQYSG-TTTATAFDEVFRVL
HEMH_THICR/16-340GMRY.GNPSI.ASAL----K-SLQD.R..---NV.....QR-----L-------IVVPLYPQYAG-ATTASTFDAVSAEL
A4X999_SALTO/20-328GNRN.WDPML.ADTV----A-QMRD.D..---GV.....ER-----A-------LAFVTSALGGY-SSCRQYQEDIAAAR
HEMH_PSEA6/16-336AMRY.GSPSI.ESVT----Q-NMLE.K..---GV.....RQ-----L-------LVLPLYPQYSG-ATNGSTFDALGEVL
HEMH_CHLAB/4-308FHRY.LPDTH.SQTI----Q-QLKT.L..---GD.....LP-----V-------VGVPLFPHFTY-AVTGSIVRFIHNHL
A3TKF4_9MICO/13-330GNRN.SAPFV.TDTL----R-AARA.Q..---GQ.....LR-----I-------CVVVTSAYSSY-SGCRQYREDLAAAT
HEMH_CHRVO/19-339AMRY.GNPSI.ESVI----G-KMRE.Q..---GV.....ER-----L-------LLLPLYPQYAA-SSSATALDEAFRVL
HEMH_GEOBB/4-316AMRY.SRPST.IDAL----A-AIKR.A..---GI.....ER-----V-------IALSLYPHYSK-ATTGSSLNELKRVL
A8L1D5_FRASN/20-328GNRN.WQPYL.ADAV----A-RMRA.D..---GV.....RR-----A-------ACFVTSAFASY-SGCRQYREDLAAAL
Q1DC34_MYXXD/7-344AMRY.GSPSI.PDGI----A-ALKA.R..---GV.....SE-----F-------TVLPLYPQEAA-SSTASSLARTYEVL
A0Z184_9GAMM/16-336AMRY.GNPSI.PSVL----Q-DLFN.A..---GI.....QR-----L-------VVLPLYPQYAG-PTTGSTFDEIAADF
HEMH_PHOLL/5-320GMNY.GSPSL.EQAI----D-NLLK.Q..---NV.....EQ-----L-------IVLPLYPQYSG-SSSAAVFDGVSLVL
A5DAX3_PICGU/50-370AFRY.ANPLT.EDTL----K-KMLD.D..---GV.....TR-----A-------VAFSQYPQFSY-STTGSSINELYRKT
Q2VYH0_MAGSA/8-320AMRY.WHPFT.YETV----A-AIRE.W..---GA.....DE-----V-------VLLPLYPQFST-TTTGSSLKEWHKQA
A3EV75_9BACT/12-335GMRY.APPRT.ADAL----R-ELVD.S..---GV.....ND-----L-------VFLPLYPQRSR-TTTGSSFREALAEA
B1YKJ8_EXIS2/3-305GLKH.IEPFV.EDAV----E-QMAK.D..---GI.....TE-----A-------VTVVLAPHYST-FSIRSYNGRAKEVA
A6F7X3_9GAMM/3-322AMTY.GERSI.KAAI----A-KLQQ.S..---GS.....EH-----I-------VVLPLFPQYSS-TTTAPVFDQVARYL
A0YYR5_LYNSP/3-322GMRY.WHPFT.EEAL----V-RIKR.D..---QI.....EQ-----L-------VILPLYPQFSI-STSGSSFRLLERLW
HEMH_THEVO/2-285AFKH.WYPSI.GEVV----P-DLKG.Y..---.......DN-----I-------VSIPLFSFFSE-NVKASYYKPLAEAL
Q1V1A3_PELUQ/2-316VMRC.WNPRA.NDVI----K-DVQS.F..---NP.....EE-----I-------ILMPLYPQYSA-ATSGSSIKEWRDVC
Q2GCY1_NEOSM/3-304AMRH.WHPFI.QQSA----T-RING.G..---EF.....AK-----A-------ILLPLYPQFST-TTSLSSIEQCLKVL
Q7QG25_ANOGA/28-351AFRY.VNPLT.EDTF----R-EVER.D..---QP.....ER-----V-------VLFSQYPQYSC-ATSGSSFNAIYTHF
Q118M8_TRIEI/24-354AFNF.CAPYLPEQVL----N-QIKS.E..---GF.....DK-----L-------LIYPLLVVDSI-FTSGIAVEQVNKAL
Q1NVN4_9DELT/7-321AMRY.WHPFA.DEAL----A-EFRQ.A..---GV.....RQ-----L-------LALPLYPHFSR-ATTGSSLNDLRRAL
HEMH_CHLPN/3-309FHRY.LPSTH.EKTL----L-ALRT.L..---HT.....RH-----V-------IGIPLFPHFTY-SVTGSIVRFFMKHV
HEMH_ACIAD/8-328AMTY.GNPGV.QHIL----K-DLAA.S..---PQ.....EH-----V-------ILLPLFPQYSA-TSTAPLYDAFANWI
B3E8G1_GEOLS/3-313GMRY.WHPFT.AETL----A-QLRK.T..---GT.....KK-----L-------VALSLYPHYSR-ATSGSSFNDLTRCL
HEMH_AQUAE/2-309GMRY.WKPYI.KDAL----S-ELLK.E..---GI.....NE-----V-------ILLPLYPQYSK-TTTGSAFNEFERSK
B4SCY0_PELPB/6-328AFSA.SPPYV.EHVM----E-QTR.....---SS.....DA-----Q-------VIVSMAPIDSS-LSCGLICSCLANSR
A4ETD1_9RHOB/25-348CMRY.GNPST.KSKV----R-AMVA.A..---GC.....ER-----I-------LFVPLYPHYAG-ATSATANDQFFRAL
HEMH_THEAC/2-283AYKH.WNPSI.EEAV----K-GLGS.Y..---.......DN-----I-------VAIPLFSFYSQ-NVKDSYLNPLESAL
HEMH_CHLMU/1-303FHRY.LTETH.QDTL----A-ALRE....---SA.....GD-----I-------IGIPLFPHYTF-AVTGSIIRFFLERI
A2VI04_MYCTU/3-299GNRN.WEPYV.EDAV----T-AMRD.N..---GV.....RR-----A-------AVFATSAWSGY-SSCTQYVEDIARAR
HEMH_GLUOX/17-337GMRY.GCPSV.AKAV----E-SLMD.Q..---GC.....DR-----I-------ISIALYPQYSA-TTTATANDQLFRAL
HEMH_HERAR/16-335AMRY.GSPSV.PEVL----R-KLKA.D..---GC.....DR-----I-------LVLPAYPQYSG-TTTASIFDAVFKHY
HEMH_DICDI/45-386GFRY.SDPLI.ADTL----D-QMEN.D..---NV.....ER-----V-------VAFSQYPQYSC-TTTGSSLNNLWKTL
Q65DD6_BACLD/5-307GLKH.ISPFI.EDAV----E-QMKK.D..---QI.....EE-----A-------VSVVLAPHYST-FSTEVYNRRAKQAA
A0L8B7_MAGSM/5-325AMRY.GNPGL.RCKV----G-SLVR.E..---GV.....RR-----L-------LIVPLFPQYAG-ATVASVMDEVMRPM
HEMH_CAMC1/2-313AMNY.TSPFV.KDVL----K-KYEK.F..---.......DE-----I-------VLLPLYPHHSQ-TTITSSLADFKKAK
Q5PA48_ANAMM/8-324CMRH.SKPGS.REAL----H-AVRD.Y..---QP.....EH-----V-------VLLPMYPQYSS-TTTLSAIEDWNNSA
Q2GL73_ANAPZ/4-320CMRY.SAPNA.LTVL----G-DIDE.Y..---KP.....CK-----V-------VLLPMYPQYSS-ATTQSSIEDWFSTS
HEMH_STRM5/6-319AMRY.GEPAL.GSEL----D-CLAA.E..---GA.....RR-----I-------VVLPLYPQYST-TTTASVEDRVDAWQ
A7A2C1_YEAS7/38-357AFRY.AKPLT.AETY----K-QMLK.D..---GV.....KK-----A-------VAFSQYPHFSY-STTGSSINELWRQI
Q0F558_9RHOB/16-336AMRY.GQPSV.ENAM----N-ALLE.Q..---GA.....RK-----V-------VVLPLYPQYCA-STTGSTFDALAADF
A4U0X7_9PROT/2-312AMRY.WHPFA.DQAL----R-EAKA.W..---GA.....ER-----V-------ILLPLYPQFST-TTTGSSLKQWHQLA
HEMH_PELPD/5-317AMRY.WKPDT.SQAL----E-AVVQ.A..---GI.....TR-----I-------VALSLYPHYSR-ATSGSSFNELERVR
HEMH_STRP2/2-294ANKF.SSPFI.PDVI----G-QMEA.D..---GI.....EQ-----C-------ICLILEPHYSF-YSVMGYEKFLESKQ
A4SLY2_AERS4/4-323AMTY.GSPSM.DDGW----Q-ALKA.K..---GV.....NR-----V-------ILLPLYPQYSV-STTASVFDAWAKAM
HEMH_SYNSC/3-326AMRY.WHPFT.ESAV----A-DIKA.D..---GM.....DE-----V-------VVLPLYPHFSI-STSGSSFRELQRLR
Q0AKE0_MARMM/7-318AMRY.WHPFT.EDVA----R-EVET.W..---QP.....DE-----T-------VLLPLYPQFST-TTTGSSLNAWRKA.
Q0AHZ2_NITEC/18-338AMIV.GNPSI.AERL----Q-RMRE.Q..---GC.....SR-----I-------LVLSLFPQYAA-SSAGCALDSVFTEL
A1SKT0_NOCSJ/8-323GNRN.WDPLL.ADTI----R-EMAA.D..---GI.....TR-----A-------ACFVTSAYASY-SSCRQYRENLYDAV
B4S8P2_PROA2/4-319SFFV.TPPFV.GKVI----E-QTR.....---QC.....DL-----Q-------LLIPMAPIDNR-LMSGSLDILAQRQQ
HEMH_HYPNA/4-317AMRY.WHPFT.EEAA----A-EVQK.W..---GA.....DE-----V-------VLLPLYPQFST-TTTGSSLSAWHKAY
A5EXB1_DICNV/10-330AMRY.GVPSI.SSAL----Q-RLQA.Q..---NV.....RQ-----L-------LVIPMYPQYAE-ATTASVFDAVAAAL
Q3AEU4_CARHZ/2-291AYQY.WRPEI.PEVV----F-NLVQ.K..---GA.....KT-----I-------YFLPMSAFNSQ-VSTGAYQKTIKNLE
HEMH_LEPBI/8-339AMAC.GYPNM.RDI.----.-EFGK.P..---N......QD-----T-------VYLPLYPQFSR-STVLSTLAILE..T
HEMH_BURXL/16-340AMRY.GTPGI.PAML----N-QLKL.A..---GA.....ER-----V-------LLMPMYPQYSS-STTATAFDDAFSAL
HEMH_ALCBS/16-336AMRY.GNPSI.ASQL----Q-AFED.E..---GI.....RK-----L-------VVLPLYPQYSG-STNGSTFDAVAQDF
HEMH_MANSM/5-321GMTY.GNPSM.QYAI----D-NLIE.Q..---KV.....DK-----I-------IVLPLYPQYSS-TTTAPVFDVFAQAL
HEMH_MYCAV/3-298.....GHTRQRDSAC----R-........---GVHHLRLER-----L-------LQLHAVRRGHR-PGAHRGRAGRARTG
HEMH_VIBF1/5-319GMTY.GEPRI.KSGI----E-SLEQ.Q..---GC.....DE-----I-------IILPLYPQYSR-TTTAAVFDQIAKQY
Q2RN84_RHORT/3-322AMRY.WKPLT.REAV----K-AAKA.W..---NP.....DQ-----V-------VLLPLYPQFSG-TTSGSSLNQWTVEA
A5VF70_SPHWW/15-329AMRY.GKPAI.GDRI----A-ALQA.A..---GC.....DR-----I-------LIAPLYPQYCA-ATTATANDAAFAVL
HEMH_SCHPO/32-352AFRY.APPLT.EDML----D-ELKK.A..---NV.....SR-----A-------VAFSQYPQWSC-ATSGASLNELRRKL
HEMH_THIDA/16-336AMRY.GRPGI.PEVL----A-RMKA.A..---GC.....DR-----I-------LVLPAYPQYAA-SSTATAFDAAFDWL
A7HSJ5_PARL1/7-322AMRY.WHPFA.DEAA----A-AIKA.W..---GA.....DE-----I-------ILLPLYPQYST-TTTESSFRDWERAA
A7I208_CAMHC/3-312AMNY.TKPFA.NEVL----K-KYEN.F..---.......DD-----I-------ILIPLYPHYSQ-TTVKSSIQSCKKA.
HEMH_PSEAB/3-337AMRY.GQPAI.EKVL----L-DLAR.R..---GI.....RR-----V-------TLAPLYPQFAD-STTTTAEQEVRRVI
HEMH_POLSJ/20-339AMRY.GNPSI.ASQL----N-QLKA.D..---GA.....TR-----I-------LILPAYPQYSG-TTTASVFDAVYSWA
A3HXU8_9BACT/6-342GMRY.QSPSI.ESAL----E-ELMK.A..---KV.....KK-----I-------IVVPLFPQYAS-ATNGSVIDKVMEIA
Q21PI6_SACD2/17-337AMRY.GNPSI.TSAI----T-TLCD.Q..---GV.....RK-----L-------LVLPLYPQYSG-STTASTFDAVAKDF
Q1YSP8_9GAMM/17-337GMSY.GNPSI.ESAI----A-ELTA.Q..---NV.....RN-----I-------TVLPLYPQYSG-ATIGSAFDAVAKVF
B3EI90_CHLL2/10-337AYYF.VPPYL.ETVL----K-EQQS....---QC.....DG-----V-------VLVPMIPVESA-FSCGVACRMIADEF
Q2RZ44_SALRD/6-342AMRY.WEPFS.EDAA----A-QMQE.D..---GV.....DK-----V-------VLLPLYPQYSK-TTTGASLVYWHELE
Q11PE0_CYTH3/9-344GMRY.QNPSI.ESAA----K-ELEA.K..---GY.....NK-----V-------IVVPLFPQYAS-ASTGSAVEEALRVL
HEMH_HELPY/20-333AMRY.TPPYA.SMVL----Q-DLAL.K..---EV.....ES-----L-------VFFSMYPQYSS-TTTLSSFNDAFNAL
B4U5Z6_HYDS0/3-310AMRY.WHPFT.AEAI----S-NLEK.V..---KP.....SK-----I-------VLLPLYPHYSS-TTTGSSFKEFYRLF
HEMH_DESPS/5-316AMRY.WPPYC.DEAL----D-YLLS.K..---GV.....ER-----L-------VALSLYPHYSK-ATTGSSLTQLHKTL
HEMH_DEIRA/9-312GMRH.WSPWI.EDAV----R-EMLD.D..---GI.....EQ-----A-------IAIVLAPQYSS-LSVAKYQKKIKAAL
HEMH_NOCFA/3-313GNRN.WHPMV.EDTV----A-EMAR.D..---GV.....TG-----A-------LVFPTSAWGGY-SGCRQYHEDIERAR
A4BNN9_9GAMM/7-327GMRY.GQPSI.ESAY----A-ELET.A..---GC.....ER-----I-------LVLPLYPQYSA-ATTASTYDALGAVL
Q6L0G9_PICTO/3-286AYKH.WKPGI.ENIV----E-DSKD.F..---.......DE-----I-------FAIPLFPFSTN-NVKNSYEKPFNEAL
HEMH_SYMTH/3-318GMTY.GQPSV.KSAL----E-ELRG.W..---GV.....RR-----L-------LVLPLFPQYSS-TTTAAVWSKVQKAL
A3WGM8_9SPHN/19-340AMRY.GQPSI.EKRL----K-ELTE.K..---GC.....DR-----I-------LIAPMYPQYCA-ATTATVFDEVARVL
Q6C140_YARLI/28-348AFRY.ANPLT.PDTY----A-QMKK.D..---GI.....KR-----A-------IAFSQYPQYSL-STTGSSLNELYRVR
A4SGR5_PROVI/4-322AYHA.APPFV.EDLL----D-ETS.....---GY.....DM-----Q-------LLVTMSPVDSD-LTAGRLQHLADRRS
HEMH_STRCO/10-330GNRN.WAPYL.TDTL----R-EMVG.D..---GR.....RR-----I-------LVLATSAYASY-SGCRQYRENLADAL
A1BDR1_CHLPD/6-328AFSA.SPPFM.ENII----E-ETR.....---AF.....DG-----Q-------ILVNMSPMDNS-LTCGLLCGYIADTY
Q8IFR0_PLAFA/26-346GMRY.GERSI.KKGL----E-YLQK.E..---NI.....NK-----L-------LVLPLYPQSAE-CTVSSTLDCIGKNL
A6DEA9_9PROT/2-294AMRY.TKPYL.NKII----H-........---KY.....EE-----I-------IFLPLYPHYSF-TTFESCLDDLKNTN
HEMH_LACRD/3-310AMTY.GKPKI.SDTI----T-GMKK.E..---.C.....QN-----I-------TVLPLFPFFTK-STTQTVIDKVKDAD
A1F5I4_VIBCL/10-324GMTY.GEPSL.LEGV----R-KLQQ.Q..---GV.....EQ-----I-------VVLPLYPQYSA-TTTAAVFDGLAKAL
A5PCT0_9SPHN/19-336AMRY.GTPSI.PERL----K-ALMD.K..---GC.....ER-----I-------LLAPMYPQYSG-ATTATVVDKAGEAL
HEMH_LACLS/4-313AMTY.GEPRI.DKVI----R-EMKE.S..---GV.....ED-----I-------TVLPLYPQYSL-TTVEPIIQQVKKID
HEMH_STRMU/5-319TMAY.SKPSI.SDVV----D-EFLK.E..---KV.....AK-----M-------IVLPLFPQYSS-TTTAAIFDAFAQSL
HEMH_RICCN/4-312NMRY.SAPFA.KEVI----G-QIKK.Y..---NP.....SE-----I-------ILLPLYSQFSS-TTTGSSVKNFLQNL
Q0AAP6_ALHEH/23-343AMRY.GNPSI.ASGL----R-RLRD.Q..---GA.....ER-----I-------VVLPLYPQYSG-STTGSTFDAVADEL
Q7SA94_NEUCR/50-383AFRY.ANPLT.EEMY----K-KLLA.D..---GFGNGRGGR-----A-------VAFTQYPQYSC-STTGSSLNELWKWR
A4SZS0_POLSQ/11-336AMRY.GQPST.QEAL----N-GLKA.Q..---GM.....ER-----L-------LVLPLYPQYSA-TTTASSFDEVFRVL
A6FYS2_9DELT/7-354AMRY.GNPSI.ASGL----E-RLRA.Q..---GC.....DR-----I-------VAFPLFPHYAS-SSTGSAVEKIYAEA
A3QF47_SHELP/11-331GMSY.GNPSL.SSGI----D-KLVA.Q..---GV.....ER-----L-------VVLPLYPQYSC-STVAPVFDAIASDY
A5V0K6_ROSS1/8-309GARH.WHPTV.ADAL----A-HLVQ.T..---GI.....QY-----V-------LVLPLSPVASQ-MSLRSYQETLEHAQ
Q487H7_COLP3/23-348AMRY.GNPSI.ASVL----Q-KFQQ.Q..---GV.....DK-----L-------VVLPLYPQYAG-PTTASTFDAVSKEL
Q02A99_SOLUE/3-300GNRN.WHPLL.ADTM----R-QMAA.D..---GV.....RR-----A-------LAIATSAYSSY-SGCRQYIENLACAS
A7BEQ8_9ACTO/4-371GNRN.WHPFV.TAGL----D-ELIQ.A..---GA.....RR-----I-------LVLPTSAYASY-SGCRQYREDLAEAA
Q4P8W9_USTMA/429-755AFRY.ARPLT.EEAL----D-EMAE.D..---GV.....TR-----A-------VGFTQYPQYSC-STTGSNLNELYREI
HEMH_BORPA/35-354AMRY.GKPSI.PAAI----T-ALRE.R..---GC.....DH-----I-------LAVPLYPQYAA-STTATVVDAVTRHA
A0LUR9_ACIC1/11-319ANRH.WQPWL.ADVV----A-QMRD.D..---GI.....ER-----A-------LAFLTSAYAGF-SSCRQYLDAIEAAR
A5G1D4_ACICJ/11-329AMRY.WHPFA.RDVA----R-EVKA.W..---NP.....ER-----I-------LLLPLYPQFST-TTTGSSLADWHDSA
HEMH_NITOC/16-335GMRH.GSPSI.ETAL----E-ELRQ.S..---GA.....QR-----L-------LVFPLYPQYSG-STTGSTFDAVAQVL
Q2S1S2_SALRD/34-360AMRY.GRPFP.EKVA----A-DMEA.D..---GV.....DK-----V-------VLVPSYPQYAA-GTTGSALAYWKALG
HEMH_YERPS/5-320GMSY.GSPNL.PEAI----E-KLLA.Q..---GV.....TN-----L-------VILPLYPQYSC-STSAAVWDAVARVL
A6CG01_9PLAN/5-308GNRN.WDPLL.TDTL----S-LMKA.D..---GI.....KR-----A-------LAFFTSTFSSY-SGCRQYREDIQRAQ
A4SF51_PROVI/10-337AYYF.VPPYL.EDLL----Q-RLRQ....---EY.....DG-----I-------VVVPMIPVESA-FSCGVACRTVSDVY
HEMH_LISMO/4-307GLKH.IEPFI.EDAV----E-AMHK.D..---GI.....EE-----A-------ISIVLAPHYSS-FSVEAYNKRAKEAA
Q4JSM9_CORJK/13-376GNRN.WEPYV.EDAL----Q-QMAR.D..---GI.....RH-----V-------YVFATSAWGGY-SGCSQYQEDLRRAI
HEMH_PSYCK/8-328AMSY.GNPGL.PDVM----D-QLRS.E..---GV.....DH-----F-------VMLPVFPQYSA-TSTGAVYDAITKWS
A1W6G8_ACISJ/26-346AMRY.GQPAI.GAQL----Q-VLQD.A..---GV.....RR-----V-------LVLPLYPQYSA-TTTASVFDDVAAWV
Q0BPC0_GRABC/29-346AMRY.WHPFA.HETV----R-EVKD.W..---DP.....DE-----I-------ILLPLYPQYST-TTTGSSLTDWREAA
HEMH_BACSK/5-306GLKH.IDPFI.EDAV----Q-KMKN.D..---GI.....ET-----A-------VSIVLAPHFST-FSVQSYNKRAQEEA
HEMH_WOLTR/2-340CMRY.WHPFA.NEVV----K-SVKQ.F..---DP.....DE-----V-------ILLPLYPQYST-TTTLSSIENWQKNA
HEMH_OCEIH/5-307GLKH.IHPFI.EDTV----E-EMAK.D..---GI.....KE-----A-------ISLVLAPHYST-FSVKSYNKRANETA
HEMH_PROFF/4-311ANRH.SMPYM.DQAL----A-DLQS.R..---GI.....RR-----V-------LTLVPTPYASY-SGCRAYREELLAGT
A8H1M0_SHEPA/18-337CMRY.GQPSV.SSTL----Q-RMHQ.E..---GV.....DK-----M-------VILPLYPQYSA-PTTASAFDAIAKEL
Q2GH68_EHRCR/9-323FMRH.SKPSA.KSTI----K-SVCQ.Y..---RP.....DK-----I-------ILIPLYPHYST-TTTLSAIQHWNYHM
A5CDS3_ORITB/6-318AMRY.WNPLI.HEVV----S-QIKE.Y..---QP.....SK-----V-------ILLPLYPQFST-STTLSAIEEFRSSL
Q01W09_SOLUE/2-280GMRN.WHPFV.KETM----D-QVRA.A..---GV.....GR-----L-------ACLCLAPQYSE-MSVGLYMKHAREAA
HEMH_SYNJB/3-322AMRY.WHPLI.ESVV----Q-QIKS.D..---GI.....TR-----L-------VVLPLYPQYSI-STTGSSFKLLDRLW
HEMH_DECAR/17-339AMRY.GSPSI.PEVL----A-HLKA.E..---GA.....KR-----I-------LLVPMYPQYAA-STTATVVDEAANWL
Q2G302_NOVAD/14-333AMRY.QSPAM.AKEL----D-ALLQ.A..---GC.....ER-----I-------LVAPLYPHYSG-ATTASALDAVADWI
HEMH_BDEBA/3-335GLQY.SEPSV.ESAL----K-DLQQ.A..---GV.....DE-----I-------LVAPMFPQYAE-ATNGSSFKLAERMA
Q3B6N8_PELLD/15-332AFHA.TPPFI.SDIL----R-DTR.....---SH.....DA-----R-------LLVSMSPVDSR-MTAGTLHLLAEKCR
HEMH_GEOSL/4-316AMRY.WKPST.MEAL----A-AIRR.E..---GI.....SR-----V-------IALSLYPHYSR-ATTGSSVNELKRVL
HEMH_WIGBR/4-320GMRY.GDPSI.CVAI----K-KMIKIY..---NV.....NK-----L-------IILPMYPQYSC-TTTASVLDSVCEVI
A6QAW0_SULNB/5-315AMRY.VPPFA.DKAL----Y-ACQK.D..---GV.....EE-----L-------ILFPMYPQYST-TTTLSSIEDIEERC
A4NSJ5_HAEIF/6-322AMTY.GNPSM.QSAV----K-NLLK.N..---QV.....ER-----I-------IVLPLYPQYSS-STTGAVFDAFANAL
Q2BIY0_9GAMM/6-329AMTY.GKPGL.TPLL----H-KLSD.T..---GY.....EK-----V-------LLIPMYPQYSA-TTTAPVYDQVAKFQ
HEMH_LEIXX/21-347GNRN.WDPYL.ADAL----T-EADQ.R..---GF.....TK-----L-------IAVATSAYSSY-SSCRQYREDFARAL
B3EFT0_CHLL2/12-332AFSA.SDPSL.EEVI----E-KTK.....---HH.....DA-----Q-------ILVSMSPVDND-LTCGQLCRYLARTR
HEMH_PARUW/4-338AMRY.QNPSI.EEGL----E-RLKL.A..---NV.....KE-----I-------VIFPLFPQYAS-ATTGSVHQEVMKHL
HEMH1_BACC1/4-307GLKH.IEPFI.EDAV----K-DMHN.D..---GI.....QD-----A-------IALVLAPHYST-FSVKSYVGRAQEEA
HEMH_SALTI/5-320GMSY.GSPSL.ESAV----D-ELLA.S..---DV.....DH-----I-------VVLPLYPQYSC-STVGAVWDELGRIL
HEMH_GLOVI/3-322GMRY.WHPFT.EEAV----R-KIKA.D..---GI.....RR-----L-------VLLPLYPQYSI-STSGSSFKLLDQIW
Q8IFK5_9APIC/26-346GMRY.GEKSI.KEGL----N-ILKM.S..---NV.....NK-----L-------LVIPLYPQSAE-CTVASTLDCISKNL
B7KUA6_METC4/33-352AMRY.GKPEV.SLRI----Q-ALLD.Q..---GC.....DR-----I-------LLVPLYPQYAA-ATSATACDQAFKAL
HEMH_ENTFA/3-313GMSY.SEPSI.ETAL----D-TLLS.K..---EI.....EE-----L-------NVIPMYPQYSG-TTVGSVFDSVMNYF
Q1K4G8_DESAC/5-319AMRY.WGPRA.DEVV----Q-RIVA.Q..---GI.....KE-----A-------VVVSLYPHYTG-ATTGSSIKDFKRAV
HEMH_SULDN/3-316AMRY.TPPFV.SEAI----E-RLSD.K..---NI.....EK-----I-------YLIPLYPQYST-TTTKSSLEDFEEQY
B0T6D4_CAUSK/5-319AMRY.WKPLT.NETA----K-AVKA.F..---AP.....DE-----V-------VLLPLYPQFST-TTTGSSLKAWSRAY
HEMH_NEIG1/17-332AMTY.GNPSI.ADVL----A-ELKS.Q..---GV.....GR-----L-------LAIPLYPQYAA-SSSGAAVDKVCEQL
Q544X6_MOUSE/67-388GFRY.VHPLT.EEAI----E-EMER.D..---GL.....ER-----A-------IAFTQYPQYSC-STTGSSLNAIYRYY
A3J3F3_9FLAO/2-336AMRY.GTITI.QKGL----Q-ELKD.K..---GV.....TE-----V-------MLMPLYPQHAM-ASTTTILVLAEELR
A1ZL88_9BACT/9-355GMRY.QNPSV.QVAL----D-RLKN.K..---GL.....ER-----I-------IVIPLFPQYAS-ATSGSVHQKVMELV
HEMH_TROWT/30-349ANRN.WQPQL.EEVL----R-EAYD.R..---GF.....RA-----F-------LTLFTSAYSCY-SSCRQYREDIAHAV
HEMH_LACC3/3-312AMNYGGEYPI.GETL----Q-TMAA.R..---GD.....AP-----I-------VVIPLFPEYTQ-STTKTILDKVAASG
A3UYB0_VIBSP/6-320GMTY.GNPSL.KAGV----E-QLME.Q..---GV.....ED-----I-------IVLPLYPQYSG-TTTAAVSDGLTKAF
A7C270_9GAMM/16-336GMRY.GNPSI.ATGL----E-QLRQ.A..---NA.....QR-----I-------LILPLYPQYSA-PTTGSTFDAIADVL
Q8GKR2_CORGT/9-320GNRN.WKPFG.NEAA----E-QMAD.D..---GV.....KN-----A-------LVLATSAWGGY-SGCQQYQEDIRGMI
HEMH_METCA/7-321AMRY.GNPSV.RLKL----E-ELRN....---RV.....ET-----I-------VVLPLYPQYSA-ATTGSAFDAVCDTL
HEMH_CAMFF/2-314AMNY.TPPFA.IDSL----K-KYKY.A..---.......DE-----I-------LLFPLYPHHSR-TTIVSSLDSANRAI
Q1NA21_9SPHN/14-328AMRY.GNPAI.GERL----K-AMKQ.A..---GC.....DR-----I-------LLAPLYPQYSG-ATTATANDAAFAAL
B3EK40_CHLPB/21-336SFFV.TPPFV.EQIV----E-QVR.....---DC.....DM-----L-------LLIPMAPIDNR-LMSGSLEILAERYL
HEMH_LEUMM/3-312AMTY.RKPNI.AETL----K-EMRL.A..---GA.....DD-----I-------VVLPLFPQYSV-TSTQSVIDQVRKAD
HEMH_LACPL/2-311AMTY.GQPDI.GATL----K-AMVA.D..---GC.....EK-----P-------IILPLFPQYTQ-STHGGIHRQVEATG
A3UIC5_9RHOB/4-317AMRY.WHPFV.DEAV----K-AVKA.Y..---QP.....DE-----I-------VLLPLYPQFST-TTTGSSFKAWRDA.
A7NKU7_ROSCS/7-309GMKH.WHPFI.AETV----P-RIAR.D..---GV.....RE-----V-------VALVLAPHYSR-MSVGGYRKYLDEAN
Q6BFD7_PARTE/32-353AFRY.GLPLQ.EDAI----E-YAFEKTEG---RI.....QK-----F-------LLFSQYPQYSC-STGGNAIRNAIELL
A1AWG9_RUTMC/9-331GMRY.GNPSI.SSAL----D-KLRA.K..---GC.....EK-----I-------IVLPLYPQYSN-TTTLSTLDAINQTL
Q9ATG7_9CHLO/62-386GMRY.WHPFT.EDSI----K-QIKA.D..---GI.....TK-----L-------VALPLYPQYSI-STTGSSLRCIRDEF
HEMH_LEPBJ/4-338TMTC.GYPDI.RKLN----R-DFLV.P..---T......KQ-----N-------ILLPLYPHFSR-STVLSTAKLVEQTT
B4S748_PROA2/5-331AYYF.VPPYL.EDTL----E-ELRE....---TY.....DG-----V-------VVVPMIPVESA-FSCGVACQMISDVY
HEMH_AZOSB/17-335AMRY.GAPAV.ADKL----G-ALRA.A..---GC.....TR-----I-------LVVPMYPQYAA-STTASVMDEVARCL
Q00YL8_OSTTA/64-389GMRY.WKPFT.EDAI----D-AIKR.D..---RV.....NR-----L-------VVLPLYPQFSI-STSGSSLRLLEQCF
Q0FE11_9RHOB/14-337AMRY.GNPST.ESVI----K-NMKD.Q..---GV.....EK-----I-------VFFPLYPQYAG-PTTATANDEAFRTL
Q1ITV1_KORVE/3-296GMRN.WHPFV.ADTI----E-QMKQ.D..---GI.....EH-----C-------VALCLAPQNSR-TSVGLYRKALMEKN
A4BAF4_9GAMM/14-332AMRY.GNPDI.ASRL----D-AMRA.A..---GC.....DR-----L-------LVVPLYPQYSA-TTNASVNDAVFDHL
HEMH_BRUA2/27-348AMRY.GQPSI.ESIT----D-RLLQ.Q..---GC.....ER-----I-------VIFPLYPQYSA-TTTATVNDKFFEAL
Q0YQ48_9CHLB/46-338AYYF.VPPYL.DDML----S-ELRR....---DY.....DG-----I-------VVVPMIPVESA-FSCGVACQMVMDVC
HEMH_CORDI/12-330GNRN.WHPFV.NDTA----E-KMVR.D..---GV.....RN-----V-------AVFATSAWGGY-SGCRQYDEDIVRMN

PF01903

P71751_MYCTU/53-151-------------------------------DI......PA......QIA.....SCRVG--------------------
Q7UNS6_RHOBA/42-150-------------------------------DI......PD......AVE.....AVARQ--------------------
Q82UF1_NITEU/52-144-------------------------------LI......RT......LVT.....EENQT--------------------
CBIX_METJA/9-138-------------------------------DI......PR......LLG.....LIEDN--------------------
Q7V242_PROMP/174-278-------------------------------.I......KR......QSD.....IVALD--------------------
CBIX_HALSA/9-130-------------------------------VI......PR......ELR.....LDDFD--------------------
CBIX_HALSA/152-263-------------------------------DI......PED...MGLTD.....DYRTG--------------------
Q81FY5_BACCR/9-114-------------------------------DI......PF......ELE.....KLTNQ--------------------
Q8FM68_COREF/9-112-------------------------------DV......PE......AVS.....NAQQR--------------------
Q8CN68_STAES/9-113-------------------------------DI......PQ......ILK.....EMKAR--------------------
CBIX_ARCFU/10-119-------------------------------DL......PD......LLG.....FPRGR--------------------
CBIX_SULTO/9-108-------------------------------DI......PK......QLE.....EIKGV--------------------
Q9X2M7_STACA/9-114-------------------------------DI......PT......IMK.....EMQLM--------------------
Q8TKD6_METAC/3355-3469-------------------------------.IKYMLGLPS......TLE.....DAAAQ--------------------
Q7U7Z1_SYNPX/16-120-------------------------------DI......PS......VLN.....TFTAE--------------------
Q7VCD4_PROMA/148-252-------------------------------.I......RK......YVQ.....LVALD--------------------
P74414_SYNY3/23-131-------------------------------DL......PQ......AIA.....QAKAE--------------------
Q8NV21_STAAW/9-113-------------------------------DI......PN......IVH.....EMKRR--------------------
Q8EXP3_LEPIN/11-115-------------------------------DI......SL......ILS.....DLKRE--------------------
Q7V757_PROMM/20-124-------------------------------DI......PS......VLN.....NYAAE--------------------
CBIX_BACME/14-118-------------------------------HI......PA......AID.....EAKEK--------------------
Q82BN1_STRAW/64-163-------------------------------DI......PD......AAA.....AATRV--------------------
Q9RZD7_DEIRA/3-101-------------------------------VI......PR......ELG.....FEWRG--------------------
Q96ZL1_SULTO/11-123-------------------------------DIMGSFGVSE......FYK.....WVKST--------------------
Q8XWQ5_RALSO/11-116-------------------------------DL......PA......LVE.....RCAQA--------------------
SIRB_BACSU/10-115-------------------------------DI......PE......EIV.....RVASR--------------------
Q7NDP2_GLOVI/28-133-------------------------------DV......TN......ELD.....RARER--------------------
Q7NXQ9_CHRVO/13-118-------------------------------DM......PS......ELL.....ALQQA--------------------
Q81FY5_BACCR/133-233-------------------------------.I......EK......EVR.....QYEVE--------------------
Q7NXQ9_CHRVO/143-247-------------------------------.I......YG......AAA.....DLAAR--------------------
CBIX_METKA/9-134-------------------------------DI......PK......MLG.....LEPEW--------------------
Q7VCD4_PROMA/20-124-------------------------------DI......PA......VLN.....DYSLK--------------------
Q8DJ31_THEEB/165-269-------------------------------.I......YR......LTA.....AAQAA--------------------
Q829K6_STRAW/144-248-------------------------------.V......RQ......QTE.....GWAAA--------------------
CBIX_METTH/18-137-------------------------------DI......PH......ILG.....LDNGA--------------------
Q8DHP8_THEEB/20-121-------------------------------DL......PL......AIA.....AAESV--------------------
Q81E58_BACCR/9-114-------------------------------DI......PL......EIA.....KMKNQ--------------------
CBIX_SULSO/9-118-------------------------------DI......PR......LLG.....IDNDE--------------------
Q82L75_STRAW/11-113-------------------------------DI......PA......VLR.....EAPSR--------------------
Q7UNS6_RHOBA/198-298-------------------------------.I......ER......QTK.....EVATK--------------------
Q8DJ31_THEEB/33-138-------------------------------DV......TN......ELD.....RARRA--------------------
P74414_SYNY3/149-243-------------------------------.I......RK......ERE.....QLQLV--------------------
Q7U7Z1_SYNPX/145-249-------------------------------.I......RQ......HTE.....RVAAD--------------------
Q8YZE1_NOSS1/3-102-------------------------------DI......PS......EVT.....QAQQA--------------------
Q8EXP3_LEPIN/133-237-------------------------------.I......YH......IAK.....EFSEK--------------------
Q9L2E8_STRCO/21-118-------------------------------DI......PE......MAA.....ASPAR--------------------
Q8YZE1_NOSS1/117-213-------------------------------.I......AQ......AVE.....ALKLQ--------------------
Q7NHF8_GLOVI/27-130-------------------------------DL......TE......ALR.....RARRA--------------------
Q9KCS3_BACHD/144-248-------------------------------.L......QA......KVN.....ELNET--------------------
Q82L75_STRAW/135-230-------------------------------.................IA.....RGAAE--------------------
SIRB_BACSU/134-236-------------------------------.I......ER......EVQ.....KLKAH--------------------
Q9L2E8_STRCO/140-233-------------------------------.........................CAAA--------------------
Q9RS86_DEIRA/9-126-------------------------------VL......PR......ELG.....LGHQG--------------------
Q84JH7_ARATH/89-194-------------------------------DI......PS......LTA.....DAAKE--------------------
CBIX_SYNY3/164-268-------------------------------.I......FT......ITE.....EQRAT--------------------
Q8EQN8_OCEIH/9-114-------------------------------DI......PE......EVE.....RIKVE--------------------
Q7V242_PROMP/46-150-------------------------------DI......PS......LLM.....NYAKK--------------------
Q9RZD7_DEIRA/122-231-------------------------------TI......PHDLGLTGAVT.....EFPEL--------------------
P95216_MYCTU/123-221-------------------------------.................LR.....ASGAD--------------------
Q8ZZB2_PYRAE/8-112-------------------------------DI......LG......ELG.....VEMGK--------------------
Q8NLX3_CORGL/9-112-------------------------------DV......PE......AVK.....DASEK--------------------
Q93IF7_PROFR/147-251-------------------------------.L......SE......QVD.....AWLET--------------------
Q8TKD6_METAC/423-539-------------------------------.I......KY......ILGISSSITEEDA--------------------
CBIX_BACME/141-245-------------------------------.L......EE......MVK.....QYKMQ--------------------
Q82BN1_STRAW/189-282-------------------------------.........................CAEA--------------------
Q93IF7_PROFR/12-121-------------------------------DI......PE......FIE.....AGRDG--------------------
CBIX_SYNY3/32-137-------------------------------DV......TN......ELD.....RSRQA--------------------
CBIX_METMA/12-124-------------------------------DI......PE......ILS.....LDKEG--------------------
Q9KCS3_BACHD/9-115-------------------------------DI......PQ......EIE.....RAEKK--------------------
Q8EQN8_OCEIH/134-236-------------------------------.M......ES......EIN.....NMEKK--------------------
P95216_MYCTU/8-105-------------------------------DL......PA......HVA.....A..SA--------------------
Q829K6_STRAW/13-118-------------------------------DI......PA......ALA.....REKER--------------------
Q7NDP2_GLOVI/156-260-------------------------------.I......QE......TAA.....LQQTL--------------------
Q7NHF8_GLOVI/150-253-------------------------------.I......TW......EVD.....RLANE--------------------
Q8XS58_RALSO/22-127-------------------------------DM......PS......ELL.....ALKQA--------------------
Q97WC4_SULSO/14-126-------------------------------DI......MG......ELG.....IQRLN--------------------

PF06180

Q8Y7R9_LISMO/3-255-------------------------------DMASDEENSW------KST-----LEQAG--------------------
Q8KFD8_CHLTE/13-299-------------------------------DIADDDTGSW------KGA-----FEAAG--------------------
Q8R628_FUSNN/14-265-------------------------------DMAV....TY------KEE-----LEKNG--------------------
Q97JB3_CLOAB/3-262-------------------------------DMAGNSEDSW------KNI-----LTSNG--------------------
Q8XL14_CLOPE/3-261-------------------------------DMASDEEDSW------KSR-----FESEG--------------------
Q57MX2_SALCH/3-257-------------------------------DMASDDGDSW------KMR-----FNAAG--------------------
Q9RMI6_PORGN/31-292-------------------------------DMAGDEDDSW------KTL-----LTNAG--------------------
Q97LH8_CLOAB/3-263-------------------------------DM....QEEW------VNI-----FKDKG--------------------

PF00762

HEMH_COXBU/19-351..SF..............K....E....MT.VIDRFFEEPH------YID-----SMTTL....IHENLNE.F.......
HEMH_RHIEC/19-340..LS..............MRWQPA....LR.TVPDYHDDET------YIE-----ALAQS....VERHLSS.L.......
HEMH_CAUCR/4-317...................KGSGV....QT.TVGCYPTEGG------LIE-----AHARM....IRESWEK.AG......
HEMH_METFK/17-337..IR..............TRNMPE....IR.TIRDYHDHPA------YIH-----AVAKS....IRLYWQQ.H.......
HEMH_FRATW/10-329..SK..............LRWQPT....IK.GINPYYDNKF------HIQ-----TISQQ....IKEHLKK.L.......
HEMH_RHOBA/7-309..EE.............VGEGAPL....VE.KVRMGFNHPG------FIA-----AMADN....VSKAAQT.IG......
A7JUM6_PASHA/6-320..KA..............QRKIVP....FD.FIHSYHNDPL------YIQ-----ALANS....IDV..KP.D.......
Q3A6H8_PELCD/15-332..VR..............FCPELD....YR.LIHDWFDWPP------FLD-----ALAHL....VREALAR.FDG.....
A0JYM7_ARTS2/30-358..TETG..........LDGKL..E....VD.KVRQYFDHPG------FVE-----PFVEG....TAAGLAD.VR......
A7GM50_BACCN/4-305..RE...............IGGPV....IE.PIEQWYDEPK------FIA-----YWANQ....IKETFGK.IKH.....
Q1N3F6_9GAMM/5-324..KR..............CPHLPE....MR.FVNEYHQHPL------YIQ-----ALTNS....VKEYWKE.H.......
Q2IPY0_ANADE/3-312PKDR.............P..........LA.EVCTWHDHEG------YLD-----ASAAA....LRETLEQ.VPA.....
HEMH_LEGPC/2-331..AN..............QEIIPS....IK.IIRDFYQRPE------YIQ-----AQAKI....MKPYIKD.N.......
A3I3M0_9BACI/5-305..GD...............R..LT....IT.SVESWYDEPK------FIE-----YWKQQ....INDTFKS.MSE.....
HEMH_STAAN/4-307..AK...............YG.IQ....LT.HVKHYYEQPK------FIE-----YWTNK....VNETLAQ.IPE.....
Q1GQW0_SPHAL/14-327..KT..............LRWQPA....LR.FLPPYHDDPA------YLA-----ALKAS....VEAGLAT.L.......
A6W899_KINRD/11-329..QALA..........EEGRSL.E....VD.KIRHYFNHPA------FTD-----VNAQA....VAAALEE.LP......
A7T926_NEMVE/2-249............................WS.M.........------...-----....D....................
A0NNM3_9RHOB/33-355..LK..............MRWQPA....IR.TVPPYHDDPV------YVT-----ALAKS....VERHLES.L.......
Q0YS02_9CHLB/6-332SPGEL...........GN..........VR.VLSRFWADEQ------LHR-----LYLDH....LFQSGGE.K.......
A6ELJ2_9BACT/3-339..AE..............HFPQVK....IT.RTAAFSKRKD------YVD-----VLSQS....IAEGLEN.........
HEMH_PSEPW/3-337..AE..............RALPLQ....LR.VLQPFYDHPE------YID-----ALVAS....ARPYLEQ.........
A1SXP1_PSYIN/19-339..CK..............WRWVPE....LH.FINGYHKNES------YIN-----SLANS....VSEDLEA.N.......
Q0G0T3_9RHIZ/27-348..MR..............QRWMPA....VR.TVPAYHDEPV------YID-----ALAKS....IESHLST.L.......
A4A641_9GAMM/16-336..SK..............RRWIPD....LQ.FVASYHDQPG------YIS-----AIADT....IRNHWKS.H.......
A6GNF2_9BURK/14-338..KP..............VRNIPE....LR.LVKHYHDHPA------YIH-----ALAES....VRKHWQA.H.......
A3ZL09_9PLAN/3-305..VE.............VGDQAPR....CD.KIRTYYNHPG------FIE-----TMSSC....VRESLDQ.IP......
Q5KFH8_CRYNJ/49-370KQLGW............GGNGEVK....WS.VIDRWPTHPG------LVE-----AFAHN....IKAALQT.YPE.....
Q47NJ1_THEFY/4-317..AA.............V.PEAPE....ID.LIRPFYDHPG------FID-----AFVDH....TRQALER.IP......
A6EVP6_9ALTE/16-336..TR..............RRWLPD....LR.FVSHYPDYPP------YIE-----AMANH....IQAHWDK.H.......
Q3SU51_NITWN/22-343..SE..............MRAQPT....LR.VTPPYYDDPD------YID-----ALAVS....IETHLAS.L.......
Q6AB01_PROAC/16-329..AH.............AGITDMQ....VD.KVPPFNEAPG------FIR-----ANAEA....LMQAFMR.IPP.....
HEMH_ZYMMO/13-326..QK..............IRWQPN....LR.SLEPYYTHPA------YIQ-----TLKKN....IEDQIKA.L.......
HEMH_WOLSU/2-314..AL..............LSYFPK....TK.EIDRYFEDSN------YNE-----AIIDR....ILEALGG.DN......
A6VPL9_ACTSZ/8-324..QS..............TRKMLP....FS.FIHSYHLDEN------YIN-----SLTES....IKVRLKN.D.......
Q2Y6A8_NITMU/15-335..AK..............LRNIPA....VR.TVKHYHDHPG------YIA-----ALANN....VRDHWAR.A.......
Q26GH9_FLABB/2-337..KE..............HFPHMS....FT.TMPPFYNHPD------YIR-----VLSES....IKESLEG.........
HEMH_RALPJ/16-344..GE..............MRNQPE....LR.LVKHFHDDPA------YIN-----ALHQQ....VGAYWAQ.H.......
HEMH_THICR/16-340..QQ..............WRWIPE....LR.FVRNYHKHPG------YIK-----ALANS....IREHQAE.H.......
A4X999_SALTO/20-328..AA.............VGPDAPV....IE.KLRQFWDHPG------FVE-----PHVDA....VRTALAQ.LD......
HEMH_PSEA6/16-336..RK..............TRWIPD....VR.FISHYHDFTP------YID-----AVAGS....ITEHWAT.H.......
HEMH_CHLAB/4-308PSLN........................IS.WVAHFGNHPQ------FIS-----CMIDH....ILEFLQS.HDI.....
A3TKF4_9MICO/13-330..EELG..........LAAVDL.D....ID.KVRPYALHPG------FTA-----VNTEH....LVDSVST.ID......
HEMH_CHRVO/19-339..SR..............LRNMPE....VR.TVRHFHDDPG------YIA-----ALAAQ....IRKHWQY.G.......
HEMH_GEOBB/4-316..KE..............SGAKFE....IS.YIDRFYNHPL------YIK-----ALSEK....VVQGLAS.FP......
A8L1D5_FRASN/20-328..EQ.............VGPGAPD....LV.KLRLFFDHPG------FVE-----PMVDH....CVRALAS.LP......
Q1DC34_MYXXD/7-344..AQ..............SWDVPF....VR.AVPAFFEHPG------FLD-----AFTAV....ARPVIDD.........
A0Z184_9GAMM/16-336..VT..............RRWLPN....FR.FIANYCDDPG------YIA-----AVAAS....IRQHWEQ.H.......
HEMH_PHOLL/5-320..QK..............YRTIPG....MH.FIRSYADHPA------YIS-----ALKET....IEQSFDK.H.......
A5DAX3_PICGU/50-370LELD..............PERKIK....WS.VIDRWPKQAG------MVK-----AFSQH....ITDKLNE.FPE.....
Q2VYH0_MAGSA/8-320..ER..............QGLVVP....TR.MACCYPTEPG------LVD-----AMADL....AKAGHQE.AA......
A3EV75_9BACT/12-335..KR..............IAPGLP....VR.TIPAWPVYPP------YIK-----SLAET....VGDALSR.IP......
B1YKJ8_EXIS2/3-305..DK...............HG.IH....LA.SVESWYKEEA------FID-----WWGTE....IRKTFDA.LPV.....
A6F7X3_9GAMM/3-322..QA..............TIDAPS....VS.LVKHYHNHDT------YID-----ALALS....IERHWQE.N.......
A0YYR5_LYNSP/3-322SEDP..............ALQDIN....YT.VIPSWYDRPG------YLQ-----AMSQL....IAQELDH.CQ......
HEMH_THEVO/2-285..EK..............NDIRTK....ME.FVNGISNYDL------FIP-----MWIHL....IEEKEKG.D.......
Q1V1A3_PELUQ/2-316..KK..............NNYHVK....TN.TICCYPTDQN------FIN-----AHTKE....IIKKIKD.L.......
Q2GCY1_NEOSM/3-304.....................RIP....TQ.VVCCYYDNQL------FIE-----AHVET....ILPIYAE.AC......
Q7QG25_ANOGA/28-351KENPL............NGLAQAR....WS.VIDRWGTHPL------LAK-----TFADN....IRKELDK.FPA.....
Q118M8_TRIEI/24-354..VK.............LADKNEHWIKGQR.YIPSFYNEPD------YIN-----LMAKM....VEEQIAN.DLAV....
Q1NVN4_9DELT/7-321..AT..............HDDFFT....CR.EINAWPEQPD------YLA-----ALSET....ISQGATA.FG......
HEMH_CHLPN/3-309..PE..................IP....IS.WIPQFGSDSK------FVS-----LITCH....IRDFLQK.LGI.....
HEMH_ACIAD/8-328..PK..............QRHLPG....LT.IIKDYYRHPV------FIQ-----ALVSS....VQRFQQQ.H.......
B3E8G1_GEOLS/3-313..AD..............LDSDLE....VV.RIPHFYDHPL------YID-----ALTEK....IEAGLAS.FP......
HEMH_AQUAE/2-309..KA.............LKADHIK....VK.KIEHFYDHPL------YIK-----AWAEQ....IKQSVEK.........
B4SCY0_PELPB/6-328KAEEL...........GK..........VK.VLSRFWNDEQ------LYS-----IYCDH....LFEQ..R.S.......
A4ETD1_9RHOB/25-348..ME..............ETWQPA....AR.TIEPYFDDPA------YIE-----ALARS....VEEAYGQ.A.......
HEMH_THEAC/2-283..RR..............YGFSPR....LE.FVNGLANSDL------FLP-----MWANI....ISEDASE.D.......
HEMH_CHLMU/1-303PEKP........................MA.WITHFGVHPQ------FIS-----CMREH....IQDCLIA.QGI.....
A2VI04_MYCTU/3-299..RA.............AGRDAPE....LV.KLRPYFDHPL------FVE-----MFADA....ITAAAAT.V.......
HEMH_GLUOX/17-337..MR..............LRRQPA....VL.TVPSFPDHPA------FIR-----ALETS....VQDTLAG.L.......
HEMH_HERAR/16-335..AR..............ERNVPE....LR.FVKHYHDHES------YIR-----ALQKS....VLAHWDM.A.......
HEMH_DICDI/45-386EEKQ..............MQSKFK....WS.VIDRWQDHKG------FID-----ATIHK....IKKAYNQ.FNSKLREL
Q65DD6_BACLD/5-307..AA...............IGGPR....IA.SIDEWYQEEG------FIR-----YWSEE....IGSILND.MSE.....
A0L8B7_MAGSM/5-325..HI..............HRLMPT....LR.VMTPYYAQDA------YID-----ALVAS....LEGVDLS.E.......
HEMH_CAMC1/2-313..EE..............LKLKAK....IS.LCEPFYDDDT------YNK-----IIISH....IREAIKD.TD......
Q5PA48_ANAMM/8-324..RK..............ACYAPD....TR.IICCYHTHKD------YIA-----AHCKL....ILDEYNKAAM......
Q2GL73_ANAPZ/4-320..HK..............AGYSFW....TD.IIWDYHSDEH------FIA-----AHCKL....ISEAYEKALA......
HEMH_STRM5/6-319..RR..............NPGV.T....VS.LVRDYSVDPG------WVE-----AVAGS....IRRYWEQ.Q.......
A7A2C1_YEAS7/38-357KALD..............SERSIS....WS.VIDRWPTNEG------LIK-----AFSEN....ITKKLQE.FPQ.....
Q0F558_9RHOB/16-336..TT..............RRWLPD....LR.FISHYHDDAR------YIA-----CLAES....IKAHWAA.H.......
A4U0X7_9PROT/2-312..................ANSFGE....TR.TVCCYPVEPG------LIR-----AMAAK....IRVEWDQ.AV......
HEMH_PELPD/5-317..AR..............SATPFQ....VT.CVRQFHDHPL------YIT-----SLCDR....IGQALSG.YA......
HEMH_STRP2/2-294..IQ........................FL.VIKDWYQEEA------LLN-----YWADE....IAKILKE.EVK.....
A4SLY2_AERS4/4-323..KK..............ERNLPV....VR.LIRDYHAHPE------YIQ-----ALAMS....VRRHWEQ.K.......
HEMH_SYNSC/3-326QADP..............AFEKLP....IR.CIRSWFDHPG------YVK-----AMAEL....IAAEVRN.SD......
Q0AKE0_MARMM/7-318....................GGPE....TR.TVCCYPVEPA------FLD-----AHAAL....IRKSWEK.AG......
Q0AHZ2_NITEC/18-338..GK..............MRNIPD....IR.TVKHYHDDPG------YIA-----ALAQN....VRDYWEK.H.......
A1SKT0_NOCSJ/8-323..AALG..........EDLEDAPV....LD.KLRHPFNHPG------FVE-----PMVDA....TLAALAD.LP......
B4S8P2_PROA2/4-319SSQSQ...........MR..........PK.VISGFWNDPD------LLN-----ISLDH....LFMHAA..........
HEMH_HYPNA/4-317.....................KGK....SR.TICCYPFEEN------FVS-----AHVDQ....IMAAWER.AG......
A5EXB1_DICNV/10-330..EK..............TRALPE....IR.FVHHWHDHKN------YLD-----ALAAA....FQHYLSK.N.......
Q3AEU4_CARHZ/2-291..EK...............FPEIK....FY.FKGGLAEEPY------FIE-----AHRQL....LTTALQP.FS......
HEMH_LEPBI/8-339..KF.............GECPVGS....GG.YVPHFGLDPN------FHS-----ISAKFIYEFFTNQLPK.DQYLHYPE
HEMH_BURXL/16-340..KR..............MRNQPE....IR.TVRQYADHPA------YIA-----ALAAQ....VHQYWHQ.H.......
HEMH_ALCBS/16-336..MG..............RRLLPD....LR.FISHYPDYPP------YIQ-----AMAEH....IRAYREK.N.......
HEMH_MANSM/5-321..KR..............HRHIVP....FE.FIHSYHLDEN------YIE-----ALVKS....IKVRLKN.D.......
HEMH_MYCAV/3-298...............................QAAAVFRPSA------VRG-----DVRRR....DADAAAK.VP......
HEMH_VIBF1/5-319..KT..............TPVLPN....FT.MIHNYHDHPL------YIK-----ALANS....VRQSWER.N.......
Q2RN84_RHORT/3-322..EK..............AGLTAQ....TH.TVCCYATEVG------LIT-----ALAERTLGGLEQVRESTVGL.....
A5VF70_SPHWW/15-329..AK..............MRWQPA....IR.TLPPYFDHPA------YID-----ALAAS....VRDGLAA.F.......
HEMH_SCHPO/32-352IEKG..............MEKDFE....WS.IVDRWPLQQG------LIN-----AFAEN....IEETLKT.YPE.....
HEMH_THIDA/16-336..RR..............TRNQPA....LR.TLKHYHDHPE------YIR-----ALAAN....LRDYWQM.H.......
A7HSJ5_PARL1/7-322..AK..............AGLSAP....VK.TVCCYPLAPG------FIA-----AHVAL....LRDVIAK.AG......
A7I208_CAMHC/3-312....................MSKD....FK.ICEVFYKNEK------YNE-----ILLNL....IKDEISN.FSA.....
HEMH_PSEAB/3-337..AA..............HRLELE....VS.TLPPFYDQPV------YLD-----ALVES....VRPYLQQ.........
HEMH_POLSJ/20-339..AR..............VRRIPE....FR.FVNNYHDDPG------YIS-----ALAER....VRTHWRH.Y.......
A3HXU8_9BACT/6-342..RG..............WQIIPE....IT.FVNNFIDHPL------FLK-----AWKEL....GEDMMKD.........
Q21PI6_SACD2/17-337..AS..............RRWLPE....LR.FVNHYNSHPD------YIN-----ALVNS....IRAHWGK.H.......
Q1YSP8_9GAMM/17-337..TK..............TRWVPE....LH.FIGGYQQSET------YID-----ALCET....IRKQFDE.H.......
B3EI90_CHLL2/10-337SENRY...........SR..........IR.LLNKLWRDPE------LHR-----IYVDY....LFSKVD..........
Q2RZ44_SALRD/6-342..KA.............GEIPAWP....TT.SVFEYATYPK------YIE-----ALSDR....IDEGLER.FPD.....
Q11PE0_CYTH3/9-344..GK..............WEITPH....IE.VISKFFDHPL------FIK-----AFAEI....GRKYLAE.........
HEMH_HELPY/20-333..KS.............LETFRPK....VR.VIERFYASKK------LNK-----IILNT....ILNTLNN.RK......
B4U5Z6_HYDS0/3-310..KK.............SSLKDTP....VK.EIRDYHDHPL------FIK-----AWTEN....IKNSGID.........
HEMH_DESPS/5-316..KK..............KNISLP....LT.EIPSWPKQRD------YIA-----AIAAN....IKKGLAT.FH......
HEMH_DEIRA/9-312..EM..............NHGHID....FA.YIDNYHTEPG------YIT-----ALADR....VRIGIQE.FPE.....
HEMH_NOCFA/3-313..AA.............VGPAAPH....LT.KLRQYFDHPL------LIE-----AFADA....IRAALER.LP......
A4BNN9_9GAMM/7-327..RK..............RRVMPH....LR.LLRDYHDHPD------YIS-----ALAAS....IREYWQQ.H.......
Q6L0G9_PICTO/3-286..KK..............YNVTAR....VR.FLNGLEDQEL------LYS-----AWIEK....ISGHMYN.E.......
HEMH_SYMTH/3-318..DG..............WRDLPE....QI.FIRDFPTHPK------YLA-----FLTER....ISGYIAE.K.......
A3WGM8_9SPHN/19-340..RE..............MRWQPA....LR.FLPPYHDDDL------YLT-----ALADD....LTRQVNA.L.......
Q6C140_YARLI/28-348KELD..............PNEEIE....WS.VIDRWPTHPG------LTK-----AMADN....VKEQLAA.YEKE....
A4SGR5_PROVI/4-322IAENN...........AR..........PPVVISGFWDDPM------LYR-----VYLNH....LFSHAS..........
HEMH_STRCO/10-330..AALE..........SEGLELPK....ID.KLRHYFNHPG------FVE-----PMVDG....VVRSLAE.LP......
A1BDR1_CHLPD/6-328TGPEL...........TK..........VK.VISGFWRDEN------LYA-----LYLSH....LFEQ............
Q8IFR0_PLAFA/26-346..KN..............WSNVPE....LR.FISGYCLKDI------FIN-----TMKEN....IENYWEL.Y.......
A6DEA9_9PROT/2-294FKGK........................VK.IINPFFENEK------FNE-----IIKEN....ILKEVDN.P.......
HEMH_LACRD/3-310..PE........................AK.IIDRFSAEED------YLD-----LLAKQ....IQTAWDR.G.......
A1F5I4_VIBCL/10-324..RQ..............LPVVPE....LH.FIRDYHDHPL------YIQ-----ALAKS....VRASWQQ.H.......
A5PCT0_9SPHN/19-336..GK..............MRWQPS....LR.TLPPYHDDPA------YID-----ALEAD....LTRQLSA.L.......
HEMH_LACLS/4-313..DK........................IN.VIRDFHQIES------YTD-----LLAES....IREKWQA.N.......
HEMH_STRMU/5-319..KK..............KKDIPP....FD.FIHHYYERPS------YIQ-----ALAQT....IHL..QE.N.......
HEMH_RICCN/4-312...................DIDIP....IK.TICCYPLEKD------FIK-----AHVSL....IKEKLYD.........
Q0AAP6_ALHEH/23-343..KR..............WRWVPE....FR.FIGQYHDDER------YIE-----ALAAS....IREHWAE.H.......
Q7SA94_NEUCR/50-383QRLEGKAG.....PSEDGKDGTIR....WS.VIDRWPTHPG------LVE-----AFARN....IEEKLAE.YPE.....
A4SZS0_POLSQ/11-336..GT..............WRDQPE....LR.LVKHYHDNPA------YIA-----ALRDQ....VLSSWDK.N.......
A6FYS2_9DELT/7-354..GK..............LWNTPY....VT.IVPAFYDHPA------FIE-----AFAAV....GRPVLDD.........
A3QF47_SHELP/11-331..KG..............RRNYPE....TR.FSKEYFEHPA------YIA-----ALAGS....VRRHWQD.K.......
A5V0K6_ROSS1/8-309..TE..............VAQPVR....LH.LIPDWPDLPG------YRS-----ALTIN....ATLALER.LPD.....
Q487H7_COLP3/23-348..QK..............WRYIPS....IH.FLNTYHNNPF------YIQ-----ALAET....VKEHVAS.H.......
Q02A99_SOLUE/3-300..AA.............AGPNAPA....ID.KLPPFWNQPG------FVE-----ANADR....VSDALAR.LP......
A7BEQ8_9ACTO/4-371..EALRDKWGTIELGAEDSADNPDADIILD.KVRPYYSTLG------MAS-----AQIAS....VRRAWEA.LAAR....
Q4P8W9_USTMA/429-755QRRKER..........GAPEANIS....WS.LIDRWPTHPL------LVE-----AFTNR....IQAVLDT.YPE.....
HEMH_BORPA/35-354..GR..............LRDQPA....LR.FVKRFHNDPA------YVE-----AQAGR....IAEFWQA.H.......
A0LUR9_ACIC1/11-319..RR.............VGPRAPR....ID.RLRQYFNHPG------FIE-----PFRDA....TQSALAT.LP......
A5G1D4_ACICJ/11-329..AR..............AGLVAP....TT.TLCCWYDDPA------FAA-----ATAEP....VIRTYET.ARAE....
HEMH_NITOC/16-335..ST..............WRWVPE....LR.MIAQYHDHSG------YLE-----ALAET....IRRSWKE.A.......
Q2S1S2_SALRD/34-360..AR.............GERPSWP....TT.VVPEYAANPK------YVQ-----AVSER....IDEALQR.FPR.....
HEMH_YERPS/5-320..KG..............YRRLPS....IS.FIRDYAEHPA------YIS-----ALKQS....VERSFAE.H.......
A6CG01_9PLAN/5-308..KE.............VGAGAPE....VD.KLRVFFNHPG------FIE-----ATVSR....TREALEQ.IP......
A4SF51_PROVI/10-337GNERY...........SL..........VR.LMNKFWADDE------LQR-----IYVDH....LFNRLS..........
HEMH_LISMO/4-307..DK...............LGGPR....IN.AINDWYKQPK------FIQ-----MWADR....INETAKQ.IPA.....
Q4JSM9_CORJK/13-376..AACE..........EAGLEAPK....VE.RLPQFHRHPT------FIA-----EFARA....VDAAREQ.LRAE....
HEMH_PSYCK/8-328..LK..............QRNLPN....IT.IVKDYFAHPL------YIK-----ALADS....IRRFQAV.H.......
A1W6G8_ACISJ/26-346..RR..............SRCFPE....LR.FVNDYHDHPD------YIA-----ALAQS....VRAHWQR.E.......
Q0BPC0_GRABC/29-346..AA..............AGLAKQ....TF.SLCCYHSDRD------FAS-----ATAAL....VRKAYDE.ARNTL...
HEMH_BACSK/5-306..DR...............IGGPT....IY.TIESWYKEPG------FLQ-----FWKEQ....IENEMKK..AD.....
HEMH_WOLTR/2-340..KQ..............YGIKCN....TK.IIRHHYDNQD------FIE-----AHANL....ITKHYKL.AS......
HEMH_OCEIH/5-307..EK...............YG.IQ....LD.SVEDWYTEPG------FIK-----FWADG....IKATYAE.MTE.....
HEMH_PROFF/4-311RIDD.............EGRPALQ....VV.KLDPYADLPA------LVT-----AQVQL....LRAALAD.H.......
A8H1M0_SHEPA/18-337..AT..............WRYLPA....LH.FINSYHDHPD------FID-----ALAAS....IAKDFEL.N.......
Q2GH68_EHRCR/9-323..KK..............SRFHCP....TS.TICCYYNNEN------YIK-----AHCQL....IIEKYRE.AQ......
A5CDS3_ORITB/6-318..LK..............NNFSCL....VK.TVCCYPINKG------LVD-----GYSSI....IKNCTND.F.......
Q01W09_SOLUE/2-280GAIE........................LA.WAHSYHDEPL------LIE-----AFAER....LQGMSGK.........
HEMH_SYNJB/3-322AEDP..............ELACIE....RR.QICSWYDQPQ------YVQ-----AMARA....IREQLDG.FA......
HEMH_DECAR/17-339..TK..............IRNQPE....MR.FVRNFHDHEG------YLA-----ALEKS....VRQHWQT.N.......
Q2G302_NOVAD/14-333..KA..............RRRLPA....LR.TLPPYHDDPA------YIG-----ALHAD....LSRQIDA.L.......
HEMH_BDEBA/3-335..KK..............LHLTAP....LR.RLPAFFDDAS------FVG-----TSVKL....VEETLQD.........
Q3B6N8_PELLD/15-332GTVDG...........PA..........PV.VVDGFWGDSG------LRR-----VYVNH....VFRYGR..........
HEMH_GEOSL/4-316..SQ..............SGVQFQ....MM.YVDRFFDHPL------YID-----ALAEK....IREGLDD.FH......
HEMH_WIGBR/4-320..KK..............YRNIPS....II.FIRDYADNIN------YIN-----AITNS....IKKSFNK.N.......
A6QAW0_SULNB/5-315..EA..............MGYAPK....IT.VIDPYYDDYT------YIE-----ACCEK....ILEVAEG.KE......
A4NSJ5_HAEIF/6-322..KE..............ERGLVP....FD.FIHSYHVDEN------YIN-----ALANS....IKVRLKS.D.......
Q2BIY0_9GAMM/6-329..LQ..............QRRVLD....VR.IVNSYYDHPK------YVE-----ALANQ....VANFRAE.N.......
HEMH_LEIXX/21-347..RETG..........LEGRIQ......ID.KVRQFFDHPG------FVE-----PFIEG....VKNAVEE.L.......
B3EFT0_CHLL2/12-332PADDL...........SR..........VK.VISRFWCDAA------LHQ-----LCAAH....VVAA............
HEMH_PARUW/4-338..QQ..............WQNIPT....LT.FINSYPDHPG------LVG-----AFCER....AKQY.DL.........
HEMH1_BACC1/4-307..EK...............LGNLT....IH.GIDSWYKEPK------FIQ-----YWVDA....VKGIYNG.MSD.....
HEMH_SALTI/5-320..AR..............KRRIPG....IS.FIRDYADDGA------YID-----ALAKS....ARESFAR.H.......
HEMH_GLOVI/3-322ARDP..............SLKAIE....RI.TINSWYSRPG------YIR-----AMGER....VREGLDK.FD......
Q8IFK5_9APIC/26-346..KG..............WQNIPE....LR.FLSGYCFNEK------YID-----SIKEN....IEKFWEK.N.......
B7KUA6_METC4/33-352..MQ..............MRWQPT....VR.VSPPYHDDPV------YIE-----AMAQS....IREGLAK.L.......
HEMH_ENTFA/3-313..IK..............SDRIVD....IK.FIRSFYNNPQ------YID-----YFSKK....INEALNE.S.......
Q1K4G8_DESAC/5-319..SQ..............HAPDLQ....CR.YIEEWHDQDQ------YLD-----ALAEC....VQDGLAQ.VPE.....
HEMH_SULDN/3-316HLSSGD..........AI..........LV.EIKHFFQNKN------YNM-----AILER....IKERVSL.EE......
B0T6D4_CAUSK/5-319..................RKGSGR....IS.TVCCYPVDED------LVQ-----AHADL....IKAAYDK.AG......
HEMH_NEIG1/17-332..LL..............QRNQMS....VR.TISRFYDDAG------YID-----AMKNH....ILRYWAE.H.......
Q544X6_MOUSE/67-388NEVG..............QKPTMK....WS.TIDRWPTHPL------LIQ-----CFADH....ILKELNH.FPE.....
A3J3F3_9FLAO/2-336..QK..............HFPEMT....FT.NVPAFYNKPD------FIQ-----ALANS....IKKHLDG.........
A1ZL88_9BACT/9-355..KK..............WQIVPD....IH.FVQSFFDYPE------FVH-----AFAEI....GKKYLKE.........
HEMH_TROWT/30-349..ERAG..........LSGRI..I....VD.KLRQFFDHPG------FVL-----PFIEG....IQDCLEQ.VK......
HEMH_LACC3/3-312..VK........................TV.VIDRFYDHSD------YQK-----ILAQQ....IDDAYEA.G.......
A3UYB0_VIBSP/6-320..KQ..............MPVIPS....YR.FIRDYYAHPS------YAK-----ALAES....VRSHWDK.N.......
A7C270_9GAMM/16-336..KR..............WRWLPD....IR.FISHYPDQPT------YIS-----ALVTQ....IKNHWAK.Y.......
Q8GKR2_CORGT/9-320..KHLE..........SQGQSVT.....FT.KLRQFYDHPR------FVS-----TMAQL....VQDSYAK.LP......
HEMH_METCA/7-321..KT..............WRHIPS....LH.FIGDYHRSPK------YLE-----AVAAS....IRSFWQE.H.......
HEMH_CAMFF/2-314..KE..............LSIKSN....IK.VINYFYKDER------YNK-----IITSS....IKEKIAE.MN......
Q1NA21_9SPHN/14-328..AK..............MRWQPA....VR.TLPPYHDDPA------YIG-----ALRRS....IEGAITA.L.......
B3EK40_CHLPB/21-336PPRVP...........SR..........PQ.VISGFWNDPG------LLN-----VYLDH....LFMHAA..........
HEMH_LEUMM/3-312..KN........................IN.IVKSFYNDEA------YLD-----LLARD....IREAWAK.N.......
HEMH_LACPL/2-311..LP........................HT.FIDSFYDQPT------YIH-----LLATK....VWQSYQA.H.......
A3UIC5_9RHOB/4-317....................GGPE....AR.AICCYPEEAD------FIT-----AHARL....IEAEWEK.AG......
A7NKU7_ROSCS/7-309..GA..............LPQPLQ....VT.FIERWHDDPG------FRR-----LIADR....ITEARVT.LPP.....
Q6BFD7_PARTE/32-353QKYK.............TIQPKLE....VS.VIDSWHKNKF------YIS-----AMATL....LNNKIKAQNL......
A1AWG9_RUTMC/9-331..DS..............WVQKPE....IA.FIEHYYDNNG------YLQ-----SLTNS....VLEHQTK.H.......
Q9ATG7_9CHLO/62-386NSDP..............YLSQVP....LA.VISRFSSRPG------YIQ-----SMADL....VQLELKK.FQ......
HEMH_LEPBJ/4-338..KF...............CPVSY....EG.WVAPFHSSQV------YLE-----SIRDLILDFFQNRLNR.KDFLHSDS
B4S748_PROA2/5-331ADKRF...........EK..........VR.VLNKLWQDPE------LHR-----IYIDY....LFQRVD..........
HEMH_AZOSB/17-335..QH..............WRNLPE....LR.FVRSFHDDPG------YIG-----ALAAS....VREHWTR.H.......
Q00YL8_OSTTA/64-389AEDE..............ALAKVR....HT.VIPSWYQRPG------YVR-----AMSQM....IAQTLKTKFD......
Q0FE11_9RHOB/14-337..MK..............MNWQPS....IR.TVAAYFDNPL------YIN-----ALANS....VKKKYAS.L.......
Q1ITV1_KORVE/3-296..PP..............F....T....VD.FVESWHDHPL------LIQ-----AFAEN....HRAGYEK.ARA.....
A4BAF4_9GAMM/14-332..KT..............LRWQPT....VR.IAHPWYDQPA------YID-----ALVQQ....VHAHLGS.A.......
HEMH_BRUA2/27-348..MK..............KRFMPA....IR.TVPSYEAEPV------YID-----ALARS....VEKHLAT.L.......
Q0YQ48_9CHLB/46-338GEGSF...........AL..........VK.VMSRLWSDDA------LHR-----IYIDY....LFAQLS..........
HEMH_CORDI/12-330..HHLE..........EKELPTLN....CL.KLRQFFDHPL------FIE-----EMSSV....VFQAARE.LGIS....

PF01903

P71751_MYCTU/53-151--------------------------------------------------------------------------------
Q7UNS6_RHOBA/42-150--------------------------------------------------------------------------------
Q82UF1_NITEU/52-144--------------------------------------------------------------------------------
CBIX_METJA/9-138--------------------------------------------------------------------------------
Q7V242_PROMP/174-278--------------------------------------------------------------------------------
CBIX_HALSA/9-130--------------------------------------------------------------------------------
CBIX_HALSA/152-263--------------------------------------------------------------------------------
Q81FY5_BACCR/9-114--------------------------------------------------------------------------------
Q8FM68_COREF/9-112--------------------------------------------------------------------------------
Q8CN68_STAES/9-113--------------------------------------------------------------------------------
CBIX_ARCFU/10-119--------------------------------------------------------------------------------
CBIX_SULTO/9-108--------------------------------------------------------------------------------
Q9X2M7_STACA/9-114--------------------------------------------------------------------------------
Q8TKD6_METAC/3355-3469--------------------------------------------------------------------------------
Q7U7Z1_SYNPX/16-120--------------------------------------------------------------------------------
Q7VCD4_PROMA/148-252--------------------------------------------------------------------------------
P74414_SYNY3/23-131--------------------------------------------------------------------------------
Q8NV21_STAAW/9-113--------------------------------------------------------------------------------
Q8EXP3_LEPIN/11-115--------------------------------------------------------------------------------
Q7V757_PROMM/20-124--------------------------------------------------------------------------------
CBIX_BACME/14-118--------------------------------------------------------------------------------
Q82BN1_STRAW/64-163--------------------------------------------------------------------------------
Q9RZD7_DEIRA/3-101--------------------------------------------------------------------------------
Q96ZL1_SULTO/11-123--------------------------------------------------------------------------------
Q8XWQ5_RALSO/11-116--------------------------------------------------------------------------------
SIRB_BACSU/10-115--------------------------------------------------------------------------------
Q7NDP2_GLOVI/28-133--------------------------------------------------------------------------------
Q7NXQ9_CHRVO/13-118--------------------------------------------------------------------------------
Q81FY5_BACCR/133-233--------------------------------------------------------------------------------
Q7NXQ9_CHRVO/143-247--------------------------------------------------------------------------------
CBIX_METKA/9-134--------------------------------------------------------------------------------
Q7VCD4_PROMA/20-124--------------------------------------------------------------------------------
Q8DJ31_THEEB/165-269--------------------------------------------------------------------------------
Q829K6_STRAW/144-248--------------------------------------------------------------------------------
CBIX_METTH/18-137--------------------------------------------------------------------------------
Q8DHP8_THEEB/20-121--------------------------------------------------------------------------------
Q81E58_BACCR/9-114--------------------------------------------------------------------------------
CBIX_SULSO/9-118--------------------------------------------------------------------------------
Q82L75_STRAW/11-113--------------------------------------------------------------------------------
Q7UNS6_RHOBA/198-298--------------------------------------------------------------------------------
Q8DJ31_THEEB/33-138--------------------------------------------------------------------------------
P74414_SYNY3/149-243--------------------------------------------------------------------------------
Q7U7Z1_SYNPX/145-249--------------------------------------------------------------------------------
Q8YZE1_NOSS1/3-102--------------------------------------------------------------------------------
Q8EXP3_LEPIN/133-237--------------------------------------------------------------------------------
Q9L2E8_STRCO/21-118--------------------------------------------------------------------------------
Q8YZE1_NOSS1/117-213--------------------------------------------------------------------------------
Q7NHF8_GLOVI/27-130--------------------------------------------------------------------------------
Q9KCS3_BACHD/144-248--------------------------------------------------------------------------------
Q82L75_STRAW/135-230--------------------------------------------------------------------------------
SIRB_BACSU/134-236--------------------------------------------------------------------------------
Q9L2E8_STRCO/140-233--------------------------------------------------------------------------------
Q9RS86_DEIRA/9-126--------------------------------------------------------------------------------
Q84JH7_ARATH/89-194--------------------------------------------------------------------------------
CBIX_SYNY3/164-268--------------------------------------------------------------------------------
Q8EQN8_OCEIH/9-114--------------------------------------------------------------------------------
Q7V242_PROMP/46-150--------------------------------------------------------------------------------
Q9RZD7_DEIRA/122-231--------------------------------------------------------------------------------
P95216_MYCTU/123-221--------------------------------------------------------------------------------
Q8ZZB2_PYRAE/8-112--------------------------------------------------------------------------------
Q8NLX3_CORGL/9-112--------------------------------------------------------------------------------
Q93IF7_PROFR/147-251--------------------------------------------------------------------------------
Q8TKD6_METAC/423-539--------------------------------------------------------------------------------
CBIX_BACME/141-245--------------------------------------------------------------------------------
Q82BN1_STRAW/189-282--------------------------------------------------------------------------------
Q93IF7_PROFR/12-121--------------------------------------------------------------------------------
CBIX_SYNY3/32-137--------------------------------------------------------------------------------
CBIX_METMA/12-124--------------------------------------------------------------------------------
Q9KCS3_BACHD/9-115--------------------------------------------------------------------------------
Q8EQN8_OCEIH/134-236--------------------------------------------------------------------------------
P95216_MYCTU/8-105--------------------------------------------------------------------------------
Q829K6_STRAW/13-118--------------------------------------------------------------------------------
Q7NDP2_GLOVI/156-260--------------------------------------------------------------------------------
Q7NHF8_GLOVI/150-253--------------------------------------------------------------------------------
Q8XS58_RALSO/22-127--------------------------------------------------------------------------------
Q97WC4_SULSO/14-126--------------------------------------------------------------------------------

PF06180

Q8Y7R9_LISMO/3-255--------------------------------------------------------------------------------
Q8KFD8_CHLTE/13-299--------------------------------------------------------------------------------
Q8R628_FUSNN/14-265--------------------------------------------------------------------------------
Q97JB3_CLOAB/3-262--------------------------------------------------------------------------------
Q8XL14_CLOPE/3-261--------------------------------------------------------------------------------
Q57MX2_SALCH/3-257--------------------------------------------------------------------------------
Q9RMI6_PORGN/31-292--------------------------------------------------------------------------------
Q97LH8_CLOAB/3-263--------------------------------------------------------------------------------

PF00762

HEMH_COXBU/19-351.......QP.........DYFLFSYHGLPERH.LVKSGCQLAICNRKNN...........CSPISSSNENC.........
HEMH_RHIEC/19-340.......DWK.......PDMLLASFHGIPMSY.F.KQGD...............................P.........
HEMH_CAUCR/4-317.....SPTN.........IRLLFSAHGLPEKV.ILA.GD...............................P.........
HEMH_METFK/17-337.......GK........PEKLVMSFHGVPRRT.Y.DLGD...............................P.........
HEMH_FRATW/10-329.......DST.......PDTVLFSFHGLPKEY.F.DKGD...............................P.........
HEMH_RHOBA/7-309......AS.P......ARTKVLFTAHSIPMGM.ADNCD..........................................
A7JUM6_PASHA/6-320..................ELLLFSFHGIPKRY.E.TEGD...............................F.........
Q3A6H8_PELCD/15-332....EQRHR.........VTLLFSAHALPEKL.ILE.GD...............................P.........
A0JYM7_ARTS2/30-358......AQLAAVGTPDAPVHILFATHSIPTRD.AEAAG................................RSEGEPR...
A7GM50_BACCN/4-305.....KE.K.........AVVIFSAHSLPEKI.IA.AGD...............................P.........
Q1N3F6_9GAMM/5-324.......GK........GDKLMMSFHGIPQRY.A.DNGD...............................P.........
Q2IPY0_ANADE/3-312....ALRGR.........TRVVFSAHGLPMSQ.VRK.GD...............................P.........
HEMH_LEGPC/2-331.......F...........HVLFSYHGIPERH.I.HKSGCDTLCPQTC.............TPIYDKNQAC.........
A3I3M0_9BACI/5-305....EERET.........GCLIVSAHSLPEKI.KD.LGD...............................P.........
HEMH_STAAN/4-307....EEHKD.........TVLVVSAHSLPKGL.IEKNND...............................P.........
Q1GQW0_SPHAL/14-327.......DFI.......PDVLLASFHGMPERT.L.HLGD...............................P.........
A6W899_KINRD/11-329......EPAR......AGARVVFVTHSVPDAM.NDVSG................................PPAA......
A7T926_NEMVE/2-249..................YLLHLKKAGFLSRL...DRGD...............................P.........
A0NNM3_9RHOB/33-355.......DFK.......PNVVLTSYHGIPQSY.F.KRGD...............................P.........
Q0YS02_9CHLB/6-332......LKDQPVL.RDEERILLLLFHGTLVSN...EKGEV............................PP..........
A6ELJ2_9BACT/3-339.........V......DYEHILFSYHGVPERH.I.RKSDITNGNCKMDGK........CCFKKGSEQHEFC.........
HEMH_PSEPW/3-337.........D.......YDHLLLSFHGLPERH.L.KKLMPGSKHDLRAAD........CCKDASAEVRAVC.........
A1SXP1_PSYIN/19-339.......GM........PQKLVFSYHGMPKLF.L.KNGD...............................P.........
Q0G0T3_9RHIZ/27-348.......DFT.......PERVVASYHGIPQSY.F.RKGD...............................P.........
A4A641_9GAMM/16-336.......DR........AEKLLFSYHGEPRRY.L.DEGD...............................P.........
A6GNF2_9BURK/14-338.......GKPNF...DQGDVLLFSFHGVPEMT.L.LKGD...............................P.........
A3ZL09_9PLAN/3-305......SERR......QRAELIFTAHSIPLGM.SDNCN..........................................
Q5KFH8_CRYNJ/49-370....DRRGD.........VTILFSAHSLPLDI.VNR.GD...............................P.........
Q47NJ1_THEFY/4-317......EELR......PETRLLYSAHSLPIAM.AKKSGD...............................PRRDY.....
A6EVP6_9ALTE/16-336.......GR........NQKLILSYHGVPLKY.L.QRGD...............................P.........
Q3SU51_NITWN/22-343.......SFT.......PEIIMASFHGMPQAY.V.AKGD...............................P.........
Q6AB01_PROAC/16-329....TPL..E.......ATRVVFVTHSIPDSM.QDASGAGQP.........................GTD..........
HEMH_ZYMMO/13-326.......DFK.......PDSLLLSYHGMPVKT.R.ELGD...............................P.........
HEMH_WOLSU/2-314......PEE.........FTLIFSAHGLPQSV.IDA.GD...............................P.........
A6VPL9_ACTSZ/8-324..................EFLLFSYHGIPLRY.E.QEGD...............................D.........
Q2Y6A8_NITMU/15-335.......GR........PDKLVMSFHGIPRAS.V.DKGD...............................P.........
Q26GH9_FLABB/2-337.........K......DYEHLLFSYHGVPKRH.I.RKSDITKSHCKMDGK.........CCSTPSPAHQYC.........
HEMH_RALPJ/16-344.......GAPDF...AHGDKLVLSFHGVPRRT.L.ELGD...............................P.........
HEMH_THICR/16-340.......GK........PDLLVMSYHGIPQRY.F.DNGD...............................P.........
A4X999_SALTO/20-328......PARR......DSTRIVFTAHSIPTSA.AAAAG................................PHG.......
HEMH_PSEA6/16-336.......GR........ADKLIFTYHGIPKRY.L.TAGD...............................P.........
HEMH_CHLAB/4-308.....PTHD.........CCLLFSAHGLPMRY.VNK.GD...............................P.........
A3TKF4_9MICO/13-330......ASKL......PTTRLLFVTHSIPEAM.DDTSG................................PGDS......
HEMH_CHRVO/19-339.......QR........PDKLVMSFHGVPRFT.R.DKGD...............................P.........
HEMH_GEOBB/4-316.....DRKD.........VEIVFSAHSLPQSF.IEE.GD...............................P.........
A8L1D5_FRASN/20-328......AAVR......DEARLVFTAHALPRSQ.AAASG................................PDG.......
Q1DC34_MYXXD/7-344.........A......RADYVLFSFHGLPERH.M.RKSDPTGTHCLSTAS.........CCDAMTDANRHC.........
A0Z184_9GAMM/16-336.......GR........ADKLIFSYHGSPQRY.L.QNGD...............................P.........
HEMH_PHOLL/5-320.......GQ........PDRLLLSYHGIPQRF.V.DTGD...............................I.........
A5DAX3_PICGU/50-370....EDRSK.........VLVLFSAHSLPMEI.VNR.GD...............................S.........
Q2VYH0_MAGSA/8-320.....AAGK.........PRILFSAHGLPKSV.IAK.GD...............................P.........
A3EV75_9BACT/12-335.....EEET.........VHILFSAHGIPEFL.VTREKD...............................P.........
B1YKJ8_EXIS2/3-305.....PEDR.........AVLVVSAHSLPEKI.IA.NGD...............................P.........
A6F7X3_9GAMM/3-322.......GR........AEKLLLSYHGIPKFL.V.EKGD...............................I.........
A0YYR5_LYNSP/3-322.....DSEH.........IHLFFSAHGVPVNY.VEEAGD...............................P.........
HEMH_THEVO/2-285..................SFYLFDAHSLPHPE...NEED.........................................
Q1V1A3_PELUQ/2-316.......KN.........FKLIFSAHGLPEKN.IKK.GD...............................P.........
Q2GCY1_NEOSM/3-304.....AFGK.........PIILFSAHGLPLSV.IKA.GD...............................P.........
Q7QG25_ANOGA/28-351....EKRKD.........VVLLFSAHSLPLRA.VSR.GD...............................A.........
Q118M8_TRIEI/24-354...AHLPSQ.........IGIVLTNHGCPHKA....KG..........................................
Q1NVN4_9DELT/7-321......GEE.........YTLLYSAHSLPVSF.IED.GD...............................P.........
HEMH_CHLPN/3-309.....LEKE.........CCFLFSVHGLPVRY.ISQ.GD...............................P.........
HEMH_ACIAD/8-328.......GK........PQKLLMSFHGIPQPY.A.DKGD...............................P.........
B3E8G1_GEOLS/3-313.....NRTG.........VQLLFSAHSLPQSF.IAE.GD...............................P.........
HEMH_AQUAE/2-309......PEE.........YHFLFSAHSLPKKL.IEE.GD...............................P.........
B4SCY0_PELPB/6-328......LRQAPG...SEAQTLLLLFHGTLVAD...TKGNT............................PQ..........
A4ETD1_9RHOB/25-348.......AKR.......PDILVVSYHGMPKRY.L.MQGD...............................P.........
HEMH_THEAC/2-283..................SFYLFDAHSLPAPD...REED.........................................
HEMH_CHLMU/1-303.....VAED.........CFFLFSVHGLPMRH.I.RLGD...............................P.........
A2VI04_MYCTU/3-299......R..G.......DARLVFTAHSIPTAA.DRRCG................................PN........
HEMH_GLUOX/17-337.......SFK.......PQQIVASFHGLPKTC.I.EKGD...............................T.........
HEMH_HERAR/16-335.......GR........PDKLVMSFHGVPKRT.L.TLGD...............................P.........
HEMH_DICDI/45-386DIDDVDANNNNN...NNKPVLVFSAHSLPMST.VEK.GD...............................P.........
Q65DD6_BACLD/5-307....KEREK.........AAVIFSAHSLPEKI.RE.HGD...............................P.........
A0L8B7_MAGSM/5-325.......PD.........HRLLLSYHGLPKRH.V.DEGD...............................P.........
HEMH_CAMC1/2-313......ISD.........VSLIFSAHSLPRKI.IEK.GD...............................I.........
Q5PA48_ANAMM/8-324.....GHSS.........PRILFSAHGLPVHI.VKR.GD...............................P.........
Q2GL73_ANAPZ/4-320.....LNAR.........ARILFSAHSLPVSF.IEK.GD...............................P.........
HEMH_STRM5/6-319.......GR........GQTLMFSFHGIPQRL.A.DGGD...............................P.........
A7A2C1_YEAS7/38-357....PVRDK.........VVLLFSAHSLPMDV.VNT.GD...............................A.........
Q0F558_9RHOB/16-336.......GR........TDKLVFSYHGIPKRY.L.KNGD...............................P.........
A4U0X7_9PROT/2-312.....GQGR.........PRLLFSAHGLPQSI.IDK.GD...............................P.........
HEMH_PELPD/5-317.....DPGD.........VHLLFTAHGLPQSF.IDS.GD...............................P.........
HEMH_STRP2/2-294....QDS...........FKVIFSAHSVPIFA.LD.FGD...............................P.........
A4SLY2_AERS4/4-323.......GQ........GDHLLMSFHGIPERY.E.NEGD...............................P.........
HEMH_SYNSC/3-326.....DPTK.........AHVFFSAHGVPKSY.VEEAGD...............................P.........
Q0AKE0_MARMM/7-318.....RPEN.........IRLLFSAHGLPKKI.IDA.GD...............................P.........
Q0AHZ2_NITEC/18-338.......GR........PDKLVISFHGVPRKT.L.EMGD...............................P.........
A1SKT0_NOCSJ/8-323......EQVR......EEAHLVFVTHSLPEAM.NAASG................................PEG.......
B4S8P2_PROA2/4-319.........PS.....DNTALVLAFHGTLEKN...QKGEE............................PG..........
HEMH_HYPNA/4-317.....RPGN.........VNLLLSAHGLPESV.VKS.GD...............................P.........
A5EXB1_DICNV/10-330.......GA........PQLLLLSFHGVPKSV.I.TEGD...............................P.........
Q3AEU4_CARHZ/2-291......PKN.........TGIIFTAHNLPKKA.I.EQGD...............................P.........
HEMH_LEPBI/8-339EKPNCDWRN.........LDLVFSAHGVPMRL.IHK.GD...............................R.........
HEMH_BURXL/16-340.......GRPDF...AAGDKLVLSFHGVPKRT.L.DLGD...............................P.........
HEMH_ALCBS/16-336.......GS........ADKLVFSFHGVPKRF.L.LKGD...............................P.........
HEMH_MANSM/5-321..................EFLLFSFHGIPKRY.E.QEGD...............................F.........
HEMH_MYCAV/3-298.....AG...........ARLVFTAHSVPVAA.DERLG................................PR........
HEMH_VIBF1/5-319.......GK........GDYVLCSYHGIPQRF.V.DNGD...............................I.........
Q2RN84_RHORT/3-322.....PA...........PRVLFSAHGLPRKV.VDA.GD...............................P.........
A5VF70_SPHWW/15-329.......HGE.......PDAILASFHGMPART.L.DLGD...............................P.........
HEMH_SCHPO/32-352....DVRDD.........VVIVFSAHSLPMSQ.VAK.GD...............................P.........
HEMH_THIDA/16-336.......GR........PDVLVMSFHGVPRYT.L.DKGD...............................P.........
A7HSJ5_PARL1/7-322.....GTDG.........IRILFSAHGLPKKV.IEA.GD...............................P.........
A7I208_CAMHC/3-312....EEISE.........ISLIFSAHSLPIKI.IEK.GD...............................P.........
HEMH_PSEAB/3-337.........P.......HDHLLLSFHGLPERH.I.RKLVKDPAHDLLAEN.........SRNVSPEALALC.........
HEMH_POLSJ/20-339.......GQ........AGQLVMSFHGVPERT.L.KLGD...............................P.........
A3HXU8_9BACT/6-342.........K......EYDHYLFSYHGLPERQ.I.KKGSVDNYCKLGAC...........CNKYGPSNQFC.........
Q21PI6_SACD2/17-337.......GR........AQKLVLSYHGVPQFY.L.HKGD...............................P.........
Q1YSP8_9GAMM/17-337.......GE........PDKLVFSYHGTPQSY.L.NKGD...............................P.........
B3EI90_CHLL2/10-337.......AGIKVD.GAGKIGLVLVIHGTLVRD...RAGNP............................PK..........
Q2RZ44_SALRD/6-342....DVRDD.........VHLLFSAHGTPLSE.MKDRDD...............................P.........
Q11PE0_CYTH3/9-344.........R......NWDHIIFSYHGIPERQ.I.KKASIGDQCKLGTC...........CQVYGSRNEYC.........
HEMH_HELPY/20-333......SQD.........FVLIFSVHGLPKSV.IDA.GD...............................T.........
B4U5Z6_HYDS0/3-310.......DE.........YFILFSAHSLPQKI.IDK.KD...............................P.........
HEMH_DESPS/5-316......GEK.........TEIVYSAHSLPTSF.IEA.GD...............................P.........
HEMH_DEIRA/9-312....DERDD.........VHVILSAHSLPVRI.IK.EGD...............................P.........
HEMH_NOCFA/3-313......ADRR......DRARLVFTAHSVPVAA.DAAAG................................PPAD......
A4BNN9_9GAMM/7-327.......GR........GERLLISFHGIPKRY.A.ERGD...............................P.........
Q6L0G9_PICTO/3-286..................SPFLFAAHSLPLYS...DEST.........................................
HEMH_SYMTH/3-318.......GR........PDALVLSYHSIPQAY.T.ASGD...............................D.........
A3WGM8_9SPHN/19-340.......SFK.......PETMLLSFHGMPQRT.L.ERGD...............................P.........
Q6C140_YARLI/28-348...GINPED.........VTILFSAHSLPMEV.VNK.GD...............................P.........
A4SGR5_PROVI/4-322.........GE.....EGPALLLTFHGTLVKD...RKGNE............................PG..........
HEMH_STRCO/10-330......AEVR......DGAHIAFCTHSIPTSA.ADGSG................................PVEEH.....
A1BDR1_CHLPD/6-328......IAMRPVV.EHENRVLLLLFHGTLVAD...AKGRP............................PA..........
Q8IFR0_PLAFA/26-346.......GK........SKKLIISYHSLPIRN.V.IQGD...............................L.........
A6DEA9_9PROT/2-294.......KE.........WNLIFSAHGIPKKL.INK.GD...............................K.........
HEMH_LACRD/3-310.......KY.........DKLLISYHGIPTAM.V.NHGD...............................P.........
A1F5I4_VIBCL/10-324.......GQ........GDLLLCSYHGIPKRY.A.QNGD...............................I.........
A5PCT0_9SPHN/19-336.......DFE.......PEVLLLSFHGMPERT.L.HLGD...............................P.........
HEMH_LACLS/4-313.......HY.........DKLILSYHGIPLSY.VTKKKD...............................A.........
HEMH_STRMU/5-319..................EHLLFSFHGIPQRY.V.IEGD...............................Y.........
HEMH_RICCN/4-312.......KN.........FRILFSAHGLPEKI.IKA.GD...............................P.........
Q0AAP6_ALHEH/23-343.......GR........GEKLLFSFHGTPRRY.L.LDGD...............................P.........
Q7SA94_NEUCR/50-383....ERRKD.........VVLLFSAHSLPMSV.VNR.GD...............................P.........
A4SZS0_POLSQ/11-336.......GRPDF...AKGDRFVMSFHGLPKRN.L.MKGD...............................P.........
A6FYS2_9DELT/7-354.........F......QPDHVLFSFHGLPERQVI.RSADPGQCLPKPQC...........CASIHAGNRNC.........
A3QF47_SHELP/11-331.......GQ........GDCLLMSFHGVPLRY.V.TEGD...............................P.........
A5V0K6_ROSS1/8-309....CDRSR.........TALLAIAHSVAESA.RKPETE.........................................
Q487H7_COLP3/23-348.......GK........PERLVLSYHGMPELF.H.KWGD...............................P.........
Q02A99_SOLUE/3-300......HDRR......DAARLVFTAHSIPLAM.ATTCR..........................................
A7BEQ8_9ACTO/4-371....GVDP.A.......GIRLIFVTHSIPVSM.EAGSS................................PFPFHPSIDE
Q4P8W9_USTMA/429-755....EKRNQ.........VPIMFSAHSLPMQI.VSGRGD...............................P.........
HEMH_BORPA/35-354.......GR........PQKLVMSFHGLPRYS.I.ELGD...............................P.........
A0LUR9_ACIC1/11-319......PEVR......AGAPIVYVAHSIPEAM.NAASG................................PAG.......
A5G1D4_ACICJ/11-329...LGAGAK.........IRLLFSAHGLPESI.VKA.GD...............................P.........
HEMH_NITOC/16-335.......GR........GERLLISFHGLPKRY.L.LAGD...............................P.........
Q2S1S2_SALRD/34-360....HVREE.........VALVFSAHGSVFDA.QGPRKP...............................P.........
HEMH_YERPS/5-320.......GQ........PDRLVMSFHGIPKRY.A.QLGD...............................D.........
A6CG01_9PLAN/5-308......EERR......GQATILYSAHSIPMVM.AAGCR..........................................
A4SF51_PROVI/10-337.......GTRFQK.GAGKFGLVLVIHGTLVKD...RAGNP............................PR..........
HEMH_LISMO/4-307....DELLD.........TVLIVSAHSLPEKI.KQ.HND...............................P.........
Q4JSM9_CORJK/13-376....HGEEVA......AQADLVFTAHSVPTVA.DKAAG................................PHKF......
HEMH_PSYCK/8-328.......GK........PEKLMFSFHGIPQPY.A.DKGD...............................P.........
A1W6G8_ACISJ/26-346.......GGP.......ADKLVMSFHGIPERN.V.RLGD...............................P.........
Q0BPC0_GRABC/29-346..PDDVP...........LRLLFSAHGLPEVI.VKK.GD...............................P.........
HEMH_BACSK/5-306.....SIDD.........LCVIFSAHSLPEKI.IQ.AND...............................P.........
HEMH_WOLTR/2-340.....EVGK.........PRVLFSAHSLPLSV.IKK.GD...............................P.........
HEMH_OCEIH/5-307....EERNN.........SVLIVSAHSLPEKI.LK.DGD...............................P.........
HEMH_PROFF/4-311......P..........DAHLVFTTHSIPTAM.AETSG................................PHG.......
A8H1M0_SHEPA/18-337.......GQ........PQKLVLSYHGMPERN.L.HLGD...............................P.........
Q2GH68_EHRCR/9-323.....NYGS.........PRILFSAHSLPLSI.VQR.GD...............................P.........
A5CDS3_ORITB/6-318.......SN.........TVLLFSAHGLPKKF.ITQ.GD...............................P.........
Q01W09_SOLUE/2-280....................VLFTAHSLPSPNEI..............................................
HEMH_SYNJB/3-322.....EPEG.........VHVLFSAHGIPESY.VTEAGD...............................P.........
HEMH_DECAR/17-339.......GSLG.....DNDRLLISFHGLPKRS.L.DLGD...............................P.........
Q2G302_NOVAD/14-333.......DFA.......PELLLLSYHGMPERT.L.HLGD...............................P.........
HEMH_BDEBA/3-335.........K......EVDHYLFSFHGLPESH.V.RKI.PGCLTTEDC............CFEKNACAKNC.........
Q3B6N8_PELLD/15-332.........ND.....PGAALLLAFHGTIIRD...ARGCE............................PG..........
HEMH_GEOSL/4-316.....PLAE.........VQVLFSAHSLPQSF.IDE.GD...............................P.........
HEMH_WIGBR/4-320.......GI........PEMLIMSFHGIPKKY.I.KDGD...............................D.........
A6QAW0_SULNB/5-315......TKE.........YDLLLSAHGLPMSI.IKA.GD...............................P.........
A4NSJ5_HAEIF/6-322..................EFLLFSYHGIPLRY.E.KMGD...............................Y.........
Q2BIY0_9GAMM/6-329.......ES........VDKLILSYHGIPKEY.A.DKGD...............................P.........
HEMH_LEIXX/21-347......RERAPEIHPATGVRILFSTHSIPSTD.AGKSG................................PSGRPDSG..
B3EFT0_CHLL2/12-332.......SAEPRLGRSERHVLLLLFHGTLVTD...GSGEL............................PA..........
HEMH_PARUW/4-338.........S......IYDYFLFSFHGLPERQ.I.RKGDSTGKCLTENC...........CQVICSDNAFC.........
HEMH1_BACC1/4-307....AEREK.........AVLIVSAHSLPEKI.IA.MGD...............................P.........
HEMH_SALTI/5-320.......GE........PDLLLLSYHGIPQRY.A.DEGD...............................D.........
HEMH_GLOVI/3-322.....NPDG.........VHILFSAHGVPRTY.VDQDGD...............................P.........
Q8IFK5_9APIC/26-346.......GK........GKKLIISYHSLPVKY.V.QDGD...............................L.........
B7KUA6_METC4/33-352.......DFE.......PEVILTSFHGVPKSY.L.LKGD...............................P.........
HEMH_ENTFA/3-313.......PI.........DAIVFSYHGIPMSY.V.KDGD...............................N.........
Q1K4G8_DESAC/5-319....AKRGK.........LTLLFSAHALPQKF.IDR.GD...............................P.........
HEMH_SULDN/3-316......MSE.........FDLIFSAHGLPLKV.IQR.GD...............................T.........
B0T6D4_CAUSK/5-319.....RPGP.........ARLLFSAHGLPEKI.IEA.GD...............................P.........
HEMH_NEIG1/17-332.......GR........GKKLMLSFHGVPQKH.Y.DLGD...............................P.........
Q544X6_MOUSE/67-388....EKRSE.........VVILFSAHSLPMSV.VNR.GD...............................P.........
A3J3F3_9FLAO/2-336.........F......EYDHLLFSYHGIPKRH.I.RKTDVTKSHCKIDGS.........CCNTPSPAHEFC.........
A1ZL88_9BACT/9-355.........A......EYDHVLFSYHGLPERQ.I.RKGDHTGSCLKEAAANPYLEGQANCCATLHSHNRGC.........
HEMH_TROWT/30-349......ERGFK....VSRTAILFSTHSIPELD.AAFSG................................PEDAHF....
HEMH_LACC3/3-312.......AY.........DTVILSYHGIPTAM.V.RHGD...............................P.........
A3UYB0_VIBSP/6-320.......GR........GDHLVCSFHGIPKRL.A.DEGD...............................I.........
A7C270_9GAMM/16-336.......GI........PDKLLFSFHGIPKRF.F.LAG