Sequence alignment for CL0044

PF05138

C6BKZ7_RALP1/1-266----------------------------------------------------------------------------M...
A3M4C2_ACIBT/24-251----------------------------------------------------------------------------L...
Q5P3I7_AROAE/1-255----------------------------------------------------------------------------M...
A7IDQ6_XANP2/1-258----------------------------------------------------------------------------M...
Q28UP2_JANSC/1-252----------------------------------------------------------------------------M...
A4IPM8_GEOTN/1-277----------------------------------------------------------------------------MERR
A8GGD5_SERP5/1-253----------------------------------------------------------------------------M...
A9BS46_DELAS/26-317----------------------------------------------------------------------------MRLQ
Q1VT63_9FLAO/20-305----------------------------------------------------------------------------MFDA
A1SLH6_NOCSJ/1-287----------------------------------------------------------------------------MSFE
A4IPN0_GEOTN/1-291----------------------------------------------------------------------------MRRI
Q63PZ2_BURPS/1-267----------------------------------------------------------------------------M...
A6VZX4_MARMS/1-253----------------------------------------------------------------------------M...
Q5KRM4_CORGT/1-277----------------------------------------------------------------------------MSFA
A1K268_AZOSB/1-256----------------------------------------------------------------------------M...
B2UJA5_RALPJ/1-316----------------------------------------------------------------------------MYTQ
Q8FRT9_COREF/1-278----------------------------------------------------------------------------MSSF
Q2B8B4_9BACI/1-275----------------------------------------------------------------------------MGTL
Q1BRS9_BURCA/1-267----------------------------------------------------------------------------M...
Q82FA7_STRAW/1-239----------------------------------------------------------------------------M...
Q92TG2_RHIME/1-261----------------------------------------------------------------------------MV..
Q70IL9_9PSED/1-255----------------------------------------------------------------------------M...
Q92TG1_RHIME/19-310----------------------------------------------------------------------------MDPQ
A3YFB5_9GAMM/1-258----------------------------------------------------------------------------M...
A5W3A8_PSEP1/1-252----------------------------------------------------------------------------M...
A6F429_9ALTE/1-254----------------------------------------------------------------------------M...
Q5SJN6_THET8/14-305----------------------------------------------------------------------------YQER
A6N3S0_ARTOX/1-313----------------------------------------------------------------------------MAAQ
Q2B8B6_9BACI/1-308----------------------------------------------------------------------------MAGQ
A3KI26_STRAM/1-262----------------------------------------------------------------------------MRP.
Q46WB5_CUPPJ/1-280----------------------------------------------------------------------------MMTP
A2TU38_9FLAO/1-251----------------------------------------------------------------------------M...
Q1BRT1_BURCA/1-311----------------------------------------------------------------------------MYTQ
Q9Z9U8_BACHO/1-315----------------------------------------------------------------------------MYNF
A1SSN8_PSYIN/1-292----------------------------------------------------------------------------MSLD
A3JQN5_9RHOB/1-312----------------------------------------------------------------------------MMYS
Q8FRU1_COREF/1-304----------------------------------------------------------------------------MTTA
A4YR16_BRASO/1-258----------------------------------------------------------------------------M...
Q2L2P2_BORA1/1-311----------------------------------------------------------------------------MYAQ
A6CP08_9BACI/1-271----------------------------------------------------------------------------MTV.
Q93JC5_STRCO/18-306----------------------------------------------------------------------------LQEH
A3JQN7_9RHOB/1-250----------------------------------------------------------------------------M...
A0Z3K2_9GAMM/22-265----------------------------------------------------------------------------M...
A3K7C2_9RHOB/45-284----------------------------------------------------------------------------M...
A3U7D6_CROAH/1-251----------------------------------------------------------------------------M...
A0Z940_9GAMM/5-298----------------------------------------------------------------------------MSLV
Q5UWC7_HALMA/42-333----------------------------------------------------------------------------MNVD
A1K266_AZOSB/1-311----------------------------------------------------------------------------MYTQ
Q2BHR4_9GAMM/1-253----------------------------------------------------------------------------M...
Q26EY3_FLABB/27-281----------------------------------------------------------------------------L...
A2SEG2_METPP/1-257----------------------------------------------------------------------------M...
Q47J43_DECAR/1-260----------------------------------------------------------------------------M...
A4XC44_SALTO/13-267----------------------------------------------------------------------------MQT.
Q5YXT2_NOCFA/1-305----------------------------------------------------------------------------MIDH
Q9KGB1_BACHD/1-271----------------------------------------------------------------------------MNFA
Q4KBZ2_PSEF5/1-253----------------------------------------------------------------------------M...
A1BBH5_PARDP/7-270----------------------------------------------------------------------------MTT.
A6ERY7_9BACT/1-251----------------------------------------------------------------------------M...
A3S9B1_9RHOB/1-240----------------------------------------------------------------------------M...
Q13TE9_BURXL/1-267----------------------------------------------------------------------------M...
Q1GKX3_SILST/1-253----------------------------------------------------------------------------M...
Q1LHY3_RALME/1-285----------------------------------------------------------------------------MNSS
Q2ITX4_RHOP2/29-337----------------------------------------------------------------------------MYTQ
Q5NZZ0_AROAE/1-251----------------------------------------------------------------------------M...
Q1VT65_9FLAO/1-251----------------------------------------------------------------------------M...
A0LUV5_ACIC1/1-302----------------------------------------------------------------------------MAAD
Q5KYF6_GEOKA/1-267----------------------------------------------------------------------------MDQA
Q6N3C8_RHOPA/1-258----------------------------------------------------------------------------M...
Q0K5Z0_CUPNH/1-283----------------------------------------------------------------------------MTAS
A3KIV0_STRAM/26-275----------------------------------------------------------------------------FEDP
A5G1R9_ACICJ/12-269----------------------------------------------------------------------------M...
Q1AV63_RUBXD/1-272----------------------------------------------------------------------------MTAV
Q97WU6_SULSO/22-256----------------------------------------------------------------------------LRK.
A0JZX2_ARTS2/1-288----------------------------------------------------------------------------MGVA
Q5NZZ2_AROAE/19-310----------------------------------------------------------------------------MSAE
Q1IX21_DEIGD/1-302----------------------------------------------------------------------------MTQP
A3VFT1_9RHOB/1-255----------------------------------------------------------------------------M...
A4BNV8_9GAMM/1-252----------------------------------------------------------------------------M...
A5V4A4_SPHWW/1-311----------------------------------------------------------------------------MYTT
A7ZLI9_ECO24/1-291----------------------------------------------------------------------------MTQE
A0Z3K5_9GAMM/15-294----------------------------------------------------------------------------MTAV
Q67LH7_SYMTH/1-255----------------------------------------------------------------------------M...
Q72K12_THET2/1-248----------------------------------------------------------------------------M...
A1SSP0_PSYIN/1-252----------------------------------------------------------------------------M...
Q21BH5_RHOPB/1-258----------------------------------------------------------------------------M...
A3XCS6_9RHOB/1-257----------------------------------------------------------------------------M...
A3KI28_STRAM/77-392----------------------------------------------------------------------------MSAP
Q845J4_9PSED/1-253----------------------------------------------------------------------------M...
Q9RRV1_DEIRA/1-263----------------------------------------------------------------------------MTA.
Q07SY8_RHOP5/1-258----------------------------------------------------------------------------M...
B1YIJ0_EXIS2/13-313----------------------------------------------------------------------------MTEE
A8LTI3_DINSH/1-255----------------------------------------------------------------------------M...
Q0SCS4_RHOSR/47-309----------------------------------------------------------------------------L...
A7TCZ0_NEMVE/151-413----------------------------------------------------------------------------M...
A1R9K9_ARTAT/49-305----------------------------------------------------------------------------L...
A8GGD3_SERP5/1-295----------------------------------------------------------------------------MTTD
A0NQQ2_9RHOB/1-258----------------------------------------------------------------------------M...
A4BNV6_9GAMM/1-310----------------------------------------------------------------------------MHTQ
A0LUV3_ACIC1/1-252----------------------------------------------------------------------------M...
A6T8I2_KLEP7/1-251----------------------------------------------------------------------------M...
Q0K1H4_CUPNH/2-251----------------------------------------------------------------------------M...
A1WPU7_VEREI/1-258----------------------------------------------------------------------------M...
A6N3S2_ARTOX/1-286----------------------------------------------------------------------------MSEA
A1SLH4_NOCSJ/1-247----------------------------------------------------------------------------M...
Q19A69_PSEFL/19-311----------------------------------------------------------------------------MAPE
PAAC_ECOLI/1-248----------------------------------------------------------------------------M...
Q67LH5_SYMTH/1-299----------------------------------------------------------------------------MRTL
A0Z938_9GAMM/1-252----------------------------------------------------------------------------M...
A3M4C0_ACIBT/1-292----------------------------------------------------------------------------MENN
B1YIJ2_EXIS2/1-261----------------------------------------------------------------------------M...
Q1IX23_DEIGD/1-268----------------------------------------------------------------------------MTGS
Q2BHR6_9GAMM/1-292----------------------------------------------------------------------------MTPQ
Q7WGX8_BORBR/1-254----------------------------------------------------------------------------M...
A5V4A6_SPHWW/1-250----------------------------------------------------------------------------M...
B1KMA9_SHEWM/1-299----------------------------------------------------------------------------MNIT
A3JBE4_9ALTE/1-254----------------------------------------------------------------------------M...
Q5LVE5_SILPO/19-310----------------------------------------------------------------------------MSDE

PF13794

Q9FBJ1_STRCO/44-228--------------------------------------------------------------------------------
A0JYP2_ARTS2/9-193--------------------------------------------------------------------------------
A4F8L9_SACEN/21-205--------------------------------------------------------------------------------

PF09968

A0B962_METTP/231-388--------------------------------------------------------------------------------
Q6M0S5_METMP/65-226--------------------------------------------------------------------------------
A6LNR3_THEM4/28-188--------------------------------------------------------------------------------
A6DDH3_9PROT/152-330--------------------------------------------------------------------------------
A7BLS9_9GAMM/110-270--------------------------------------------------------------------------------
A3J1L2_9FLAO/41-200--------------------------------------------------------------------------------
A0L9X2_MAGSM/215-376--------------------------------------------------------------------------------
A6UVF0_META3/84-245--------------------------------------------------------------------------------
A6DCR0_9PROT/41-203--------------------------------------------------------------------------------
Q31I99_THICR/36-198--------------------------------------------------------------------------------
A6DCQ9_9PROT/42-203--------------------------------------------------------------------------------
A3N331_ACTP2/49-209--------------------------------------------------------------------------------

PF06175

Q8DGE6_THEEB/14-210--------------------------------------------------------------------------------
Q8CX43_SHEON/3-250--------------------------------------------------------------------------------
Q8YT06_NOSS1/3-199--------------------------------------------------------------------------------
Q9I2V2_PSEAE/4-199--------------------------------------------------------------------------------
Q9KQT8_VIBCH/11-254--------------------------------------------------------------------------------
MIAE_SALTY/21-264--------------------------------------------------------------------------------

PF00210

O51633_BORBU/17-163--------------------------------------------------------------------------------
C1L1L4_LISMC/10-156--------------------------------------------------------------------------------
Q7CVU6_AGRT5/29-171--------------------------------------------------------------------------------
FRI_AEDAE/47-192--------------------------------------------------------------------------------
A9L0T5_SHEB9/8-145--------------------------------------------------------------------------------
Q47H63_DECAR/8-145--------------------------------------------------------------------------------
Q7NS74_CHRVO/8-145--------------------------------------------------------------------------------
Q2W946_MAGSA/8-145--------------------------------------------------------------------------------
A6UZL6_PSEA7/8-144--------------------------------------------------------------------------------
A6VZ68_MARMS/8-145--------------------------------------------------------------------------------
A1K209_AZOSB/8-144--------------------------------------------------------------------------------
Q5QYS8_IDILO/8-145--------------------------------------------------------------------------------
Q2RNM7_RHORT/8-145--------------------------------------------------------------------------------
A4C4I5_9GAMM/8-145--------------------------------------------------------------------------------
Q1R5Y6_ECOUT/8-144--------------------------------------------------------------------------------
A5VB21_SPHWW/8-144--------------------------------------------------------------------------------
A1WVE6_HALHL/8-144--------------------------------------------------------------------------------
BFRB_NEIGO/8-144--------------------------------------------------------------------------------
A5WHB2_PSYWF/8-144--------------------------------------------------------------------------------
A6VZ67_MARMS/8-144--------------------------------------------------------------------------------
Q486V4_COLP3/8-144--------------------------------------------------------------------------------
A0KTR2_SHESA/8-144--------------------------------------------------------------------------------
Q6NE82_9PROT/8-144--------------------------------------------------------------------------------
Q1N3D5_9GAMM/8-144--------------------------------------------------------------------------------
Q5QYS9_IDILO/8-144--------------------------------------------------------------------------------
A6SUV4_JANMA/8-144--------------------------------------------------------------------------------
A3Q090_MYCSJ/8-144--------------------------------------------------------------------------------
Q0RHP5_FRAAA/10-146--------------------------------------------------------------------------------
Q091J6_STIAD/47-183--------------------------------------------------------------------------------
A0NS52_9RHOB/8-144--------------------------------------------------------------------------------
A3JWU8_9RHOB/8-144--------------------------------------------------------------------------------
Q5NM50_ZYMMO/8-144--------------------------------------------------------------------------------
Q024H5_SOLUE/31-167--------------------------------------------------------------------------------
Q1EMI9_LEPBI/8-144--------------------------------------------------------------------------------
Q1IK36_KORVE/8-144--------------------------------------------------------------------------------
Q39UD7_GEOMG/8-144--------------------------------------------------------------------------------
Q1Q5F8_9BACT/8-143--------------------------------------------------------------------------------
A7HHQ5_ANADF/8-144--------------------------------------------------------------------------------
Q7VQF0_BLOFL/8-144--------------------------------------------------------------------------------
Q2GE61_NEOSM/7-143--------------------------------------------------------------------------------
A6CF83_9PLAN/8-144--------------------------------------------------------------------------------
Q73FS6_WOLPM/6-148--------------------------------------------------------------------------------
A3YZ38_9SYNE/11-147--------------------------------------------------------------------------------
A4BLJ1_9GAMM/11-147--------------------------------------------------------------------------------
Q0AHV3_NITEC/8-139--------------------------------------------------------------------------------
Q3SFL0_THIDA/6-135--------------------------------------------------------------------------------
A6FK64_9RHOB/8-144--------------------------------------------------------------------------------
A4A1Y7_9PLAN/7-143--------------------------------------------------------------------------------
Q0BUB9_GRABC/32-177--------------------------------------------------------------------------------
DPS_AGRT5/19-162--------------------------------------------------------------------------------
DPS_ACIAD/26-168--------------------------------------------------------------------------------
Q07GK9_ROSDO/17-162--------------------------------------------------------------------------------
Q2CAH6_9RHOB/18-159--------------------------------------------------------------------------------
Q0FT36_9RHOB/18-160--------------------------------------------------------------------------------
Q1DDZ6_MYXXD/18-163--------------------------------------------------------------------------------
Q3M4R5_ANAVT/26-170--------------------------------------------------------------------------------
A0LWG9_ACIC1/21-160--------------------------------------------------------------------------------
A1T8Z5_MYCVP/26-167--------------------------------------------------------------------------------
A4AGA8_9ACTN/36-176--------------------------------------------------------------------------------
A7BBG2_9ACTO/21-162--------------------------------------------------------------------------------
A3ZU64_9PLAN/20-161--------------------------------------------------------------------------------
A4QI42_CORGB/18-162--------------------------------------------------------------------------------
A1TH15_MYCVP/18-162--------------------------------------------------------------------------------
Q3KZ37_NOCSI/23-167--------------------------------------------------------------------------------
A4A8V0_9GAMM/21-165--------------------------------------------------------------------------------
A0AD01_STRAM/23-167--------------------------------------------------------------------------------
FTPA_HAEDU/44-188--------------------------------------------------------------------------------
DPS2_DEIRA/79-223--------------------------------------------------------------------------------
Q5WI06_BACSK/7-151--------------------------------------------------------------------------------
TPF1_TREPA/36-177--------------------------------------------------------------------------------
Q2IR77_RHOP2/9-147--------------------------------------------------------------------------------
Q1QGB4_NITHX/16-157--------------------------------------------------------------------------------
Q9A4G1_CAUCR/37-177--------------------------------------------------------------------------------
Q68VU3_RICTY/4-143--------------------------------------------------------------------------------
Q7NGR9_GLOVI/17-162--------------------------------------------------------------------------------
Q8DG54_THEEB/12-156--------------------------------------------------------------------------------
Q1J1Q0_DEIGD/77-222--------------------------------------------------------------------------------
Q9K3L0_STRCO/52-198--------------------------------------------------------------------------------
Q1IK59_KORVE/49-195--------------------------------------------------------------------------------
A3WEG4_9SPHN/13-158--------------------------------------------------------------------------------
A3ZY47_9PLAN/17-162--------------------------------------------------------------------------------
Q5HSQ2_CAMJR/4-149--------------------------------------------------------------------------------
A0RM57_CAMFF/5-145--------------------------------------------------------------------------------
Q8REM0_FUSNN/4-142--------------------------------------------------------------------------------
A5FAK1_FLAJ1/17-159--------------------------------------------------------------------------------
A3XLP6_LEEBM/15-157--------------------------------------------------------------------------------
Q1VZR4_9FLAO/15-159--------------------------------------------------------------------------------
Q4A6A8_MYCS5/1-137--------------------------------------------------------------------------------
Q04D79_OENOB/12-159--------------------------------------------------------------------------------
Q9FAA0_LACFE/7-153--------------------------------------------------------------------------------
Q82Z45_ENTFA/7-153--------------------------------------------------------------------------------
A8AW08_STRGC/25-171--------------------------------------------------------------------------------
Q03LA4_STRTD/26-172--------------------------------------------------------------------------------
Q74KF5_LACJO/7-153--------------------------------------------------------------------------------
Q1WRB2_LACS1/34-180--------------------------------------------------------------------------------
Q03SI7_LACBA/26-172--------------------------------------------------------------------------------
A0Z048_LYNSP/36-181--------------------------------------------------------------------------------
Q7NHH1_GLOVI/31-176--------------------------------------------------------------------------------
Q3IPN0_NATPD/30-175--------------------------------------------------------------------------------
Q67R42_SYMTH/16-162--------------------------------------------------------------------------------
BFR_DESDA/13-142--------------------------------------------------------------------------------
Q1MQL3_LAWIP/15-151--------------------------------------------------------------------------------
Q1IS71_KORVE/8-144--------------------------------------------------------------------------------
A6DC96_9PROT/7-143--------------------------------------------------------------------------------
A6Q7E1_SULNB/6-142--------------------------------------------------------------------------------
Q1Q315_9BACT/9-146--------------------------------------------------------------------------------
Q3ZXT0_DEHSC/7-137--------------------------------------------------------------------------------
Q3B5B6_PELLD/17-161--------------------------------------------------------------------------------
Q2FMS4_METHJ/17-161--------------------------------------------------------------------------------
A6L680_BACV8/19-163--------------------------------------------------------------------------------
A9AJZ8_BURM1/50-192--------------------------------------------------------------------------------
A3DMK7_STAMF/7-139--------------------------------------------------------------------------------
A0RUV2_CENSY/25-165--------------------------------------------------------------------------------
Q7NDE3_GLOVI/20-166--------------------------------------------------------------------------------
Q9YBZ3_AERPE/19-168--------------------------------------------------------------------------------
Q2RMD8_MOOTA/7-141--------------------------------------------------------------------------------
Q9K5J5_BACAN/9-143--------------------------------------------------------------------------------
Q8ERY8_OCEIH/9-143--------------------------------------------------------------------------------
Q7UWW0_RHOBA/7-140--------------------------------------------------------------------------------
A3ZR38_9PLAN/6-140--------------------------------------------------------------------------------
Q0AEZ2_NITEC/9-145--------------------------------------------------------------------------------
O66666_AQUAE/154-284--------------------------------------------------------------------------------
A6CI68_9BACI/7-140--------------------------------------------------------------------------------
Q67S14_SYMTH/6-143--------------------------------------------------------------------------------
B3EMU8_CHLPB/7-143--------------------------------------------------------------------------------
A8F5W0_THELT/7-144--------------------------------------------------------------------------------
Q73QJ4_TREDE/6-143--------------------------------------------------------------------------------
D1N6G1_9BACT/7-144--------------------------------------------------------------------------------
Q3A1G4_PELCD/7-144--------------------------------------------------------------------------------
Q8U2T8_PYRFU/7-144--------------------------------------------------------------------------------
A7HMU5_FERNB/7-144--------------------------------------------------------------------------------
A4WKQ8_PYRAR/321-458--------------------------------------------------------------------------------
Q1ASD6_RUBXD/14-151--------------------------------------------------------------------------------
A9B878_HERA2/7-144--------------------------------------------------------------------------------
A7NP42_ROSCS/7-144--------------------------------------------------------------------------------
Q6MCM0_PARUW/6-143--------------------------------------------------------------------------------
A8DR49_9BACT/7-144--------------------------------------------------------------------------------
A0LJP8_SYNFM/7-144--------------------------------------------------------------------------------
A1VDR6_DESVV/7-144--------------------------------------------------------------------------------
A5UNY9_METS3/7-144--------------------------------------------------------------------------------
Q2FQC4_METHJ/9-146--------------------------------------------------------------------------------
Q6AMM6_DESPS/7-144--------------------------------------------------------------------------------
A7ABY7_9PORP/8-145--------------------------------------------------------------------------------
O83010_PORGN/8-145--------------------------------------------------------------------------------
A6L3Z0_BACV8/7-144--------------------------------------------------------------------------------
Q8A8R0_BACTN/6-143--------------------------------------------------------------------------------
A7HD23_ANADF/7-144--------------------------------------------------------------------------------
A7VV91_9CLOT/7-144--------------------------------------------------------------------------------
Q97KS2_CLOAB/7-144--------------------------------------------------------------------------------
Q185Y2_CLOD6/7-141--------------------------------------------------------------------------------
A6UTU4_META3/7-144--------------------------------------------------------------------------------
Q6LY34_METMP/6-143--------------------------------------------------------------------------------
Q46E88_METBF/7-144--------------------------------------------------------------------------------
A6LMA2_THEM4/7-144--------------------------------------------------------------------------------
B9M5T0_GEOSF/7-144--------------------------------------------------------------------------------
Q1JW00_DESAC/7-144--------------------------------------------------------------------------------
A7C0L0_9GAMM/7-144--------------------------------------------------------------------------------
A6U2Z7_STAA2/7-144--------------------------------------------------------------------------------
Q5WLC3_BACSK/10-147--------------------------------------------------------------------------------
Q72Y25_BACC1/7-144--------------------------------------------------------------------------------
A7YTG3_FRATU/7-144--------------------------------------------------------------------------------
A5N4F2_CLOK5/7-144--------------------------------------------------------------------------------
Q899N4_CLOTE/7-144--------------------------------------------------------------------------------
A6TMX8_ALKMQ/7-144--------------------------------------------------------------------------------
Q8XLR2_CLOPE/7-144--------------------------------------------------------------------------------
B0KBX0_THEP3/7-144--------------------------------------------------------------------------------
A4XMZ6_CALS8/7-144--------------------------------------------------------------------------------
B8I3V4_CLOCE/7-144--------------------------------------------------------------------------------
A3DBC9_CLOTH/5-142--------------------------------------------------------------------------------
A4ANB4_MARSH/7-144--------------------------------------------------------------------------------
A5WH54_PSYWF/11-148--------------------------------------------------------------------------------
A6EKF4_9SPHI/16-153--------------------------------------------------------------------------------
A5FM49_FLAJ1/16-153--------------------------------------------------------------------------------
A3HS92_9BACT/18-155--------------------------------------------------------------------------------
A1ZLT6_9BACT/28-165--------------------------------------------------------------------------------
A9A256_NITMS/8-145--------------------------------------------------------------------------------
Q7X3H8_TREHY/9-146--------------------------------------------------------------------------------
A0KRF7_SHESA/7-144--------------------------------------------------------------------------------
A6VPR5_ACTSZ/7-144--------------------------------------------------------------------------------
Q31JA0_THICR/7-144--------------------------------------------------------------------------------
Q9RNF8_HELPX/7-144--------------------------------------------------------------------------------
Q8D2Y7_WIGBR/7-144--------------------------------------------------------------------------------
Q1LTF7_BAUCH/7-144--------------------------------------------------------------------------------
A7MEF7_CROS8/7-144--------------------------------------------------------------------------------
FTNB_ECO57/7-144--------------------------------------------------------------------------------
A6FGT3_9GAMM/9-146--------------------------------------------------------------------------------
Q6A5N4_PROAC/8-146--------------------------------------------------------------------------------
Q4JX21_CORJK/8-145--------------------------------------------------------------------------------
Q8NMP2_CORGL/8-145--------------------------------------------------------------------------------
C0A2T5_9BACT/6-143--------------------------------------------------------------------------------
A1SHK2_NOCSJ/7-144--------------------------------------------------------------------------------
A4FJL2_SACEN/16-153--------------------------------------------------------------------------------
A1KQH6_MYCBP/12-149--------------------------------------------------------------------------------
A0K014_ARTS2/7-144--------------------------------------------------------------------------------
Q5Z3M1_NOCFA/11-148--------------------------------------------------------------------------------
Q0IB83_SYNS3/32-169--------------------------------------------------------------------------------
A3Z7J9_9SYNE/10-147--------------------------------------------------------------------------------
Q46LC4_PROMT/29-166--------------------------------------------------------------------------------
A2BW25_PROM5/30-167--------------------------------------------------------------------------------
A4CU24_SYNPV/6-143--------------------------------------------------------------------------------
A3YZ65_9SYNE/32-169--------------------------------------------------------------------------------
Q7V873_PROMM/5-142--------------------------------------------------------------------------------
Q7NC62_MYCGA/6-144--------------------------------------------------------------------------------
Q14P78_SPICI/11-144--------------------------------------------------------------------------------
O77232_SCHJA/38-173--------------------------------------------------------------------------------
Q17PG4_AEDAE/49-190--------------------------------------------------------------------------------
A1C334_DAPPU/14-155--------------------------------------------------------------------------------
A0S5U1_HYDVU/14-154--------------------------------------------------------------------------------
FRI_PACLE/13-154--------------------------------------------------------------------------------
Q0PKG0_HALDI/15-156--------------------------------------------------------------------------------
O96408_SCHJA/13-154--------------------------------------------------------------------------------
A8WNX6_CAEBR/13-154--------------------------------------------------------------------------------
FRIL1_MOUSE/14-155--------------------------------------------------------------------------------
FRI3_LITCT/14-155--------------------------------------------------------------------------------
Q6IQF1_DANRE/13-154--------------------------------------------------------------------------------
A7S8I5_NEMVE/90-231--------------------------------------------------------------------------------
Q0PKG1_HALDI/52-190--------------------------------------------------------------------------------
O15972_LIOJA/32-206--------------------------------------------------------------------------------
A2AHC5_MOUSE/17-158--------------------------------------------------------------------------------
Q9DAX0_MOUSE/17-158--------------------------------------------------------------------------------
A2VCJ5_CLOSI/9-150--------------------------------------------------------------------------------
FRIH2_SCHMA/15-156--------------------------------------------------------------------------------
Q9VYH1_DROME/25-165--------------------------------------------------------------------------------
Q2TQ27_CARRO/41-183--------------------------------------------------------------------------------
FRIY_LYMST/34-216--------------------------------------------------------------------------------
FRI1_PEA/88-233--------------------------------------------------------------------------------
A4RT97_OSTLU/17-162--------------------------------------------------------------------------------
Q9XFY2_CHLPR/83-228--------------------------------------------------------------------------------
Q8SRN5_ENCCU/18-158--------------------------------------------------------------------------------
Q5MGP3_LONON/42-197--------------------------------------------------------------------------------
A8CW67_LUTLO/42-193--------------------------------------------------------------------------------
A8D916_BOMIG/44-196--------------------------------------------------------------------------------
Q9U0S2_NILLU/47-206--------------------------------------------------------------------------------
A1C331_DAPPU/38-183--------------------------------------------------------------------------------
Q16T40_AEDAE/40-186--------------------------------------------------------------------------------
Q5QBK7_9DIPT/55-208--------------------------------------------------------------------------------
Q52SA8_TRINI/26-176--------------------------------------------------------------------------------
Q9TVI4_CALET/56-206--------------------------------------------------------------------------------
Q8MUW9_APRGE/57-204--------------------------------------------------------------------------------
A8CW63_LUTLO/54-207--------------------------------------------------------------------------------
Q9BII4_9TREM/55-199--------------------------------------------------------------------------------
Q3UWK9_MOUSE/14-152--------------------------------------------------------------------------------
ARTM_ARTSA/32-172--------------------------------------------------------------------------------

PF09537

A4G4I6_HERAR/9-119--------------------------------------------------------------------------------
B0KPC2_PSEPG/7-117--------------------------------------------------------------------------------
A0M5S8_GRAFK/6-116--------------------------------------------------------------------------------
A2TRU2_9FLAO/6-116--------------------------------------------------------------------------------
A4YW11_BRASO/1-110--------------------------------------------------------------------------------
Q2ISU3_RHOP2/4-113--------------------------------------------------------------------------------
Q476Y2_CUPPJ/7-117--------------------------------------------------------------------------------
Q08M54_STIAD/4-111--------------------------------------------------------------------------------
A3KTV6_PSEAI/8-118--------------------------------------------------------------------------------
Q3IYE5_RHOS4/13-121--------------------------------------------------------------------------------
A3DJV7_CLOTH/7-116--------------------------------------------------------------------------------
Q07S33_RHOP5/4-113--------------------------------------------------------------------------------
Q3BVR2_XANC5/6-115--------------------------------------------------------------------------------
A5PE58_9SPHN/1-110--------------------------------------------------------------------------------
A2U3N9_9FLAO/7-117--------------------------------------------------------------------------------
Q07PC2_RHOP5/3-112--------------------------------------------------------------------------------
B5E925_GEOBB/5-113--------------------------------------------------------------------------------
Q2NBQ4_ERYLH/1-110--------------------------------------------------------------------------------
Q0FLV7_9RHOB/12-120--------------------------------------------------------------------------------
Q0SSJ9_CLOPS/8-117--------------------------------------------------------------------------------
A6EG78_9SPHI/6-118--------------------------------------------------------------------------------
Q3M4J2_ANAVT/209-301--------------------------------------------------------------------------------
A9C130_DELAS/176-286--------------------------------------------------------------------------------
Q0KB71_CUPNH/7-117--------------------------------------------------------------------------------
Q887I8_PSESM/7-117--------------------------------------------------------------------------------
A3TIM1_9MICO/3-116--------------------------------------------------------------------------------
A3U6Z8_CROAH/24-134--------------------------------------------------------------------------------
Q15NE8_PSEA6/5-115--------------------------------------------------------------------------------
Q023Z4_SOLUE/5-115--------------------------------------------------------------------------------
Q26B76_FLABB/6-116--------------------------------------------------------------------------------
Q3IVZ0_RHOS4/11-119--------------------------------------------------------------------------------
Q8XXF1_RALSO/7-117--------------------------------------------------------------------------------
Q3K810_PSEPF/7-117--------------------------------------------------------------------------------
A4XUK4_PSEMY/9-119--------------------------------------------------------------------------------
Q1N7C3_9SPHN/4-113--------------------------------------------------------------------------------
A1TM49_ACIAC/185-295--------------------------------------------------------------------------------
B2JMY7_BURP8/4-114--------------------------------------------------------------------------------
Q21P44_SACD2/29-139--------------------------------------------------------------------------------
B4SKE7_STRM5/6-115--------------------------------------------------------------------------------
Q2SCK1_HAHCH/5-115--------------------------------------------------------------------------------
B2TGN5_BURPP/4-114--------------------------------------------------------------------------------
Q2Y8P3_NITMU/5-115--------------------------------------------------------------------------------
Q1VAV2_VIBAL/4-114--------------------------------------------------------------------------------
B0SY12_CAUSK/7-116--------------------------------------------------------------------------------
Q26G94_FLABB/6-116--------------------------------------------------------------------------------
A1VPM3_POLNA/175-285--------------------------------------------------------------------------------
A5V9B8_SPHWW/33-142--------------------------------------------------------------------------------
Q166R7_ROSDO/13-121--------------------------------------------------------------------------------
A2U3Q7_9FLAO/6-116--------------------------------------------------------------------------------
A5V2C1_SPHWW/29-137--------------------------------------------------------------------------------
A8MGM2_ALKOO/6-115--------------------------------------------------------------------------------
A3ZS58_9PLAN/10-120--------------------------------------------------------------------------------
A6B9D2_VIBPA/4-112--------------------------------------------------------------------------------
Q26D84_FLABB/15-125--------------------------------------------------------------------------------
A6EEM1_9SPHI/4-118--------------------------------------------------------------------------------
Q2BCF3_9BACI/5-106--------------------------------------------------------------------------------
A3XKU4_LEEBM/6-116--------------------------------------------------------------------------------
Q48MB3_PSE14/7-117--------------------------------------------------------------------------------
Q1D9W1_MYXXD/39-146--------------------------------------------------------------------------------
Q3IHE9_PSEHT/7-117--------------------------------------------------------------------------------
A5FJ39_FLAJ1/10-121--------------------------------------------------------------------------------
A3U8G4_CROAH/15-125--------------------------------------------------------------------------------
A6VRV2_MARMS/6-117--------------------------------------------------------------------------------
A4CGM0_ROBBH/6-116--------------------------------------------------------------------------------
A3XKU3_LEEBM/6-116--------------------------------------------------------------------------------
A6SZY6_JANMA/4-114--------------------------------------------------------------------------------
Q7USR8_RHOBA/12-122--------------------------------------------------------------------------------
Q1IRA5_KORVE/5-114--------------------------------------------------------------------------------
A4WXB8_RHOS5/11-119--------------------------------------------------------------------------------
A4XNN6_PSEMY/3-113--------------------------------------------------------------------------------
A3W9J5_9SPHN/2-111--------------------------------------------------------------------------------
A4VP43_PSEU5/5-115--------------------------------------------------------------------------------
A2SFH6_METPP/5-115--------------------------------------------------------------------------------
A3XNV9_LEEBM/11-121--------------------------------------------------------------------------------
Q4ZXE4_PSEU2/7-117--------------------------------------------------------------------------------
A6EG63_9SPHI/6-117--------------------------------------------------------------------------------
A3U4G7_CROAH/5-117--------------------------------------------------------------------------------
Q2CEG5_9RHOB/3-112--------------------------------------------------------------------------------
A4A276_9PLAN/14-124--------------------------------------------------------------------------------

PF07875

A4XMZ0_CALS8/5-68--------------------------------------------------------------------------------
Q3EKQ4_BACTI/62-125--------------------------------------------------------------------------------
A5I1Q7_CLOBH/16-79--------------------------------------------------------------------------------
Q9K644_BACHD/133-196--------------------------------------------------------------------------------
A6M292_CLOB8/16-79--------------------------------------------------------------------------------
Q9KEV6_BACHD/15-78--------------------------------------------------------------------------------
Q0SWC3_CLOPS/2-65--------------------------------------------------------------------------------
Q97FP5_CLOAB/9-72--------------------------------------------------------------------------------
A6CTZ8_9BACI/23-86--------------------------------------------------------------------------------
Q2BDD9_9BACI/15-78--------------------------------------------------------------------------------
A6BGT2_9FIRM/3-66--------------------------------------------------------------------------------
Q8ELM4_OCEIH/130-193--------------------------------------------------------------------------------
Q2BA87_9BACI/121-184--------------------------------------------------------------------------------
Q0AVR0_SYNWW/6-69--------------------------------------------------------------------------------
Q65F68_BACLD/23-86--------------------------------------------------------------------------------
A6M290_CLOB8/10-73--------------------------------------------------------------------------------
Q4MR30_BACCE/2-65--------------------------------------------------------------------------------
A0Q278_CLONN/2-65--------------------------------------------------------------------------------
YRAF_BACSU/18-81--------------------------------------------------------------------------------
A7Z1V3_BACA2/15-78--------------------------------------------------------------------------------
Q67MT8_SYMTH/17-80--------------------------------------------------------------------------------
Q97FG0_CLOAB/16-79--------------------------------------------------------------------------------
A8FBD5_BACP2/117-180--------------------------------------------------------------------------------
A3I3H5_9BACI/121-184--------------------------------------------------------------------------------
Q97JF1_CLOAB/102-165--------------------------------------------------------------------------------
A7Z2T2_BACA2/122-185--------------------------------------------------------------------------------
Q5WIT4_BACSK/122-185--------------------------------------------------------------------------------
A7GNZ9_BACCN/82-145--------------------------------------------------------------------------------
Q5KVI9_GEOKA/20-83--------------------------------------------------------------------------------
A6TLQ8_ALKMQ/10-73--------------------------------------------------------------------------------
Q65CP9_BACLD/75-139--------------------------------------------------------------------------------
A5I017_CLOBH/2-65--------------------------------------------------------------------------------
YUSN_BACSU/22-85--------------------------------------------------------------------------------
Q8R816_THETN/8-71--------------------------------------------------------------------------------
A3DD47_CLOTH/2-65--------------------------------------------------------------------------------
Q5L3H9_GEOKA/81-145--------------------------------------------------------------------------------
Q65JC0_BACLD/15-78--------------------------------------------------------------------------------
A1HNM7_9FIRM/9-72--------------------------------------------------------------------------------
YHCQ_BACSU/121-184--------------------------------------------------------------------------------
Q97LE8_CLOAB/15-78--------------------------------------------------------------------------------
A5D0N6_PELTS/107-170--------------------------------------------------------------------------------
B8I7R4_CLOCE/101-164--------------------------------------------------------------------------------
A5N8T4_CLOK5/2-65--------------------------------------------------------------------------------
Q65M26_BACLD/120-183--------------------------------------------------------------------------------
A4IN35_GEOTN/19-82--------------------------------------------------------------------------------
A7ZAR0_BACA2/78-142--------------------------------------------------------------------------------
A5KJI1_9FIRM/2-65--------------------------------------------------------------------------------
Q3A9B7_CARHZ/6-69--------------------------------------------------------------------------------
Q97E03_CLOAB/16-79--------------------------------------------------------------------------------
Q8ES15_OCEIH/3-66--------------------------------------------------------------------------------
Q2RGX7_MOOTA/100-163--------------------------------------------------------------------------------
Q2RHK6_MOOTA/7-70--------------------------------------------------------------------------------
A9KJ50_CLOPH/6-69--------------------------------------------------------------------------------
Q252C4_DESHY/3-66--------------------------------------------------------------------------------
A3DC40_CLOTH/17-80--------------------------------------------------------------------------------
COTF_BACSU/77-141--------------------------------------------------------------------------------
Q67KL3_SYMTH/48-111--------------------------------------------------------------------------------
A6TVY2_ALKMQ/16-79--------------------------------------------------------------------------------
A4J5V2_DESRM/7-70--------------------------------------------------------------------------------
Q9K780_BACHD/21-84--------------------------------------------------------------------------------
A0RFR9_BACAH/75-139--------------------------------------------------------------------------------
Q18CV2_CLOD6/16-79--------------------------------------------------------------------------------
B8D269_HALOH/15-78--------------------------------------------------------------------------------
A5Z919_9FIRM/6-69--------------------------------------------------------------------------------
A5D0C0_PELTS/3-66--------------------------------------------------------------------------------

PF05974

Q7D2Y1_AGRT5/3-159--------------------------------------------------------------------------------
A6CEX2_9PLAN/11-168--------------------------------------------------------------------------------
Q11AY7_MESSB/10-167--------------------------------------------------------------------------------
Q11TD5_CYTH3/34-191--------------------------------------------------------------------------------
B9B5H5_9BURK/3-158--------------------------------------------------------------------------------
Q89H23_BRAJA/1-158--------------------------------------------------------------------------------
A7ZZJ3_ECOHS/2-157--------------------------------------------------------------------------------
Q8PG92_XANAC/5-162--------------------------------------------------------------------------------
Q2N5V6_ERYLH/5-164--------------------------------------------------------------------------------
Q11CH8_MESSB/7-164--------------------------------------------------------------------------------
A6T9K0_KLEP7/2-157--------------------------------------------------------------------------------
Q47PX9_THEFY/5-162--------------------------------------------------------------------------------
Q2RUN9_RHORT/4-159--------------------------------------------------------------------------------
A3SZ42_9RHOB/27-186--------------------------------------------------------------------------------
A4A274_9PLAN/5-162--------------------------------------------------------------------------------
Q1IZK8_DEIGD/29-185--------------------------------------------------------------------------------
A6EG70_9SPHI/34-192--------------------------------------------------------------------------------
Q98GX4_RHILO/1-158--------------------------------------------------------------------------------
E0TEY5_PARBH/5-164--------------------------------------------------------------------------------
Q7AEY0_ECO57/5-163--------------------------------------------------------------------------------
Q8PKL6_XANAC/3-158--------------------------------------------------------------------------------
Q0BW11_GRABC/53-210--------------------------------------------------------------------------------
A4ELT9_9RHOB/5-164--------------------------------------------------------------------------------
Q2JZP1_RHIEC/6-163--------------------------------------------------------------------------------
A7IKA4_XANP2/10-167--------------------------------------------------------------------------------
Q1IMP2_KORVE/3-161--------------------------------------------------------------------------------
A4WT57_RHOS5/10-166--------------------------------------------------------------------------------
B0U7G3_METS4/4-159--------------------------------------------------------------------------------
Q18IC2_HALWD/5-160--------------------------------------------------------------------------------
Q07RJ3_RHOP5/10-167--------------------------------------------------------------------------------
A6EH70_9SPHI/7-165--------------------------------------------------------------------------------
Q4UQ81_XANC8/5-160--------------------------------------------------------------------------------
A4EK29_9RHOB/5-164--------------------------------------------------------------------------------
Q7WNA6_BORBR/5-162--------------------------------------------------------------------------------
A5FEI3_FLAJ1/35-192--------------------------------------------------------------------------------
A7MLF2_CROS8/5-163--------------------------------------------------------------------------------
A3P9L7_BURP0/123-278--------------------------------------------------------------------------------
A5FGJ1_FLAJ1/57-214--------------------------------------------------------------------------------
Q92X71_RHIME/3-158--------------------------------------------------------------------------------
Q6WB78_ALCFA/7-162--------------------------------------------------------------------------------
A3U308_9RHOB/5-161--------------------------------------------------------------------------------
Q2IZB5_RHOP2/8-165--------------------------------------------------------------------------------
Q28Q87_JANSC/5-164--------------------------------------------------------------------------------
Q6MCM2_PARUW/7-170--------------------------------------------------------------------------------
Q98DP6_RHILO/10-167--------------------------------------------------------------------------------
B0UQL3_METS4/6-163--------------------------------------------------------------------------------
Q1IVZ3_DEIGD/5-161--------------------------------------------------------------------------------
Q07KF9_RHOP5/256-415--------------------------------------------------------------------------------
C1DPA9_AZOVD/3-158--------------------------------------------------------------------------------
A5PDQ9_9SPHN/10-168--------------------------------------------------------------------------------
B1Z9G7_METPB/5-160--------------------------------------------------------------------------------
Q2KDJ5_RHIEC/6-163--------------------------------------------------------------------------------
A6E9F0_9SPHI/20-174--------------------------------------------------------------------------------
A6X824_OCHA4/6-163--------------------------------------------------------------------------------
Q01V03_SOLUE/6-163--------------------------------------------------------------------------------
A4YZ67_BRASO/4-159--------------------------------------------------------------------------------
Q1YKQ2_MOBAS/13-170--------------------------------------------------------------------------------
Q1QGY5_NITHX/3-158--------------------------------------------------------------------------------
Q2RVL1_RHORT/10-167--------------------------------------------------------------------------------
Q2IXU9_RHOP2/10-168--------------------------------------------------------------------------------
Q28UW6_JANSC/13-172--------------------------------------------------------------------------------
Q6MC28_PARUW/4-175--------------------------------------------------------------------------------
A6EDE5_9SPHI/9-167--------------------------------------------------------------------------------
A5EEQ8_BRASB/255-414--------------------------------------------------------------------------------
Q11CI8_MESSB/3-158--------------------------------------------------------------------------------
A3ZRB2_9PLAN/10-166--------------------------------------------------------------------------------
Q01UE6_SOLUE/4-161--------------------------------------------------------------------------------
A1B150_PARDP/5-162--------------------------------------------------------------------------------
A3VE20_9RHOB/3-161--------------------------------------------------------------------------------
B0UBY3_METS4/4-159--------------------------------------------------------------------------------
Q8YZ72_NOSS1/15-173--------------------------------------------------------------------------------
Q1BVU6_BURCA/3-158--------------------------------------------------------------------------------
Q3SP74_NITWN/6-163--------------------------------------------------------------------------------
A4WGM2_ENT38/5-158--------------------------------------------------------------------------------
Q0FYD4_9RHIZ/5-164--------------------------------------------------------------------------------
Q217H9_RHOPB/4-159--------------------------------------------------------------------------------
A6UF79_SINMW/6-163--------------------------------------------------------------------------------
B7KQ91_METC4/6-165--------------------------------------------------------------------------------
A7MK76_CROS8/3-158--------------------------------------------------------------------------------
A3K1P1_9RHOB/10-169--------------------------------------------------------------------------------
B0UBY7_METS4/6-165--------------------------------------------------------------------------------
A4VLE8_PSEU5/10-165--------------------------------------------------------------------------------
Q98P06_RHILO/13-170--------------------------------------------------------------------------------
Q11LJ1_MESSB/3-158--------------------------------------------------------------------------------
A9W6G1_METEP/4-159--------------------------------------------------------------------------------
A0LZC6_GRAFK/3-160--------------------------------------------------------------------------------
A6W5K1_KINRD/7-163--------------------------------------------------------------------------------
A0M7B4_GRAFK/3-160--------------------------------------------------------------------------------
Q3J5G6_RHOS4/9-166--------------------------------------------------------------------------------
Q1QSM8_CHRSD/16-174--------------------------------------------------------------------------------
Q0BW13_GRABC/6-161--------------------------------------------------------------------------------
A4XUK0_PSEMY/3-158--------------------------------------------------------------------------------
A4WQ47_RHOS5/3-158--------------------------------------------------------------------------------
A6V5Z0_PSEA7/3-158--------------------------------------------------------------------------------
Q2RUE8_RHORT/5-162--------------------------------------------------------------------------------
Q1INK4_KORVE/10-168--------------------------------------------------------------------------------
B2JRX0_BURP8/24-181--------------------------------------------------------------------------------
Q1QJZ8_NITHX/8-165--------------------------------------------------------------------------------
Q1QG59_NITHX/3-158--------------------------------------------------------------------------------
B0U8B5_METS4/7-163--------------------------------------------------------------------------------
A5FF55_FLAJ1/31-188--------------------------------------------------------------------------------
A4WDL1_ENT38/5-163--------------------------------------------------------------------------------
Q2KD03_RHIEC/258-417--------------------------------------------------------------------------------
A3WXM1_9BRAD/5-162--------------------------------------------------------------------------------
Q2JZN4_RHIEC/5-160--------------------------------------------------------------------------------
Q1YF89_MOBAS/5-164--------------------------------------------------------------------------------
Q5FS57_GLUOX/10-165--------------------------------------------------------------------------------
A3WF16_9SPHN/5-164--------------------------------------------------------------------------------
Q4ZL48_PSEU2/5-162--------------------------------------------------------------------------------
Q01R92_SOLUE/3-162--------------------------------------------------------------------------------
A3UGS3_9RHOB/3-162--------------------------------------------------------------------------------

PF12902

A0ZHB6_NODSP/18-250--------------------------------------------------------------------------------
A1X1N4_9BURK/613-836--------------------------------------------------------------------------------
A3HV98_9BACT/38-321--------------------------------------------------------------------------------
A3HZ39_9BACT/19-235--------------------------------------------------------------------------------
A3Y7W6_9GAMM/17-250--------------------------------------------------------------------------------
A4FHP6_SACEN/30-243--------------------------------------------------------------------------------
A4LG06_BURPE/20-228--------------------------------------------------------------------------------
A6ULY2_SINMW/16-247--------------------------------------------------------------------------------
A8M272_SALAI/669-906--------------------------------------------------------------------------------
A8ZLP5_ACAM1/23-242--------------------------------------------------------------------------------
B0C5X5_ACAM1/25-233--------------------------------------------------------------------------------
B0CT19_LACBS/234-434--------------------------------------------------------------------------------
B1KIQ0_SHEWM/17-245--------------------------------------------------------------------------------
E0ULS0_CYAP2/25-248--------------------------------------------------------------------------------
E0UKM8_CYAP2/76-306--------------------------------------------------------------------------------
B5HPH9_9ACTO/76-269--------------------------------------------------------------------------------
B7JXC8_CYAP8/18-243--------------------------------------------------------------------------------
B8PFV9_POSPM/149-342--------------------------------------------------------------------------------
B9NM45_9RHOB/334-495--------------------------------------------------------------------------------
D2S599_GEOOG/25-233--------------------------------------------------------------------------------
D7W1T5_9FLAO/113-372--------------------------------------------------------------------------------
C7QG40_CATAD/22-236--------------------------------------------------------------------------------
C7PJ64_CHIPD/65-298--------------------------------------------------------------------------------
C6W0G0_DYAFD/25-230--------------------------------------------------------------------------------
D0LW11_HALO1/25-246--------------------------------------------------------------------------------
C3KD44_PSEFS/15-238--------------------------------------------------------------------------------
C3XXN2_BRAFL/2783-3028--------------------------------------------------------------------------------
C3ZZV2_BRAFL/3683-3925--------------------------------------------------------------------------------
Q0H2X4_9ACTO/620-853--------------------------------------------------------------------------------
Q0RHC0_FRAAA/25-238--------------------------------------------------------------------------------
Q27IF3_9ACTO/618-871--------------------------------------------------------------------------------
Q7USU6_RHOBA/51-263--------------------------------------------------------------------------------
Q8GRF3_9ACTO/686-926--------------------------------------------------------------------------------
Q8KHV6_NOCAE/602-842--------------------------------------------------------------------------------
Q9AAP0_CAUCR/14-241--------------------------------------------------------------------------------
Q9FBT7_STRCO/27-241--------------------------------------------------------------------------------
Q9RJF6_STRCO/71-265--------------------------------------------------------------------------------
VIOB_CHRVO/605-828--------------------------------------------------------------------------------

PF13628

B9M9A2_GEOSF/32-168--------------------------------------------------------------------------------
D8JRV0_HYPDA/27-169--------------------------------------------------------------------------------
B5EEU3_GEOBB/29-165--------------------------------------------------------------------------------
D5WLB6_BURSC/27-169--------------------------------------------------------------------------------
B2J1E3_NOSP7/67-203--------------------------------------------------------------------------------
Q46RG7_CUPPJ/74-211--------------------------------------------------------------------------------
B9XLH1_9BACT/39-176--------------------------------------------------------------------------------
B1ZNP6_OPITP/29-171--------------------------------------------------------------------------------
B4CUJ0_9BACT/35-171--------------------------------------------------------------------------------
B9TGV0_RICCO/88-225--------------------------------------------------------------------------------
E0UH58_CYAP2/56-192--------------------------------------------------------------------------------
B8IFB9_METNO/26-168--------------------------------------------------------------------------------
Q2Y8Y8_NITMU/29-171--------------------------------------------------------------------------------
A5XZ63_BURML/27-169--------------------------------------------------------------------------------
Q2K1W8_RHIEC/36-173--------------------------------------------------------------------------------
Q89S47_BRAJA/47-189--------------------------------------------------------------------------------
Q475E9_CUPPJ/38-175--------------------------------------------------------------------------------
Q2JYM6_RHIEC/26-168--------------------------------------------------------------------------------
B7XMG6_ENTBH/26-161--------------------------------------------------------------------------------
B1SYH2_9BURK/28-170--------------------------------------------------------------------------------
B2JWH1_BURP8/26-168--------------------------------------------------------------------------------
E3I358_RHOVT/31-167--------------------------------------------------------------------------------
Q983W7_RHILO/27-169--------------------------------------------------------------------------------
B2JMY4_BURP8/40-174--------------------------------------------------------------------------------
C6BHV4_RALP1/37-174--------------------------------------------------------------------------------
B4RD58_PHEZH/36-178--------------------------------------------------------------------------------
B2TGN9_BURPP/45-179--------------------------------------------------------------------------------
A5ET49_BRASB/16-158--------------------------------------------------------------------------------
C6W7B7_DYAFD/46-182--------------------------------------------------------------------------------
B1Z4Z9_BURA4/61-196--------------------------------------------------------------------------------
A6WYV3_OCHA4/28-170--------------------------------------------------------------------------------
A4VIW1_PSEU5/27-163--------------------------------------------------------------------------------
C6VVL2_DYAFD/52-188--------------------------------------------------------------------------------
D2QCP5_SPILD/50-187--------------------------------------------------------------------------------
A5W3E5_PSEP1/25-160--------------------------------------------------------------------------------
F0QBL1_ACIAP/59-196--------------------------------------------------------------------------------
B3R194_CUPTR/37-174--------------------------------------------------------------------------------
Q5NXZ0_AROAE/83-220--------------------------------------------------------------------------------
C0INK3_9BACT/23-165--------------------------------------------------------------------------------
A8I5I1_AZOC5/73-211--------------------------------------------------------------------------------
B1Z9Q1_METPB/40-177--------------------------------------------------------------------------------
E8S4J3_MICSL/32-168--------------------------------------------------------------------------------
A6V653_PSEA7/32-167--------------------------------------------------------------------------------
Q1IQR0_KORVE/28-170--------------------------------------------------------------------------------
A2WJB2_9BURK/59-195--------------------------------------------------------------------------------
A9EY26_SORC5/67-203--------------------------------------------------------------------------------
A6EII6_9SPHI/56-192--------------------------------------------------------------------------------
Q210M7_RHOPB/37-173--------------------------------------------------------------------------------
C6XDF2_METSD/33-170--------------------------------------------------------------------------------
A8EAJ0_BURPE/58-193--------------------------------------------------------------------------------
A9HSC1_GLUDA/37-173--------------------------------------------------------------------------------
A1K296_AZOSB/48-185--------------------------------------------------------------------------------
Q4ZL47_PSEU2/25-161--------------------------------------------------------------------------------
B2FDC1_RHIME/28-164--------------------------------------------------------------------------------
A1K6J4_AZOSB/48-184--------------------------------------------------------------------------------
C7PV19_CHIPD/48-184--------------------------------------------------------------------------------
A3WXM9_9BRAD/46-182--------------------------------------------------------------------------------
A4YPU2_BRASO/40-175--------------------------------------------------------------------------------
A4CGT8_ROBBH/26-168--------------------------------------------------------------------------------
C1DPB0_AZOVD/26-162--------------------------------------------------------------------------------
C4WP31_9RHIZ/50-187--------------------------------------------------------------------------------
Q3SKS8_THIDA/41-177--------------------------------------------------------------------------------
Q2RUP1_RHORT/26-161--------------------------------------------------------------------------------
E6VQ01_RHOPX/36-173--------------------------------------------------------------------------------
Q07KD9_RHOP5/36-173--------------------------------------------------------------------------------
E1TJA8_BURSG/45-179--------------------------------------------------------------------------------
A6UMR2_SINMW/24-160--------------------------------------------------------------------------------
Q2IXV0_RHOP2/36-173--------------------------------------------------------------------------------
C6B7S0_RHILS/38-175--------------------------------------------------------------------------------
A5VBV5_SPHWW/29-171--------------------------------------------------------------------------------
B4R7U0_PHEZH/55-191--------------------------------------------------------------------------------
A4X9Y5_SALTO/32-168--------------------------------------------------------------------------------
A4YTJ9_BRASO/36-173--------------------------------------------------------------------------------
C6X5B6_FLAB3/62-198--------------------------------------------------------------------------------
Q2IZZ6_RHOP2/43-180--------------------------------------------------------------------------------
A4XUL6_PSEMY/32-167--------------------------------------------------------------------------------
A1W2W2_ACISJ/28-163--------------------------------------------------------------------------------
A8HXW5_AZOC5/37-175--------------------------------------------------------------------------------
A4WXT6_RHOS5/92-229--------------------------------------------------------------------------------
Q3KBI4_PSEPF/25-166--------------------------------------------------------------------------------
B0T245_CAUSK/55-193--------------------------------------------------------------------------------
D5WLX4_BURSC/38-172--------------------------------------------------------------------------------
B1G845_9BURK/54-190--------------------------------------------------------------------------------
Q7WM56_BORBR/46-182--------------------------------------------------------------------------------
B1G087_9BURK/38-172--------------------------------------------------------------------------------
B8EIS3_METSB/37-174--------------------------------------------------------------------------------
B9B0D3_9BURK/83-218--------------------------------------------------------------------------------
A7HWP1_PARL1/40-178--------------------------------------------------------------------------------
Q2IP97_ANADE/111-254--------------------------------------------------------------------------------
B3Q5A8_RHIE6/48-184--------------------------------------------------------------------------------
C6VZG6_DYAFD/31-167--------------------------------------------------------------------------------
D2ZGE9_9ENTR/52-189--------------------------------------------------------------------------------
Q6N5I2_RHOPA/73-210--------------------------------------------------------------------------------
C7JB67_ACEP3/36-171--------------------------------------------------------------------------------
A7H8S3_ANADF/104-247--------------------------------------------------------------------------------
B8H682_CAUCN/79-216--------------------------------------------------------------------------------
E1TCF2_BURSG/40-174--------------------------------------------------------------------------------
C5AE76_BURGB/65-200--------------------------------------------------------------------------------
A2WFV6_9BURK/45-179--------------------------------------------------------------------------------
A9GDI6_SORC5/85-228--------------------------------------------------------------------------------
A5VGP0_SPHWW/46-184--------------------------------------------------------------------------------
C6XDG6_METSD/26-163--------------------------------------------------------------------------------
C7PPP6_CHIPD/45-181--------------------------------------------------------------------------------
B2H110_BURPE/47-181--------------------------------------------------------------------------------
Q5LX51_SILPO/25-167--------------------------------------------------------------------------------
C1CZB6_DEIDV/40-176--------------------------------------------------------------------------------
A5V2I5_SPHWW/61-199--------------------------------------------------------------------------------
B1ZWK7_OPITP/63-194--------------------------------------------------------------------------------
Q0BSG9_GRABC/35-171--------------------------------------------------------------------------------
B4W7Y0_9CAUL/55-193--------------------------------------------------------------------------------
A9IMD9_BORPD/32-169--------------------------------------------------------------------------------
C3X6U1_OXAFO/26-168--------------------------------------------------------------------------------
A6EC23_9SPHI/68-203--------------------------------------------------------------------------------
Q3KGN9_PSEPF/27-163--------------------------------------------------------------------------------
C6B942_RHILS/26-162--------------------------------------------------------------------------------
D2QJS3_SPILD/61-198--------------------------------------------------------------------------------
Q2JZN3_RHIEC/26-162--------------------------------------------------------------------------------
C3X783_OXAFO/52-194--------------------------------------------------------------------------------
B5WV33_9BURK/27-168--------------------------------------------------------------------------------
D2PPQ1_KRIFD/35-171--------------------------------------------------------------------------------
C6W1M4_DYAFD/32-168--------------------------------------------------------------------------------
Q4UUM7_XANC8/84-221--------------------------------------------------------------------------------
A4F0L3_9RHOB/59-201--------------------------------------------------------------------------------
B9KN92_RHOSK/33-169--------------------------------------------------------------------------------
D9QKZ8_BRESC/54-192--------------------------------------------------------------------------------
B2JML1_BURP8/48-182--------------------------------------------------------------------------------
Q2IPC5_ANADE/58-201--------------------------------------------------------------------------------
A6EI02_9SPHI/96-235--------------------------------------------------------------------------------
Q8PKY1_XANAC/43-180--------------------------------------------------------------------------------
Q7NGC4_GLOVI/47-190--------------------------------------------------------------------------------
Q1NI17_9SPHN/59-197--------------------------------------------------------------------------------
C3KDG8_PSEFS/41-177--------------------------------------------------------------------------------
Q1H3J6_METFK/38-175--------------------------------------------------------------------------------
Q9RUK1_DEIRA/23-161--------------------------------------------------------------------------------
Q7NHN8_GLOVI/69-212--------------------------------------------------------------------------------
Q5FUH2_GLUOX/43-180--------------------------------------------------------------------------------
B0UDQ0_METS4/45-193--------------------------------------------------------------------------------
Q1D3N0_MYXXD/108-250--------------------------------------------------------------------------------
A9GLZ6_SORC5/143-281--------------------------------------------------------------------------------
Q02LP9_PSEAB/21-152--------------------------------------------------------------------------------
B6IR05_RHOCS/41-177--------------------------------------------------------------------------------
C6XZD3_PEDHD/100-224--------------------------------------------------------------------------------
Q3BN66_XANC5/52-193--------------------------------------------------------------------------------
B6QZY9_9RHOB/36-167--------------------------------------------------------------------------------

PF05067

YJQC_BACSU/1-278--------------------------------------------------------------------------------
Q9I1T0_PSEAE/1-294--------------------------------------------------------------------------------
Q9KAU6_BACHD/1-281--------------------------------------------------------------------------------
COTJC_BACSU/1-189--------------------------------------------------------------------------------
Q9KDZ2_BACHD/1-298--------------------------------------------------------------------------------
MCAT_BACSU/1-273--------------------------------------------------------------------------------

PF03713

A8LVC1_SALAI/31-177--------------------------------------------------------------------------------
Q5YML7_NOCFA/57-220--------------------------------------------------------------------------------
Q6XN35_RHOER/37-208--------------------------------------------------------------------------------
A6W729_KINRD/39-201--------------------------------------------------------------------------------
Q5Z101_NOCFA/55-219--------------------------------------------------------------------------------
Q0SGM9_RHOSR/61-227--------------------------------------------------------------------------------
A4FN49_SACEN/88-259--------------------------------------------------------------------------------
A4FE15_SACEN/46-216--------------------------------------------------------------------------------
Q5YWT9_NOCFA/45-201--------------------------------------------------------------------------------
Q0SK07_RHOSR/51-206--------------------------------------------------------------------------------
A3TIC0_9MICO/54-213--------------------------------------------------------------------------------
Q6SK75_ARTAU/34-199--------------------------------------------------------------------------------
A4AKP7_9ACTN/51-214--------------------------------------------------------------------------------
Q47S90_THEFY/23-182--------------------------------------------------------------------------------
Q82AV5_STRAW/43-199--------------------------------------------------------------------------------
A4XAY7_SALTO/62-216--------------------------------------------------------------------------------
A0AW55_ARTS2/62-226--------------------------------------------------------------------------------
A6WGU5_KINRD/112-290--------------------------------------------------------------------------------
Q0RCA7_FRAAA/59-245--------------------------------------------------------------------------------
A8KZW0_FRASN/79-262--------------------------------------------------------------------------------
A4AKP3_9ACTN/56-207--------------------------------------------------------------------------------
A6GQF3_9BURK/49-215--------------------------------------------------------------------------------
A1SNX0_NOCSJ/32-195--------------------------------------------------------------------------------
A1SDH4_NOCSJ/59-212--------------------------------------------------------------------------------
Q1BFR6_MYCSS/55-200--------------------------------------------------------------------------------
A4T3N9_MYCGI/55-203--------------------------------------------------------------------------------
A1T1H5_MYCVP/54-201--------------------------------------------------------------------------------
Q0RS99_FRAAA/44-228--------------------------------------------------------------------------------
Q5YMP0_NOCFA/64-211--------------------------------------------------------------------------------
A3TRU4_9MICO/44-193--------------------------------------------------------------------------------
Q0JWQ8_STRAM/60-205--------------------------------------------------------------------------------
Q82E39_STRAW/71-222--------------------------------------------------------------------------------
A6WGV6_KINRD/98-261--------------------------------------------------------------------------------
A3TK32_9MICO/55-197--------------------------------------------------------------------------------
Q5YT33_NOCFA/59-206--------------------------------------------------------------------------------
A1TDH2_MYCVP/59-210--------------------------------------------------------------------------------
A4T8S2_MYCGI/67-217--------------------------------------------------------------------------------
Q1BC35_MYCSS/58-226--------------------------------------------------------------------------------
A0R280_MYCS2/52-198--------------------------------------------------------------------------------
Q1B113_MYCSS/53-222--------------------------------------------------------------------------------
A0K235_ARTS2/57-202--------------------------------------------------------------------------------
A4AG55_9ACTN/49-193--------------------------------------------------------------------------------
Q8NLI1_CORGL/71-217--------------------------------------------------------------------------------
A1UPV4_MYCSK/41-184--------------------------------------------------------------------------------
Q2N5S7_ERYLH/58-210--------------------------------------------------------------------------------
A5PA80_9SPHN/57-209--------------------------------------------------------------------------------
A3UC46_9RHOB/55-216--------------------------------------------------------------------------------
A3WF42_9SPHN/68-231--------------------------------------------------------------------------------
Q0ATP4_MARMM/56-229--------------------------------------------------------------------------------
Q022J2_SOLUE/61-225--------------------------------------------------------------------------------
A4X6R2_SALTO/79-221--------------------------------------------------------------------------------
Q0H2Y8_SACER/71-240--------------------------------------------------------------------------------
Q9K3P2_STRCO/76-218--------------------------------------------------------------------------------
A3TNA7_9MICO/73-222--------------------------------------------------------------------------------
Q9RVD0_DEIRA/33-176--------------------------------------------------------------------------------
B0U8H5_METS4/225-369--------------------------------------------------------------------------------
Q9RRN7_DEIRA/55-183--------------------------------------------------------------------------------
Q1J3D3_DEIGD/62-202--------------------------------------------------------------------------------
Q1J295_DEIGD/57-193--------------------------------------------------------------------------------
A6EJ19_9SPHI/53-195--------------------------------------------------------------------------------
Q7VFW4_HELHP/40-187--------------------------------------------------------------------------------
B9KE81_CAMLR/56-203--------------------------------------------------------------------------------
Q11UY7_CYTH3/68-211--------------------------------------------------------------------------------
A7JSQ1_PASHA/104-245--------------------------------------------------------------------------------
Q1QE07_PSYCK/97-242--------------------------------------------------------------------------------
A9AYN0_HERA2/50-184--------------------------------------------------------------------------------
A5V0R4_ROSS1/56-190--------------------------------------------------------------------------------
A0ZFH3_NODSP/72-222--------------------------------------------------------------------------------
Q2JRB2_SYNJA/58-208--------------------------------------------------------------------------------
Q0YT76_9CHLB/64-193--------------------------------------------------------------------------------
P72559_SYNE7/55-207--------------------------------------------------------------------------------
A3Z244_9SYNE/68-221--------------------------------------------------------------------------------
Q55943_SYNY3/46-190--------------------------------------------------------------------------------
Q8ZSB7_NOSS1/59-222--------------------------------------------------------------------------------
Q31P39_SYNE7/58-213--------------------------------------------------------------------------------
A3YWB8_9SYNE/73-239--------------------------------------------------------------------------------
Q1AZS8_RUBXD/64-204--------------------------------------------------------------------------------
Q1D6W0_MYXXD/49-189--------------------------------------------------------------------------------
Q3SJA1_THIDA/49-185--------------------------------------------------------------------------------
A7HAD4_ANADF/47-185--------------------------------------------------------------------------------
A1SIT5_NOCSJ/74-207--------------------------------------------------------------------------------
A3TP12_9MICO/50-191--------------------------------------------------------------------------------
A1UPT7_MYCSK/34-187--------------------------------------------------------------------------------
A3I411_9BACI/39-184--------------------------------------------------------------------------------
A4F8Y7_SACEN/55-202--------------------------------------------------------------------------------
A5CV70_CLAM3/55-232--------------------------------------------------------------------------------

PF00268

RIR2_EBVA8/1-276--------------------------------------------------------------------------------
RIR2_BHV1C/7-288--------------------------------------------------------------------------------
RIR2_HUMAN/70-351--------------------------------------------------------------------------------
RIR2_VZVD/1-280--------------------------------------------------------------------------------
RIR2_YEAST/76-358--------------------------------------------------------------------------------
RIR4_SALTY/1-281--------------------------------------------------------------------------------
RIR2_HHV11/28-314--------------------------------------------------------------------------------
RIR2_SCHPO/66-348--------------------------------------------------------------------------------
RIR2_DICDI/12-293--------------------------------------------------------------------------------
RIR2_SHV21/1-279--------------------------------------------------------------------------------
RIR2_EHV1B/12-295--------------------------------------------------------------------------------
RIR2_CAEEL/62-343--------------------------------------------------------------------------------
RIR2_ASFB7/9-294--------------------------------------------------------------------------------

PF03232

COQ7_HUMAN/47-217--------------------------------------------------------------------------------
Q6BPA8_DEBHA/54-250--------------------------------------------------------------------------------
Q2GE68_NEOSM/5-175--------------------------------------------------------------------------------
A5FUU9_ACICJ/16-182--------------------------------------------------------------------------------
Q9TVU0_DROME/50-219--------------------------------------------------------------------------------
Q4FNJ8_PELUB/7-177--------------------------------------------------------------------------------
Q582P6_TRYB2/23-204--------------------------------------------------------------------------------
Q1GVM9_SPHAL/4-171--------------------------------------------------------------------------------
COQ7_SCHPO/41-216--------------------------------------------------------------------------------
Q7RZB1_NEUCR/74-256--------------------------------------------------------------------------------
Q4E674_TRYCC/24-205--------------------------------------------------------------------------------
Q73G62_WOLPM/16-180--------------------------------------------------------------------------------
COQ7_CAEEL/17-187--------------------------------------------------------------------------------
Q2GCC1_NOVAD/3-170--------------------------------------------------------------------------------
Q2RNK3_RHORT/45-212--------------------------------------------------------------------------------
Q6J4P7_APILI/25-195--------------------------------------------------------------------------------
A5P9R2_9SPHN/11-180--------------------------------------------------------------------------------
A7TK78_VANPO/55-238--------------------------------------------------------------------------------
Q5A1Q6_CANAL/50-246--------------------------------------------------------------------------------
A8F0U6_RICM5/20-188--------------------------------------------------------------------------------
E0TD93_PARBH/31-201--------------------------------------------------------------------------------
Q1N9T4_9SPHN/17-184--------------------------------------------------------------------------------
Q5KIZ4_CRYNJ/66-251--------------------------------------------------------------------------------
E9AE97_LEIMA/97-280--------------------------------------------------------------------------------
Q5HBV3_EHRRW/6-170--------------------------------------------------------------------------------
Q2F6B9_BOMMO/27-196--------------------------------------------------------------------------------
Q40K31_EHRCH/6-170--------------------------------------------------------------------------------
Q5NLW7_ZYMMO/17-185--------------------------------------------------------------------------------
Q1RHH8_RICBR/11-179--------------------------------------------------------------------------------
COQ7_DICDI/48-217--------------------------------------------------------------------------------
A3UGP4_9RHOB/17-188--------------------------------------------------------------------------------
A2RV27_DANRE/53-223--------------------------------------------------------------------------------
A4TYY9_9PROT/18-184--------------------------------------------------------------------------------
Q9A697_CAUCR/30-200--------------------------------------------------------------------------------
A7HTM0_PARL1/20-193--------------------------------------------------------------------------------
Q7Q596_ANOGA/22-194--------------------------------------------------------------------------------
Q0BU90_GRABC/23-189--------------------------------------------------------------------------------
Q75CT1_ASHGO/43-226--------------------------------------------------------------------------------
Q5D9V5_SCHJA/11-181--------------------------------------------------------------------------------
Q2W739_MAGSA/17-185--------------------------------------------------------------------------------
CAT5_YEAST/50-233--------------------------------------------------------------------------------
Q6C5T9_YARLI/12-192--------------------------------------------------------------------------------
Q0AM53_MARMM/22-193--------------------------------------------------------------------------------
Q1HQL9_AEDAE/23-193--------------------------------------------------------------------------------
Q5PBA0_ANAMM/4-170--------------------------------------------------------------------------------
Q28EZ6_XENTR/52-222--------------------------------------------------------------------------------
Q6FM78_CANGA/48-232--------------------------------------------------------------------------------

PF02915

Q8FZ24_BRUSU/20-157--------------------------------------------------------------------------------
O27405_METTH/16-131--------------------------------------------------------------------------------
Q8U1L0_PYRFU/18-147--------------------------------------------------------------------------------
Q9X1L2_THEMA/5-141--------------------------------------------------------------------------------
Q8RTU6_9PROT/83-214--------------------------------------------------------------------------------
Q9WZC5_THEMA/7-123--------------------------------------------------------------------------------
ACSF2_SYNY3/89-222--------------------------------------------------------------------------------
Q9V073_PYRAB/23-158--------------------------------------------------------------------------------
O58303_PYRHO/19-154--------------------------------------------------------------------------------
Q8U1L6_PYRFU/22-157--------------------------------------------------------------------------------
ACSF1_SYNY3/89-222--------------------------------------------------------------------------------
O26912_METTH/5-120--------------------------------------------------------------------------------
O26850_METTH/9-145--------------------------------------------------------------------------------
RUBY_DESVH/11-139--------------------------------------------------------------------------------
ACSF1_NOSS1/82-215--------------------------------------------------------------------------------
Q9RMF8_MOOTH/11-139--------------------------------------------------------------------------------
Q89CA2_BRAJA/11-148--------------------------------------------------------------------------------
ACSF_PORPU/80-213--------------------------------------------------------------------------------
Q9WXM4_THEMA/6-140--------------------------------------------------------------------------------
RUBY_CLOPE/11-143--------------------------------------------------------------------------------
ACSF2_NOSS1/89-222--------------------------------------------------------------------------------
A9CKH9_AGRT5/20-157--------------------------------------------------------------------------------
CRD1_ARATH/134-267--------------------------------------------------------------------------------
ACSF_CYACA/82-215--------------------------------------------------------------------------------
Q92KS6_RHIME/20-157--------------------------------------------------------------------------------
RUBY_METJA/15-152--------------------------------------------------------------------------------
Q9UZU3_PYRAB/26-160--------------------------------------------------------------------------------
Q98DQ2_RHILO/20-157--------------------------------------------------------------------------------
ACSF_RUBGE/90-221--------------------------------------------------------------------------------
O29426_ARCFU/5-135--------------------------------------------------------------------------------
O28633_ARCFU/4-119--------------------------------------------------------------------------------
Q8KZ48_9PROT/77-208--------------------------------------------------------------------------------
O29427_ARCFU/5-137--------------------------------------------------------------------------------
NIGY_DESVH/31-160--------------------------------------------------------------------------------
O27972_ARCFU/15-130--------------------------------------------------------------------------------
Q9V026_PYRAB/32-168--------------------------------------------------------------------------------
Q9UWP7_9EURY/10-125--------------------------------------------------------------------------------
Q8R811_THETN/2-140--------------------------------------------------------------------------------

PF13668

Q5AVP0_EMENI/134-269--------------------------------------------------------------------------------
C1F3A5_ACIC5/23-187--------------------------------------------------------------------------------
D3PQH2_MEIRD/38-209--------------------------------------------------------------------------------
A6S480_BOTFB/30-166--------------------------------------------------------------------------------
D2QRU0_SPILD/66-195--------------------------------------------------------------------------------
D9QP73_BRESC/63-237--------------------------------------------------------------------------------
D2QMT4_SPILD/63-193--------------------------------------------------------------------------------
A8NHQ9_COPC7/124-261--------------------------------------------------------------------------------
C6W7H4_DYAFD/67-197--------------------------------------------------------------------------------
C4JFF2_UNCRE/41-177--------------------------------------------------------------------------------
A5AXH5_VITVI/574-741--------------------------------------------------------------------------------
Q1AVF2_RUBXD/50-181--------------------------------------------------------------------------------
Q0UES8_PHANO/27-163--------------------------------------------------------------------------------
C1D1F0_DEIDV/57-227--------------------------------------------------------------------------------
C7QET9_CATAD/119-262--------------------------------------------------------------------------------
Q0UN97_PHANO/56-194--------------------------------------------------------------------------------
D7W2M6_9FLAO/70-207--------------------------------------------------------------------------------
C6W7H5_DYAFD/59-194--------------------------------------------------------------------------------
A9S267_PHYPA/20-196--------------------------------------------------------------------------------
B2WN46_PYRTR/29-165--------------------------------------------------------------------------------
C7YY56_NECH7/30-166--------------------------------------------------------------------------------
C7PHE9_CHIPD/61-200--------------------------------------------------------------------------------
Q1AVF1_RUBXD/64-195--------------------------------------------------------------------------------
Q9LZJ2_ARATH/33-200--------------------------------------------------------------------------------
Q745Y9_THET2/28-152--------------------------------------------------------------------------------
A2Q670_MEDTR/38-205--------------------------------------------------------------------------------
D3EZI8_CONWI/53-180--------------------------------------------------------------------------------
A6W4B4_KINRD/57-226--------------------------------------------------------------------------------
B9FMH8_ORYSJ/64-217--------------------------------------------------------------------------------
B9T0V5_RICCO/35-202--------------------------------------------------------------------------------
D2QJB2_SPILD/63-193--------------------------------------------------------------------------------
D3EZX4_CONWI/69-195--------------------------------------------------------------------------------
B9L2W7_THERP/5-140--------------------------------------------------------------------------------
Q5NZC8_AROAE/51-183--------------------------------------------------------------------------------
C1A3R7_GEMAT/70-201--------------------------------------------------------------------------------
A0LZF5_GRAFK/67-200--------------------------------------------------------------------------------
Q9RZK8_DEIRA/61-237--------------------------------------------------------------------------------
A1WBY8_ACISJ/80-212--------------------------------------------------------------------------------
B0DCR6_LACBS/28-162--------------------------------------------------------------------------------
A3XPH6_LEEBM/59-205--------------------------------------------------------------------------------
Q745Y5_THET2/44-207--------------------------------------------------------------------------------
B3R613_CUPTR/60-194--------------------------------------------------------------------------------
D2QJB3_SPILD/63-198--------------------------------------------------------------------------------
A2XGL9_ORYSI/69-236--------------------------------------------------------------------------------
Q127J3_POLSJ/49-181--------------------------------------------------------------------------------
A5FJH2_FLAJ1/63-205--------------------------------------------------------------------------------
B7IDP2_THEAB/2-153--------------------------------------------------------------------------------
Q1NFZ5_9SPHN/66-239--------------------------------------------------------------------------------
D0LL68_HALO1/57-201--------------------------------------------------------------------------------
C7RKL2_ACCPU/49-185--------------------------------------------------------------------------------
B0DV96_LACBS/38-174--------------------------------------------------------------------------------
A8PI33_COPC7/121-258--------------------------------------------------------------------------------
D1CIN4_THET1/4-134--------------------------------------------------------------------------------
C5C2C0_BEUC1/71-202--------------------------------------------------------------------------------
B9HIK8_POPTR/43-210--------------------------------------------------------------------------------
B9T0V6_RICCO/35-202--------------------------------------------------------------------------------
C0NCN2_AJECG/32-168--------------------------------------------------------------------------------
C5X0M3_SORBI/80-247--------------------------------------------------------------------------------
A8NW93_COPC7/49-203--------------------------------------------------------------------------------
Q2CF59_9RHOB/31-161--------------------------------------------------------------------------------
Q6BVQ7_DEBHA/28-164--------------------------------------------------------------------------------
C9S734_VERA1/33-166--------------------------------------------------------------------------------
C2FVH4_9SPHI/66-196--------------------------------------------------------------------------------
A0M2H2_GRAFK/86-224--------------------------------------------------------------------------------
C6XUE9_PEDHD/64-194--------------------------------------------------------------------------------
A3I156_9BACT/63-200--------------------------------------------------------------------------------
C6NX50_9GAMM/54-197--------------------------------------------------------------------------------
C7PHE8_CHIPD/70-200--------------------------------------------------------------------------------
Q7ND08_GLOVI/14-155--------------------------------------------------------------------------------
C1F3A6_ACIC5/49-222--------------------------------------------------------------------------------
Q11V38_CYTH3/57-193--------------------------------------------------------------------------------
Q4PGP0_USTMA/91-225--------------------------------------------------------------------------------
D3F6V0_CONWI/68-195--------------------------------------------------------------------------------
A3I157_9BACT/58-189--------------------------------------------------------------------------------
A8PI32_COPC7/43-181--------------------------------------------------------------------------------
B9GGY2_POPTR/34-201--------------------------------------------------------------------------------
A4G567_HERAR/52-184--------------------------------------------------------------------------------
A9SYP0_PHYPA/38-208--------------------------------------------------------------------------------
C1D191_DEIDV/46-222--------------------------------------------------------------------------------
C9SFS6_VERA1/50-186--------------------------------------------------------------------------------
C6TE89_SOYBN/43-210--------------------------------------------------------------------------------
D3L3V4_9BACT/18-170--------------------------------------------------------------------------------
D7W2M7_9FLAO/58-191--------------------------------------------------------------------------------
Q11V37_CYTH3/38-167--------------------------------------------------------------------------------
D3PQH0_MEIRD/42-175--------------------------------------------------------------------------------
Q1IK95_KORVE/7-170--------------------------------------------------------------------------------
Q2CF60_9RHOB/63-198--------------------------------------------------------------------------------
Q5KLK1_CRYNJ/29-176--------------------------------------------------------------------------------
B9LPE2_HALLT/74-217--------------------------------------------------------------------------------
D5X661_THIK1/64-198--------------------------------------------------------------------------------
D2QRT9_SPILD/63-197--------------------------------------------------------------------------------
D3EZI9_CONWI/53-179--------------------------------------------------------------------------------
A0LZF4_GRAFK/83-228--------------------------------------------------------------------------------
D2RUZ2_HALTV/65-208--------------------------------------------------------------------------------
D2PR20_KRIFD/39-169--------------------------------------------------------------------------------
DRPE_CRAPL/38-205--------------------------------------------------------------------------------
B9RZV0_RICCO/40-207--------------------------------------------------------------------------------
C6XUF0_PEDHD/62-202--------------------------------------------------------------------------------
A6UK42_SINMW/43-207--------------------------------------------------------------------------------
A0M2H1_GRAFK/67-200--------------------------------------------------------------------------------
C7YU90_NECH7/49-187--------------------------------------------------------------------------------
B0D1I8_LACBS/25-158--------------------------------------------------------------------------------
C1A3R6_GEMAT/17-158--------------------------------------------------------------------------------
D2PR19_KRIFD/62-193--------------------------------------------------------------------------------
B8PIB6_POSPM/17-150--------------------------------------------------------------------------------
D2QMT3_SPILD/102-233--------------------------------------------------------------------------------
Q01L47_ORYSA/55-222--------------------------------------------------------------------------------
C7P2F7_HALMD/55-195--------------------------------------------------------------------------------
A8PGN7_COPC7/36-176--------------------------------------------------------------------------------
B6TNA6_MAIZE/60-227--------------------------------------------------------------------------------
A9C0V0_DELAS/59-233--------------------------------------------------------------------------------
B0RH45_CLAMS/61-230--------------------------------------------------------------------------------
A6ED15_9SPHI/62-203--------------------------------------------------------------------------------
A1DER8_NEOFI/31-168--------------------------------------------------------------------------------
Q8LAU8_ARATH/42-209--------------------------------------------------------------------------------
A8HQR8_CHLRE/27-199--------------------------------------------------------------------------------
D7VQN2_9SPHI/61-197--------------------------------------------------------------------------------
B9L2W6_THERP/49-186--------------------------------------------------------------------------------
A3XPH7_LEEBM/59-196--------------------------------------------------------------------------------
B7AB89_THEAQ/43-174--------------------------------------------------------------------------------
B6H6V8_PENCW/27-158--------------------------------------------------------------------------------
A5FJH3_FLAJ1/65-204--------------------------------------------------------------------------------
D3F6V1_CONWI/68-195--------------------------------------------------------------------------------
C5DDC7_LACTC/38-174--------------------------------------------------------------------------------

PF14530

A0JUT6_ARTS2/252-380--------------------------------------------------------------------------------
A0PQB9_MYCUA/25-162--------------------------------------------------------------------------------
A0QVM1_MYCS2/20-157--------------------------------------------------------------------------------
A1R512_ARTAT/240-368--------------------------------------------------------------------------------
A1T7H3_MYCVP/19-156--------------------------------------------------------------------------------
A1UER3_MYCSK/19-156--------------------------------------------------------------------------------
A4TCF5_MYCGI/24-161--------------------------------------------------------------------------------
A4X4N2_SALTO/13-149--------------------------------------------------------------------------------
A6W7Y8_KINRD/216-343--------------------------------------------------------------------------------
B1MD94_MYCA9/18-155--------------------------------------------------------------------------------
B1VYP0_STRGG/20-150--------------------------------------------------------------------------------
B8HG51_ARTCA/255-383--------------------------------------------------------------------------------
B8ZRT8_MYCLB/28-165--------------------------------------------------------------------------------
C0ZYA0_RHOE4/13-150--------------------------------------------------------------------------------
C4RD64_9ACTO/13-149--------------------------------------------------------------------------------
C6WDL2_ACTMD/9-146--------------------------------------------------------------------------------
C7MQU7_SACVD/183-320--------------------------------------------------------------------------------
C7QDY8_CATAD/3-133--------------------------------------------------------------------------------
C9Z255_STRSW/8-138--------------------------------------------------------------------------------
D0LBI3_GORB4/7-144--------------------------------------------------------------------------------
D1AAG0_THECD/12-148--------------------------------------------------------------------------------
D1BJ70_SANKS/255-391--------------------------------------------------------------------------------
D2AXS6_STRRD/6-136--------------------------------------------------------------------------------
D5ZUC6_9ACTO/16-146--------------------------------------------------------------------------------
D6M453_9ACTO/21-151--------------------------------------------------------------------------------
D6XAR4_9ACTO/9-139--------------------------------------------------------------------------------
D6Y7V9_THEBD/21-152--------------------------------------------------------------------------------
D7B4K2_NOCDD/18-148--------------------------------------------------------------------------------
D7CAH0_STRBB/5-135--------------------------------------------------------------------------------
D8HX71_AMYMU/174-311--------------------------------------------------------------------------------
D9SXT1_MICAI/11-147--------------------------------------------------------------------------------
D9V4I2_9ACTO/196-333--------------------------------------------------------------------------------
D9W0Z2_9ACTO/31-161--------------------------------------------------------------------------------
E2Q955_STRCL/34-164--------------------------------------------------------------------------------
E4NHU9_KITSK/186-315--------------------------------------------------------------------------------
F0M7C1_ARTPP/267-395--------------------------------------------------------------------------------
Q47RV6_THEFY/19-148--------------------------------------------------------------------------------

PF03405

STAD5_ORYSJ/60-388PPQKREIFDSLQPWAKEN.LLNLLKPVEKSWQPQDFLPDPSS..DGF...YDEVKELRERAKEIPDDYFVCLVGDMVTEE
STAD_GOSHI/66-395PPHKIEIFKSLEGWAENN.ILTHLKPVEKCWQPADFLPDPNS..DGF...HEQVKELRERAKEIPDDYFVVLVGDMITEE
P92933_ASCSY/50-383PPEKVQIFKSLESWATQN.VLPLLKPVEKSWQPTEFLPNPAQNFDDF...TKEVHALRHRTSDLPDEFLVVLVGDMITEE
STAD_LINUS/65-394PTGSWEIFKSLGRLGLRDVLISHLKPVEKCWQPQDFLPEPES..DGF...EEQVKELRARAKELPDDYFVVLVGDMITEE
Q9XFC1_LUPLU/50-382PPEKIEIFKSLESWASQS.VLPLLKPVEQCWQPQEFVPDSSLPFGDF...TDQVKALRDRTAELPEEYFVVLVGDMITED
Q40879_PELHO/39-368APQKIEIFKSMEEWGKHN.ILPLAKPVEKSWQPTDFLPDPSS..EGF...MEEYNAFKERTRELPDEYFVVLAGDMITEE
Q50050_MYCLE/4-326ELTDLQLLHELEPVVEKY.MNRHER.LHKNWNPHDYIPWSDG..KNFYAL..GGQDWDPEQSQLSDVAQVAMVQNLVTED
STAD_SPIOL/69-397PQEKIEIFKSLEGWAEEN.LLVHLKPVEKCWQPQDYLPDPAS..EDF...RDQVKEIQERAKEIPDDLYVVLVGDMITEE
Q41510_THUAT/59-387APEKAEIFNSMHGWVEDT.ILPFLKPVEESWQPTDFLPDSTS..DGF...HEQVEELRKRTADLPDDYLVALVGAMVTEE
STAD_CORSA/54-383RPEVDELFNSLEGWARDN.ILVHLKSVENSWQPQDYLPDPTS..DAF...EDQVKEMRERAKDIPDEYFVVLVGDMITEE
Q43198_THUAT/60-388PPEKREIFNSLHGWAETN.LLSLLKPVDKCWQPSDFLPDPSA..DGF...DEQVRELRKRTKELPDEYFIVLIGDMITEE

PF02332

MEMB_METTR/74-311------------DWTQKF------------------------------------------------------------HG
MEMB_METCA/71-308------------DWTQKF------------------------------------------------------------HG
TMOE_PSEME/53-278------------LWYKQY------------------------------------------------------------RN
TMOA_PSEME/17-251------------NWTPSY------------------------------------------------------------VT
O07068_BURCE/17-252------------NCSPEI------------------------------------------------------------RH
P95408_PSEAI/17-251------------NWTPKY------------------------------------------------------------VT
Q9R3H0_9GAMM/36-263------------TWDFD.------------------------------------------------------------.K
Q9ZNP6_COMTE/50-272------------LWEPEF------------------------------------------------------------EL
O87802_PSEST/56-281------------TWYKKY------------------------------------------------------------CF
O07072_BURCE/54-281------------RWYKQN------------------------------------------------------------TL
Q9EZP0_BURCE/17-251------------NWTPSY------------------------------------------------------------VT
Q53027_RHOCO/16-243------------DWDFTS------------------------------------------------------------VE
O69182_CUPNE/55-280------------QWFKRH------------------------------------------------------------RN
Q9RBP2_9NOCA/23-257------------DWDLSY------------------------------------------------------------VD
O30592_BURPI/51-277------------TWDPAH------------------------------------------------------------EL
O87798_PSEST/17-251------------NWTPKY------------------------------------------------------------VT
O84959_9RALS/50-273------------TWAPQF------------------------------------------------------------EL
O32431_ACISP/29-260------------DWDFSY------------------------------------------------------------AD
Q53025_RHOCO/50-281------------DWPLRF------------------------------------------------------------DD
Q9ZET3_XANP2/55-281------------VWLKKN------------------------------------------------------------RD
DMPL_PSEUF/50-273------------LWDPQH------------------------------------------------------------EL
O87082_XANP2/17-251------------DWTLSY------------------------------------------------------------VD
O32429_ACISP/50-273------------LWKPDK------------------------------------------------------------TL

PF05138

C6BKZ7_RALP1/1-266...............................................TA-DAHLQYVL---RLA--------------DN
A3M4C2_ACIBT/24-251.................................................-........---...--------------..
Q5P3I7_AROAE/1-255...........................................TQQMTS-PEHIEYVL---RLG--------------DN
A7IDQ6_XANP2/1-258........................................ATTSITVRE-TPLVRYLL---RRA--------------DD
Q28UP2_JANSC/1-252........................................PDVIQDRAD-KALFEFLL---RMG--------------DN
A4IPM8_GEOTN/1-277D.................................SAMSEKSMYFHPDGQ-EALVELLF---QLA--------------DD
A8GGD5_SERP5/1-253.............................................TFNS-DPLITYVL---RQG--------------DT
A9BS46_DELAS/26-317QRFDE.........................RIDAGEFIEAKDWMPDNYR-KTLLRQIS---QHA--------------HS
Q1VT63_9FLAO/20-305KIA..............................RDGKIEPKDWMPEKYR-KTHIRQIS---QHA--------------HS
A1SLH6_NOCSJ/1-287ELL.............................ADDGRVEPRDEMPDAYR-RTLVRQIA---QHA--------------HS
A4IPN0_GEOTN/1-291EA................................GEKIEADDWMPDEYR-MTLIKLVA---MHA--------------VS
Q63PZ2_BURPS/1-267..............................................TTT-PQHLAYVL---RLA--------------DN
A6VZX4_MARMS/1-253..............................................TKY-DELTEFLL---RLG--------------DS
Q5KRM4_CORGT/1-277TNDSATR......................QTQGDAMTPEDVVASGQVAS-DAVANYAL---MLA--------------DD
A1K268_AZOSB/1-256..........................................TQANSAN-PAHLEYVL---RLA--------------DN
B2UJA5_RALPJ/1-316SLDQPGGLPTEQELANVPLGEAEWQARFDARIGADQKIEPQDWMPAPYR-KTLLRQIS---QHA--------------HS
Q8FRT9_COREF/1-278ASVDSAT.....................RQTQGDGITAEDIQAAGAVAT-EDVANYAV---SLG--------------DD
Q2B8B4_9BACI/1-275...................................TGELKAEQPGNKAS-RAAIELLY---QLA--------------DD
Q1BRS9_BURCA/1-267..............................................TIT-PEHLSYVL---RLA--------------DN
Q82FA7_STRAW/1-239............................................TV...-TVHTAAAL---ALG--------------DD
Q92TG2_RHIME/1-261......................................QATAMQAVVDR-AALFDFLL---GMG--------------DN
Q70IL9_9PSED/1-255............................................SASTN-TDLIQYLL---RLG--------------DS
Q92TG1_RHIME/19-310ERAFQE........................RIDAGQKIEPKEWMPEGYR-KTLIRQIS---QHA--------------HS
A3YFB5_9GAMM/1-258..........................................NSNTTQT-TALFHYLL---RLA--------------DS
A5W3A8_PSEP1/1-252...............................................HK-EALIPYLL---LLG--------------DS
A6F429_9ALTE/1-254..............................................TQA-EALQEYLL---RLA--------------DS
Q5SJN6_THET8/14-305LEEFEA........................RIARGEKIEPGDWMPAEYR-RQLIRMIS---QHA--------------HS
A6N3S0_ARTOX/1-313NLQSVPVELTAGTSET...AEADGQANFDRVIAEDSRIEPKDWMPAAYR-KTLLRQIS---QHA--------------HS
Q2B8B6_9BACI/1-308LYSSLTEEEKL..............GNFMHRISNGEKIEADDWMPDDYR-LTLIKLIS---MHG--------------IS
A3KI26_STRAM/1-262......................................GLPPDQPSCSA-ADLSLHLL---RLG--------------DD
Q46WB5_CUPPJ/1-280....................................TTDTTLSHLPPER-TAALRYVL---RLA--------------DN
A2TU38_9FLAO/1-251................................................N-KDLYNYII---GIA--------------DN
Q1BRT1_BURCA/1-311SLDIPGNVAPLDAAA.....ESPEQARFDAVMAADGKIEPQDWMPDAYR-KTLVRQIS---QHA--------------HS
Q9Z9U8_BACHO/1-315VEHGGVINGQEEDQ........EKYAAFMEKIDSGKKIEADDWMPKDYR-ETLIKLIS---MHG--------------IS
A1SSN8_PSYIN/1-292NIAFES........................KIEKEIPIEPKNWMPEKYR-KTLIRQIG---QHA--------------HS
A3JQN5_9RHOB/1-312QGLIGAKTDSDETP........EFLAAFQARIDADEKIEPNDPMPAGYR-KTLVRQIG---QHA--------------HS
Q8FRU1_COREF/1-304TQQLTSTDDVQA............QEHFDALIAQDSRIEPTDWMPAAYR-KTLTRQIS---QHA--------------HS
A4YR16_BRASO/1-258........................................TAPSITVSE-TPLVLYTL---RRA--------------DD
Q2L2P2_BORA1/1-311LVETGVKQLRSKDEL......SGSEREFQRRVDEGIRIEAKDWMPEAYR-KTLVRQIS---QHA--------------HS
A6CP08_9BACI/1-271.....................................SNAVEVKDEKYK-TALVELLY---QLA--------------DD
Q93JC5_STRCO/18-306FDAT...........................IARDQRIEPRDWMPDGYR-KTLVRQIA---QHA--------------HS
A3JQN7_9RHOB/1-250...............................................DA-SLHFDCLV---RLA--------------DD
A0Z3K2_9GAMM/22-265.............................................SGTD-KALMQELL---CIA--------------DT
A3K7C2_9RHOB/45-284.................................................-........---..G--------------DN
A3U7D6_CROAH/1-251...............................................SN-QTLINYIL---GIA--------------DN
A0Z940_9GAMM/5-298GNEQKFQ......................SRVDAEEKVEPKDWMPEKYR-QNLIRQIS---QHA--------------HS
Q5UWC7_HALMA/42-333EVKD...........................RAGPREFSPKDDLPEEYR-KAATRMLE---FHA--------------NS
A1K266_AZOSB/1-311ALDIPQADAAPLRAVE....NPAYQAEFDARIDAGDFIEPKDWMPEAYR-KTLVRQIS---QHA--------------HS
Q2BHR4_9GAMM/1-253.............................................SDIK-AATLEYAT---RLG--------------DD
Q26EY3_FLABB/27-281...........................................ESTENK-KHLIDYLL---GVA--------------DN
A2SEG2_METPP/1-257.........................................TQSIELRR-DPAVQYLL---RIA--------------DT
Q47J43_DECAR/1-260.................................................-SAAIDYLL---HLA--------------DN
A4XC44_SALTO/13-267.....................................APGAEQTAPGAV-ASRFDFVL---GLA--------------DD
Q5YXT2_NOCFA/1-305DSAFSGLLDGDGD..........GQWAFGTSFDDPLAGVDTTVPADVDT-AALAAYCL---MLG--------------DD
Q9KGB1_BACHD/1-271....................................MTPEEAKTNEAYC-RALIELLY---QLA--------------DD
Q4KBZ2_PSEF5/1-253..............................................NPA-NDLLNHLL---RLG--------------DS
A1BBH5_PARDP/7-270....................................PQVAELAQPDAGQ-EAFFEMLL---RIG--------------DS
A6ERY7_9BACT/1-251...............................................KN-QNLYNYII---SIA--------------DN
A3S9B1_9RHOB/1-240.................................................-........---..G--------------DN
Q13TE9_BURXL/1-267..............................................NIT-PQHLQYVL---RLA--------------DN
Q1GKX3_SILST/1-253..............................................SHD-AAFYEFLL---RMG--------------DN
Q1LHY3_RALME/1-285IT...............................AASNGDASLAGLPLTR-SAPLQYVL---RLA--------------DN
Q2ITX4_RHOP2/29-337ALNTTEAEDRNLED.......AGRAALFQARIDAEERIEPNDWMPAAYR-KTLTRQIS---QHA--------------HS
Q5NZZ0_AROAE/1-251...............................................LL-DDKSVYLM---RLG--------------DN
Q1VT65_9FLAO/1-251...............................................TN-ENLIHYIH---GIA--------------DN
A0LUV5_ACIC1/1-302DPTAAGLDELT..............ARFEATIAANERIEPRDWMPDGYR-QTLIRQIA---QHA--------------HS
Q5KYF6_GEOKA/1-267TLLKE.........................KVQNGFIVEGIDDMNEEYL-NALKQTLT---IVG--------------DT
Q6N3C8_RHOPA/1-258........................................PAASIEIND-TPLFTTTL---RRA--------------DD
Q0K5Z0_CUPNH/1-283P.................................QPTAPASLDHLPPAR-TAGLRYVL---RLA--------------DN
A3KIV0_STRAM/26-275...................................LHGVDTTVPEGVDA-VELAAECV---ALA--------------DD
A5G1R9_ACICJ/12-269........................................STTSITVRE-TPLVRFLL---RRA--------------DD
Q1AV63_RUBXD/1-272SEEALL.......................ERIRSGKLIEDPEQATERYI-EGLKRTLI---VSA--------------DT
Q97WU6_SULSO/22-256.....................................FESIYDLPPEAV-EVLFKLLS---VQG--------------DT
A0JZX2_ARTS2/1-288TAGTSGDATASA...........TRITPGNALRPEDIALAVSRGTAKPS-EDVAEFAL---RLG--------------DD
Q5NZZ2_AROAE/19-310ERAFQE........................KIDAGIKIEAKDWMPEGYR-RTLIRQIS---QHA--------------HS
Q1IX21_DEIGD/1-302QMIHPGETPEQ.............HAAFQARIARGEKIEPGDWMPAEYR-RQLIRMIS---QHA--------------HS
A3VFT1_9RHOB/1-255.............................................TQQS-DPKFEALL---RLG--------------DN
A4BNV8_9GAMM/1-252..............................................NQR-QALYEYLL---RLG--------------DN
A5V4A4_SPHWW/1-311ELDKTATAPTPIGGE.....DPALIAAFEARVAADEFIEPKDWMPEAYR-RTLTRQIS---QHA--------------HS
A7ZLI9_ECO24/1-291ERFEQ.........................RIAQETAIEPQDWMPDAYR-KTLIRQIG---QHA--------------HS
A0Z3K5_9GAMM/15-294DPQEQAL.....................LERIHAGELIEDMQELTPRYR-AILERTLE---IAA--------------QS
Q67LH7_SYMTH/1-255.................................................-...IALLY---QLA--------------DD
Q72K12_THET2/1-248...............................................LE-ELLVEKLT---ALA--------------DD
A1SSP0_PSYIN/1-252...........................................NNI...-DPKLQYVL---QLA--------------DT
Q21BH5_RHOPB/1-258........................................ATASIAIAE-TPLVNYAL---RRG--------------DD
A3XCS6_9RHOB/1-257..........................................AAPLTQD-EALFQFLL---RMG--------------DN
A3KI28_STRAM/77-392TLAGTADDQEA.............LARFEALVADGGTIEPRDWMPDGYR-RMLVRQIA---QHA--------------HS
Q845J4_9PSED/1-253..............................................NPN-HDLIEYLL---RLG--------------DS
Q9RRV1_DEIRA/1-263.....................................TTPTLTLTDAQI-QALIRKLT---ALA--------------DD
Q07SY8_RHOP5/1-258........................................ATSSIAVSE-APLVLYTL---RRA--------------DD
B1YIJ0_EXIS2/13-313EKMERFK......................ERIENGEKIEADDWMPDFYR-DTLIKLIS---MHG--------------IS
A8LTI3_DINSH/1-255............................................GQADP-DPLFAFLC---RMG--------------DN
Q0SCS4_RHOSR/47-309.................................................-SALAGYCL---MLG--------------DD
A7TCZ0_NEMVE/151-413.................................................-........---.LA--------------DN
A1R9K9_ARTAT/49-305.......................................EISRGQVKPS-EDVAEFAL---RIG--------------DD
A8GGD3_SERP5/1-295AQYQQHF.....................DDKIAADISIEAKDWMPDAYR-QNLIRQIG---QHA--------------HS
A0NQQ2_9RHOB/1-258........................................ASATDLIAN-DIQFEWLL---RRG--------------DT
A4BNV6_9GAMM/1-310PAHTEVELTRSAEAI......AELEQAFQAKIDADIKIEPKDWMPQAYR-QSLVRQIS---QHA--------------HS
A0LUV3_ACIC1/1-252..............................................TTD-PLLFTYTL---RLG--------------DD
A6T8I2_KLEP7/1-251..............................................NNP-NPVATYAL---RLG--------------DN
Q0K1H4_CUPNH/2-251................................................D-NHKLEYLL---RLG--------------DA
A1WPU7_VEREI/1-258........................................QTPSIQLRR-DPAVQYLL---RLG--------------DT
A6N3S2_ARTOX/1-286NASATRIT...................PGNALRPEDIALEVRTGLAKPS-EDTAEYAL---RLG--------------DD
A1SLH4_NOCSJ/1-247.................................................-SAHLDYVV---GLA--------------DD
Q19A69_PSEFL/19-311ERAFQE........................KIDAEIKIEAKHWMPDAYR-QTLIRQIS---QHA--------------HS
PAAC_ECOLI/1-248.................................................-NQLTAYTL---RLG--------------DN
Q67LH5_SYMTH/1-299DERHAEF.....................LDRVTRGEKVEATDWMPDESR-MALVKFLQ---MHA--------------LS
A0Z938_9GAMM/1-252........................................KLHD.....-.PLTRYVV---RLG--------------DD
A3M4C0_ACIBT/1-292YQKFEQ........................NIANEITIEAKDQMPDAYR-KTLIRQIG---QHG--------------HS
B1YIJ2_EXIS2/1-261............................................TETER-LALASLLY---QLA--------------DD
Q1IX23_DEIGD/1-268VP................................PSAVSRPQDLAPQLR-AALIEKLT---ALA--------------DD
Q2BHR6_9GAMM/1-292EEQFWA........................KIEAEEKIEPKDWMPDDYR-KNLIRQIS---QHA--------------HS
Q7WGX8_BORBR/1-254................................................D-KSLFEYLL---RLG--------------DT
A5V4A6_SPHWW/1-250................................................S-DILFRSLL---ELG--------------DD
B1KMA9_SHEWM/1-299ENQASESLA.................NFEHKIAEEQKIEPKDWMPEAYR-ANLIRQMS---QHA--------------HS
A3JBE4_9ALTE/1-254..............................................TEQ-KALQDYLL---RLA--------------DS
Q5LVE5_SILPO/19-310ERAFQD........................KIDNDIKIEPKDWMPDDYR-RTLIRQIG---QHA--------------HS

PF13794

Q9FBJ1_STRCO/44-228---------------------------------------------PQYR-AAVVDLLG---ALA--------------YG
A0JYP2_ARTS2/9-193---------------------------------------------ARYN-RFVADLFG---MMA--------------YG
A4F8L9_SACEN/21-205---------------------------------------------DRYD-EGVVDLLA---ALA--------------YG

PF09968

A0B962_METTP/231-388----------------------------------------------DAD-WMLFIWKE---EKA-------------ARD
Q6M0S5_METMP/65-226----------------------------------------------EID-GLLLMREE---EKL-------------ARD
A6LNR3_THEM4/28-188----------------------------------------------ETE-SIMQMRKE---EKL-------------ARD
A6DDH3_9PROT/152-330----------------------------------------------DKD-ALAYMWNE---EKL-------------AKD
A7BLS9_9GAMM/110-270----------------------------------------------EIT-TLSFMREE---EKM-------------ARD
A3J1L2_9FLAO/41-200----------------------------------------------EKA-GLLFMLEE---EKL-------------ARD
A0L9X2_MAGSM/215-376----------------------------------------------EKR-FLIYMREE---EKL-------------ARD
A6UVF0_META3/84-245----------------------------------------------EKE-GLIEMREE---EKL-------------ARD
A6DCR0_9PROT/41-203----------------------------------------------EHK-DLVDILEE---EKL-------------ARD
Q31I99_THICR/36-198----------------------------------------------EEA-GLLYMREE---EKL-------------ARD
A6DCQ9_9PROT/42-203----------------------------------------------EIK-DLLHMREE---EKL-------------ARD
A3N331_ACTP2/49-209----------------------------------------------EID-SLRYMREE---EKL-------------AHD

PF06175

Q8DGE6_THEEB/14-210--------------------------------IETPVRIKFLLQPTRRE-WVEQA..I---AHLDTILLDHSHCERKAAG
Q8CX43_SHEON/3-250--------------------------------QLLAPVHAFLRCETPQT-WIDVARAS---ASLDELLIDHCNCELKAAQ
Q8YT06_NOSS1/3-199--------------------------------TPVLPKINVLKQTTSEA-WIEQA..I---ANLDIILLDHSHCERKAAG
Q9I2V2_PSEAE/4-199--------------------------------TMLPEIDQFLACSTPAA-WVEAALER---Q..DVMLLDHKACEMKAAA
Q9KQT8_VIBCH/11-254--------------------------------QLLEPINHFLQCPTPDE-WVEEARKP---ENLRVLLLDHLLCELKAGQ
MIAE_SALTY/21-264--------------------------------QILSPVLNFLHCPTPQA-WIVQARDP---QNLPLLLTDHLICELKAAQ

PF00210

O51633_BORBU/17-163-----------------------------------------QLK---LQ-ELL--ASL...HIF--------------YS
C1L1L4_LISMC/10-156-----------------------------------------KEF---LN-HQV--ANL...NVF--------------TV
Q7CVU6_AGRT5/29-171-----------------------------------------SAA---LT-ALL--ADV...FTL--------------YI
FRI_AEDAE/47-192-----------------------------------------LAA---LH-RQI--NKE...FDA--------------SI
A9L0T5_SHEB9/8-145-----------------------------------------IDA---LN-RLL--TGE...LSA--------------MD
Q47H63_DECAR/8-145-----------------------------------------IDI---LN-DLL--TGE...LTA--------------VD
Q7NS74_CHRVO/8-145-----------------------------------------IAL---LN-DLL--AEE...LSA--------------AD
Q2W946_MAGSA/8-145-----------------------------------------ISR---LN-KLL--VGE...LVA--------------AD
A6UZL6_PSEA7/8-144-----------------------------------------IDY---LN-TLL--TGE...LAA--------------RD
A6VZ68_MARMS/8-145-----------------------------------------IDG---LN-ALL--ANE...LAA--------------ID
A1K209_AZOSB/8-144-----------------------------------------ISA---LN-ALL--VDE...LAA--------------RD
Q5QYS8_IDILO/8-145-----------------------------------------VEQ---LN-RLL--AFE...LTS--------------ID
Q2RNM7_RHORT/8-145-----------------------------------------LAE---LN-TLL--AYE...MTA--------------SD
A4C4I5_9GAMM/8-145-----------------------------------------INR---LN-QQL--TLE...LSS--------------MD
Q1R5Y6_ECOUT/8-144-----------------------------------------INY---LN-KLL--GNE...LVA--------------IN
A5VB21_SPHWW/8-144-----------------------------------------IDI---LN-ETL--KNE...LTA--------------IN
A1WVE6_HALHL/8-144-----------------------------------------IEY---LN-GGL--KKE...LTA--------------IN
BFRB_NEIGO/8-144-----------------------------------------IRE---LN-KNL--GLL...LVT--------------IN
A5WHB2_PSYWF/8-144-----------------------------------------IRA---LN-KVL--GQS...LIA--------------IN
A6VZ67_MARMS/8-144-----------------------------------------VAN---LN-KVL--ANE...LVG--------------IN
Q486V4_COLP3/8-144-----------------------------------------IAL---LN-SAL--AIE...LIA--------------IN
A0KTR2_SHESA/8-144-----------------------------------------VGQ---LN-RVL--TCE...LTA--------------IN
Q6NE82_9PROT/8-144-----------------------------------------LAA---LN-DVL--RHQ...LTA--------------IN
Q1N3D5_9GAMM/8-144-----------------------------------------LDA---LN-GVL--TTE...LTS--------------IN
Q5QYS9_IDILO/8-144-----------------------------------------IQQ---LN-KIL--TLK...LTA--------------IN
A6SUV4_JANMA/8-144-----------------------------------------IRL---LN-AQL--TNE...LTA--------------IN
A3Q090_MYCSJ/8-144-----------------------------------------LKL---LN-EQL--TSE...LTA--------------IN
Q0RHP5_FRAAA/10-146-----------------------------------------IEL---LN-SVL--TNE...LTT--------------IN
Q091J6_STIAD/47-183-----------------------------------------IKL---LN-DVL--TNE...LTA--------------VN
A0NS52_9RHOB/8-144-----------------------------------------IEY---LN-KAL--RHE...LTA--------------VN
A3JWU8_9RHOB/8-144-----------------------------------------IEY---LN-DAL--RSE...LTA--------------VS
Q5NM50_ZYMMO/8-144-----------------------------------------IEH---LN-RQL--TNE...LTV--------------IN
Q024H5_SOLUE/31-167-----------------------------------------LES---LN-EAL--KAE...LTA--------------IH
Q1EMI9_LEPBI/8-144-----------------------------------------IDI---LA-EVL--SAE...LTA--------------IN
Q1IK36_KORVE/8-144-----------------------------------------IAV---LS-EVL--KAE...LTA--------------IN
Q39UD7_GEOMG/8-144-----------------------------------------IEH---LN-ARL--AEE...LTA--------------VN
Q1Q5F8_9BACT/8-143-----------------------------------------IVV---LN-ELL--MAE...ITA--------------IN
A7HHQ5_ANADF/8-144-----------------------------------------LGL---LN-ELL--SSE...LTA--------------VH
Q7VQF0_BLOFL/8-144-----------------------------------------ILH---LN-KLL--SDE...LVA--------------VN
Q2GE61_NEOSM/7-143-----------------------------------------VER---LN-EAL--ERE...LLA--------------IN
A6CF83_9PLAN/8-144-----------------------------------------IDA---LN-EGL--TIE...LTA--------------IN
Q73FS6_WOLPM/6-148-----------------------------------------VKH---LN-KLL--TNE...LTS--------------VR
A3YZ38_9SYNE/11-147-----------------------------------------LGY---LG-RAL--SLE...LSA--------------VQ
A4BLJ1_9GAMM/11-147-----------------------------------------LGY---LG-RAL--SLE...LTA--------------VQ
Q0AHV3_NITEC/8-139-----------------------------------------LGW---LA-RAL--NHE...MGA--------------VQ
Q3SFL0_THIDA/6-135-----------------------------------------LGY---LN-RAL--AHE...LAA--------------VQ
A6FK64_9RHOB/8-144-----------------------------------------IEN---LQ-TAL--AME...LTA--------------VN
A4A1Y7_9PLAN/7-143-----------------------------------------IEN---LQ-KAL--SME...LTA--------------CH
Q0BUB9_GRABC/32-177-----------------------------------------IEL---LN-ARL--ADA...IDT--------------AL
DPS_AGRT5/19-162-----------------------------------------IGI---LN-ESL--ASV...IDL--------------AL
DPS_ACIAD/26-168-----------------------------------------VKI---LN-QIL--ANL...IDL--------------SL
Q07GK9_ROSDO/17-162-----------------------------------------IDL---LQ-RTL--ADA...IDL--------------RL
Q2CAH6_9RHOB/18-159-----------------------------------------IDL---LN-ANL--ADT...IAL--------------TL
Q0FT36_9RHOB/18-160-----------------------------------------IGV---LN-DRL--ADT...IDL--------------SH
Q1DDZ6_MYXXD/18-163-----------------------------------------IDS---LN-TLL--ADA...IDL--------------HW
Q3M4R5_ANAVT/26-170-----------------------------------------VAI---LN-QTL--AAT...LDL--------------KT
A0LWG9_ACIC1/21-160-----------------------------------------AEH---LQ-AVL--ADL...IEL--------------HM
A1T8Z5_MYCVP/26-167-----------------------------------------GAA---LQ-RVL--VDL...IEL--------------HL
A4AGA8_9ACTN/36-176-----------------------------------------TDR---MQ-QVL--VDL...LEL--------------QL
A7BBG2_9ACTO/21-162-----------------------------------------AGN---LQ-KVL--TDV...TAL--------------SL
A3ZU64_9PLAN/20-161-----------------------------------------AQQ---LQ-SSL--VDQ...IDL--------------AL
A4QI42_CORGB/18-162-----------------------------------------IDG---LQ-ERL--TDY...NDL--------------HL
A1TH15_MYCVP/18-162-----------------------------------------AEL---LQ-KAL--SRY...NDL--------------HL
Q3KZ37_NOCSI/23-167-----------------------------------------VEL---LQ-SRL--DAC...TDL--------------HL
A4A8V0_9GAMM/21-165-----------------------------------------VQA---LD-GRM--VAL...IDL--------------AL
A0AD01_STRAM/23-167-----------------------------------------IGV---LR-LRL--HAL...NDL--------------HL
FTPA_HAEDU/44-188-----------------------------------------AEA---LQ-MRL--QGL...NEL--------------AL
DPS2_DEIRA/79-223-----------------------------------------VQA---LQ-NTL--TEL...QAL--------------QL
Q5WI06_BACSK/7-151-----------------------------------------QQL---LN-KQV--ATW...SVL--------------YV
TPF1_TREPA/36-177-----------------------------------------CEQ---LR-QHV--ADL...GVL--------------YI
Q2IR77_RHOP2/9-147-----------------------------------------TDA---LS-RVL--GRT...FGL--------------YV
Q1QGB4_NITHX/16-157-----------------------------------------AAL---LG-RLL--ADS...YII--------------YV
Q9A4G1_CAUCR/37-177-----------------------------------------AAS---LN-KVL--ADS...YAL--------------YL
Q68VU3_RICTY/4-143-----------------------------------------VKA---LE-RIL--ADS...YVL--------------YF
Q7NGR9_GLOVI/17-162-----------------------------------------IDL---LN-RDL--SDA...YLV--------------LI
Q8DG54_THEEB/12-156-----------------------------------------LTT---LK-REQ--ANA...VVM--------------YL
Q1J1Q0_DEIGD/77-222-----------------------------------------SET---LQ-RNL--ATT...ISL--------------YL
Q9K3L0_STRCO/52-198-----------------------------------------CQR---LN-KVL--ADT...RIL--------------HD
Q1IK59_KORVE/49-195-----------------------------------------TAQ---LN-QLL--ADT...MTL--------------RD
A3WEG4_9SPHN/13-158-----------------------------------------ITE---LN-GLL--ADH...FAL--------------YT
A3ZY47_9PLAN/17-162-----------------------------------------AAK---VN-DLL--ADV...FVL--------------FV
Q5HSQ2_CAMJR/4-149-----------------------------------------TKQ---LL-QMQ--ADA...HHL--------------WV
A0RM57_CAMFF/5-145-----------------------------------------VKQ---LN-QIQ--ADA...HAF--------------FI
Q8REM0_FUSNN/4-142-----------------------------------------KEN---LN-KYL--SNL...GIL--------------IT
A5FAK1_FLAJ1/17-159-----------------------------------------VEE---LN-VLL--SNF...QVY--------------YQ
A3XLP6_LEEBM/15-157-----------------------------------------VEQ---LN-VLL--ADY...HIY--------------YQ
Q1VZR4_9FLAO/15-159-----------------------------------------IKE---LN-IVL--ADY...HMY--------------YQ
Q4A6A8_MYCS5/1-137-----------------------------------------MKK---LE-YLL--TLQASFMLL--------------TL
Q04D79_OENOB/12-159-----------------------------------------KAQ---LN-QLI--ADI...SQL--------------KV
Q9FAA0_LACFE/7-153-----------------------------------------KEV---LN-QLV--ADL...SQL--------------VM
Q82Z45_ENTFA/7-153-----------------------------------------KEI---LN-QLV--ADL...SQF--------------SV
A8AW08_STRGC/25-171-----------------------------------------KAV---LN-QVV--ADL...YTA--------------HI
Q03LA4_STRTD/26-172-----------------------------------------KAV---LN-QAV--ADL...SVA--------------AS
Q74KF5_LACJO/7-153-----------------------------------------KKI---MN-EIV--ADL...TQT--------------HM
Q1WRB2_LACS1/34-180-----------------------------------------AAI---AD-HLL--GNM...HTL--------------HV
Q03SI7_LACBA/26-172-----------------------------------------GAM---TN-HIL--ANL...HIS--------------IV
A0Z048_LYNSP/36-181-----------------------------------------CEG---MN-ALL--ASF...QAL--------------YI
Q7NHH1_GLOVI/31-176-----------------------------------------TEG---LN-HLL--ASF...YTL--------------YH
Q3IPN0_NATPD/30-175-----------------------------------------VDA---LN-TDL--AAT...YVL--------------YH
Q67R42_SYMTH/16-162-----------------------------------------ALQ---LD-DHQ--CAL...NVA--------------LH
BFR_DESDA/13-142-----------------------------------------IEV---LN-KAR--AME...LHA--------------IH
Q1MQL3_LAWIP/15-151-----------------------------------------IDA---LN-YAR--SME...LHA--------------IS
Q1IS71_KORVE/8-144-----------------------------------------IEQ---LN-HAL--HGE...MTA--------------IL
A6DC96_9PROT/7-143-----------------------------------------IEL---LN-KAI--AEE...LSA--------------IH
A6Q7E1_SULNB/6-142-----------------------------------------IDL---LN-NAI--GDE...LAA--------------IN
Q1Q315_9BACT/9-146-----------------------------------------YKM---LC-EVY--TAE...IGA--------------IG
Q3ZXT0_DEHSC/7-137-----------------------------------------IEL---LT-KDM--EDE...HGA--------------II
Q3B5B6_PELLD/17-161-----------------------------------------LEL---LN-KAF--ADE...WLA--------------YY
Q2FMS4_METHJ/17-161-----------------------------------------ISL---LN-KAL--ADE...WLA--------------YY
A6L680_BACV8/19-163-----------------------------------------LAQ---LN-AAL--SEE...WLA--------------FY
A9AJZ8_BURM1/50-192-----------------------------------------LKL---LN-DAL--ATE...IVC--------------TL
A3DMK7_STAMF/7-139-----------------------------------------LEL---LN-EAI--ARE...LQV--------------SI
A0RUV2_CENSY/25-165-----------------------------------------IKQ---LV-INS--SVE...FAA--------------YY
Q7NDE3_GLOVI/20-166-----------------------------------------VAK---LV-RAA--SAE...FTT--------------YY
Q9YBZ3_AERPE/19-168-----------------------------------------IKR---LL-SAF--ADE...WVA--------------GY
Q2RMD8_MOOTA/7-141-----------------------------------------INL---LN-LDL--SWE...YAA--------------MI
Q9K5J5_BACAN/9-143-----------------------------------------IEG---LN-EDL--AGE...YSA--------------II
Q8ERY8_OCEIH/9-143-----------------------------------------IDG---LN-EDL--ANE...YAA--------------AI
Q7UWW0_RHOBA/7-140-----------------------------------------INQ---LN-EIL--KHE...WTG--------------VA
A3ZR38_9PLAN/6-140-----------------------------------------IDK---LN-DIL--RHE...WTG--------------VA
Q0AEZ2_NITEC/9-145-----------------------------------------IAL---LN-KIM--ELE...LAG--------------VV
O66666_AQUAE/154-284-----------------------------------------FNI---LN-KLL--QKE...YRL--------------IL
A6CI68_9BACI/7-140-----------------------------------------IKT---LN-EFL--RGQ...YMG--------------IH
Q67S14_SYMTH/6-143-----------------------------------------EAA---LN-EQI--KLE...LHS--------------AY
B3EMU8_CHLPB/7-143-----------------------------------------QKA---LN-EQI--DKE...FYS--------------AH
A8F5W0_THELT/7-144-----------------------------------------LKA---LN-EQI--KKE...LDS--------------AY
Q73QJ4_TREDE/6-143-----------------------------------------TKA---LN-EQI--NKE...MES--------------AY
D1N6G1_9BACT/7-144-----------------------------------------TAA---LN-DQM--VFE...ISS--------------AY
Q3A1G4_PELCD/7-144-----------------------------------------LDA---LN-EQM--KNE...FYS--------------AY
Q8U2T8_PYRFU/7-144-----------------------------------------LKA---LN-DQL--NRE...LYS--------------AY
A7HMU5_FERNB/7-144-----------------------------------------LKA---LN-EQV--GKE...IFS--------------SY
A4WKQ8_PYRAR/321-458-----------------------------------------VEA---LN-RQL--NYE...LRN--------------AY
Q1ASD6_RUBXD/14-151-----------------------------------------RDA---IE-EQV--GRE...FYA--------------AY
A9B878_HERA2/7-144-----------------------------------------EAA---IN-DQI--KHE...FES--------------AY
A7NP42_ROSCS/7-144-----------------------------------------QQA---IN-KQI--THE...FSA--------------SH
Q6MCM0_PARUW/6-143-----------------------------------------YTA---LN-EQI--KHE...FYS--------------SY
A8DR49_9BACT/7-144-----------------------------------------QEA---IN-GQL--NAE...LYS--------------SY
A0LJP8_SYNFM/7-144-----------------------------------------EKA---LN-EQL--NAE...LYS--------------SY
A1VDR6_DESVV/7-144-----------------------------------------NDA---LN-EQV--KWE...LYS--------------SY
A5UNY9_METS3/7-144-----------------------------------------ELE---LN-KQV--NAE...LYS--------------GY
Q2FQC4_METHJ/9-146-----------------------------------------EKA---LN-EQI--NAE...LYS--------------AY
Q6AMM6_DESPS/7-144-----------------------------------------NHA---LN-VQI--NAE...FFS--------------SY
A7ABY7_9PORP/8-145-----------------------------------------SEA---FN-AQV--NAE...MWS--------------SN
O83010_PORGN/8-145-----------------------------------------TKA---IN-DQI--KAE...MWS--------------SN
A6L3Z0_BACV8/7-144-----------------------------------------QEA---IN-AQI--VAE...MWS--------------AN
Q8A8R0_BACTN/6-143-----------------------------------------QNA---LN-EQI--TAE...LWS--------------AN
A7HD23_ANADF/7-144-----------------------------------------SEA---LN-RHV--QAE...LYS--------------AH
A7VV91_9CLOT/7-144-----------------------------------------ADL---LN-QQI--NKE...FYS--------------AY
Q97KS2_CLOAB/7-144-----------------------------------------LKL---LN-DQV--TKE...FYS--------------AY
Q185Y2_CLOD6/7-141-----------------------------------------EKL---LN-EQI--NHE...LYS--------------AY
A6UTU4_META3/7-144-----------------------------------------LKA---LN-KQI--NKE...LFS--------------AY
Q6LY34_METMP/6-143-----------------------------------------RCE---IE-EQI--NKE...FYS--------------AY
Q46E88_METBF/7-144-----------------------------------------EEA---LN-EQI--NKE...MYS--------------SY
A6LMA2_THEM4/7-144-----------------------------------------IEA---LN-NQV--NEE...FYS--------------AY
B9M5T0_GEOSF/7-144-----------------------------------------YAA---LN-KHM--NIE...LYS--------------AY
Q1JW00_DESAC/7-144-----------------------------------------TKA---LN-EQM--NFE...FYS--------------AN
A7C0L0_9GAMM/7-144-----------------------------------------AEE---LN-DQI--NRE...FYS--------------AY
A6U2Z7_STAA2/7-144-----------------------------------------LEA---LN-DQM--NHE...YFA--------------AH
Q5WLC3_BACSK/10-147-----------------------------------------VKA---LN-HQM--NME...FQA--------------AH
Q72Y25_BACC1/7-144-----------------------------------------HDA---LN-DQM--NFE...FYS--------------AH
A7YTG3_FRATU/7-144-----------------------------------------LDA---LN-DQF--NYE...LES--------------AN
A5N4F2_CLOK5/7-144-----------------------------------------VNF---IN-DQI--NFE...YYS--------------AN
Q899N4_CLOTE/7-144-----------------------------------------NKA---IN-DQI--NFE...MES--------------EN
A6TMX8_ALKMQ/7-144-----------------------------------------LQE---FN-EQV--KHE...FFS--------------AN
Q8XLR2_CLOPE/7-144-----------------------------------------LQR---LN-EQV--NFE...FYS--------------SY
B0KBX0_THEP3/7-144-----------------------------------------LEG---LN-KQL--NYE...IYS--------------AY
A4XMZ6_CALS8/7-144-----------------------------------------IDM---LN-EQL--NKE...LFS--------------AY
B8I3V4_CLOCE/7-144-----------------------------------------NDL---LN-RQV--QKE...FYS--------------AY
A3DBC9_CLOTH/5-142-----------------------------------------YDN---LN-EQM--NFE...LES--------------AY
A4ANB4_MARSH/7-144-----------------------------------------EKA---LN-TQI--QIE...AES--------------SQ
A5WH54_PSYWF/11-148-----------------------------------------EKA---LN-EQM--NNE...AAQ--------------AQ
A6EKF4_9SPHI/16-153-----------------------------------------ETL---LN-QQI--KKE...ALS--------------SS
A5FM49_FLAJ1/16-153-----------------------------------------ENI---LN-LQA--KLE...SDA--------------SN
A3HS92_9BACT/18-155-----------------------------------------EKL---LN-KQV--EME...GKS--------------SA
A1ZLT6_9BACT/28-165-----------------------------------------ESI---LN-DQI--KIE...SNS--------------SA
A9A256_NITMS/8-145-----------------------------------------KKA---LN-DQI--ALE...AAA--------------SN
Q7X3H8_TREHY/9-146-----------------------------------------IKL---LN-IQL--NKE...LYS--------------AS
A0KRF7_SHESA/7-144-----------------------------------------IEK---LN-EQI--NME...FFS--------------SN
A6VPR5_ACTSZ/7-144-----------------------------------------VKL---LN-AQM--NLE...FYS--------------SN
Q31JA0_THICR/7-144-----------------------------------------ATL---LN-KQV--NAE...YYA--------------SS
Q9RNF8_HELPX/7-144-----------------------------------------IKL---LN-EQV--NKE...MNS--------------SN
Q8D2Y7_WIGBR/7-144-----------------------------------------VVN---LN-KQL--NLE...LFS--------------SN
Q1LTF7_BAUCH/7-144-----------------------------------------KTK---LD-EQL--NLE...IFS--------------VN
A7MEF7_CROS8/7-144-----------------------------------------VQK---LN-AQM--NQE...FYA--------------SN
FTNB_ECO57/7-144-----------------------------------------LLK---LN-SQM--NRE...FYA--------------SN
A6FGT3_9GAMM/9-146-----------------------------------------ATA---LN-QQM--TKE...FTA--------------SH
Q6A5N4_PROAC/8-146-----------------------------------------LKA---FN-DQI--TLE...LTA--------------DM
Q4JX21_CORJK/8-145-----------------------------------------QKQ---LN-EQV--TAE...HQA--------------AL
Q8NMP2_CORGL/8-145-----------------------------------------ASA---FN-NQV--TAE...LEA--------------SM
C0A2T5_9BACT/6-143-----------------------------------------ATA---FN-QQA--NRE...HYT--------------SL
A1SHK2_NOCSJ/7-144-----------------------------------------VDQ---LN-AQI--GNE...LAA--------------HN
A4FJL2_SACEN/16-153-----------------------------------------QNL---LE-DQV--GNE...FTS--------------SQ
A1KQH6_MYCBP/12-149-----------------------------------------HAL---MQ-EQI--HNE...FTA--------------AQ
A0K014_ARTS2/7-144-----------------------------------------NDL---LA-KQV--GNE...FAA--------------SQ
Q5Z3M1_NOCFA/11-148-----------------------------------------PAL---LN-AQI--RRG...FTV--------------AQ
Q0IB83_SYNS3/32-169-----------------------------------------VEQ---LQ-AHL--NLE...RQS--------------SA
A3Z7J9_9SYNE/10-147-----------------------------------------LDA---MQ-QHL--NME...RNA--------------HA
Q46LC4_PROMT/29-166-----------------------------------------LEA---LY-QHT--SLE...RVS--------------SA
A2BW25_PROM5/30-167-----------------------------------------LDN---FY-DHL--TME...RYA--------------NV
A4CU24_SYNPV/6-143-----------------------------------------VVA---IQ-QHI--NLE...LEA--------------SM
A3YZ65_9SYNE/32-169-----------------------------------------HQG---LC-NHL--QME...LMA--------------SY
Q7V873_PROMM/5-142-----------------------------------------TKA---IN-LHL--ACE...FQA--------------SH
Q7NC62_MYCGA/6-144-----------------------------------------RKL---LN-NQY--NSE...MAA--------------AT
Q14P78_SPICI/11-144-----------------------------------------QHY---ID-EHI--KMQ...FFC--------------..
O77232_SCHJA/38-173-----------------------------------------EEG---LN-DQI--LYE...YEA--------------FY
Q17PG4_AEDAE/49-190-----------------------------------------QNA---IN-EQI--NVE...LAA--------------GY
A1C334_DAPPU/14-155-----------------------------------------EAC---IN-KQI--NIE...LNA--------------HY
A0S5U1_HYDVU/14-154-----------------------------------------EDA---IN-NQI--NME...LYA--------------SY
FRI_PACLE/13-154-----------------------------------------CEP---IN-KQI--NLE...FYA--------------SY
Q0PKG0_HALDI/15-156-----------------------------------------EAG---IN-RQI--NME...LYA--------------SY
O96408_SCHJA/13-154-----------------------------------------EAG---IN-KQI--IME...LYA--------------SY
A8WNX6_CAEBR/13-154-----------------------------------------EAA---VN-KQI--NVE...LYA--------------SY
FRIL1_MOUSE/14-155-----------------------------------------EAA---VN-RLV--NLH...LRA--------------SY
FRI3_LITCT/14-155-----------------------------------------EAG---LN-RTV--NLK...FHS--------------SY
Q6IQF1_DANRE/13-154-----------------------------------------EAN---IN-KLI--NLK...LTA--------------SY
A7S8I5_NEMVE/90-231-----------------------------------------EAG---IN-KQI--NRE...LFA--------------HY
Q0PKG1_HALDI/52-190-----------------------------------------INE---LN-DRL--NGS...LVA--------------SY
O15972_LIOJA/32-206-----------------------------------------IEK---MN-DQI--NLE...LHA--------------SY
A2AHC5_MOUSE/17-158-----------------------------------------EDA---IN-THI--QLR...LYA--------------SY
Q9DAX0_MOUSE/17-158-----------------------------------------NAA---LN-SQI--QLQ...LYG--------------SY
A2VCJ5_CLOSI/9-150-----------------------------------------EAA---IN-KQI--NME...LEA--------------SY
FRIH2_SCHMA/15-156-----------------------------------------ENA---IN-KQI--NVE...LQA--------------AY
Q9VYH1_DROME/25-165-----------------------------------------EKK---LN-DQI--NME...LKA--------------SH
Q2TQ27_CARRO/41-183-----------------------------------------INA---IQ-HQI--NEE...MHA--------------SL
FRIY_LYMST/34-216-----------------------------------------NQL---LE-QQI--QKE...LAA--------------SY
FRI1_PEA/88-233-----------------------------------------ESV---IN-EQI--NVE...YNA--------------SY
A4RT97_OSTLU/17-162-----------------------------------------ELA---LN-AQI--NVE...YNV--------------SY
Q9XFY2_CHLPR/83-228-----------------------------------------EAA---VN-EQI--NVE...YNI--------------SY
Q8SRN5_ENCCU/18-158-----------------------------------------GLL---LS-SQL--LLE...YNA--------------YY
Q5MGP3_LONON/42-197-----------------------------------------LKS---MQ-DQI--KME...VRA--------------SL
A8CW67_LUTLO/42-193-----------------------------------------IES---MR-DQI--QKE...VDA--------------SM
A8D916_BOMIG/44-196-----------------------------------------TNE---LK-AQV--NTE...INA--------------AM
Q9U0S2_NILLU/47-206-----------------------------------------TLE---VK-DQI--KME...YNA--------------AM
A1C331_DAPPU/38-183-----------------------------------------LNH---LR-SHI--KRE...LQA--------------AV
Q16T40_AEDAE/40-186-----------------------------------------LAA---LH-RQI--VIH...FDS--------------SI
Q5QBK7_9DIPT/55-208-----------------------------------------SQK---LT-NYA--WDQ...IVA--------------SY
Q52SA8_TRINI/26-176-----------------------------------------ATE---LQ-AYA--KLH...LER--------------SY
Q9TVI4_CALET/56-206-----------------------------------------ASE---MQ-AYA--NLH...IER--------------SY
Q8MUW9_APRGE/57-204-----------------------------------------QEG---LQ-KFV--NDH...FTL--------------SF
A8CW63_LUTLO/54-207-----------------------------------------QSA---LQ-EFT--MMQ...IQS--------------SF
Q9BII4_9TREM/55-199-----------------------------------------EHA---VN-KAI--QLH...QQA--------------VL
Q3UWK9_MOUSE/14-152-----------------------------------------LAY---IH-RIA--CMQ...MNL--------------SD
ARTM_ARTSA/32-172-----------------------------------------EKA---FV-EHI--HLE...LAS--------------SY

PF09537

A4G4I6_HERAR/9-119---------------------------------------DVIST..-LN-DLI--ETC---KDG--------------EE
B0KPC2_PSEPG/7-117---------------------------------------DVIDV..-LN-DLI--EYS---KDG--------------EK
A0M5S8_GRAFK/6-116---------------------------------------EVSNK..-LN-ELL--EKN---YDA--------------EK
A2TRU2_9FLAO/6-116---------------------------------------EVGNK..-LN-NLL--TKS---YDA--------------EA
A4YW11_BRASO/1-110---------------------------------------MAADS..-LK-TLH--TSL---IDA--------------RN
Q2ISU3_RHOP2/4-113---------------------------------------DILDH..-LK-TLN--TSA---IDA--------------RN
Q476Y2_CUPPJ/7-117---------------------------------------QTVIA..-LN-QLI--EVD---MDS--------------ER
Q08M54_STIAD/4-111---------------------------------------TDIDT..-LN-SFL--RGE---LSA--------------VE
A3KTV6_PSEAI/8-118---------------------------------------DTLDV..-LN-DLL--QTS---KDG--------------EA
Q3IYE5_RHOS4/13-121---------------------------------------AALDA..-LE-TLH--LRS---LDV--------------LA
A3DJV7_CLOTH/7-116---------------------------------------VVIEE..-LN-SLL--EGN---YMA--------------IH
Q07S33_RHOP5/4-113---------------------------------------DTLDH..-LK-TLH--TAA---VDA--------------RN
Q3BVR2_XANC5/6-115---------------------------------------KTEHS..-LN-DLI--AIS---RDG--------------KD
A5PE58_9SPHN/1-110---------------------------------------MATTV..-FK-SLT--DTT---FDS--------------VE
A2U3N9_9FLAO/7-117---------------------------------------EVGKK..-LN-GLL--ERT---YDA--------------EK
Q07PC2_RHOP5/3-112---------------------------------------DFIRC..-LK-ILH--TSL---VDT--------------RI
B5E925_GEOBB/5-113---------------------------------------DILNH..-LG-KLI--QLD---VDA--------------TH
Q2NBQ4_ERYLH/1-110---------------------------------------MASTT..-FK-SLT--DTT---FDS--------------VE
Q0FLV7_9RHOB/12-120---------------------------------------DQLST..-LQ-DLL--SRS---AET--------------HA
Q0SSJ9_CLOPS/8-117---------------------------------------TPSEA..-LN-DNL--KGL---YMG--------------ID
A6EG78_9SPHI/6-118---------------------------------------KAASV..-LN-DLT--EIN---NDR--------------VA
Q3M4J2_ANAVT/209-301---------------------------------------DIVRG..-LN-TAL--GGE---RYS--------------LE
A9C130_DELAS/176-286---------------------------------------DVVDV..-LN-DLL--ESC---RDG--------------EY
Q0KB71_CUPNH/7-117---------------------------------------QAVLA..-LN-QLI--EAG---KDS--------------EL
Q887I8_PSESM/7-117---------------------------------------ETISI..-LN-DLI--ETS---IDG--------------KE
A3TIM1_9MICO/3-116---------------------------------------DDEKA..-AK-ELV--ETL---RDG--------------EK
A3U6Z8_CROAH/24-134---------------------------------------QVSNK..-LN-ELL--KKN---YDA--------------EA
Q15NE8_PSEA6/5-115---------------------------------------NHVEK..-VS-SII--KVL---NGG--------------IE
Q023Z4_SOLUE/5-115---------------------------------------AIITH..-LK-QLV--ETS---KNG--------------EL
Q26B76_FLABB/6-116---------------------------------------QTEKY..-LN-DLL--EKT---YDA--------------QR
Q3IVZ0_RHOS4/11-119---------------------------------------AAADA..-LE-TLH--DRT---VDV--------------LA
Q8XXF1_RALSO/7-117---------------------------------------GIVLA..-LN-RLI--EVG---KND--------------EL
Q3K810_PSEPF/7-117---------------------------------------EAISV..-LN-DLI--ETS---KDG--------------QE
A4XUK4_PSEMY/9-119---------------------------------------ELVRT..-LN-KLI--ETC---KDG--------------EA
Q1N7C3_9SPHN/4-113---------------------------------------HTISK..-LD-DLI--TTL---IDS--------------VK
A1TM49_ACIAC/185-295---------------------------------------DVVDV..-LD-DLL--ESC---RDG--------------EY
B2JMY7_BURP8/4-114---------------------------------------NVIAV..-LN-ELI--ATS---KDG--------------ER
Q21P44_SACD2/29-139---------------------------------------DYLTH..-LN-DLV--RAL---NSS--------------IH
B4SKE7_STRM5/6-115---------------------------------------TIEHR..-LN-DLI--EIA---RDG--------------KS
Q2SCK1_HAHCH/5-115---------------------------------------SETNS..-LR-DLV--KVL---NDG--------------ID
B2TGN5_BURPP/4-114---------------------------------------NVVSV..-LN-DLV--ETS---KDG--------------EK
Q2Y8P3_NITMU/5-115---------------------------------------RIISM..-LN-GLI--EIS---RDG--------------AQ
Q1VAV2_VIBAL/4-114---------------------------------------E...N..-IA-SII--ELI---ESG--------------NE
B0SY12_CAUSK/7-116---------------------------------------DHIKL..-VN-SLV--ETT---IDS--------------AD
Q26G94_FLABB/6-116---------------------------------------EVANK..-LN-ELL--EKN---YDA--------------EA
A1VPM3_POLNA/175-285---------------------------------------EVIDT..-LN-DLL--ESC---RDG--------------EY
A5V9B8_SPHWW/33-142---------------------------------------TWMRS..-GE-RLL--ETL---ADS--------------LT
Q166R7_ROSDO/13-121---------------------------------------DAERA..-LQ-TLM--TRV---EDV--------------RQ
A2U3Q7_9FLAO/6-116---------------------------------------KVSNQ..-LN-ELL--EKN---YDA--------------EK
A5V2C1_SPHWW/29-137---------------------------------------ALTRS..-LN-RLI--AAL---NDT--------------IG
A8MGM2_ALKOO/6-115---------------------------------------DTIKA..-LN-ELL--QGE---YMA--------------IE
A3ZS58_9PLAN/10-120---------------------------------------ETLTA..-LH-ELT--RVL---HDS--------------QT
A6B9D2_VIBPA/4-112---------------------------------------E...N..-IA-SII--ELI---HSG--------------ND
Q26D84_FLABB/15-125---------------------------------------ATVNA..-LN-ALL--EKN---YDA--------------EQ
A6EEM1_9SPHI/4-118---------------------------------------NTVNTEI-LN-DLI--QIN---NDR--------------VK
Q2BCF3_9BACI/5-106---------------------------------------SVAKE..-LN-KFL--KGI---YMG--------------IH
A3XKU4_LEEBM/6-116---------------------------------------KMGEK..-LN-ELL--EKN---YDA--------------EA
Q48MB3_PSE14/7-117---------------------------------------EAISV..-LN-DLI--ETS---KDG--------------EK
Q1D9W1_MYXXD/39-146---------------------------------------KDVET..-LN-SFL--RGE---ISA--------------VE
Q3IHE9_PSEHT/7-117---------------------------------------NEVNH..-IS-DII--QVM---NSG--------------ID
A5FJ39_FLAJ1/10-121---------------------------------------EAVKT..-LE-GLI--SIL---EDG--------------KL
A3U8G4_CROAH/15-125---------------------------------------DIVNH..-LQ-QLL--EKN---YDA--------------EA
A6VRV2_MARMS/6-117---------------------------------------AHAHH..-IT-DII--KVM---NGG--------------IE
A4CGM0_ROBBH/6-116---------------------------------------KISNK..-LN-ELL--EKT---YDA--------------EK
A3XKU3_LEEBM/6-116---------------------------------------KISNN..-LN-ELL--TKN---YDA--------------EA
A6SZY6_JANMA/4-114---------------------------------------DVLAT..-LN-ELI--EAC---RDG--------------EA
Q7USR8_RHOBA/12-122---------------------------------------TTIEK..-LQ-KLI--RAN---IDS--------------YN
Q1IRA5_KORVE/5-114---------------------------------------KPVSV..-LK-KVI--ETA---RDG--------------EK
A4WXB8_RHOS5/11-119---------------------------------------AAADA..-LE-ALH--DRS---VDV--------------LA
A4XNN6_PSEMY/3-113---------------------------------------SKTAQ..-LN-ELI--EIT---RDG--------------KR
A3W9J5_9SPHN/2-111---------------------------------------SNINT..-LK-SLT--QTT---YDS--------------VE
A4VP43_PSEU5/5-115---------------------------------------ETISV..-LN-DLI--ETC---KDG--------------EK
A2SFH6_METPP/5-115---------------------------------------QVIQI..-LN-ELI--ETS---KDG--------------QY
A3XNV9_LEEBM/11-121---------------------------------------ELTEA..-LQ-KLL--VKN---YDA--------------EK
Q4ZXE4_PSEU2/7-117---------------------------------------ETISI..-LN-DLI--ETS---KDG--------------EE
A6EG63_9SPHI/6-117---------------------------------------EIISD..-LQ-GLV--NIV---NDG--------------KE
A3U4G7_CROAH/5-117---------------------------------------EISNS..-IQ-EII--ENN---NDS--------------YK
Q2CEG5_9RHOB/3-112---------------------------------------SDLKI..-VE-TLT--DTT---IDS--------------VE
A4A276_9PLAN/14-124---------------------------------------KTVAK..-LQ-KLI--RAN---IDS--------------YD

PF07875

A4XMZ0_CALS8/5-68-----------------------------------------SDRDI.AF-SLL--NAM---KLQ--------------AM
Q3EKQ4_BACTI/62-125-----------------------------------------GDIHI.AT-CYI--AHL---KRL--------------AL
A5I1Q7_CLOBH/16-79-----------------------------------------NDEVI.SV-NML--SAG---KAA--------------AD
Q9K644_BACHD/133-196-----------------------------------------SDQGI.SG-HML--GLM---KSQ--------------AT
A6M292_CLOB8/16-79-----------------------------------------AARDI.AQ-DML--KDS---KFA--------------VT
Q9KEV6_BACHD/15-78-----------------------------------------TDQVV.AT-DML--IAA---KAG--------------IK
Q0SWC3_CLOPS/2-65-----------------------------------------QEKEM.IS-DYL--AGI---NAS--------------LA
Q97FP5_CLOAB/9-72-----------------------------------------TEKDL.IE-DIL--SSE---KQL--------------IS
A6CTZ8_9BACI/23-86-----------------------------------------NDRDL.VN-DML--SME---KYM--------------TD
Q2BDD9_9BACI/15-78-----------------------------------------TDQMV.AM-DLL--NSA---KSG--------------AR
A6BGT2_9FIRM/3-66-----------------------------------------DEKTM.VS-DAL--AGV---NGE--------------LV
Q8ELM4_OCEIH/130-193-----------------------------------------SDQGI.SA-YML--GNA---KSL--------------TS
Q2BA87_9BACI/121-184-----------------------------------------GDQCY.SG-YLL--ALM---KGA--------------AS
Q0AVR0_SYNWW/6-69-----------------------------------------RDKEM.VN-DVL--SMT---KSG--------------LA
Q65F68_BACLD/23-86-----------------------------------------NDRDF.VN-ELL--TTE---KYM--------------TS
A6M290_CLOB8/10-73-----------------------------------------SEKDI.AL-DLM--TSS---KAT--------------IT
Q4MR30_BACCE/2-65-----------------------------------------NEKDM.VN-DYL--AGL---NAS--------------LT
A0Q278_CLONN/2-65-----------------------------------------QEKDM.MN-DVL--SMV---NSS--------------VG
YRAF_BACSU/18-81-----------------------------------------ADTTF.AM-DFL--IRA---KEG--------------VR
A7Z1V3_BACA2/15-78-----------------------------------------TDQIV.AM-DLL--NSA---KSG--------------VR
Q67MT8_SYMTH/17-80-----------------------------------------DDRVI.AE-GLL--TAA---KLK--------------AT
Q97FG0_CLOAB/16-79-----------------------------------------TNKDI.AS-DFM--MNL---DDF--------------IV
A8FBD5_BACP2/117-180-----------------------------------------KDLGI.TG-HML--SLV---KSH--------------AG
A3I3H5_9BACI/121-184-----------------------------------------NDEAI.SG-FLL--GAQ---KGA--------------AK
Q97JF1_CLOAB/102-165-----------------------------------------NDREI.AT-AYL--LTL---KRA--------------GR
A7Z2T2_BACA2/122-185-----------------------------------------KDLGI.SG-HML--GLI---KAQ--------------AS
Q5WIT4_BACSK/122-185-----------------------------------------NDETI.AL-SML--NAV---KSV--------------AP
A7GNZ9_BACCN/82-145-----------------------------------------GDIGI.AI-SYI--LHL---KKL--------------AL
Q5KVI9_GEOKA/20-83-----------------------------------------NERDF.LN-DML--TTE---KYM--------------TL
A6TLQ8_ALKMQ/10-73-----------------------------------------TEKEL.MN-DLL--ASE---KQV--------------TS
Q65CP9_BACLD/75-139-----------------------------------------ADLYFDAG-DLL--VLA---KTT--------------VR
A5I017_CLOBH/2-65-----------------------------------------QDKDM.IN-DTL--SAL---KAS--------------LT
YUSN_BACSU/22-85-----------------------------------------NDRDF.VN-ELL--TTE---KYM--------------TT
Q8R816_THETN/8-71-----------------------------------------TDKEI.MM-NIL--GSY---KLA--------------IE
A3DD47_CLOTH/2-65-----------------------------------------QDKEM.VN-DVL--SQI---NSS--------------LT
Q5L3H9_GEOKA/81-145-----------------------------------------GDRALHAG-DLL--GFS---KTA--------------VR
Q65JC0_BACLD/15-78-----------------------------------------TEQVI.AT-DFL--ISA---KTG--------------VK
A1HNM7_9FIRM/9-72-----------------------------------------SDKDL.LQ-VCL--NET---KHL--------------AS
YHCQ_BACSU/121-184-----------------------------------------DDSII.SR-QML--CAI---KAQ--------------AS
Q97LE8_CLOAB/15-78-----------------------------------------NDHVV.AT-DFL--IST---KSG--------------VK
A5D0N6_PELTS/107-170-----------------------------------------SDRTI.AM-GAL--VFH---KCS--------------AV
B8I7R4_CLOCE/101-164-----------------------------------------NDREI.AT-SYL--LTL---KRA--------------GR
A5N8T4_CLOK5/2-65-----------------------------------------DEKEL.MQ-DLL--TSE---KQV--------------IS
Q65M26_BACLD/120-183-----------------------------------------DDACI.SS-FML--GLM---KTC--------------CS
A4IN35_GEOTN/19-82-----------------------------------------NEQII.AA-DYL--IGA---KSA--------------IK
A7ZAR0_BACA2/78-142-----------------------------------------ADSSFYSG-GLL--ILA---KTS--------------VR
A5KJI1_9FIRM/2-65-----------------------------------------DEKTL.VS-DAL--VGI---NGE--------------LK
Q3A9B7_CARHZ/6-69-----------------------------------------KDQDM.IT-DIL--SFE---KFL--------------ST
Q97E03_CLOAB/16-79-----------------------------------------DDQVI.AG-VMM--DGA---KSS--------------AG
Q8ES15_OCEIH/3-66-----------------------------------------QDKDI.VN-DYL--NGL---NAS--------------MK
Q2RGX7_MOOTA/100-163-----------------------------------------DDRDV.AS-GML--GCH---KSS--------------AT
Q2RHK6_MOOTA/7-70-----------------------------------------DDKSI.FS-DCL--ASE---KLL--------------TS
A9KJ50_CLOPH/6-69-----------------------------------------KEKEI.LT-DAL--CTE---KAA--------------TD
Q252C4_DESHY/3-66-----------------------------------------DEKVM.VN-DVL--SSV---KSS--------------LT
A3DC40_CLOTH/17-80-----------------------------------------TDETI.AY-NLM--AGA---AAA--------------AT
COTF_BACSU/77-141-----------------------------------------ADNPFYSG-DLL--GFA---KTS--------------VR
Q67KL3_SYMTH/48-111-----------------------------------------NDRDR.MQ-DLL--AQE---KYL--------------TS
A6TVY2_ALKMQ/16-79-----------------------------------------NDEVI.AN-NMM--GSA---AAS--------------AQ
A4J5V2_DESRM/7-70-----------------------------------------TDKNL.CL-AML--NQL---KWD--------------AS
Q9K780_BACHD/21-84-----------------------------------------SDRDF.IN-DQL--ATE---KYI--------------TS
A0RFR9_BACAH/75-139-----------------------------------------DDTGFYAG-DLL--GLA---KTS--------------VR
Q18CV2_CLOD6/16-79-----------------------------------------DDKVI.ML-SML--SSA---KAS--------------AN
B8D269_HALOH/15-78-----------------------------------------SDEVI.AS-NML--SSA---KAA--------------AN
A5Z919_9FIRM/6-69-----------------------------------------TEKEI.LG-DAL--NSE---KNA--------------TT
A5D0C0_PELTS/3-66-----------------------------------------EEKDR.LT-DSL--ITQ---KYI--------------AS

PF05974

Q7D2Y1_AGRT5/3-159---------------------------------------TLSDI---FE-HTL--RDV---YYA--------------EN
A6CEX2_9PLAN/11-168---------------------------------------NLEDL---FV-EQI--QDL---YDA--------------EN
Q11AY7_MESSB/10-167---------------------------------------SMDDL---FM-HTL--KDI---YYA--------------EN
Q11TD5_CYTH3/34-191---------------------------------------QLQKL---FE-DEL--KDI---YWA--------------EK
B9B5H5_9BURK/3-158---------------------------------------TPHAH---LE-DWL--RDA---YAM--------------EH
Q89H23_BRAJA/1-158---------------------------------------MLSDL---FL-ETL--KDI---YYA--------------EN
A7ZZJ3_ECOHS/2-157---------------------------------------NRIEH---YH-DWL--RDA---HAM--------------EK
Q8PG92_XANAC/5-162---------------------------------------TVEDL---FI-HEL--SDI---YSA--------------EK
Q2N5V6_ERYLH/5-164---------------------------------------DLEYL---YA-ALL--QDM---VSA--------------DE
Q11CH8_MESSB/7-164---------------------------------------TLENL---ML-ETL--KDI---YHA--------------EK
A6T9K0_KLEP7/2-157---------------------------------------TDIEN---YH-NWL--RDA---HAM--------------EK
Q47PX9_THEFY/5-162---------------------------------------TPRDL---FV-HEM--SAM---RTG--------------EA
Q2RUN9_RHORT/4-159---------------------------------------TPREH---LI-DWL--RDA---YAM--------------EM
A3SZ42_9RHOB/27-186---------------------------------------SLKDV---YH-DQL--QDL---YSA--------------NK
A4A274_9PLAN/5-162---------------------------------------SLQKL---YV-QEL--KDL---YSA--------------EN
Q1IZK8_DEIGD/29-185---------------------------------------DLQDL---YV-EQL--QDV---YSA--------------EQ
A6EG70_9SPHI/34-192---------------------------------------EFHEF---FV-DEL--KDI---YWA--------------EK
Q98GX4_RHILO/1-158---------------------------------------MLDDL---FH-DTL--KDI---YFA--------------EK
E0TEY5_PARBH/5-164---------------------------------------TLKDV---YI-DQL--QDV---YSA--------------NR
Q7AEY0_ECO57/5-163---------------------------------------SVEDI---FI-HLL--SDT---YSA--------------EK
Q8PKL6_XANAC/3-158---------------------------------------EPQEN---LM-DWL--RDA---HAM--------------EQ
Q0BW11_GRABC/53-210---------------------------------------TLSDA---FY-ETL--KDI---YFA--------------EK
A4ELT9_9RHOB/5-164---------------------------------------NLEDV---YH-DQL--QDL---WSA--------------NT
Q2JZP1_RHIEC/6-163---------------------------------------TLNDL---FL-DTL--KDI---YYA--------------EK
A7IKA4_XANP2/10-167---------------------------------------SLDDL---FV-HTL--RDI---YYA--------------EK
Q1IMP2_KORVE/3-161---------------------------------------TAHEM---FI-HEL--QDL---LDA--------------EQ
A4WT57_RHOS5/10-166---------------------------------------TMDDL---YM-HML--QDI---YYA--------------EM
B0U7G3_METS4/4-159---------------------------------------DLRSL---YV-TAL--RNT---HAL--------------EL
Q18IC2_HALWD/5-160---------------------------------------SKREL---FD-REL--RKL---YHA--------------EI
Q07RJ3_RHOP5/10-167---------------------------------------TMDDL---FV-HQL--QDI---YYA--------------EK
A6EH70_9SPHI/7-165---------------------------------------NLKEV---YI-NAI--AEL---YAA--------------EK
Q4UQ81_XANC8/5-160---------------------------------------QSRER---LV-KWL--QDA---YAM--------------EK
A4EK29_9RHOB/5-164---------------------------------------TLEDL---YV-EQL--KDI---YSA--------------NK
Q7WNA6_BORBR/5-162---------------------------------------TLQEL---FI-HEL--SDI---YSA--------------EK
A5FEI3_FLAJ1/35-192---------------------------------------GLSEL---FE-DGL--KDI---YWA--------------EK
A7MLF2_CROS8/5-163---------------------------------------TAQDL---FV-HLL--SDT---YSA--------------EK
A3P9L7_BURP0/123-278---------------------------------------TPQEH---LE-DWL--RDA---YAM--------------ER
A5FGJ1_FLAJ1/57-214---------------------------------------GLREL---FV-DSL--KDI---YWA--------------EK
Q92X71_RHIME/3-158---------------------------------------TANEH---LV-AWL--RDA---HAM--------------EE
Q6WB78_ALCFA/7-162---------------------------------------RASKH---LM-DWL--RDA---HAM--------------EE
A3U308_9RHOB/5-161---------------------------------------SLKAL---YF-TEL--QEA---ASF--------------EA
Q2IZB5_RHOP2/8-165---------------------------------------NLNDL---FL-DTL--KDI---YYA--------------EK
Q28Q87_JANSC/5-164---------------------------------------TLEDL---YL-EQL--RDI---YSA--------------NM
Q6MCM2_PARUW/7-170---------------------------------------GLHKL---FI-DEL--QDM---YSA--------------EK
Q98DP6_RHILO/10-167---------------------------------------TLDDL---FV-HTL--RDI---YYA--------------EK
B0UQL3_METS4/6-163---------------------------------------DLRTL---FL-HQL--KDT---YFA--------------EN
Q1IVZ3_DEIGD/5-161---------------------------------------TLNDL---YV-SLL--RDL---YSA--------------EQ
Q07KF9_RHOP5/256-415---------------------------------------GMDDL---LI-DEL--HDI---LHA--------------EK
C1DPA9_AZOVD/3-158---------------------------------------TVHEN---LL-DWL--RDA---HAM--------------EQ
A5PDQ9_9SPHN/10-168---------------------------------------NLSDC---YT-EEL--ADL---WSA--------------ND
B1Z9G7_METPB/5-160---------------------------------------DIGTI---YA-GAL--RNT---RAL--------------ER
Q2KDJ5_RHIEC/6-163---------------------------------------TLEDL---FY-DTL--KDI---YFA--------------ER
A6E9F0_9SPHI/20-174---------------------------------------KLKTF---FI-KHL--DRI---YGA--------------KL
A6X824_OCHA4/6-163---------------------------------------NLEDL---FH-DTL--KDI---YYA--------------ER
Q01V03_SOLUE/6-163---------------------------------------RFEDL---FE-EEI--EAL---YDA--------------EM
A4YZ67_BRASO/4-159---------------------------------------KARDI---FI-LGL--RNA---HAM--------------EV
Q1YKQ2_MOBAS/13-170---------------------------------------SLDDL---FL-HTL--QDI---YYA--------------EK
Q1QGY5_NITHX/3-158---------------------------------------RIEEN---LM-AWL--RNA---HAM--------------EE
Q2RVL1_RHORT/10-167---------------------------------------SLDDL---FV-HAL--EDI---YYA--------------EQ
Q2IXU9_RHOP2/10-168---------------------------------------TMDDM---LL-HGL--RDI---YYA--------------EQ
Q28UW6_JANSC/13-172---------------------------------------TLHDV---YH-DQL--QDL---YSA--------------CK
Q6MC28_PARUW/4-175---------------------------------------SLFEV---FT-TVL--RDL---FDV--------------EN
A6EDE5_9SPHI/9-167---------------------------------------GLREF---LI-DGL--EDI---YDA--------------EE
A5EEQ8_BRASB/255-414---------------------------------------GLGDL---LI-EEL--RDI---LHA--------------EK
Q11CI8_MESSB/3-158---------------------------------------DMDER---LN-QWL--RDA---HAM--------------EL
A3ZRB2_9PLAN/10-166---------------------------------------TLADA---FW-EEL--QDV---LSA--------------EM
Q01UE6_SOLUE/4-161---------------------------------------SLKGL---FE-EEI--RDL---YDA--------------EK
A1B150_PARDP/5-162---------------------------------------VLDDL---FH-DTL--KDI---YYA--------------ER
A3VE20_9RHOB/3-161---------------------------------------TLDAL---FK-HFL--RDI---YYA--------------EK
B0UBY3_METS4/4-159---------------------------------------DISSI---YT-TAL--RNT---HAL--------------ET
Q8YZ72_NOSS1/15-173---------------------------------------NFQEK---FI-YEV--GAM---YDA--------------EH
Q1BVU6_BURCA/3-158---------------------------------------NQHEH---LE-DWL--RDA---YAM--------------ER
Q3SP74_NITWN/6-163---------------------------------------RLQDL---FH-DTL--KDI---YFA--------------EK
A4WGM2_ENT38/5-158---------------------------------------TLEDL---FS-HDL--SDV---YSA--------------EK
Q0FYD4_9RHIZ/5-164---------------------------------------NLKDI---YI-DQA--QDI---YSA--------------CN
Q217H9_RHOPB/4-159---------------------------------------DAREI---FV-VGL--RNA---HAM--------------EI
A6UF79_SINMW/6-163---------------------------------------TLEDL---FH-DTL--KDM---YYA--------------ER
B7KQ91_METC4/6-165---------------------------------------SLQDV---YL-DEL--KDN---WSA--------------ND
A7MK76_CROS8/3-158---------------------------------------TYEEN---YH-DWL--RDA---HAM--------------EK
A3K1P1_9RHOB/10-169---------------------------------------TLQDV---YV-DQL--QDL---YSA--------------CE
B0UBY7_METS4/6-165---------------------------------------RLKEV---YL-DEL--KDL---WSA--------------ND
A4VLE8_PSEU5/10-165---------------------------------------VRTER---LI-EWL--RDA---HAM--------------EA
Q98P06_RHILO/13-170---------------------------------------GLEDM---FV-EGL--KDI---YYA--------------EK
Q11LJ1_MESSB/3-158---------------------------------------HPKDH---LL-SWL--RDA---HAA--------------EE
A9W6G1_METEP/4-159---------------------------------------DTREI---YV-TAL--KNT---HAL--------------EM
A0LZC6_GRAFK/3-160---------------------------------------NLTEL---LE-HEI--KDL---YSA--------------EK
A6W5K1_KINRD/7-163---------------------------------------TPEQI---FS-YKL--GAA---LTM--------------EK
A0M7B4_GRAFK/3-160---------------------------------------DLKEL---FE-HQL--KDL---YSA--------------EN
Q3J5G6_RHOS4/9-166---------------------------------------ELDTA---FH-DML--KDV---YYA--------------ER
Q1QSM8_CHRSD/16-174---------------------------------------TPNDL---FV-RLL--YEI---NSA--------------EK
Q0BW13_GRABC/6-161---------------------------------------KARDV---FI-LGL--RNQ---HAV--------------EN
A4XUK0_PSEMY/3-158---------------------------------------TPTDN---LL-DWL--RDA---HAM--------------EQ
A4WQ47_RHOS5/3-158---------------------------------------VMRQT---FI-EGL--KNA---HAM--------------EK
A6V5Z0_PSEA7/3-158---------------------------------------SKQEN---LL-DWL--RDA---HAM--------------EQ
Q2RUE8_RHORT/5-162---------------------------------------TLDKL---FY-DTL--KDI---YYA--------------ER
Q1INK4_KORVE/10-168---------------------------------------NLEEL---FI-EQL--RDL---YDG--------------EQ
B2JRX0_BURP8/24-181---------------------------------------TLRDL---FI-HSL--SDI---YSA--------------EK
Q1QJZ8_NITHX/8-165---------------------------------------DLHDL---FL-DQL--RDI---YFA--------------EK
Q1QG59_NITHX/3-158---------------------------------------RAEEN---LM-AWL--RDA---HAM--------------EE
B0U8B5_METS4/7-163---------------------------------------TLQDA---FY-ETL--KDV---YYA--------------ER
A5FF55_FLAJ1/31-188---------------------------------------ELKAL---FV-DSL--KDI---YWA--------------EN
A4WDL1_ENT38/5-163---------------------------------------TLQDV---FI-HLL--SDT---YSA--------------EK
Q2KD03_RHIEC/258-417---------------------------------------AIQEV---LV-DEL--RDL---LHA--------------EK
A3WXM1_9BRAD/5-162---------------------------------------DLNGL---FL-DTL--KDV---YYA--------------EK
Q2JZN4_RHIEC/5-160---------------------------------------EIRDV---FV-VGL--RNA---HAM--------------EN
Q1YF89_MOBAS/5-164---------------------------------------NLKDI---YI-DQL--QDI---HSA--------------CN
Q5FS57_GLUOX/10-165---------------------------------------SALDI---YL-DAL--RDH---LSI--------------ES
A3WF16_9SPHN/5-164---------------------------------------TLKDL---YI-DQL--QDI---YSA--------------DK
Q4ZL48_PSEU2/5-162---------------------------------------TIEDL---FI-HEL--SDV---YSA--------------EK
Q01R92_SOLUE/3-162---------------------------------------QLKEL---LV-EQL--QDL---LHA--------------ES
A3UGS3_9RHOB/3-162---------------------------------------SLKDL---YI-DQL--QDL---YSA--------------DK

PF12902

A0ZHB6_NODSP/18-250-----------------------------------------------LI-QGL-.MIE---HAT--------------LP
A1X1N4_9BURK/613-836-----------------------------------------------LK-KAI-.DLE---LSL--------------ML
A3HV98_9BACT/38-321-----------------------------------------------LK-QAS-.TTE---HLL--------------AM
A3HZ39_9BACT/19-235-----------------------------------------------IQ-TAI-.ELE---HST--------------IP
A3Y7W6_9GAMM/17-250-----------------------------------------------LQ-YAV-.DLE---LWT--------------IP
A4FHP6_SACEN/30-243-----------------------------------------------LQ-AAM-.QIE---LTT--------------IP
A4LG06_BURPE/20-228-----------------------------------------------LQ-TAI-.ELE---YST--------------LP
A6ULY2_SINMW/16-247-----------------------------------------------LH-RAM-.QLE---HAT--------------IP
A8M272_SALAI/669-906-----------------------------------------------LR-EAA-.KVE---LAV--------------ML
A8ZLP5_ACAM1/23-242-----------------------------------------------LQ-TAL-.KLE---FST--------------LP
B0C5X5_ACAM1/25-233-----------------------------------------------LQ-NAI-.QLE---HST--------------IP
B0CT19_LACBS/234-434-----------------------------------------------VH-AGV-.MIE---LST--------------IP
B1KIQ0_SHEWM/17-245-----------------------------------------------LQ-GAV-.DLE---LWT--------------IP
E0ULS0_CYAP2/25-248-----------------------------------------------LQ-DAI-.DLE---HST--------------IP
E0UKM8_CYAP2/76-306-----------------------------------------------LK-QAM-.KIE---HAT--------------IP
B5HPH9_9ACTO/76-269-----------------------------------------------LQ-VAV-.ELE---LST--------------IP
B7JXC8_CYAP8/18-243-----------------------------------------------LI-QGM-.MIE---HAT--------------LP
B8PFV9_POSPM/149-342-----------------------------------------------LR-DAL-.RIE---LTT--------------IP
B9NM45_9RHOB/334-495-----------------------------------------------LK-TRL-AAME---MTL--------------SL
D2S599_GEOOG/25-233-----------------------------------------------VQ-LAI-.ELE---HST--------------VP
D7W1T5_9FLAO/113-372-----------------------------------------------LQ-TAI-.LIE---HST--------------IP
C7QG40_CATAD/22-236-----------------------------------------------LQ-WAI-.ELE---HAT--------------IP
C7PJ64_CHIPD/65-298-----------------------------------------------LC-IDA-.EIE---HGL--------------ML
C6W0G0_DYAFD/25-230-----------------------------------------------VQ-RAI-.ELE---HST--------------IP
D0LW11_HALO1/25-246-----------------------------------------------LN-QAA-.GLE---HSL--------------MA
C3KD44_PSEFS/15-238-----------------------------------------------LH-TAM-.TLE---LST--------------IP
C3XXN2_BRAFL/2783-3028-----------------------------------------------LQ-TAI-.QLE---LAT--------------IP
C3ZZV2_BRAFL/3683-3925-----------------------------------------------LQ-TAL-.ELE---LAT--------------IP
Q0H2X4_9ACTO/620-853-----------------------------------------------LR-QAA-.TIE---LAV--------------ML
Q0RHC0_FRAAA/25-238-----------------------------------------------LL-TAI-.QLE---FST--------------IP
Q27IF3_9ACTO/618-871-----------------------------------------------LR-DAV-.KLE---LAV--------------MI
Q7USU6_RHOBA/51-263-----------------------------------------------LQ-TAA-.EIE---HSL--------------LV
Q8GRF3_9ACTO/686-926-----------------------------------------------LH-DAA-.AIE---LAV--------------ML
Q8KHV6_NOCAE/602-842-----------------------------------------------LR-HGV-.AIE---LAV--------------ML
Q9AAP0_CAUCR/14-241-----------------------------------------------FQ-GAI-.DLE---LWT--------------IP
Q9FBT7_STRCO/27-241-----------------------------------------------LQ-WAI-.EVE---HST--------------LP
Q9RJF6_STRCO/71-265-----------------------------------------------LQ-VAV-.ALE---LAT--------------IP
VIOB_CHRVO/605-828-----------------------------------------------LR-KAV-.DLE---LSV--------------ML

PF13628

B9M9A2_GEOSF/32-168-----------------------------------------------GK.DKD.FIKK---AAS--------------GG
D8JRV0_HYPDA/27-169-----------------------------------------------PS.DPQ.IAHI---AYT--------------AG
B5EEU3_GEOBB/29-165-----------------------------------------------RH.DKA.FVKE---AAS--------------GG
D5WLB6_BURSC/27-169-----------------------------------------------PS.DPQ.IAAI---VVT--------------AN
B2J1E3_NOSP7/67-203-----------------------------------------------SS.DRQ.FITE---AAQ--------------DG
Q46RG7_CUPPJ/74-211-----------------------------------------------AS.DTD.FMKK---AAQ--------------AG
B9XLH1_9BACT/39-176-----------------------------------------------AK.DFK.FVTD---AAK--------------GG
B1ZNP6_OPITP/29-171-----------------------------------------------VT.DAQ.IAAI---VVA--------------AN
B4CUJ0_9BACT/35-171-----------------------------------------------HT.DKS.FLED---SYK--------------GG
B9TGV0_RICCO/88-225-----------------------------------------------SK.DKK.FVTN---AAE--------------AG
E0UH58_CYAP2/56-192-----------------------------------------------AT.DRN.FVTE---AAQ--------------GG
B8IFB9_METNO/26-168-----------------------------------------------PN.DAQ.IAHI---AYT--------------AG
Q2Y8Y8_NITMU/29-171-----------------------------------------------LT.DAE.IAHI---VVT--------------AN
A5XZ63_BURML/27-169-----------------------------------------------LT.DPQ.IAAI---VVT--------------AN
Q2K1W8_RHIEC/36-173-----------------------------------------------PK.TED.FIKE---AAA--------------SD
Q89S47_BRAJA/47-189-----------------------------------------------PT.DPQ.IAHI---AYT--------------AG
Q475E9_CUPPJ/38-175-----------------------------------------------DS.DVM.FLRK---AAD--------------AG
Q2JYM6_RHIEC/26-168-----------------------------------------------PT.DPQ.IAHI---AYT--------------AG
B7XMG6_ENTBH/26-161-----------------------------------------------AT.SNS.FVDD---AAQ--------------GG
B1SYH2_9BURK/28-170-----------------------------------------------PT.DPQ.IAAI---VVT--------------AN
B2JWH1_BURP8/26-168-----------------------------------------------PS.DAQ.IAAI---VVT--------------AN
E3I358_RHOVT/31-167-----------------------------------------------SP.DEA.FVRD---LSS--------------GG
Q983W7_RHILO/27-169-----------------------------------------------PT.DPQ.IAHI---AYT--------------AG
B2JMY4_BURP8/40-174-----------------------------------------------PG.DTQ.FAQD---ASQ--------------AG
C6BHV4_RALP1/37-174-----------------------------------------------KS.DTT.FVTK---AAA--------------AG
B4RD58_PHEZH/36-178-----------------------------------------------PT.DAQ.IAHI---AYT--------------AG
B2TGN9_BURPP/45-179-----------------------------------------------PA.DQQ.FVQD---ASQ--------------SD
A5ET49_BRASB/16-158-----------------------------------------------LS.DPQ.IAHI---AYT--------------AG
C6W7B7_DYAFD/46-182-----------------------------------------------ED.DAE.FAVA---AAD--------------GG
B1Z4Z9_BURA4/61-196-----------------------------------------------GG.DAE.FIDK---AAM--------------AG
A6WYV3_OCHA4/28-170-----------------------------------------------LH.DPA.IAHI---AYT--------------AG
A4VIW1_PSEU5/27-163-----------------------------------------------AE.GDN.FVDE---ASA--------------KG
C6VVL2_DYAFD/52-188-----------------------------------------------EE.DSK.FAVD---AAN--------------GG
D2QCP5_SPILD/50-187-----------------------------------------------EE.SNE.FAVK---AAT--------------GG
A5W3E5_PSEP1/25-160-----------------------------------------------AT.SDD.FVEA---ATE--------------AG
F0QBL1_ACIAP/59-196-----------------------------------------------RA.DKS.FLDD---AAH--------------NG
B3R194_CUPTR/37-174-----------------------------------------------AG.DVD.FMNK---AAQ--------------AG
Q5NXZ0_AROAE/83-220-----------------------------------------------GV.DRS.FISE---AMS--------------RG
C0INK3_9BACT/23-165-----------------------------------------------LS.DPE.IASV---AVV--------------AN
A8I5I1_AZOC5/73-211-----------------------------------------------PS.TQD.FVTQ---AAV--------------SD
B1Z9Q1_METPB/40-177-----------------------------------------------PS.SQD.FVTQ---AVI--------------SD
E8S4J3_MICSL/32-168-----------------------------------------------TQ.DTQ.YLQA---VHQ--------------VN
A6V653_PSEA7/32-167-----------------------------------------------TA.PQT.FVSE---ASA--------------AG
Q1IQR0_KORVE/28-170-----------------------------------------------PS.DPQ.IAGV---VQT--------------AN
A2WJB2_9BURK/59-195-----------------------------------------------GS.DAE.FVDK---AAL--------------GG
A9EY26_SORC5/67-203-----------------------------------------------ES.DRE.FVEK---AGQ--------------GG
A6EII6_9SPHI/56-192-----------------------------------------------GK.DPAKFAEQ---AAI--------------GG
Q210M7_RHOPB/37-173-----------------------------------------------PA.TQD.FVTQ---AAI--------------SD
C6XDF2_METSD/33-170-----------------------------------------------MS.DKN.FFEN---AAQ--------------AN
A8EAJ0_BURPE/58-193-----------------------------------------------GV.DAE.FVDK---AGL--------------AG
A9HSC1_GLUDA/37-173-----------------------------------------------DA.DMT.FIEK---AAQ--------------TN
A1K296_AZOSB/48-185-----------------------------------------------SE.DRD.FLEN---ASQ--------------AG
Q4ZL47_PSEU2/25-161-----------------------------------------------QD.ADD.FVED---ASA--------------KG
B2FDC1_RHIME/28-164-----------------------------------------------LQ.PQE.FARR---MSM--------------SN
A1K6J4_AZOSB/48-184-----------------------------------------------PQ.DRL.FLKL---AAM--------------GN
C7PV19_CHIPD/48-184-----------------------------------------------KE.SSD.FAVK---AAD--------------GG
A3WXM9_9BRAD/46-182-----------------------------------------------YQ.DQL.FAQT---AAV--------------GG
A4YPU2_BRASO/40-175-----------------------------------------------PAKDQH.FMTE---AIQ--------------GD
A4CGT8_ROBBH/26-168-----------------------------------------------LS.DAE.IASV---AVV--------------AN
C1DPB0_AZOVD/26-162-----------------------------------------------ME.ADD.FVDE---ASA--------------KG
C4WP31_9RHIZ/50-187-----------------------------------------------PS.TQD.FVTL---SGS--------------GD
Q3SKS8_THIDA/41-177-----------------------------------------------KA.DVQ.FAVD---AAA--------------AG
Q2RUP1_RHORT/26-161-----------------------------------------------EP.AQS.FVDK---AAV--------------GG
E6VQ01_RHOPX/36-173-----------------------------------------------PS.TPD.FVKQ---VAI--------------SD
Q07KD9_RHOP5/36-173-----------------------------------------------PS.TQD.FVTQ---VAV--------------SD
E1TJA8_BURSG/45-179-----------------------------------------------PA.DQQ.FIQD---ASQ--------------SD
A6UMR2_SINMW/24-160-----------------------------------------------IS.SEE.FVTV---AAS--------------SD
Q2IXV0_RHOP2/36-173-----------------------------------------------PS.TAD.FVKQ---AAI--------------SD
C6B7S0_RHILS/38-175-----------------------------------------------PK.TED.FVVE---AAS--------------SD
A5VBV5_SPHWW/29-171-----------------------------------------------VS.DAQ.IAHI---AYT--------------AG
B4R7U0_PHEZH/55-191-----------------------------------------------NS.TEA.FVAN---AAM--------------SD
A4X9Y5_SALTO/32-168-----------------------------------------------QQ.DTQ.YLQA---IHQ--------------VN
A4YTJ9_BRASO/36-173-----------------------------------------------PS.TED.FVKE---VAT--------------SD
C6X5B6_FLAB3/62-198-----------------------------------------------EQ.DKM.FANE---AAK--------------GG
Q2IZZ6_RHOP2/43-180-----------------------------------------------AD.TQK.FIQQ---VTI--------------SD
A4XUL6_PSEMY/32-167-----------------------------------------------IS.TED.FVEE---ASA--------------KG
A1W2W2_ACISJ/28-163-----------------------------------------------TK.DRE.FLTQ---AAT--------------GG
A8HXW5_AZOC5/37-175-----------------------------------------------LS.GPR.FVET---AAI--------------AG
A4WXT6_RHOS5/92-229-----------------------------------------------ND.PAD.FAQM---AGV--------------SN
Q3KBI4_PSEPF/25-166-----------------------------------------------AT.DND.FVDN---AAA--------------GG
B0T245_CAUSK/55-193-----------------------------------------------TK.AAT.FVAK---AAA--------------SD
D5WLX4_BURSC/38-172-----------------------------------------------QA.DKD.FVQA---ASM--------------SS
B1G845_9BURK/54-190-----------------------------------------------PT.DQQ.FMLT---AAS--------------VG
Q7WM56_BORBR/46-182-----------------------------------------------SA.DRD.FLED---AAQ--------------AG
B1G087_9BURK/38-172-----------------------------------------------QV.DKD.FVQA---ASM--------------SS
B8EIS3_METSB/37-174-----------------------------------------------PS.TSD.FVRQ---VAI--------------SD
B9B0D3_9BURK/83-218-----------------------------------------------GI.DAE.FVDK---AAT--------------LG
A7HWP1_PARL1/40-178-----------------------------------------------IT.TEQ.YVNK---AAL--------------GD
Q2IP97_ANADE/111-254-----------------------------------------------KD.LDE.GLQK---LHA--------------AN
B3Q5A8_RHIE6/48-184-----------------------------------------------NQ.DRL.FARL---AAA--------------GG
C6VZG6_DYAFD/31-167-----------------------------------------------QT.DRD.FMMK---AAD--------------AN
D2ZGE9_9ENTR/52-189-----------------------------------------------SG.DEK.ALKD---MAQ--------------AN
Q6N5I2_RHOPA/73-210-----------------------------------------------AA.TES.FIQQ---VAI--------------SD
C7JB67_ACEP3/36-171-----------------------------------------------PK.TDD.FIQG---AVW--------------SD
A7H8S3_ANADF/104-247-----------------------------------------------GD.LEE.RIQE---LHA--------------SN
B8H682_CAUCN/79-216-----------------------------------------------KA..DV.FAAK---LAD--------------GA
E1TCF2_BURSG/40-174-----------------------------------------------AA.DQT.FIAE---GTK--------------AV
C5AE76_BURGB/65-200-----------------------------------------------GI.DPE.FVDK---ASL--------------AG
A2WFV6_9BURK/45-179-----------------------------------------------EA.DQT.FITD---GTK--------------TV
A9GDI6_SORC5/85-228-----------------------------------------------LT.DEQ.ILAV---LDA--------------SN
A5VGP0_SPHWW/46-184-----------------------------------------------SP.GQA.FANT---AAA--------------SD
C6XDG6_METSD/26-163-----------------------------------------------MQ.DEM.FLKN---AVK--------------AS
C7PPP6_CHIPD/45-181-----------------------------------------------NA.AVN.FATN---VAN--------------AN
B2H110_BURPE/47-181-----------------------------------------------EA.DQA.FVTD---ATK--------------AV
Q5LX51_SILPO/25-167-----------------------------------------------MN.DLE.IAHT---AYT--------------AG
C1CZB6_DEIDV/40-176-----------------------------------------------NS.DVL.FMES---ATI--------------SN
A5V2I5_SPHWW/61-199-----------------------------------------------PT.GQD.FADQ---AAK--------------SD
B1ZWK7_OPITP/63-194-----------------------------------------------RG.DRR.FVDK---LAK--------------LG
Q0BSG9_GRABC/35-171-----------------------------------------------DT.DRS.FVTA---LTQ--------------AN
B4W7Y0_9CAUL/55-193-----------------------------------------------NT.VEG.FVTS---LAV--------------GN
A9IMD9_BORPD/32-169-----------------------------------------------HQ.DRL.FMEA---ATR--------------AG
C3X6U1_OXAFO/26-168-----------------------------------------------NS.APE.VAST---LWA--------------IN
A6EC23_9SPHI/68-203-----------------------------------------------GN.EKS.FLLN---AAV--------------TG
Q3KGN9_PSEPF/27-163-----------------------------------------------QS.PAD.FINE---ASA--------------KG
C6B942_RHILS/26-162-----------------------------------------------QH.ATD.FAAK---AAM--------------SN
D2QJS3_SPILD/61-198-----------------------------------------------TA.DQD.LMMQ---VAK--------------GG
Q2JZN3_RHIEC/26-162-----------------------------------------------RA.ASD.FATT---ATI--------------SN
C3X783_OXAFO/52-194-----------------------------------------------NS.APE.VVST---LYS--------------IN
B5WV33_9BURK/27-168-----------------------------------------------LT.DAQ.IVGI---ILV--------------AN
D2PPQ1_KRIFD/35-171-----------------------------------------------DQ.DRA.FLRG---AHQ--------------SN
C6W1M4_DYAFD/32-168-----------------------------------------------DI.DRQ.FLLA---AAD--------------DA
Q4UUM7_XANC8/84-221-----------------------------------------------ED.EQE.ALGM---LSA--------------IN
A4F0L3_9RHOB/59-201-----------------------------------------------MN.DLE.IAHS---AYT--------------AG
B9KN92_RHOSK/33-169-----------------------------------------------DD.AQV.FAGM---AVS--------------SA
D9QKZ8_BRESC/54-192-----------------------------------------------NT.AGG.FVTA---LAT--------------SD
B2JML1_BURP8/48-182-----------------------------------------------AA.DQT.FINE---GTR--------------AV
Q2IPC5_ANADE/58-201-----------------------------------------------ED.ARN.TLAT---LHL--------------RN
A6EI02_9SPHI/96-235-----------------------------------------------VS.NDD.FLHK---AAV--------------HI
Q8PKY1_XANAC/43-180-----------------------------------------------PG.ERE.ALGI---LSA--------------IN
Q7NGC4_GLOVI/47-190-----------------------------------------------QT.DTR.LLAS---MAE--------------FG
Q1NI17_9SPHN/59-197-----------------------------------------------PI.DAAGYVAQ---AGA--------------AD
C3KDG8_PSEFS/41-177-----------------------------------------------QS.PAE.FIEQ---ASA--------------KG
Q1H3J6_METFK/38-175-----------------------------------------------AK.DQG.YLKD---IAR--------------LG
Q9RUK1_DEIRA/23-161-----------------------------------------------GT.DTA.FLAK---AVR--------------GN
Q7NHN8_GLOVI/69-212-----------------------------------------------DV.DAG.LLRL---TAE--------------YG
Q5FUH2_GLUOX/43-180-----------------------------------------------TA.DAA.FIQQ---IDE--------------MD
B0UDQ0_METS4/45-193-----------------------------------------------EA.EAK.HIAD---TLA--------------AG
Q1D3N0_MYXXD/108-250-----------------------------------------------LT.DGQ.ILGV---LLV--------------AN
A9GLZ6_SORC5/143-281-----------------------------------------------PS.DAE.LTML---ISF--------------IH
Q02LP9_PSEAB/21-152-----------------------------------------------PA.DTRALLAD---SLA--------------DS
B6IR05_RHOCS/41-177-----------------------------------------------GF.DAT.HLQQ---AYQ--------------RG
C6XZD3_PEDHD/100-224-----------------------------------------------MS.DEE.LVNK---MLT--------------DQ
Q3BN66_XANC5/52-193-----------------------------------------------KG.DGA.VLGV---LAA--------------ID
B6QZY9_9RHOB/36-167-----------------------------------------------HG.STD.YTNK---TLT--------------IS

PF05067

YJQC_BACSU/1-278----------------------MF.YHIKELQYQAKPAHPDPVYAKKLQ-EVL--GGQFGEISV--------------MM
Q9I1T0_PSEAE/1-294----------------------MF.VHDKRLQYTVRVAAPDPGLANLLL-EQF--GGPQGELAA--------------AM
Q9KAU6_BACHD/1-281----------------------MF.YHVKHLQYHAKPERPDPVYAKKLQ-EIL--GGQFGEISV--------------AL
COTJC_BACSU/1-189----------------------MW.VYEKKLQYPVKVSTCNPTLAKYLI-EQY--GGADGELAA--------------AL
Q9KDZ2_BACHD/1-298----------------------MFKRIDKLLIDLPKPDHPDANAAAAVQ-ELL--GGRFGEMST--------------LN
MCAT_BACSU/1-273----------------------MF.KHTKMLQHPAKPDRPDPLFAKKMQ-EIL--GGQFGEISV--------------AM

PF03713

A8LVC1_SALAI/31-177--------------------------------------------------DVMYLQMM---IAH--------------HG
Q5YML7_NOCFA/57-220--------------------------------------------------DVGFAQDM---ATH--------------HN
Q6XN35_RHOER/37-208--------------------------------------------------EVGFAQDM---SVH--------------HG
A6W729_KINRD/39-201--------------------------------------------------DVGFARDM---ATH--------------HS
Q5Z101_NOCFA/55-219--------------------------------------------------DIGFLQDM---SVH--------------HT
Q0SGM9_RHOSR/61-227--------------------------------------------------DVGFAQDM---SVH--------------HS
A4FN49_SACEN/88-259--------------------------------------------------DVGFAQDM---SVH--------------HQ
A4FE15_SACEN/46-216--------------------------------------------------DIGFSQDM---SAH--------------HA
Q5YWT9_NOCFA/45-201--------------------------------------------------ETGFAQDM---AAH--------------HQ
Q0SK07_RHOSR/51-206--------------------------------------------------DIGFAQDM---SVH--------------HE
A3TIC0_9MICO/54-213--------------------------------------------------EAGFSRDM---QTH--------------HG
Q6SK75_ARTAU/34-199--------------------------------------------------EAGFARDM---QTH--------------HL
A4AKP7_9ACTN/51-214--------------------------------------------------EAGFARDM---QVH--------------HQ
Q47S90_THEFY/23-182--------------------------------------------------DVGFLRDM---SAH--------------HA
Q82AV5_STRAW/43-199--------------------------------------------------DAGFARDM---AVH--------------HQ
A4XAY7_SALTO/62-216--------------------------------------------------EAGFARDM---TTH--------------HA
A0AW55_ARTS2/62-226--------------------------------------------------DAGFARDM---QAH--------------HA
A6WGU5_KINRD/112-290--------------------------------------------------DVGFSRDM---REH--------------HG
Q0RCA7_FRAAA/59-245--------------------------------------------------DVGFARDM---SEH--------------HA
A8KZW0_FRASN/79-262--------------------------------------------------DVGFARDM---SEH--------------HS
A4AKP3_9ACTN/56-207--------------------------------------------------DIGFFRDM---ALH--------------HE
A6GQF3_9BURK/49-215--------------------------------------------------DSGFARSM---LLH--------------HA
A1SNX0_NOCSJ/32-195--------------------------------------------------DVAFAAEM---VPH--------------HQ
A1SDH4_NOCSJ/59-212--------------------------------------------------DVAFATDM---VQH--------------HA
Q1BFR6_MYCSS/55-200--------------------------------------------------DVAFARDM---MPH--------------HQ
A4T3N9_MYCGI/55-203--------------------------------------------------DITFASTM---VKH--------------HQ
A1T1H5_MYCVP/54-201--------------------------------------------------DIAFAYDM---VPH--------------HA
Q0RS99_FRAAA/44-228--------------------------------------------------DVTFAQMM---VPH--------------HR
Q5YMP0_NOCFA/64-211--------------------------------------------------DVTFLQSM---YPH--------------HA
A3TRU4_9MICO/44-193--------------------------------------------------DLTFAQSM---IPH--------------HE
Q0JWQ8_STRAM/60-205--------------------------------------------------DVAFAKGM---IPH--------------HR
Q82E39_STRAW/71-222--------------------------------------------------DVTFAQQM---IPH--------------HQ
A6WGV6_KINRD/98-261--------------------------------------------------DVMFAQMM---IVH--------------HQ
A3TK32_9MICO/55-197--------------------------------------------------DVEFAQMM---IPH--------------HQ
Q5YT33_NOCFA/59-206--------------------------------------------------DVAFAQEM---IPH--------------HR
A1TDH2_MYCVP/59-210--------------------------------------------------DIAFARDM---VPH--------------HE
A4T8S2_MYCGI/67-217--------------------------------------------------DATFARDM---VPH--------------HE
Q1BC35_MYCSS/58-226--------------------------------------------------DVTFAQGM---IPH--------------HQ
A0R280_MYCS2/52-198--------------------------------------------------DVMFAQHM---IPH--------------HQ
Q1B113_MYCSS/53-222--------------------------------------------------DMMFSRHM---IPH--------------HQ
A0K235_ARTS2/57-202--------------------------------------------------DTLFTQSM---IPH--------------HA
A4AG55_9ACTN/49-193--------------------------------------------------DQMFATMM---IPH--------------HE
Q8NLI1_CORGL/71-217--------------------------------------------------DIMFAQMM---IPH--------------HQ
A1UPV4_MYCSK/41-184--------------------------------------------------DVAFLQQM---IPH--------------HA
Q2N5S7_ERYLH/58-210--------------------------------------------------DARFMQMM---IPH--------------HR
A5PA80_9SPHN/57-209--------------------------------------------------DVAFMQGM---ITH--------------HQ
A3UC46_9RHOB/55-216--------------------------------------------------DVRFMQDM---IVH--------------HY
A3WF42_9SPHN/68-231--------------------------------------------------DVAFLQGM---IVH--------------HQ
Q0ATP4_MARMM/56-229--------------------------------------------------DARFMQHM---IVH--------------HG
Q022J2_SOLUE/61-225--------------------------------------------------DVSFMQGM---IHH--------------HS
A4X6R2_SALTO/79-221--------------------------------------------------DTWYVQMM---IPH--------------HE
Q0H2Y8_SACER/71-240--------------------------------------------------EATYVAMM---IPH--------------HE
Q9K3P2_STRCO/76-218--------------------------------------------------DVSYARMM---IQH--------------HA
A3TNA7_9MICO/73-222--------------------------------------------------DAKFYQDM---IVH--------------HA
Q9RVD0_DEIRA/33-176--------------------------------------------------EVQFVQHM---LQH--------------HA
B0U8H5_METS4/225-369--------------------------------------------------DQAFMRRM---ASH--------------HA
Q9RRN7_DEIRA/55-183--------------------------------------------------DIKFAQLM---MDH--------------HQ
Q1J3D3_DEIGD/62-202--------------------------------------------------DRAFYSTM---IPH--------------HQ
Q1J295_DEIGD/57-193--------------------------------------------------DRAYLSMM---MAH--------------HQ
A6EJ19_9SPHI/53-195--------------------------------------------------DRDFIQMM---IPH--------------HQ
Q7VFW4_HELHP/40-187--------------------------------------------------DLNYLSNM---IPH--------------HQ
B9KE81_CAMLR/56-203--------------------------------------------------ERDFLANM---IPH--------------HQ
Q11UY7_CYTH3/68-211--------------------------------------------------DHDFAMMM---KMH--------------HQ
A7JSQ1_PASHA/104-245--------------------------------------------------DTAFAKGM---IPH--------------HI
Q1QE07_PSYCK/97-242--------------------------------------------------DTAFAKSM---LGH--------------HH
A9AYN0_HERA2/50-184--------------------------------------------------DLQFLDGM---IEH--------------HR
A5V0R4_ROSS1/56-190--------------------------------------------------DALFIDSM---IVH--------------HE
A0ZFH3_NODSP/72-222--------------------------------------------------DLRFIDGM---IVH--------------HQ
Q2JRB2_SYNJA/58-208--------------------------------------------------DLRFLDAM---ILH--------------HE
Q0YT76_9CHLB/64-193--------------------------------------------------DLRYLDGM---IAH--------------HR
P72559_SYNE7/55-207--------------------------------------------------DLRFIDAM---IQH--------------HY
A3Z244_9SYNE/68-221--------------------------------------------------DLRFLDGM---VQH--------------HT
Q55943_SYNY3/46-190--------------------------------------------------DQSFIEMM---IPH--------------HQ
Q8ZSB7_NOSS1/59-222--------------------------------------------------DQHFIEMM---VPH--------------HT
Q31P39_SYNE7/58-213--------------------------------------------------DQHFIVMM---IPH--------------HE
A3YWB8_9SYNE/73-239--------------------------------------------------DQQFIVMM---IPH--------------HD
Q1AZS8_RUBXD/64-204--------------------------------------------------DRRFIDLM---VPH--------------HQ
Q1D6W0_MYXXD/49-189--------------------------------------------------DERFIDMM---AAH--------------HQ
Q3SJA1_THIDA/49-185--------------------------------------------------EIDYMTGM---ISH--------------HQ
A7HAD4_ANADF/47-185--------------------------------------------------EVMWMTQM---IDH--------------HA
A1SIT5_NOCSJ/74-207--------------------------------------------------EPEYLAEM---VAH--------------HQ
A3TP12_9MICO/50-191--------------------------------------------------ERDFLIEM---VAH--------------HE
A1UPT7_MYCSK/34-187--------------------------------------------------DVLFARDI---IDH--------------SA
A3I411_9BACI/39-184--------------------------------------------------SENFIKQI---IPY--------------QI
A4F8Y7_SACEN/55-202--------------------------------------------------DQEFARQF---LAH--------------QG
A5CV70_CLAM3/55-232--------------------------------------------------DLSFAEEM---GDH--------------AA

PF00268

RIR2_EBVA8/1-276-----------------------------------------MS......KLL..YVRDHEGFAC--------------LT
RIR2_BHV1C/7-288-----------------------------------------AATLTRKYKYF..YETECPDLDH--------------LR
RIR2_HUMAN/70-351-----------------------------------------EPLLRENPRRFVIFPIEYHDIWQ--------------MY
RIR2_VZVD/1-280-----------------------------------------MDQ.KDCSHFF..YRPECPDINN--------------LR
RIR2_YEAST/76-358-----------------------------------------EPLLNEDKERTVLFPIKYHEIWQ--------------AY
RIR4_SALTY/1-281-----------------------------------------MKLSRISAINW..NKIQDDKDLE--------------VW
RIR2_HHV11/28-314-----------------------------------------IPKCPDPERYF..YTSQCPDINH--------------LR
RIR2_SCHPO/66-348-----------------------------------------EVVLRPNPHRFVLFPIKYHEIWQ--------------FY
RIR2_DICDI/12-293-----------------------------------------EPILKENKDRFVLFPIKYPDIWR--------------MY
RIR2_SHV21/1-279-----------------------------------------MDSVK...KYL..YTCDHVGFLE--------------LT
RIR2_EHV1B/12-295-----------------------------------------TAELSLAGAFF..YTPECPDIEH--------------LR
RIR2_CAEEL/62-343-----------------------------------------EPMLQDLDNRFVIFPLKHHDIWN--------------FY
RIR2_ASFB7/9-294-----------------------------------------EELLIENSQRFTIFPIQHPECWN--------------WY

PF03232

COQ7_HUMAN/47-217-----------------------------------------AAVDRIIR-VDHAG--E---YGA--------------NR
Q6BPA8_DEBHA/54-250-----------------------------------------AFLDRIIR-VDQAG--E---LGA--------------NY
Q2GE68_NEOSM/5-175-----------------------------------------PLIERILR-VNHAG--E---SAA--------------VY
A5FUU9_ACICJ/16-182-----------------------------------------AEIARMIR-VDHAG--E---FGA--------------KQ
Q9TVU0_DROME/50-219-----------------------------------------ALTDEIIR-VDHAG--E---LGA--------------DR
Q4FNJ8_PELUB/7-177-----------------------------------------EKVKEFIR-VDHAG--E---RGA--------------IK
Q582P6_TRYB2/23-204-----------------------------------------QKLDEAVR-VDQAG--E---VAA--------------VR
Q1GVM9_SPHAL/4-171-----------------------------------------KRTASMIR-VDQAG--E---FGA--------------TR
COQ7_SCHPO/41-216-----------------------------------------NILDSVIR-VDQAG--E---LGA--------------NQ
Q7RZB1_NEUCR/74-256-----------------------------------------AFLSSALR-VNQAG--E---LAA--------------TL
Q4E674_TRYCC/24-205-----------------------------------------IKIDEVLR-VDQAG--E---TAA--------------VR
Q73G62_WOLPM/16-180-----------------------------------------QFLQQAIR-VDHAG--E---YGA--------------IC
COQ7_CAEEL/17-187-----------------------------------------ALIEKIIR-VDHAG--E---LGA--------------DR
Q2GCC1_NOVAD/3-170-----------------------------------------AKTAAMLR-VDQAG--E---YGA--------------TR
Q2RNK3_RHORT/45-212-----------------------------------------ALIDRFLR-VDQAG--E---HGA--------------VR
Q6J4P7_APILI/25-195-----------------------------------------KLLDSIIR-VDHAG--E---LGA--------------DR
A5P9R2_9SPHN/11-180-----------------------------------------DHIARMIR-VDQAG--E---FGA--------------TR
A7TK78_VANPO/55-238-----------------------------------------AYLDRVIR-VDQAG--E---LGA--------------NY
Q5A1Q6_CANAL/50-246-----------------------------------------AYLDRVIR-VDQAG--E---LGA--------------NY
A8F0U6_RICM5/20-188-----------------------------------------KQIHEIIR-VNHAG--E---YGA--------------KR
E0TD93_PARBH/31-201-----------------------------------------RRRAEMLR-VDHAG--E---YGA--------------VN
Q1N9T4_9SPHN/17-184-----------------------------------------RDRAAMLR-VDQAG--E---FGA--------------TR
Q5KIZ4_CRYNJ/66-251-----------------------------------------KLIERIIR-VDHAG--E---LGA--------------NW
E9AE97_LEIMA/97-280-----------------------------------------QKIDEVVR-VDHAG--E---VAA--------------VR
Q5HBV3_EHRRW/6-170-----------------------------------------KFLDQVIR-VNHAG--E---YGA--------------VC
Q2F6B9_BOMMO/27-196-----------------------------------------PHLDQIIR-VDHAG--E---LGA--------------DR
Q40K31_EHRCH/6-170-----------------------------------------NLLQQAIR-VNHAG--E---YGA--------------VC
Q5NLW7_ZYMMO/17-185-----------------------------------------EERKSMIR-VDHAG--E---YGA--------------IR
Q1RHH8_RICBR/11-179-----------------------------------------KQIQEIIR-VNHAG--E---YGA--------------RR
COQ7_DICDI/48-217-----------------------------------------QIIERIIR-VDHAG--E---FGA--------------AR
A3UGP4_9RHOB/17-188-----------------------------------------SRIESMVR-VDHAG--E---YAA--------------VA
A2RV27_DANRE/53-223-----------------------------------------AMLDRMLR-VDHAG--E---YGA--------------NR
A4TYY9_9PROT/18-184-----------------------------------------QLLARILR-VDQAG--E---LGA--------------VR
Q9A697_CAUCR/30-200-----------------------------------------ARLAEILR-VDQAG--E---LAA--------------VH
A7HTM0_PARL1/20-193-----------------------------------------AAIEEMIR-VDHAG--E---YGA--------------VR
Q7Q596_ANOGA/22-194-----------------------------------------KLVDRIIR-VDQAG--E---LGA--------------NQ
Q0BU90_GRABC/23-189-----------------------------------------ERLARMIR-VDHAG--E---YGA--------------SR
Q75CT1_ASHGO/43-226-----------------------------------------AYLERVVR-VDQAG--E---LGA--------------NY
Q5D9V5_SCHJA/11-181-----------------------------------------ALVDRIVR-VDHAG--E---LGA--------------KR
Q2W739_MAGSA/17-185-----------------------------------------GLIDRFLR-VNQAG--E---LGA--------------VR
CAT5_YEAST/50-233-----------------------------------------AFLDRVIR-VDQAG--E---LGA--------------DY
Q6C5T9_YARLI/12-192-----------------------------------------SFITKLIR-VDQAG--E---LGA--------------DL
Q0AM53_MARMM/22-193-----------------------------------------RRIEEMIR-VDHAG--E---YGA--------------VA
Q1HQL9_AEDAE/23-193-----------------------------------------ETIDRIIR-VDHAG--E---LGA--------------NQ
Q5PBA0_ANAMM/4-170-----------------------------------------KSVESMIR-VDHAG--E---YAA--------------VC
Q28EZ6_XENTR/52-222-----------------------------------------AVLDRIIR-VDHAG--E---YGA--------------NR
Q6FM78_CANGA/48-232-----------------------------------------AYLSRVIR-VDQAG--E---LGA--------------NY

PF02915

Q8FZ24_BRUSU/20-157---------------------------------------------EILA-LAISS--E---EDD--------------AR
O27405_METTH/16-131---------------------------------------------NVVD-ANFRG--E---CSE--------------VG
Q8U1L0_PYRFU/18-147---------------------------------------------EILG-YAIAS--E---EDA--------------EK
Q9X1L2_THEMA/5-141---------------------------------------------DILT-VAIRL--E---EEG--------------ER
Q8RTU6_9PROT/83-214---------------------------------------------DFLV-SSITS--E---YSG--------------CV
Q9WZC5_THEMA/7-123---------------------------------------------KFLE-DAFAG--E---SMA--------------HM
ACSF2_SYNY3/89-222---------------------------------------------DFLE-RSCTS--E---FSG--------------FL
Q9V073_PYRAB/23-158---------------------------------------------ELLG-MAIKS--E---IEA--------------RK
O58303_PYRHO/19-154---------------------------------------------ELLG-MAIKS--E---IGA--------------QK
Q8U1L6_PYRFU/22-157---------------------------------------------ELLG-MAIKA--E---IGA--------------RE
ACSF1_SYNY3/89-222---------------------------------------------EFLE-RSCTA--E---FSG--------------FL
O26912_METTH/5-120---------------------------------------------DNLK-EAFAG--E---SQA--------------NR
O26850_METTH/9-145---------------------------------------------ENLT-KAFIG--E---SQA--------------RN
RUBY_DESVH/11-139---------------------------------------------KNIL-TAFAG--E---SQA--------------RN
ACSF1_NOSS1/82-215---------------------------------------------EYLE-RSCIS--E---FSG--------------FL
Q9RMF8_MOOTH/11-139---------------------------------------------KNLL-TSFAG--E---SQA--------------RN
Q89CA2_BRAJA/11-148---------------------------------------------EVLA-VAISS--E---EED--------------SR
ACSF_PORPU/80-213---------------------------------------------EFLE-RSCTA--E---FSG--------------FL
Q9WXM4_THEMA/6-140---------------------------------------------DLLN-IALRI--E---STG--------------YS
RUBY_CLOPE/11-143---------------------------------------------ENLM-KSFAG--E---CQA--------------RT
ACSF2_NOSS1/89-222---------------------------------------------DFLE-RSCTS--E---FSG--------------FL
A9CKH9_AGRT5/20-157---------------------------------------------EILA-LAISS--E---EDD--------------SR
CRD1_ARATH/134-267---------------------------------------------EFLE-RSCTA--E---FSG--------------FL
ACSF_CYACA/82-215---------------------------------------------EFLE-RSCTA--E---FSG--------------FL
Q92KS6_RHIME/20-157---------------------------------------------EILA-LAISS--E---EDD--------------GR
RUBY_METJA/15-152---------------------------------------------KNLT-KAYIG--E---SLA--------------RN
Q9UZU3_PYRAB/26-160---------------------------------------------EILS-YAIFN--E---EAE--------------IR
Q98DQ2_RHILO/20-157---------------------------------------------EILA-LAISS--E---EDD--------------GR
ACSF_RUBGE/90-221---------------------------------------------DFLV-SSVTS--E---FSG--------------CV
O29426_ARCFU/5-135---------------------------------------------KNLL-KGYIG--E---SLA--------------IS
O28633_ARCFU/4-119---------------------------------------------KFLE-DAFAG--E---SQA--------------HM
Q8KZ48_9PROT/77-208---------------------------------------------DLLV-SSITA--E---YSG--------------CV
O29427_ARCFU/5-137---------------------------------------------ENLV-KAFIG--E---SMA--------------RN
NIGY_DESVH/31-160---------------------------------------------ENLK-AAIAG--E---TGA--------------HA
O27972_ARCFU/15-130---------------------------------------------ENLR-NAYAG--E---SQA--------------MV
Q9V026_PYRAB/32-168---------------------------------------------EILS-YALSG--E---LDS--------------TK
Q9UWP7_9EURY/10-125---------------------------------------------KFLE-EAFAG--E---SMA--------------HM
Q8R811_THETN/2-140---------------------------------------------NALE-FAIKM--E---KDG--------------EK

PF13668

Q5AVP0_EMENI/134-269------------------------------------------SDFDYQS-VALGVHQE---YIE..............LD
C1F3A5_ACIC5/23-187------------------------------------------TDADIFN-FALNL..E---YLE..............AE
D3PQH2_MEIRD/38-209------------------------------------------QDVAVLN-FALNL..E---YLE..............AA
A6S480_BOTFB/30-166------------------------------------------TDADILQ-YALTL..E---HLE..............NA
D2QRU0_SPILD/66-195------------------------------------------GDVGILA-FAYVL..E---QLE..............AA
D9QP73_BRESC/63-237------------------------------------------LDVEILN-FALQL..E---YLE..............AQ
D2QMT4_SPILD/63-193------------------------------------------AAIDTAN-FALTL..E---YLE..............DE
A8NHQ9_COPC7/124-261------------------------------------------DDLRVLN-YALTY..E---YLT..............TA
C6W7H4_DYAFD/67-197------------------------------------------GDIGVLN-YAYAL..E---QLE..............AA
C4JFF2_UNCRE/41-177------------------------------------------TDADVLQ-FALTL..E---HLE..............NV
A5AXH5_VITVI/574-741------------------------------------------GDVNLLQ-FAENL..E---HLE..............AD
Q1AVF2_RUBXD/50-181------------------------------------------GDVDIAN-FALTL..E---YLE..............AE
Q0UES8_PHANO/27-163------------------------------------------SDGDILN-YALTL..E---HLE..............NT
C1D1F0_DEIDV/57-227------------------------------------------IDVDVLN-FALNL..E---YLE..............AA
C7QET9_CATAD/119-262------------------------------------------GDLKVVA-LATAL..E---NQA..............VA
Q0UN97_PHANO/56-194------------------------------------------TDVDILN-FALTA..E---HLE..............SE
D7W2M6_9FLAO/70-207------------------------------------------TLTDALQ-LALVL..E---YLE..............NE
C6W7H5_DYAFD/59-194------------------------------------------AAVDVLN-YALKL..E---YLE..............DE
A9S267_PHYPA/20-196------------------------------------------KDKELTQ-VALNL..E---YFE..............AE
B2WN46_PYRTR/29-165------------------------------------------TDGIILN-YALTL..E---HLE..............DA
C7YY56_NECH7/30-166------------------------------------------NDGVILN-YALTL..E---HLE..............DT
C7PHE9_CHIPD/61-200------------------------------------------DVLGVLN-YALTL..E---YLE..............AE
Q1AVF1_RUBXD/64-195------------------------------------------TDAQILQ-FAYLL..E---LLE..............GT
Q9LZJ2_ARATH/33-200------------------------------------------SDVDRVH-FAMNL..E---FTE..............AE
Q745Y9_THET2/28-152------------------------------------------SQEDVLA-LALAA..E---ELA..............RE
A2Q670_MEDTR/38-205------------------------------------------SDVDLLE-FPLNL..E---YLE..............AE
D3EZI8_CONWI/53-180------------------------------------------GDVAILN-YALTL..E---ELQ..............AA
A6W4B4_KINRD/57-226------------------------------------------SEVSVLN-FALNL..E---YLE..............AE
B9FMH8_ORYSJ/64-217------------------------------------------SDMAHIQ-FLLNA..K---FVE..............AE
B9T0V5_RICCO/35-202------------------------------------------DDKDRLQ-FALNL..E---YSE..............AE
D2QJB2_SPILD/63-193------------------------------------------GDLGILN-YAFVL..E---QIE..............SR
D3EZX4_CONWI/69-195------------------------------------------QDVAILN-YALTL..E---YLE..............AA
B9L2W7_THERP/5-140------------------------------------------SVQDIIS-IAATA..E---ALA..............VT
Q5NZC8_AROAE/51-183------------------------------------------ADARILN-TALAA..E---HEA..............IA
C1A3R7_GEMAT/70-201------------------------------------------GDIAVLQ-FAYAL..E---QLE..............AD
A0LZF5_GRAFK/67-200------------------------------------------SPTDVLN-FALTL..E---YLE..............AE
Q9RZK8_DEIRA/61-237------------------------------------------LDATIFN-FALNL..E---YLE..............AA
A1WBY8_ACISJ/80-212------------------------------------------ADVRILN-TALAA..E---YEA..............VA
B0DCR6_LACBS/28-162------------------------------------------TDTDILV-FALNL..E---LIE..............VN
A3XPH6_LEEBM/59-205------------------------------------------DVVGVLN-LALTL..E---YLE..............DE
Q745Y5_THET2/44-207------------------------------------------LDVAILN-FALNL..E---YLE..............GL
B3R613_CUPTR/60-194------------------------------------------DDINILN-TALGL..E---YQA..............IA
D2QJB3_SPILD/63-198------------------------------------------NVVDVLN-FALLL..E---YLE..............SD
A2XGL9_ORYSI/69-236------------------------------------------HDVDPVR-FALNL..E---FAE..............AE
Q127J3_POLSJ/49-181------------------------------------------GDVQILN-TAIGA..E---LEA..............IA
A5FJH2_FLAJ1/63-205------------------------------------------TPIGALQ-FALTL..E---YLE..............NE
B7IDP2_THEAB/2-153------------------------------------------SIEDILK-LAENF..E---IEG..............YK
Q1NFZ5_9SPHN/66-239------------------------------------------TDADVLN-FALQL..E---YLE..............AQ
D0LL68_HALO1/57-201------------------------------------------HDIELFN-SGLLL..E---QTA..............IL
C7RKL2_ACCPU/49-185------------------------------------------GDVNILN-VALGL..E---HEA..............IA
B0DV96_LACBS/38-174------------------------------------------ADSQVLN-FLLTL..E---HLE..............RA
A8PI33_COPC7/121-258------------------------------------------EDLRVLN-YALTY..E---YLA..............AA
D1CIN4_THET1/4-134------------------------------------------KYLDVLN-YALTL..E---HLE..............DA
C5C2C0_BEUC1/71-202------------------------------------------GDLEILN-YALTL..E---YLE..............AE
B9HIK8_POPTR/43-210------------------------------------------SDIDLLE-FPLNL..E---YLE..............AE
B9T0V6_RICCO/35-202------------------------------------------TDQDRLQ-FALNL..E---FLE..............AE
C0NCN2_AJECG/32-168------------------------------------------SDVDILQ-FALTL..E---HLE..............NV
C5X0M3_SORBI/80-247------------------------------------------YDVDPMQ-FALNL..E---FTE..............AE
A8NW93_COPC7/49-203------------------------------------------DDVRILN-FALSF..E---YLA..............TA
Q2CF59_9RHOB/31-161------------------------------------------GDTGVLN-YAYAL..E---QLE..............AA
Q6BVQ7_DEBHA/28-164------------------------------------------IDVDILQ-YALTL..E---HLE..............NA
C9S734_VERA1/33-166------------------------------------------GDIDILN-YALTL..E---FLE..............RK
C2FVH4_9SPHI/66-196------------------------------------------GDIAILN-YAYAL..E---QLE..............AA
A0M2H2_GRAFK/86-224------------------------------------------GDLAILN-YAYIL..E---QLE..............AA
C6XUE9_PEDHD/64-194------------------------------------------DDFGVLN-YAYAL..E---QLE..............AA
A3I156_9BACT/63-200------------------------------------------SLIGVLN-YALTL..E---HLE..............YR
C6NX50_9GAMM/54-197------------------------------------------GDLDILN-FALNA..E---HQA..............IA
C7PHE8_CHIPD/70-200------------------------------------------GDFAVLN-YAFAL..E---QLE..............AA
Q7ND08_GLOVI/14-155------------------------------------------NDLEILN-NALYF..E---HQG..............IW
C1F3A6_ACIC5/49-222------------------------------------------TDADILN-FALNL..E---FLE..............AQ
Q11V38_CYTH3/57-193------------------------------------------GDTGILN-YAYAL..E---QLE..............AA
Q4PGP0_USTMA/91-225------------------------------------------NDTQILQ-YALTL..E---HLE..............AE
D3F6V0_CONWI/68-195------------------------------------------SDVDILN-YALTL..E---YLE..............AA
A3I157_9BACT/58-189------------------------------------------GDIGILN-YAYAL..E---QLE..............AA
A8PI32_COPC7/43-181------------------------------------------DDVRILN-YALSW..E---YLA..............TA
B9GGY2_POPTR/34-201------------------------------------------IDKDLVQ-FPLNL..E---FLE..............AE
A4G567_HERAR/52-184------------------------------------------ADVNILN-TALGA..E---LEA..............IA
A9SYP0_PHYPA/38-208------------------------------------------RDVEELN-VILNA..E---YLE..............AE
C1D191_DEIDV/46-222------------------------------------------LDATIFN-FALNL..E---YLE..............AA
C9SFS6_VERA1/50-186------------------------------------------TDIDILQ-FALTL..E---WLE..............GT
C6TE89_SOYBN/43-210------------------------------------------KDADLLE-FALNL..E---YLE..............AE
D3L3V4_9BACT/18-170------------------------------------------MEKKILE-FALKM..E---GEA..............RD
D7W2M7_9FLAO/58-191------------------------------------------GDVGILN-YAYAL..E---QLE..............AD
Q11V37_CYTH3/38-167------------------------------------------SVTDTLN-YALTL..E---YLE..............EA
D3PQH0_MEIRD/42-175------------------------------------------SDLDVLN-LALTA..E---YLA..............TD
Q1IK95_KORVE/7-170------------------------------------------EEVDILN-FALNL..E---YLE..............AE
Q2CF60_9RHOB/63-198------------------------------------------QVKDVLN-FALTL..E---YLE..............DE
Q5KLK1_CRYNJ/29-176------------------------------------------TDIDILQ-YALTL..E---HLEKILPDTPPPFSTTLSN
B9LPE2_HALLT/74-217------------------------------------------DDVDILN-YARTL..E---LLE..............AS
D5X661_THIK1/64-198------------------------------------------DDIAILN-VALGL..E---YQA..............IA
D2QRT9_SPILD/63-197------------------------------------------GVKDVLN-FALTL..E---YLE..............YR
D3EZI9_CONWI/53-179------------------------------------------QDREILQ-LALLL..E---HVQ..............EG
A0LZF4_GRAFK/83-228------------------------------------------GNLGILN-YAYAL..E---QLE..............AA
D2RUZ2_HALTV/65-208------------------------------------------NDIEILN-YALTL..E---YLE..............AV
D2PR20_KRIFD/39-169------------------------------------------NDIEVLN-YALAL..E---YLE..............AE
DRPE_CRAPL/38-205------------------------------------------SDVSLLE-FPLNL..E---LLE..............AE
B9RZV0_RICCO/40-207------------------------------------------GDVDLLE-FPINL..E---YLE..............AE
C6XUF0_PEDHD/62-202------------------------------------------AVTDVLN-FALAL..E---YLE..............YH
A6UK42_SINMW/43-207------------------------------------------EDEDVFQ-FALNL..E---YME..............AE
A0M2H1_GRAFK/67-200------------------------------------------SPTEVLN-FALTL..E---YLE..............RN
C7YU90_NECH7/49-187------------------------------------------TDPDILQ-FALTL..E---HLE..............ES
B0D1I8_LACBS/25-158------------------------------------------DDDTVLN-FALTL..E---YLE..............AD
C1A3R6_GEMAT/17-158------------------------------------------DVLDVLQ-FALLL..E---HLE..............AD
D2PR19_KRIFD/62-193------------------------------------------SDLDILN-YALTL..E---YLE..............AA
B8PIB6_POSPM/17-150------------------------------------------RDTSIMQ-YALNL..E---HIE..............LA
D2QMT3_SPILD/102-233------------------------------------------GDVGILN-YAFAL..E---QLE..............AA
Q01L47_ORYSA/55-222------------------------------------------SDVDLLE-FPLNL..E---YLE..............AE
C7P2F7_HALMD/55-195------------------------------------------TDVDVLN-YALTL..E---YLE..............DE
A8PGN7_COPC7/36-176------------------------------------------SDILVFK-FADVL..E---QLE..............SA
B6TNA6_MAIZE/60-227------------------------------------------SDMEQLQ-FLLNA..K---FVE..............AE
A9C0V0_DELAS/59-233------------------------------------------TDAEILN-FALNL..E---YLE..............SQ
B0RH45_CLAMS/61-230------------------------------------------TDLAVLN-FALNL..E---YLE..............AE
A6ED15_9SPHI/62-203------------------------------------------AVVDVLN-YALTL..E---YLE..............YH
A1DER8_NEOFI/31-168------------------------------------------GDVQVVQ-YAWAV..E---YMV..............QQ
Q8LAU8_ARATH/42-209------------------------------------------QDRKLLE-FPLNL..E---YLE..............AE
A8HQR8_CHLRE/27-199------------------------------------------LETAVLN-FALNL..E---YLE..............AN
D7VQN2_9SPHI/61-197------------------------------------------DVNGVLN-YALTL..E---YLE..............AE
B9L2W6_THERP/49-186------------------------------------------SVKEILD-IAVTA..E---AMA..............VT
A3XPH7_LEEBM/59-196------------------------------------------GDVGVLN-YAYAL..E---QLE..............AA
B7AB89_THEAQ/43-174------------------------------------------SDLDILQ-LALTA..E---YLA..............AD
B6H6V8_PENCW/27-158------------------------------------------SDADILN-YALTL..E---HLE..............AS
A5FJH3_FLAJ1/65-204------------------------------------------GDFGVLT-YAYAL..E---QLE..............AD
D3F6V1_CONWI/68-195------------------------------------------SDVRILN-YALTL..E---YLE..............AA
C5DDC7_LACTC/38-174------------------------------------------LDVDILQ-FALTL..E---RLE..............NK

PF14530

A0JUT6_ARTS2/252-380----------------------------------------------ALA-MTVKT--E---AET--------------VY
A0PQB9_MYCUA/25-162----------------------------------------------ALC-DALAV--E---HAT--------------IY
A0QVM1_MYCS2/20-157----------------------------------------------ALF-DAVAT--E---HGI--------------IY
A1R512_ARTAT/240-368----------------------------------------------ALA-AVVRS--Q---QEA--------------IY
A1T7H3_MYCVP/19-156----------------------------------------------ALF-DAIAT--E---HAT--------------IY
A1UER3_MYCSK/19-156----------------------------------------------ALY-DAIAT--E---HAA--------------IY
A4TCF5_MYCGI/24-161----------------------------------------------ALF-DALAA--E---HAT--------------IY
A4X4N2_SALTO/13-149----------------------------------------------AHT-AALTA--E---YAA--------------IW
A6W7Y8_KINRD/216-343----------------------------------------------ALQ-AALAG--E---HAA--------------VF
B1MD94_MYCA9/18-155----------------------------------------------ALA-NALAN--E---HAA--------------IY
B1VYP0_STRGG/20-150----------------------------------------------AVQ-AALAA--E---HAA--------------VY
B8HG51_ARTCA/255-383----------------------------------------------ALT-AVLQA--E---QQA--------------AY
B8ZRT8_MYCLB/28-165----------------------------------------------GLS-EALVV--E---HST--------------IY
C0ZYA0_RHOE4/13-150----------------------------------------------ALL-TAIES--E---NAA--------------IF
C4RD64_9ACTO/13-149----------------------------------------------ALA-GALAA--E---YAA--------------VF
C6WDL2_ACTMD/9-146----------------------------------------------AVQ-VGLGA--E---HAA--------------VW
C7MQU7_SACVD/183-320----------------------------------------------ALQ-SALAA--E---HAA--------------IW
C7QDY8_CATAD/3-133----------------------------------------------ALQ-TALGN--E---HAA--------------VY
C9Z255_STRSW/8-138----------------------------------------------AVQ-AALAA--E---HAA--------------VY
D0LBI3_GORB4/7-144----------------------------------------------ARN-AVADA--E---NAA--------------IF
D1AAG0_THECD/12-148----------------------------------------------ALQ-AALAA--E---HAA--------------VY
D1BJ70_SANKS/255-391----------------------------------------------DLV-TVVRA--E---DAA--------------GY
D2AXS6_STRRD/6-136----------------------------------------------GLG-TALAA--E---HAA--------------VY
D5ZUC6_9ACTO/16-146----------------------------------------------ALQ-AALAA--E---HAA--------------VY
D6M453_9ACTO/21-151----------------------------------------------AAE-AALRA--E---HAA--------------VY
D6XAR4_9ACTO/9-139----------------------------------------------ALQ-KALAA--E---HAA--------------VY
D6Y7V9_THEBD/21-152----------------------------------------------ALA-KALAA--E---HAA--------------VY
D7B4K2_NOCDD/18-148----------------------------------------------ALA-EALRA--E---HAA--------------VY
D7CAH0_STRBB/5-135----------------------------------------------ATQ-AALAA--E---HAA--------------VY
D8HX71_AMYMU/174-311----------------------------------------------PLQ-VALAA--E---HAA--------------MW
D9SXT1_MICAI/11-147----------------------------------------------ALA-DALAA--E---YAA--------------IW
D9V4I2_9ACTO/196-333----------------------------------------------SLQ-KALAA--E---HAS--------------LW
D9W0Z2_9ACTO/31-161----------------------------------------------AAQ-AALAA--E---HAA--------------AY
E2Q955_STRCL/34-164----------------------------------------------AVH-AALAA--E---HAA--------------VY
E4NHU9_KITSK/186-315----------------------------------------------ALQ-NALAA--E---HAA--------------VY
F0M7C1_ARTPP/267-395----------------------------------------------ALS-AAGAA--E---HQG--------------VY
Q47RV6_THEFY/19-148----------------------------------------------ALR-DALLA--E---HAA--------------VY

PF03405

STAD5_ORYSJ/60-388ALPTYQTMLNTLDGVRDETGASPTTWAVWTRAWTAEENRHGDLLNKYMY-LTGRVDMK---QIE--------------KT
STAD_GOSHI/66-395ALSTYQTMLNTLDGTRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLY-LSGRVDMR---QIE--------------RT
P92933_ASCSY/50-383ALPTYQSMINRLDGVKDETGACTSPWAIWTRAWTAEENRHGDLLKTYLY-LSGRVDMT---MID--------------KT
STAD_LINUS/65-394ALPTYQTMLNTLDGVRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLY-LSGRVDMR---QIE--------------KT
Q9XFC1_LUPLU/50-382ALPTYQSMINNLDGVRDETGSSPSPWALWTRAWTAEEKRHGDLLRTYLY-LSGRVDMK---KIE--------------KT
Q40879_PELHO/39-368ALPTYQTLVNRPDEVADETGHSESPWAVWSRAWTAEENRHGDLLNKYLY-LSGKLDMR---QVE--------------KT
Q50050_MYCLE/4-326NLPSYHREIAMTMGM...DGA....WGQWVNRWTAEENRHGIALRDYLV-VTRAVDPV---ELE--------------KL
STAD_SPIOL/69-397ALPTYQTMLNTLDGAKDETGASPTSWAVWTRAWTAEENRHGDLLNKYLY-LSGRVDMR---SIE--------------KT
Q41510_THUAT/59-387ALPTYQTMLNTTDVIYDESGASPVPWAVWTRAWTAEENRHGDIVNKYLY-LSGRVDMK---QIE--------------KT
STAD_CORSA/54-383ALPTYMSMLNRCDGIKDDTGAQPTSWATWTRAWTAEENRHGDLLNKYLY-LSGRVDMR---MIE--------------KT
Q43198_THUAT/60-388ALPTYQTMINTLDAVRDETGASLTPWAIWNRAWTAEENRHGDLLNKYLY-LSGRVDMK---QVE--------------KT

PF02332

MEMB_METTR/74-311GRPSWG...NESTELRTTD-------------WYRHRDPARRWHHPYVK-DKSEEA-R---YTQ--------------R.
MEMB_METCA/71-308GRPSWG...NETTELRTVD-------------WFKHRDPLRRWHAPYVK-DKAEEW-R---YTD--------------R.
TMOE_PSEME/53-278ASP...........LKHDN-------------WDAFTDPDQLVYRTYNL-MQDGQE-S---YVQ--------------S.
TMOA_PSEME/17-251EEQLFPERMSGHMGIPLEK-------------WESYDEPYKTSYPEYVS-IQREKD-A---GAY--------------S.
O07068_BURCE/17-252RKRTISASVERRVDIPMEK-------------WEGYDEPYKQTYPEYVR-VQREKD-S---GAY--------------S.
P95408_PSEAI/17-251EDELFPPELSGSFDIPMEK-------------WEAYDEPYKQTYPEYVK-VQREKD-A---GVY--------------S.
Q9R3H0_9GAMM/36-263NRTKYSTKYKMANDTK...-------------.....EQFKLIAKEYAR-MESVKD-E---RQF--------------GS
Q9ZNP6_COMTE/50-272FDT.......GRTAIRMAD-------------WNALRDPRQYYYATWTM-TRAKQQ-E---AME--------------A.
O87802_PSEST/56-281DSP...........LKHDD-------------WNAFRDPDQLVYRTYNL-LQDGQE-S---YVQ--------------G.
O07072_BURCE/54-281NSP...........LKHDD-------------WNAFRDPDQVIYRTYNL-MQDGQE-A---YVY--------------G.
Q9EZP0_BURCE/17-251ESELFPDIMTGAQGVPMET-------------WETYDEPYKTSYPEYVS-IQREKD-A---GAY--------------S.
Q53027_RHOCO/16-243RRPKFETKYKMPKKGK...-------------.....DPFRVLIRDYMK-MEAEKD-D---RTH--------------G.
O69182_CUPNE/55-280ASP...........LKHAD-------------WNAFRDPDELVYRTYNM-LQDGQE-T---YVS--------------G.
Q9RBP2_9NOCA/23-257PSEAFPASWSGAGDVPTEA-------------WDKWDEPFRVSYRDYVR-IQREKE-S---GVK--------------A.
O30592_BURPI/51-277YDA.......GRSRIRLAD-------------WQALKDPRQFYYATWTM-TRARQQ-E---AVE--------------A.
O87798_PSEST/17-251ENELFPEEMSGARGISMEA-------------WEKYDEPYKITYPEYVS-IQREKD-S---GAY--------------S.
O84959_9RALS/50-273YDK.......RRTAIEMAD-------------WYALKDPRQYYYGAYVG-TRGRQQ-E---AAE--------------K.
O32431_ACISP/29-260RKDAFP..YEEFEGIKITD-------------WSKWEDPFRLTMDNYWK-YQAEKE-K---KLY--------------A.
Q53025_RHOCO/50-281GRAPWE...EESSAVRTSE-------------WSAYRDPHQLWQRPYVS-TCNQDQ-Q---ALA--------------R.
Q9ZET3_XANP2/55-281EIA...........LKVDS-------------WDLFRDPDRTTYDTYVK-MQDDQE-T---YVD--------------N.
DMPL_PSEUF/50-273HDP.......TRTAIRMTD-------------WHKVTDPRQFYYGAYVQ-TRARMQ-E---ATE--------------H.
O87082_XANP2/17-251RAVAFPEEWKGEKDICGTA-------------WDDWDEPFRVSFREYVM-VQRDKE-A---SVG--------------A.
O32429_ACISP/50-273NDK.......THTALQMQD-------------WYAFKDPRQFYYGAYVQ-HRARLQ-D---TAE--------------S.

PF05138

C6BKZ7_RALP1/1-266ALILG--------------------------------------QRNA---------------------------------
A3M4C2_ACIBT/24-251.....--------------------------------------...A---------------------------------
Q5P3I7_AROAE/1-255ALILG--------------------------------------QRLS---------------------------------
A7IDQ6_XANP2/1-258ALILG--------------------------------------HRLS---------------------------------
Q28UP2_JANSC/1-252TLILG--------------------------------------HRLS---------------------------------
A4IPM8_GEOTN/1-277DFLLA--------------------------------------YRGS---------------------------------
A8GGD5_SERP5/1-253PLILA--------------------------------------QRLC---------------------------------
A9BS46_DELAS/26-317EIVGM--------------------------------------LPEG---------------------------------
Q1VT63_9FLAO/20-305EIVGM--------------------------------------LPEA---------------------------------
A1SLH6_NOCSJ/1-287EIIGM--------------------------------------QPEG---------------------------------
A4IPN0_GEOTN/1-291EIMGA--------------------------------------LPEK---------------------------------
Q63PZ2_BURPS/1-267ALILG--------------------------------------QRNA---------------------------------
A6VZX4_MARMS/1-253ALIHA--------------------------------------QRLC---------------------------------
Q5KRM4_CORGT/1-277SLMLA--------------------------------------QRLG---------------------------------
A1K268_AZOSB/1-256VLILG--------------------------------------QRIS---------------------------------
B2UJA5_RALPJ/1-316EVVGM--------------------------------------LPEG---------------------------------
Q8FRT9_COREF/1-278ALMLA--------------------------------------QRLG---------------------------------
Q2B8B4_9BACI/1-275DFILS--------------------------------------YRGS---------------------------------
Q1BRS9_BURCA/1-267ALILG--------------------------------------QRNA---------------------------------
Q82FA7_STRAW/1-239ALVLS--------------------------------------HRLG---------------------------------
Q92TG2_RHIME/1-261TLILG--------------------------------------HRLS---------------------------------
Q70IL9_9PSED/1-255AMVQA--------------------------------------QRLC---------------------------------
Q92TG1_RHIME/19-310EIVGQ--------------------------------------LPEG---------------------------------
A3YFB5_9GAMM/1-258NLILS--------------------------------------QRLC---------------------------------
A5W3A8_PSEP1/1-252ALVQG--------------------------------------QRLC---------------------------------
A6F429_9ALTE/1-254DMILG--------------------------------------QRLC---------------------------------
Q5SJN6_THET8/14-305EWVGM--------------------------------------LPEG---------------------------------
A6N3S0_ARTOX/1-313EIIGM--------------------------------------QPEA---------------------------------
Q2B8B6_9BACI/1-308EIMGA--------------------------------------LPEK---------------------------------
A3KI26_STRAM/1-262ALVLG--------------------------------------QRLC---------------------------------
Q46WB5_CUPPJ/1-280ALILG--------------------------------------QRNA---------------------------------
A2TU38_9FLAO/1-251SLILG--------------------------------------QRLG---------------------------------
Q1BRT1_BURCA/1-311EVVGM--------------------------------------LPEG---------------------------------
Q9Z9U8_BACHO/1-315EIMGA--------------------------------------LPEK---------------------------------
A1SSN8_PSYIN/1-292EIIGM--------------------------------------LPEA---------------------------------
A3JQN5_9RHOB/1-312EVIGM--------------------------------------LPEG---------------------------------
Q8FRU1_COREF/1-304EIIGM--------------------------------------QPEA---------------------------------
A4YR16_BRASO/1-258ALILG--------------------------------------HRLS---------------------------------
Q2L2P2_BORA1/1-311EIVGM--------------------------------------LPEG---------------------------------
A6CP08_9BACI/1-271DFIIA--------------------------------------YRGS---------------------------------
Q93JC5_STRCO/18-306EIIGM--------------------------------------QPEG---------------------------------
A3JQN7_9RHOB/1-250HMILG--------------------------------------HRLS---------------------------------
A0Z3K2_9GAMM/22-265DWVLG--------------------------------------HWYI---------------------------------
A3K7C2_9RHOB/45-284SLILG--------------------------------------HRIS---------------------------------
A3U7D6_CROAH/1-251SLILG--------------------------------------QRLG---------------------------------
A0Z940_9GAMM/5-298EVIGE--------------------------------------QPEG---------------------------------
Q5UWC7_HALMA/42-333EIMGA--------------------------------------FLER---------------------------------
A1K266_AZOSB/1-311EIVGM--------------------------------------LPEG---------------------------------
Q2BHR4_9GAMM/1-253SVVLG--------------------------------------HRIS---------------------------------
Q26EY3_FLABB/27-281YLILG--------------------------------------QRLG---------------------------------
A2SEG2_METPP/1-257TLILA--------------------------------------QRLG---------------------------------
Q47J43_DECAR/1-260ALVLG--------------------------------------QRNA---------------------------------
A4XC44_SALTO/13-267ALVAA--------------------------------------QRLA---------------------------------
Q5YXT2_NOCFA/1-305ALIAA--------------------------------------QRLS---------------------------------
Q9KGB1_BACHD/1-271DYIVA--------------------------------------YRGS---------------------------------
Q4KBZ2_PSEF5/1-253ALVQG--------------------------------------QRLC---------------------------------
A1BBH5_PARDP/7-270ALVLG--------------------------------------HRVS---------------------------------
A6ERY7_9BACT/1-251SLILA--------------------------------------QRLG---------------------------------
A3S9B1_9RHOB/1-240TLVLG--------------------------------------HRVS---------------------------------
Q13TE9_BURXL/1-267ALILG--------------------------------------QRNT---------------------------------
Q1GKX3_SILST/1-253TLILG--------------------------------------HRVS---------------------------------
Q1LHY3_RALME/1-285ALILG--------------------------------------QRNA---------------------------------
Q2ITX4_RHOP2/29-337EIVGM--------------------------------------LPEG---------------------------------
Q5NZZ0_AROAE/1-251ALVLS--------------------------------------QRLS---------------------------------
Q1VT65_9FLAO/1-251SMILG--------------------------------------QRIS---------------------------------
A0LUV5_ACIC1/1-302EIIGM--------------------------------------QPEA---------------------------------
Q5KYF6_GEOKA/1-267ELLSV--------------------------------------PPLL---------------------------------
Q6N3C8_RHOPA/1-258ALVLG--------------------------------------HRLS---------------------------------
Q0K5Z0_CUPNH/1-283ALVLG--------------------------------------QRNA---------------------------------
A3KIV0_STRAM/26-275ALVSA--------------------------------------QRLA---------------------------------
A5G1R9_ACICJ/12-269ALILG--------------------------------------HRLS---------------------------------
Q1AV63_RUBXD/1-272ELISA--------------------------------------PAYM---------------------------------
Q97WU6_SULSO/22-256EFASI--------------------------------------EQHM---------------------------------
A0JZX2_ARTS2/1-288ALILA--------------------------------------QRLG---------------------------------
Q5NZZ2_AROAE/19-310EIVGQ--------------------------------------LPEG---------------------------------
Q1IX21_DEIGD/1-302EVVGM--------------------------------------LPEG---------------------------------
A3VFT1_9RHOB/1-255TLILG--------------------------------------HRVS---------------------------------
A4BNV8_9GAMM/1-252ALILG--------------------------------------QRLT---------------------------------
A5V4A4_SPHWW/1-311EIVGM--------------------------------------LPEG---------------------------------
A7ZLI9_ECO24/1-291EIVGM--------------------------------------LPEG---------------------------------
A0Z3K5_9GAMM/15-294EVTVL--------------------------------------TWAY---------------------------------
Q67LH7_SYMTH/1-255ELVIG--------------------------------------HRDS---------------------------------
Q72K12_THET2/1-248EVVLA--------------------------------------QRLS---------------------------------
A1SSP0_PSYIN/1-252SFVLS--------------------------------------HRLA---------------------------------
Q21BH5_RHOPB/1-258ALVLG--------------------------------------HRLS---------------------------------
A3XCS6_9RHOB/1-257TLILG--------------------------------------HRVS---------------------------------
A3KI28_STRAM/77-392EIIGM--------------------------------------QPEG---------------------------------
Q845J4_9PSED/1-253ALIQG--------------------------------------QRLC---------------------------------
Q9RRV1_DEIRA/1-263EIVLA--------------------------------------HRGG---------------------------------
Q07SY8_RHOP5/1-258ALVLG--------------------------------------HRLS---------------------------------
B1YIJ0_EXIS2/13-313EIMGA--------------------------------------LPEK---------------------------------
A8LTI3_DINSH/1-255TLVLG--------------------------------------HRVS---------------------------------
Q0SCS4_RHOSR/47-309ALISS--------------------------------------QRLA---------------------------------
A7TCZ0_NEMVE/151-413AMIIG--------------------------------------HRLS---------------------------------
A1R9K9_ARTAT/49-305GLILA--------------------------------------QRLG---------------------------------
A8GGD3_SERP5/1-295EVVGM--------------------------------------LPEA---------------------------------
A0NQQ2_9RHOB/1-258ALVLG--------------------------------------HRVS---------------------------------
A4BNV6_9GAMM/1-310EIVGM--------------------------------------LPEG---------------------------------
A0LUV3_ACIC1/1-252ALILA--------------------------------------QRLS---------------------------------
A6T8I2_KLEP7/1-251GLVLA--------------------------------------QRLG---------------------------------
Q0K1H4_CUPNH/2-251TLVLG--------------------------------------QRLS---------------------------------
A1WPU7_VEREI/1-258CLILG--------------------------------------QRLA---------------------------------
A6N3S2_ARTOX/1-286ALILA--------------------------------------QRLG---------------------------------
A1SLH4_NOCSJ/1-247ALVAA--------------------------------------QRTG---------------------------------
Q19A69_PSEFL/19-311EIVGM--------------------------------------LPEG---------------------------------
PAAC_ECOLI/1-248CLVLS--------------------------------------QRLG---------------------------------
Q67LH5_SYMTH/1-299ELMGA--------------------------------------LPEK---------------------------------
A0Z938_9GAMM/1-252ALIMG--------------------------------------HRLS---------------------------------
A3M4C0_ACIBT/1-292EIVGM--------------------------------------LPEG---------------------------------
B1YIJ2_EXIS2/1-261DFLYA--------------------------------------YRGS---------------------------------
Q1IX23_DEIGD/1-268ELILA--------------------------------------HRDS---------------------------------
Q2BHR6_9GAMM/1-292EVIGM--------------------------------------QPEG---------------------------------
Q7WGX8_BORBR/1-254TLVLS--------------------------------------QRLG---------------------------------
A5V4A6_SPHWW/1-250SLILA--------------------------------------QRLC---------------------------------
B1KMA9_SHEWM/1-299EVIGM--------------------------------------QPEG---------------------------------
A3JBE4_9ALTE/1-254DMILS--------------------------------------QRLC---------------------------------
Q5LVE5_SILPO/19-310EVVGQ--------------------------------------LPEG---------------------------------

PF13794

Q9FBJ1_STRCO/44-228ELAAF--------------------------------------ERLA---------------------------------
A0JYP2_ARTS2/9-193ELSAF--------------------------------------ERFS---------------------------------
A4F8L9_SACEN/21-205ELSAF--------------------------------------DRLA---------------------------------

PF09968

A0B962_METTP/231-388LYESL--------------------------------------YERT---------------------------------
Q6M0S5_METMP/65-226VYLEL--------------------------------------YDIW---------------------------------
A6LNR3_THEM4/28-188VYLVF--------------------------------------YDLW---------------------------------
A6DDH3_9PROT/152-330IYMTL--------------------------------------YNLY---------------------------------
A7BLS9_9GAMM/110-270VYITL--------------------------------------YEVW---------------------------------
A3J1L2_9FLAO/41-200TYIYM--------------------------------------NNLW---------------------------------
A0L9X2_MAGSM/215-376VYLNL--------------------------------------YDRW---------------------------------
A6UVF0_META3/84-245VYLTL--------------------------------------YDKW---------------------------------
A6DCR0_9PROT/41-203VYLTL--------------------------------------GKKW---------------------------------
Q31I99_THICR/36-198VYLTL--------------------------------------YERW---------------------------------
A6DCQ9_9PROT/42-203VYLTL--------------------------------------YQKW---------------------------------
A3N331_ACTP2/49-209VYIHL--------------------------------------YNRW---------------------------------

PF06175

Q8DGE6_THEEB/14-210VAINL--------------------------------------MFRY.................................
Q8CX43_SHEON/3-250TAMFL--------------------------------------LRRYALNAESGQSLLAWAKPYEEFVYHKDRDIEQFLA
Q8YT06_NOSS1/3-199VALNF--------------------------------------MFRY.................................
Q9I2V2_PSEAE/4-199TAMQL--------------------------------------IGKYS................................
Q9KQT8_VIBCH/11-254SAMFL--------------------------------------IRKYAVDKESELSLLDWFKPYEDFAYRKIGDIQSLKG
MIAE_SALTY/21-264TALLL--------------------------------------VRKYVADKSGADALLSWLQPYEAFAFRQGPEPD....

PF00210

O51633_BORBU/17-163NLRGI--------------------------------------HWNI---------------------------------
C1L1L4_LISMC/10-156KIHQI--------------------------------------HWYM---------------------------------
Q7CVU6_AGRT5/29-171KTKNF--------------------------------------HWHV---------------------------------
FRI_AEDAE/47-192IYLKY--------------------------------------AAYF---------------------------------
A9L0T5_SHEB9/8-145QYFVH--------------------------------------AHMY---------------------------------
Q47H63_DECAR/8-145QYLIH--------------------------------------GEMY---------------------------------
Q7NS74_CHRVO/8-145QYFIH--------------------------------------AEMY---------------------------------
Q2W946_MAGSA/8-145QYFVH--------------------------------------SRMY---------------------------------
A6UZL6_PSEA7/8-144QYFIH--------------------------------------SRMY---------------------------------
A6VZ68_MARMS/8-145QYFIH--------------------------------------SRMY---------------------------------
A1K209_AZOSB/8-144QYFIH--------------------------------------SRML---------------------------------
Q5QYS8_IDILO/8-145QYTSH--------------------------------------SRQY---------------------------------
Q2RNM7_RHORT/8-145QYFVH--------------------------------------AHVY---------------------------------
A4C4I5_9GAMM/8-145QYLAH--------------------------------------SKLY---------------------------------
Q1R5Y6_ECOUT/8-144QYFLH--------------------------------------ARMF---------------------------------
A5VB21_SPHWW/8-144QYFLH--------------------------------------YRML---------------------------------
A1WVE6_HALHL/8-144QYFLH--------------------------------------SRLA---------------------------------
BFRB_NEIGO/8-144QYFLH--------------------------------------ARIL---------------------------------
A5WHB2_PSYWF/8-144QYFLH--------------------------------------ARIA---------------------------------
A6VZ67_MARMS/8-144QYFLH--------------------------------------ARMF---------------------------------
Q486V4_COLP3/8-144QYFLH--------------------------------------ARMY---------------------------------
A0KTR2_SHESA/8-144QYFLH--------------------------------------ARMF---------------------------------
Q6NE82_9PROT/8-144QYFLH--------------------------------------ARMM---------------------------------
Q1N3D5_9GAMM/8-144HYFLH--------------------------------------ARMF---------------------------------
Q5QYS9_IDILO/8-144QYFLH--------------------------------------ARMY---------------------------------
A6SUV4_JANMA/8-144QYFLH--------------------------------------ARMY---------------------------------
A3Q090_MYCSJ/8-144QYFLH--------------------------------------SKMQ---------------------------------
Q0RHP5_FRAAA/10-146QYFLH--------------------------------------SRMQ---------------------------------
Q091J6_STIAD/47-183EYFLH--------------------------------------ARIA---------------------------------
A0NS52_9RHOB/8-144QYWVH--------------------------------------ARLL---------------------------------
A3JWU8_9RHOB/8-144QYWLH--------------------------------------YRMQ---------------------------------
Q5NM50_ZYMMO/8-144QYFLH--------------------------------------ARSL---------------------------------
Q024H5_SOLUE/31-167QYLLH--------------------------------------AKVC---------------------------------
Q1EMI9_LEPBI/8-144QYFIH--------------------------------------AKLC---------------------------------
Q1IK36_KORVE/8-144QYFLH--------------------------------------AEMC---------------------------------
Q39UD7_GEOMG/8-144QYFVH--------------------------------------AEMC---------------------------------
Q1Q5F8_9BACT/8-143QYFVH--------------------------------------AKMC---------------------------------
A7HHQ5_ANADF/8-144QYLLH--------------------------------------ARMC---------------------------------
Q7VQF0_BLOFL/8-144QYFLH--------------------------------------SKLF---------------------------------
Q2GE61_NEOSM/7-143QYFIH--------------------------------------SKVL---------------------------------
A6CF83_9PLAN/8-144LYFIS--------------------------------------SKMC---------------------------------
Q73FS6_WOLPM/6-148QYLLH--------------------------------------FAIL---------------------------------
A3YZ38_9SYNE/11-147QYMTQ--------------------------------------ASLL---------------------------------
A4BLJ1_9GAMM/11-147QYSTQ--------------------------------------ARLL---------------------------------
Q0AHV3_NITEC/8-139QYLAQ--------------------------------------SVLA---------------------------------
Q3SFL0_THIDA/6-135QYMAQ--------------------------------------SRLC---------------------------------
A6FK64_9RHOB/8-144QYLLH--------------------------------------AHTL---------------------------------
A4A1Y7_9PLAN/7-143QYQLH--------------------------------------AAVL---------------------------------
Q0BUB9_GRABC/32-177ILKQA--------------------------------------HWNI---------------------------------
DPS_AGRT5/19-162VTKQA--------------------------------------HWNL---------------------------------
DPS_ACIAD/26-168LTKQA--------------------------------------HWNM---------------------------------
Q07GK9_ROSDO/17-162AVKQA--------------------------------------HWTI---------------------------------
Q2CAH6_9RHOB/18-159AVKQA--------------------------------------HWTV---------------------------------
Q0FT36_9RHOB/18-160AVKQA--------------------------------------HWNL---------------------------------
Q1DDZ6_MYXXD/18-163QIKQA--------------------------------------HWNI---------------------------------
Q3M4R5_ANAVT/26-170QAKQA--------------------------------------HWNV---------------------------------
A0LWG9_ACIC1/21-160QGKQA--------------------------------------HWNV---------------------------------
A1T8Z5_MYCVP/26-167QAKQA--------------------------------------HWNV---------------------------------
A4AGA8_9ACTN/36-176QGKQA--------------------------------------HWNV---------------------------------
A7BBG2_9ACTO/21-162VGKQL--------------------------------------HWNI---------------------------------
A3ZU64_9PLAN/20-161QAKQA--------------------------------------HWNV---------------------------------
A4QI42_CORGB/18-162ILKHV--------------------------------------HWNV---------------------------------
A1TH15_MYCVP/18-162TLKHV--------------------------------------HWNV---------------------------------
Q3KZ37_NOCSI/23-167TLKHV--------------------------------------HWNV---------------------------------
A4A8V0_9GAMM/21-165TLKHI--------------------------------------HWNV---------------------------------
A0AD01_STRAM/23-167TLKHV--------------------------------------HWNV---------------------------------
FTPA_HAEDU/44-188ILKHA--------------------------------------HWNV---------------------------------
DPS2_DEIRA/79-223QTKQA--------------------------------------HWNV---------------------------------
Q5WI06_BACSK/7-151KLHNY--------------------------------------HWYV---------------------------------
TPF1_TREPA/36-177KLHNY--------------------------------------HWHI---------------------------------
Q2IR77_RHOP2/9-147QTHGY--------------------------------------HWNV---------------------------------
Q1QGB4_NITHX/16-157KTQGF--------------------------------------HWNV---------------------------------
Q9A4G1_CAUCR/37-177KTHGY--------------------------------------HWNV---------------------------------
Q68VU3_RICTY/4-143KTQNY--------------------------------------HWNV---------------------------------
Q7NGR9_GLOVI/17-162KTKKY--------------------------------------HWDV---------------------------------
Q8DG54_THEEB/12-156NYKKY--------------------------------------HWLT---------------------------------
Q1J1Q0_DEIGD/77-222KFKKY--------------------------------------HWDI---------------------------------
Q9K3L0_STRCO/52-198LYKKY--------------------------------------HWLM---------------------------------
Q1IK59_KORVE/49-195LYKKC--------------------------------------HWQV---------------------------------
A3WEG4_9SPHN/13-158KSKNF--------------------------------------HWHI---------------------------------
A3ZY47_9PLAN/17-162KTKNF--------------------------------------HWHV---------------------------------
Q5HSQ2_CAMJR/4-149KFHNY--------------------------------------HWNV---------------------------------
A0RM57_CAMFF/5-145AFHDY--------------------------------------HWNV---------------------------------
Q8REM0_FUSNN/4-142KTHNL--------------------------------------HWNV---------------------------------
A5FAK1_FLAJ1/17-159NLRGI--------------------------------------HWNI---------------------------------
A3XLP6_LEEBM/15-157KLRNF--------------------------------------HWNV---------------------------------
Q1VZR4_9FLAO/15-159KLRNF--------------------------------------HWNV---------------------------------
Q4A6A8_MYCS5/1-137KAKNY--------------------------------------HWNV---------------------------------
Q04D79_OENOB/12-159NVQQT--------------------------------------HWYM---------------------------------
Q9FAA0_LACFE/7-153VVHQT--------------------------------------HWYM---------------------------------
Q82Z45_ENTFA/7-153VIHQT--------------------------------------HWYM---------------------------------
A8AW08_STRGC/25-171ALHQV--------------------------------------HWYM---------------------------------
Q03LA4_STRTD/26-172IVHQV--------------------------------------HWYM---------------------------------
Q74KF5_LACJO/7-153VVHQH--------------------------------------HWYM---------------------------------
Q1WRB2_LACS1/34-180KLHQY--------------------------------------HWYV---------------------------------
Q03SI7_LACBA/26-172KFHQV--------------------------------------RWSV---------------------------------
A0Z048_LYNSP/36-181QYQKH--------------------------------------HFVV---------------------------------
Q7NHH1_GLOVI/31-176QYQKH--------------------------------------HWVV---------------------------------
Q3IPN0_NATPD/30-175QIKKH--------------------------------------HWNV---------------------------------
Q67R42_SYMTH/16-162QYRKH--------------------------------------HWLT---------------------------------
BFR_DESDA/13-142QYMNQ--------------------------------------HYSL---------------------------------
Q1MQL3_LAWIP/15-151QYMNQ--------------------------------------HYNL---------------------------------
Q1IS71_KORVE/8-144QYMTQ--------------------------------------SEMC---------------------------------
A6DC96_9PROT/7-143QYMYF--------------------------------------HFIL---------------------------------
A6Q7E1_SULNB/6-142QYMYF--------------------------------------HFHC---------------------------------
Q1Q315_9BACT/9-146IYMDQ--------------------------------------HTKC---------------------------------
Q3ZXT0_DEHSC/7-137QYLGH--------------------------------------AY..---------------------------------
Q3B5B6_PELLD/17-161QYWIG--------------------------------------AKIV---------------------------------
Q2FMS4_METHJ/17-161QYWVG--------------------------------------SKVV---------------------------------
A6L680_BACV8/19-163QYWVG--------------------------------------SFVV---------------------------------
A9AJZ8_BURM1/50-192RYKRH--------------------------------------YFMA---------------------------------
A3DMK7_STAMF/7-139QYMWQ--------------------------------------HVLW---------------------------------
A0RUV2_CENSY/25-165YFTLL--------------------------------------RAHC---------------------------------
Q7NDE3_GLOVI/20-166YYTLL--------------------------------------RAHA---------------------------------
Q9YBZ3_AERPE/19-168YYMYT--------------------------------------ALAV---------------------------------
Q2RMD8_MOOTA/7-141QYIQH--------------------------------------ASLL---------------------------------
Q9K5J5_BACAN/9-143MYNHN--------------------------------------AATV---------------------------------
Q8ERY8_OCEIH/9-143QYTYS--------------------------------------ASVV---------------------------------
Q7UWW0_RHOBA/7-140QYSQA--------------------------------------SFII---------------------------------
A3ZR38_9PLAN/6-140QYSQA--------------------------------------GFVV---------------------------------
Q0AEZ2_NITEC/9-145RYTHY--------------------------------------SLMV---------------------------------
O66666_AQUAE/154-284DYLYH--------------------------------------FFHS---------------------------------
A6CI68_9BACI/7-140AYEHL--------------------------------------...I---------------------------------
Q67S14_SYMTH/6-143TYLGM--------------------------------------AAYC---------------------------------
B3EMU8_CHLPB/7-143LYLSM--------------------------------------ASYA---------------------------------
A8F5W0_THELT/7-144LYLSM--------------------------------------AAYF---------------------------------
Q73QJ4_TREDE/6-143LYLGM--------------------------------------AVHF---------------------------------
D1N6G1_9BACT/7-144IYLGM--------------------------------------AAAL---------------------------------
Q3A1G4_PELCD/7-144LYKAM--------------------------------------AAYF---------------------------------
Q8U2T8_PYRFU/7-144LYFAM--------------------------------------AAYF---------------------------------
A7HMU5_FERNB/7-144LYLSM--------------------------------------ATYF---------------------------------
A4WKQ8_PYRAR/321-458LYLSM--------------------------------------AAYF---------------------------------
Q1ASD6_RUBXD/14-151LYLSM--------------------------------------AGSF---------------------------------
A9B878_HERA2/7-144LYLSM--------------------------------------SAYF---------------------------------
A7NP42_ROSCS/7-144AYMAM--------------------------------------AAYF---------------------------------
Q6MCM0_PARUW/6-143LYLSI--------------------------------------ASYF---------------------------------
A8DR49_9BACT/7-144LYLSM--------------------------------------NAYF---------------------------------
A0LJP8_SYNFM/7-144LYLSM--------------------------------------ASHF---------------------------------
A1VDR6_DESVV/7-144MYLSM--------------------------------------SSYF---------------------------------
A5UNY9_METS3/7-144LYLSM--------------------------------------ASYF---------------------------------
Q2FQC4_METHJ/9-146LYLSM--------------------------------------SSWF---------------------------------
Q6AMM6_DESPS/7-144LYLSM--------------------------------------SAWL---------------------------------
A7ABY7_9PORP/8-145LYLSM--------------------------------------SVHF---------------------------------
O83010_PORGN/8-145LYLSM--------------------------------------SVHF---------------------------------
A6L3Z0_BACV8/7-144LYLSM--------------------------------------SYFF---------------------------------
Q8A8R0_BACTN/6-143LYLSM--------------------------------------SFYL---------------------------------
A7HD23_ANADF/7-144LYLGM--------------------------------------SAWC---------------------------------
A7VV91_9CLOT/7-144LYLDF--------------------------------------SNYY---------------------------------
Q97KS2_CLOAB/7-144FYLDI--------------------------------------HNYF---------------------------------
Q185Y2_CLOD6/7-141LYLSM--------------------------------------SSYL---------------------------------
A6UTU4_META3/7-144LYLSM--------------------------------------SAYT---------------------------------
Q6LY34_METMP/6-143LYLAM--------------------------------------SNYA---------------------------------
Q46E88_METBF/7-144LYLAM--------------------------------------SAYS---------------------------------
A6LMA2_THEM4/7-144LYLSM--------------------------------------AAHF---------------------------------
B9M5T0_GEOSF/7-144LYLSM--------------------------------------SSHA---------------------------------
Q1JW00_DESAC/7-144IYLSL--------------------------------------SAYC---------------------------------
A7C0L0_9GAMM/7-144FYLAM--------------------------------------SAYS---------------------------------
A6U2Z7_STAA2/7-144AYMAM--------------------------------------AAYC---------------------------------
Q5WLC3_BACSK/10-147DYMAM--------------------------------------AAYC---------------------------------
Q72Y25_BACC1/7-144AYMAM--------------------------------------AAYC---------------------------------
A7YTG3_FRATU/7-144IYLAM--------------------------------------AGYT---------------------------------
A5N4F2_CLOK5/7-144IYLAM--------------------------------------QAYF---------------------------------
Q899N4_CLOTE/7-144IYLAM--------------------------------------RAYC---------------------------------
A6TMX8_ALKMQ/7-144YYLAM--------------------------------------AAYC---------------------------------
Q8XLR2_CLOPE/7-144TYLAM--------------------------------------AAYA---------------------------------
B0KBX0_THEP3/7-144LYVAM--------------------------------------ENYF---------------------------------
A4XMZ6_CALS8/7-144FYTAM--------------------------------------EAYF---------------------------------
B8I3V4_CLOCE/7-144LYLGF--------------------------------------EAYF---------------------------------
A3DBC9_CLOTH/5-142IYATM--------------------------------------SAYL---------------------------------
A4ANB4_MARSH/7-144VYLSM--------------------------------------ASWA---------------------------------
A5WH54_PSYWF/11-148AYLSL--------------------------------------GVWA---------------------------------
A6EKF4_9SPHI/16-153IYLSM--------------------------------------ASWC---------------------------------
A5FM49_FLAJ1/16-153KYLAM--------------------------------------AAWL---------------------------------
A3HS92_9BACT/18-155YYLSM--------------------------------------ASWC---------------------------------
A1ZLT6_9BACT/28-165KYLAM--------------------------------------ASWC---------------------------------
A9A256_NITMS/8-145SYLAM--------------------------------------ASWC---------------------------------
Q7X3H8_TREHY/9-146LYFNM--------------------------------------AGWC---------------------------------
A0KRF7_SHESA/7-144LYLQM--------------------------------------SAWC---------------------------------
A6VPR5_ACTSZ/7-144LYLQM--------------------------------------SAWC---------------------------------
Q31JA0_THICR/7-144VYLQL--------------------------------------SAWC---------------------------------
Q9RNF8_HELPX/7-144LYMSM--------------------------------------SSWC---------------------------------
Q8D2Y7_WIGBR/7-144LYLQM--------------------------------------SSWC---------------------------------
Q1LTF7_BAUCH/7-144LYLQM--------------------------------------SSWC---------------------------------
A7MEF7_CROS8/7-144LCLYY--------------------------------------SDWC---------------------------------
FTNB_ECO57/7-144LYLHL--------------------------------------SNWC---------------------------------
A6FGT3_9GAMM/9-146LYRSM--------------------------------------ASFC---------------------------------
Q6A5N4_PROAC/8-146TYRQL--------------------------------------AIEA---------------------------------
Q4JX21_CORJK/8-145VYTQL--------------------------------------AYEL---------------------------------
Q8NMP2_CORGL/8-145VYLQL--------------------------------------SYVL---------------------------------
C0A2T5_9BACT/6-143MFLAL--------------------------------------KYWA---------------------------------
A1SHK2_NOCSJ/7-144QYLAC--------------------------------------AVYY---------------------------------
A4FJL2_SACEN/16-153QYLAM--------------------------------------AVWF---------------------------------
A1KQH6_MYCBP/12-149QYVAI--------------------------------------AVYF---------------------------------
A0K014_ARTS2/7-144QYIAI--------------------------------------AAWF---------------------------------
Q5Z3M1_NOCFA/11-148QYLAG--------------------------------------AVYF---------------------------------
Q0IB83_SYNS3/32-169AYFAA--------------------------------------AIWF---------------------------------
A3Z7J9_9SYNE/10-147AYFAA--------------------------------------AIWF---------------------------------
Q46LC4_PROMT/29-166QYLAM--------------------------------------SLWF---------------------------------
A2BW25_PROM5/30-167QYFSI--------------------------------------YLWF---------------------------------
A4CU24_SYNPV/6-143SYLSM--------------------------------------SIWC---------------------------------
A3YZ65_9SYNE/32-169TYFSL--------------------------------------AVWF---------------------------------
Q7V873_PROMM/5-142TYLAM--------------------------------------SIWL---------------------------------
Q7NC62_MYCGA/6-144MMFEY--------------------------------------SARI---------------------------------
Q14P78_SPICI/11-144..YNL--------------------------------------SSAA---------------------------------
O77232_SCHJA/38-173IYDHM--------------------------------------ASYL---------------------------------
Q17PG4_AEDAE/49-190TYLSM--------------------------------------SFHF---------------------------------
A1C334_DAPPU/14-155QYMAL--------------------------------------ASYY---------------------------------
A0S5U1_HYDVU/14-154QYLSM--------------------------------------AYHF---------------------------------
FRI_PACLE/13-154VYMSM--------------------------------------GHYF---------------------------------
Q0PKG0_HALDI/15-156TYQSI--------------------------------------GFYF---------------------------------
O96408_SCHJA/13-154VYMTM--------------------------------------ASHS---------------------------------
A8WNX6_CAEBR/13-154VYLSM--------------------------------------SAYF---------------------------------
FRIL1_MOUSE/14-155TYLSL--------------------------------------GFFF---------------------------------
FRI3_LITCT/14-155VYLSM--------------------------------------ASYF---------------------------------
Q6IQF1_DANRE/13-154VYLSL--------------------------------------GMYF---------------------------------
A7S8I5_NEMVE/90-231TYLSM--------------------------------------AAHF---------------------------------
Q0PKG1_HALDI/52-190VYLSM--------------------------------------AYWF---------------------------------
O15972_LIOJA/32-206LYHGY--------------------------------------ARYF---------------------------------
A2AHC5_MOUSE/17-158VYMSM--------------------------------------AVYF---------------------------------
Q9DAX0_MOUSE/17-158IYLSM--------------------------------------ASFC---------------------------------
A2VCJ5_CLOSI/9-150AYFAF--------------------------------------ASFY---------------------------------
FRIH2_SCHMA/15-156DYMAF--------------------------------------FTYF---------------------------------
Q9VYH1_DROME/25-165QYLAM--------------------------------------AYHF---------------------------------
Q2TQ27_CARRO/41-183IYMNM--------------------------------------AAHF---------------------------------
FRIY_LYMST/34-216IYQAY--------------------------------------ASYF---------------------------------
FRI1_PEA/88-233VYHSL--------------------------------------FAYF---------------------------------
A4RT97_OSTLU/17-162IYHAM--------------------------------------WAYF---------------------------------
Q9XFY2_CHLPR/83-228VYHAI--------------------------------------STYF---------------------------------
Q8SRN5_ENCCU/18-158FYSAC--------------------------------------AAHF---------------------------------
Q5MGP3_LONON/42-197QYLGM--------------------------------------ASHF---------------------------------
A8CW67_LUTLO/42-193TYLAM--------------------------------------GAYF---------------------------------
A8D916_BOMIG/44-196TYLAM--------------------------------------GAHF---------------------------------
Q9U0S2_NILLU/47-206IYLSL--------------------------------------GVHF---------------------------------
A1C331_DAPPU/38-183TYLAM--------------------------------------GAWA---------------------------------
Q16T40_AEDAE/40-186LYLKF--------------------------------------AAYF---------------------------------
Q5QBK7_9DIPT/55-208DHLLL--------------------------------------SVNF---------------------------------
Q52SA8_TRINI/26-176DYLLS--------------------------------------AAYF---------------------------------
Q9TVI4_CALET/56-206QYLLS--------------------------------------PAFF---------------------------------
Q8MUW9_APRGE/57-204HYLLM--------------------------------------ATHF---------------------------------
A8CW63_LUTLO/54-207EYLLL--------------------------------------SSKY---------------------------------
Q9BII4_9TREM/55-199TYDHL--------------------------------------AATC---------------------------------
Q3UWK9_MOUSE/14-152AYMFL--------------------------------------ACLY---------------------------------
ARTM_ARTSA/32-172HAWSM--------------------------------------WAFY---------------------------------

PF09537

A4G4I6_HERAR/9-119GFKSC--------------------------------------AEDL---------------------------------
B0KPC2_PSEPG/7-117GFKAS--------------------------------------ADDV---------------------------------
A0M5S8_GRAFK/6-116GYKLA--------------------------------------AEKV---------------------------------
A2TRU2_9FLAO/6-116GYKKA--------------------------------------AEKV---------------------------------
A4YW11_BRASO/1-110GYQEA--------------------------------------AGDA---------------------------------
Q2ISU3_RHOP2/4-113GYQEA--------------------------------------LEDA---------------------------------
Q476Y2_CUPPJ/7-117ACMAG--------------------------------------ARDV---------------------------------
Q08M54_STIAD/4-111TYRQA--------------------------------------SKHI---------------------------------
A3KTV6_PSEAI/8-118GFHAC--------------------------------------AEDL---------------------------------
Q3IYE5_RHOS4/13-121GFETM--------------------------------------VERA---------------------------------
A3DJV7_CLOTH/7-116GYERY--------------------------------------IQHV---------------------------------
Q07S33_RHOP5/4-113GYQEA--------------------------------------LEDA---------------------------------
Q3BVR2_XANC5/6-115FYEEA--------------------------------------AAKV---------------------------------
A5PE58_9SPHN/1-110GYRQA--------------------------------------GEKA---------------------------------
A2U3N9_9FLAO/7-117GFKNA--------------------------------------ADNI---------------------------------
Q07PC2_RHOP5/3-112GYQQG--------------------------------------LKDA---------------------------------
B5E925_GEOBB/5-113AYDQA--------------------------------------IRNV---------------------------------
Q2NBQ4_ERYLH/1-110GYRQA--------------------------------------ADNA---------------------------------
Q0FLV7_9RHOB/12-120WFEEM--------------------------------------AEKA---------------------------------
Q0SSJ9_CLOPS/8-117IFKRY--------------------------------------ETKC---------------------------------
A6EG78_9SPHI/6-118GFEKA--------------------------------------LADI---------------------------------
Q3M4J2_ANAVT/209-301ALEKY--------------------------------------TEKE---------------------------------
A9C130_DELAS/176-286GFRTS--------------------------------------SENA---------------------------------
Q0KB71_CUPNH/7-117ACMSG--------------------------------------ASEV---------------------------------
Q887I8_PSESM/7-117GFQTS--------------------------------------AENA---------------------------------
A3TIM1_9MICO/3-116GFTAA--------------------------------------ADKL---------------------------------
A3U6Z8_CROAH/24-134GYKQA--------------------------------------AENV---------------------------------
Q15NE8_PSEA6/5-115FYSDA--------------------------------------TEKV---------------------------------
Q023Z4_SOLUE/5-115GYTTA--------------------------------------AEHV---------------------------------
Q26B76_FLABB/6-116GYANA--------------------------------------AEIS---------------------------------
Q3IVZ0_RHOS4/11-119GFDTM--------------------------------------VEKA---------------------------------
Q8XXF1_RALSO/7-117SCSSG--------------------------------------AREV---------------------------------
Q3K810_PSEPF/7-117GFKTC--------------------------------------AEDI---------------------------------
A4XUK4_PSEMY/9-119GFKVC--------------------------------------AEDI---------------------------------
Q1N7C3_9SPHN/4-113GYEHS--------------------------------------AAKA---------------------------------
A1TM49_ACIAC/185-295GFRAS--------------------------------------AEHA---------------------------------
B2JMY7_BURP8/4-114GFMKA--------------------------------------AEEV---------------------------------
Q21P44_SACD2/29-139FYRAA--------------------------------------NQDV---------------------------------
B4SKE7_STRM5/6-115FYEEA--------------------------------------ATKV---------------------------------
Q2SCK1_HAHCH/5-115FYTEA--------------------------------------KDKV---------------------------------
B2TGN5_BURPP/4-114GFRKA--------------------------------------AEDA---------------------------------
Q2Y8P3_NITMU/5-115GFRTC--------------------------------------ADDI---------------------------------
Q1VAV2_VIBAL/4-114IYNKA--------------------------------------IENI---------------------------------
B0SY12_CAUSK/7-116GYAEA--------------------------------------AKDA---------------------------------
Q26G94_FLABB/6-116GYKLA--------------------------------------KEKV---------------------------------
A1VPM3_POLNA/175-285GFNTS--------------------------------------AEHT---------------------------------
A5V9B8_SPHWW/33-142GFDHV--------------------------------------AEQA---------------------------------
Q166R7_ROSDO/13-121GMERL--------------------------------------VEEA---------------------------------
A2U3Q7_9FLAO/6-116GYLNA--------------------------------------AENV---------------------------------
A5V2C1_SPHWW/29-137ACEAI--------------------------------------ARDA---------------------------------
A8MGM2_ALKOO/6-115SFNTF--------------------------------------IDRV---------------------------------
A3ZS58_9PLAN/10-120ALTDS--------------------------------------AAKV---------------------------------
A6B9D2_VIBPA/4-112IYKKA--------------------------------------IDNI---------------------------------
Q26D84_FLABB/15-125GYKNA--------------------------------------LTDV---------------------------------
A6EEM1_9SPHI/4-118GYEKA--------------------------------------IEEL---------------------------------
Q2BCF3_9BACI/5-106AYEHF--------------------------------------IEKL---------------------------------
A3XKU4_LEEBM/6-116GYKNA--------------------------------------AEKV---------------------------------
Q48MB3_PSE14/7-117GFHTS--------------------------------------AEDI---------------------------------
Q1D9W1_MYXXD/39-146TYRKA--------------------------------------IGHV---------------------------------
Q3IHE9_PSEHT/7-117FYEKA--------------------------------------QQNV---------------------------------
A5FJ39_FLAJ1/10-121GYTNA--------------------------------------AEHV---------------------------------
A3U8G4_CROAH/15-125GYKKA--------------------------------------MTDA---------------------------------
A6VRV2_MARMS/6-117FYQEA--------------------------------------KTKL---------------------------------
A4CGM0_ROBBH/6-116GYKLA--------------------------------------AEKV---------------------------------
A3XKU3_LEEBM/6-116GYKLA--------------------------------------EENV---------------------------------
A6SZY6_JANMA/4-114GFKTC--------------------------------------AEDI---------------------------------
Q7USR8_RHOBA/12-122GFHES--------------------------------------AEEL---------------------------------
Q1IRA5_KORVE/5-114GFREA--------------------------------------AEHF---------------------------------
A4WXB8_RHOS5/11-119GFDTM--------------------------------------VGKA---------------------------------
A4XNN6_PSEMY/3-113FYEHA--------------------------------------HDEV---------------------------------
A3W9J5_9SPHN/2-111GYRKA--------------------------------------VDKA---------------------------------
A4VP43_PSEU5/5-115GFLEC--------------------------------------AEDL---------------------------------
A2SFH6_METPP/5-115GFAKC--------------------------------------AERA---------------------------------
A3XNV9_LEEBM/11-121GFIKA--------------------------------------MQEI---------------------------------
Q4ZXE4_PSEU2/7-117GFRTS--------------------------------------AEHA---------------------------------
A6EG63_9SPHI/6-117GYEYA--------------------------------------AQTT---------------------------------
A3U4G7_CROAH/5-117GYKQV--------------------------------------ADKA---------------------------------
Q2CEG5_9RHOB/3-112GYETA--------------------------------------ASLA---------------------------------
A4A276_9PLAN/14-124GFRES--------------------------------------ADQI---------------------------------

PF07875

A4XMZ0_CALS8/5-68ALTNL--------------------------------------ILES---------------------------------
Q3EKQ4_BACTI/62-125KFAQV--------------------------------------AVEV---------------------------------
A5I1Q7_CLOBH/16-79AYLNA--------------------------------------TLTS---------------------------------
Q9K644_BACHD/133-196MLTTA--------------------------------------SLEA---------------------------------
A6M292_CLOB8/16-79SLAAA--------------------------------------AAEA---------------------------------
Q9KEV6_BACHD/15-78NIATA--------------------------------------ISES---------------------------------
Q0SWC3_CLOPS/2-65GYGGI--------------------------------------ISQC---------------------------------
Q97FP5_CLOAB/9-72SYSSG--------------------------------------ITES---------------------------------
A6CTZ8_9BACI/23-86SYCTA--------------------------------------LNEA---------------------------------
Q2BDD9_9BACI/15-78NLAMA--------------------------------------ITEA---------------------------------
A6BGT2_9FIRM/3-66RYGEM--------------------------------------ISQT---------------------------------
Q8ELM4_OCEIH/130-193LLAMT--------------------------------------AVEM---------------------------------
Q2BA87_9BACI/121-184QLSMA--------------------------------------ALEC---------------------------------
Q0AVR0_SYNWW/6-69TYAHC--------------------------------------ISET---------------------------------
Q65F68_BACLD/23-86AYSTA--------------------------------------LNEL---------------------------------
A6M290_CLOB8/10-73TLAKV--------------------------------------LTET---------------------------------
Q4MR30_BACCE/2-65SYANY--------------------------------------IAQS---------------------------------
A0Q278_CLONN/2-65KYGDI--------------------------------------ITQC---------------------------------
YRAF_BACSU/18-81NTAVA--------------------------------------LTET---------------------------------
A7Z1V3_BACA2/15-78NYAMA--------------------------------------ATEA---------------------------------
Q67MT8_SYMTH/17-80AYCAA--------------------------------------VLET---------------------------------
Q97FG0_CLOAB/16-79SLSTA--------------------------------------TCQT---------------------------------
A8FBD5_BACP2/117-180LLSMS--------------------------------------ALEV---------------------------------
A3I3H5_9BACI/121-184CMTAA--------------------------------------ATET---------------------------------
Q97JF1_CLOAB/102-165EYAWS--------------------------------------AMEM---------------------------------
A7Z2T2_BACA2/122-185LLTMS--------------------------------------SLEM---------------------------------
Q5WIT4_BACSK/122-185IKTNA--------------------------------------AMEA---------------------------------
A7GNZ9_BACCN/82-145YFAQV--------------------------------------AVEV---------------------------------
Q5KVI9_GEOKA/20-83SYSVF--------------------------------------LHEA---------------------------------
A6TLQ8_ALKMQ/10-73AYNTG--------------------------------------ITES---------------------------------
Q65CP9_BACLD/75-139NYAIA--------------------------------------ITET---------------------------------
A5I017_CLOBH/2-65GYSTV--------------------------------------ISET---------------------------------
YUSN_BACSU/22-85AYCTA--------------------------------------LHEF---------------------------------
Q8R816_THETN/8-71MLSHA--------------------------------------AVEA---------------------------------
A3DD47_CLOTH/2-65GYANA--------------------------------------IAQS---------------------------------
Q5L3H9_GEOKA/81-145NYAAA--------------------------------------ITEA---------------------------------
Q65JC0_BACLD/15-78NIATA--------------------------------------ITET---------------------------------
A1HNM7_9FIRM/9-72STNTY--------------------------------------ISET---------------------------------
YHCQ_BACSU/121-184MLTMA--------------------------------------SLEM---------------------------------
Q97LE8_CLOAB/15-78NYAVA--------------------------------------ITET---------------------------------
A5D0N6_PELTS/107-170RSTNA--------------------------------------ALEC---------------------------------
B8I7R4_CLOCE/101-164EYAWA--------------------------------------AMEA---------------------------------
A5N8T4_CLOK5/2-65AYSTG--------------------------------------ITET---------------------------------
Q65M26_BACLD/120-183SLAMA--------------------------------------APEV---------------------------------
A4IN35_GEOTN/19-82GCATA--------------------------------------LAEA---------------------------------
A7ZAR0_BACA2/78-142NYAGA--------------------------------------ITET---------------------------------
A5KJI1_9FIRM/2-65MFGDM--------------------------------------IPQT---------------------------------
Q3A9B7_CARHZ/6-69MYHTA--------------------------------------VMEA---------------------------------
Q97E03_CLOAB/16-79AYLNA--------------------------------------TLIS---------------------------------
Q8ES15_OCEIH/3-66SYAGY--------------------------------------ITEA---------------------------------
Q2RGX7_MOOTA/100-163MRMIA--------------------------------------ALEC---------------------------------
Q2RHK6_MOOTA/7-70CYNTA--------------------------------------ITEC---------------------------------
A9KJ50_CLOPH/6-69HYNTF--------------------------------------ANEC---------------------------------
Q252C4_DESHY/3-66FYANT--------------------------------------ISEC---------------------------------
A3DC40_CLOTH/17-80AYLTA--------------------------------------TLDT---------------------------------
COTF_BACSU/77-141SYAIA--------------------------------------ITET---------------------------------
Q67KL3_SYMTH/48-111GYNMA--------------------------------------LIEA---------------------------------
A6TVY2_ALKMQ/16-79AYLSA--------------------------------------TMTA---------------------------------
A4J5V2_DESRM/7-70CLTSK--------------------------------------ILEC---------------------------------
Q9K780_BACHD/21-84SYSIA--------------------------------------MNEA---------------------------------
A0RFR9_BACAH/75-139NYAIA--------------------------------------ITET---------------------------------
Q18CV2_CLOD6/16-79MYLNS--------------------------------------ALTS---------------------------------
B8D269_HALOH/15-78AYLNA--------------------------------------ALIS---------------------------------
A5Z919_9FIRM/6-69LYNLG--------------------------------------ANEC---------------------------------
A5D0C0_PELTS/3-66GYNMA--------------------------------------AIES---------------------------------

PF05974

Q7D2Y1_AGRT5/3-159AITKA--------------------------------------LPKV---------------------------------
A6CEX2_9PLAN/11-168RLVDA--------------------------------------LPKM---------------------------------
Q11AY7_MESSB/10-167QITKA--------------------------------------LPKM---------------------------------
Q11TD5_CYTH3/34-191ALTKA--------------------------------------IPKM---------------------------------
B9B5H5_9BURK/3-158HAQAL--------------------------------------LDAQ---------------------------------
Q89H23_BRAJA/1-158KIIKT--------------------------------------LPKM---------------------------------
A7ZZJ3_ECOHS/2-157QAESM--------------------------------------LESM---------------------------------
Q8PG92_XANAC/5-162QLTKS--------------------------------------LPRL---------------------------------
Q2N5V6_ERYLH/5-164QSLAL--------------------------------------TERL---------------------------------
Q11CH8_MESSB/7-164QVLRT--------------------------------------LPKM---------------------------------
A6T9K0_KLEP7/2-157QAESL--------------------------------------LVAT---------------------------------
Q47PX9_THEFY/5-162VIADM--------------------------------------LDEM---------------------------------
Q2RUN9_RHORT/4-159QAENI--------------------------------------LEKM---------------------------------
A3SZ42_9RHOB/27-186QSLDV--------------------------------------VVAL---------------------------------
A4A274_9PLAN/5-162QLLEA--------------------------------------LPKL---------------------------------
Q1IZK8_DEIGD/29-185QLTQA--------------------------------------LGQM---------------------------------
A6EG70_9SPHI/34-192HLVKA--------------------------------------LPKM---------------------------------
Q98GX4_RHILO/1-158KILAT--------------------------------------LPKM---------------------------------
E0TEY5_PARBH/5-164QSQKA--------------------------------------TEKL---------------------------------
Q7AEY0_ECO57/5-163QLTKA--------------------------------------LSKL---------------------------------
Q8PKL6_XANAC/3-158QAEQM--------------------------------------LKAQ---------------------------------
Q0BW11_GRABC/53-210QIVKA--------------------------------------LKKS---------------------------------
A4ELT9_9RHOB/5-164QAVDV--------------------------------------VTQL---------------------------------
Q2JZP1_RHIEC/6-163QILKA--------------------------------------LPKM---------------------------------
A7IKA4_XANP2/10-167RILKA--------------------------------------LPTM---------------------------------
Q1IMP2_KORVE/3-161QLVEA--------------------------------------LGKQ---------------------------------
A4WT57_RHOS5/10-166QIEKA--------------------------------------LPKM---------------------------------
B0U7G3_METS4/4-159QALQI--------------------------------------MERQ---------------------------------
Q18IC2_HALWD/5-160EILDL--------------------------------------HSDL---------------------------------
Q07RJ3_RHOP5/10-167QLVKA--------------------------------------LPKM---------------------------------
A6EH70_9SPHI/7-165KYEKA--------------------------------------FEQL---------------------------------
Q4UQ81_XANC8/5-160EAETM--------------------------------------MAAM---------------------------------
A4EK29_9RHOB/5-164QALDV--------------------------------------TSEM---------------------------------
Q7WNA6_BORBR/5-162QLTKA--------------------------------------LPKM---------------------------------
A5FEI3_FLAJ1/35-192ALTKA--------------------------------------LPAM---------------------------------
A7MLF2_CROS8/5-163QLTRA--------------------------------------LPKL---------------------------------
A3P9L7_BURP0/123-278HAETM--------------------------------------LKAQ---------------------------------
A5FGJ1_FLAJ1/57-214ALTKA--------------------------------------LPKM---------------------------------
Q92X71_RHIME/3-158QAITM--------------------------------------LTSQ---------------------------------
Q6WB78_ALCFA/7-162QAETM--------------------------------------LNSM---------------------------------
A3U308_9RHOB/5-161QFAEA--------------------------------------LPRF---------------------------------
Q2IZB5_RHOP2/8-165QILKA--------------------------------------LPKM---------------------------------
Q28Q87_JANSC/5-164QALDV--------------------------------------TDAM---------------------------------
Q6MCM2_PARUW/7-170QITEA--------------------------------------MPKL---------------------------------
Q98DP6_RHILO/10-167QIEKA--------------------------------------LPKM---------------------------------
B0UQL3_METS4/6-163AILKA--------------------------------------LPKM---------------------------------
Q1IVZ3_DEIGD/5-161QLLIA--------------------------------------LPVM---------------------------------
Q07KF9_RHOP5/256-415QLIKA--------------------------------------LPKM---------------------------------
C1DPA9_AZOVD/3-158QAESM--------------------------------------LTSM---------------------------------
A5PDQ9_9SPHN/10-168QMTKV--------------------------------------VRDL---------------------------------
B1Z9G7_METPB/5-160QGLEQ--------------------------------------MERQ---------------------------------
Q2KDJ5_RHIEC/6-163QILRA--------------------------------------LPKM---------------------------------
A6E9F0_9SPHI/20-174HLVSK--------------------------------------LPDL---------------------------------
A6X824_OCHA4/6-163KILKA--------------------------------------LPKM---------------------------------
Q01V03_SOLUE/6-163RIVDA--------------------------------------LPRM---------------------------------
A4YZ67_BRASO/4-159QAREL--------------------------------------MERQ---------------------------------
Q1YKQ2_MOBAS/13-170QIAKV--------------------------------------LPKM---------------------------------
Q1QGY5_NITHX/3-158QAVTM--------------------------------------LTSL---------------------------------
Q2RVL1_RHORT/10-167KILTA--------------------------------------LPKM---------------------------------
Q2IXU9_RHOP2/10-168QIIKA--------------------------------------LPTM---------------------------------
Q28UW6_JANSC/13-172QSLDV--------------------------------------TNDL---------------------------------
Q6MC28_PARUW/4-175QLIAL--------------------------------------LPKM---------------------------------
A6EDE5_9SPHI/9-167KFVKC--------------------------------------FAAL---------------------------------
A5EEQ8_BRASB/255-414QLTKA--------------------------------------LPKM---------------------------------
Q11CI8_MESSB/3-158QAEHM--------------------------------------LNGL---------------------------------
A3ZRB2_9PLAN/10-166QMAKA--------------------------------------LPKM---------------------------------
Q01UE6_SOLUE/4-161QLVKA--------------------------------------LPKM---------------------------------
A1B150_PARDP/5-162RILKA--------------------------------------LPRM---------------------------------
A3VE20_9RHOB/3-161QVLKT--------------------------------------LPKM---------------------------------
B0UBY3_METS4/4-159QGLSQ--------------------------------------MEHQ---------------------------------
Q8YZ72_NOSS1/15-173RFWEA--------------------------------------QQTM---------------------------------
Q1BVU6_BURCA/3-158QAETM--------------------------------------IDAQ---------------------------------
Q3SP74_NITWN/6-163KILSA--------------------------------------LPKM---------------------------------
A4WGM2_ENT38/5-158QILRA--------------------------------------LPKM---------------------------------
Q0FYD4_9RHIZ/5-164QSEKV--------------------------------------TREL---------------------------------
Q217H9_RHOPB/4-159QAREM--------------------------------------MERQ---------------------------------
A6UF79_SINMW/6-163KILKA--------------------------------------LPKM---------------------------------
B7KQ91_METC4/6-165QMART--------------------------------------VQQL---------------------------------
A7MK76_CROS8/3-158QAEQM--------------------------------------LESM---------------------------------
A3K1P1_9RHOB/10-169QAQKV--------------------------------------MDDL---------------------------------
B0UBY7_METS4/6-165QMAGA--------------------------------------IRQL---------------------------------
A4VLE8_PSEU5/10-165QAETM--------------------------------------LNKQ---------------------------------
Q98P06_RHILO/13-170KILKA--------------------------------------LPKM---------------------------------
Q11LJ1_MESSB/3-158QAITM--------------------------------------LSNL---------------------------------
A9W6G1_METEP/4-159QALQI--------------------------------------MERQ---------------------------------
A0LZC6_GRAFK/3-160QLLEA--------------------------------------LPEM---------------------------------
A6W5K1_KINRD/7-163DTLAM--------------------------------------LGDL---------------------------------
A0M7B4_GRAFK/3-160QLIKA--------------------------------------LPKM---------------------------------
Q3J5G6_RHOS4/9-166QILKA--------------------------------------LPKM---------------------------------
Q1QSM8_CHRSD/16-174QITRA--------------------------------------LPKL---------------------------------
Q0BW13_GRABC/6-161QAVEL--------------------------------------LQRQ---------------------------------
A4XUK0_PSEMY/3-158QAEKM--------------------------------------LTAQ---------------------------------
A4WQ47_RHOS5/3-158QALSI--------------------------------------MQPQ---------------------------------
A6V5Z0_PSEA7/3-158QAEQM--------------------------------------LKGQ---------------------------------
Q2RUE8_RHORT/5-162KILKA--------------------------------------LPKM---------------------------------
Q1INK4_KORVE/10-168QITKA--------------------------------------LPKL---------------------------------
B2JRX0_BURP8/24-181QMTKS--------------------------------------LPKM---------------------------------
Q1QJZ8_NITHX/8-165QILKA--------------------------------------LPRM---------------------------------
Q1QG59_NITHX/3-158HDVTM--------------------------------------LNSL---------------------------------
B0U8B5_METS4/7-163QSVRA--------------------------------------LKKS---------------------------------
A5FF55_FLAJ1/31-188ALVGA--------------------------------------LPKM---------------------------------
A4WDL1_ENT38/5-163QLTRG--------------------------------------LAKL---------------------------------
Q2KD03_RHIEC/258-417QLLKA--------------------------------------LPKM---------------------------------
A3WXM1_9BRAD/5-162QIYKS--------------------------------------LPKM---------------------------------
Q2JZN4_RHIEC/5-160QALSI--------------------------------------MKPQ---------------------------------
Q1YF89_MOBAS/5-164QSAKV--------------------------------------TREL---------------------------------
Q5FS57_GLUOX/10-165KAIET--------------------------------------ALSE---------------------------------
A3WF16_9SPHN/5-164QSLDA--------------------------------------TKKL---------------------------------
Q4ZL48_PSEU2/5-162QITKA--------------------------------------LPRL---------------------------------
Q01R92_SOLUE/3-162QLTDA--------------------------------------LPQM---------------------------------
A3UGS3_9RHOB/3-162QALSV--------------------------------------SKDL---------------------------------

PF12902

A0ZHB6_NODSP/18-250PYLTA--------------------------------------LYSL---------------------------------
A1X1N4_9BURK/613-836QYLYA--------------------------------------AYSI---------------------------------
A3HV98_9BACT/38-321QYLFT--------------------------------------SFSL---------------------------------
A3HZ39_9BACT/19-235PYLTA--------------------------------------NFTL---------------------------------
A3Y7W6_9GAMM/17-250FYMSA--------------------------------------MYSI---------------------------------
A4FHP6_SACEN/30-243LYMTA--------------------------------------MYSI---------------------------------
A4LG06_BURPE/20-228LYLSA--------------------------------------MFSL---------------------------------
A6ULY2_SINMW/16-247PYMTA--------------------------------------LYSI---------------------------------
A8M272_SALAI/669-906QYLYA--------------------------------------AYSV---------------------------------
A8ZLP5_ACAM1/23-242PYLIA--------------------------------------LWTI---------------------------------
B0C5X5_ACAM1/25-233PYLTA--------------------------------------AYSL---------------------------------
B0CT19_LACBS/234-434LYLYA--------------------------------------MYSI---------------------------------
B1KIQ0_SHEWM/17-245YYMSA--------------------------------------MYSI---------------------------------
E0ULS0_CYAP2/25-248PYLTA--------------------------------------FYSI---------------------------------
E0UKM8_CYAP2/76-306PYMTA--------------------------------------LYSI---------------------------------
B5HPH9_9ACTO/76-269PYLCG--------------------------------------WWSI---------------------------------
B7JXC8_CYAP8/18-243PYLTA--------------------------------------LYSL---------------------------------
B8PFV9_POSPM/149-342VF...--------------------------------------....---------------------------------
B9NM45_9RHOB/334-495QYLYA--------------------------------------YFSL---------------------------------
D2S599_GEOOG/25-233PYLTA--------------------------------------YYTL---------------------------------
D7W1T5_9FLAO/113-372PYLTA--------------------------------------LYSI---------------------------------
C7QG40_CATAD/22-236PYMCA--------------------------------------LYSL---------------------------------
C7PJ64_CHIPD/65-298QYLYA--------------------------------------AYSL---------------------------------
C6W0G0_DYAFD/25-230PYLTA--------------------------------------MFSL---------------------------------
D0LW11_HALO1/25-246AYLYA--------------------------------------AFSI---------------------------------
C3KD44_PSEFS/15-238LYMTP--------------------------------------LISI---------------------------------
C3XXN2_BRAFL/2783-3028PYLSA--------------------------------------IFSI---------------------------------
C3ZZV2_BRAFL/3683-3925PYLTA--------------------------------------MFSI---------------------------------
Q0H2X4_9ACTO/620-853QYLYA--------------------------------------AYSV---------------------------------
Q0RHC0_FRAAA/25-238PYLCA--------------------------------------QWSV---------------------------------
Q27IF3_9ACTO/618-871QYLYA--------------------------------------AYTV---------------------------------
Q7USU6_RHOBA/51-263QYLYT--------------------------------------AYSI---------------------------------
Q8GRF3_9ACTO/686-926QYLYA--------------------------------------AYSV---------------------------------
Q8KHV6_NOCAE/602-842QYLYA--------------------------------------AFSI---------------------------------
Q9AAP0_CAUCR/14-241YYLTV--------------------------------------LYSI---------------------------------
Q9FBT7_STRCO/27-241PYLTA--------------------------------------LYSL---------------------------------
Q9RJF6_STRCO/71-265PYLCG--------------------------------------WWSV---------------------------------
VIOB_CHRVO/605-828QYLYA--------------------------------------AYSI---------------------------------

PF13628

B9M9A2_GEOSF/32-168MMEVE--------------------------------------LGQL---------------------------------
D8JRV0_HYPDA/27-169DIDVK--------------------------------------AGQL---------------------------------
B5EEU3_GEOBB/29-165MMEVE--------------------------------------AGRL---------------------------------
D5WLB6_BURSC/27-169QVDID--------------------------------------AGKL---------------------------------
B2J1E3_NOSP7/67-203LAEVQ--------------------------------------LGQL---------------------------------
Q46RG7_CUPPJ/74-211TMEIE--------------------------------------ASKL---------------------------------
B9XLH1_9BACT/39-176MTEVE--------------------------------------LGQL---------------------------------
B1ZNP6_OPITP/29-171QVDVD--------------------------------------AGKL---------------------------------
B4CUJ0_9BACT/35-171VTEIQ--------------------------------------SAQM---------------------------------
B9TGV0_RICCO/88-225HTEVE--------------------------------------ASKI---------------------------------
E0UH58_CYAP2/56-192MAEVK--------------------------------------LGQL---------------------------------
B8IFB9_METNO/26-168QIDIK--------------------------------------AAEL---------------------------------
Q2Y8Y8_NITMU/29-171TADIE--------------------------------------NGNL---------------------------------
A5XZ63_BURML/27-169QVDID--------------------------------------AGKL---------------------------------
Q2K1W8_RHIEC/36-173MFEIA--------------------------------------SSKL---------------------------------
Q89S47_BRAJA/47-189VIDIN--------------------------------------AAKQ---------------------------------
Q475E9_CUPPJ/38-175TMEIA--------------------------------------ASRL---------------------------------
Q2JYM6_RHIEC/26-168QIDVT--------------------------------------AAEQ---------------------------------
B7XMG6_ENTBH/26-161ITEVE--------------------------------------AGKL---------------------------------
B1SYH2_9BURK/28-170QVDID--------------------------------------AGKL---------------------------------
B2JWH1_BURP8/26-168QVDID--------------------------------------AGKL---------------------------------
E3I358_RHOVT/31-167LFEIQ--------------------------------------AAYI---------------------------------
Q983W7_RHILO/27-169VLDIE--------------------------------------AAKQ---------------------------------
B2JMY4_BURP8/40-174ATEIA--------------------------------------ASKL---------------------------------
C6BHV4_RALP1/37-174MLEVQ--------------------------------------ASQA---------------------------------
B4RD58_PHEZH/36-178ELDIA--------------------------------------AGRQ---------------------------------
B2TGN9_BURPP/45-179ATEIA--------------------------------------ASKV---------------------------------
A5ET49_BRASB/16-158EIDIK--------------------------------------AAKQ---------------------------------
C6W7B7_DYAFD/46-182MMEVQ--------------------------------------LGEL---------------------------------
B1Z4Z9_BURA4/61-196KAEVQ--------------------------------------ASQL---------------------------------
A6WYV3_OCHA4/28-170AIDVA--------------------------------------AAKQ---------------------------------
A4VIW1_PSEU5/27-163IAEIE--------------------------------------TAKM---------------------------------
C6VVL2_DYAFD/52-188LAEVQ--------------------------------------LGKI---------------------------------
D2QCP5_SPILD/50-187MMEVE--------------------------------------LGRM---------------------------------
A5W3E5_PSEP1/25-160IAEVV--------------------------------------TGNL---------------------------------
F0QBL1_ACIAP/59-196HAEVK--------------------------------------SSQL---------------------------------
B3R194_CUPTR/37-174QMEID--------------------------------------ASKL---------------------------------
Q5NXZ0_AROAE/83-220LAEVE--------------------------------------ASRL---------------------------------
C0INK3_9BACT/23-165QIDIS--------------------------------------YAAI---------------------------------
A8I5I1_AZOC5/73-211MFEIE--------------------------------------SAKL---------------------------------
B1Z9Q1_METPB/40-177MFENQ--------------------------------------SSKL---------------------------------
E8S4J3_MICSL/32-168LFEIT--------------------------------------AGNL---------------------------------
A6V653_PSEA7/32-167VAEIE--------------------------------------AGKM---------------------------------
Q1IQR0_KORVE/28-170KIDID--------------------------------------TAHI---------------------------------
A2WJB2_9BURK/59-195KTEVQ--------------------------------------ASQL---------------------------------
A9EY26_SORC5/67-203LLEVR--------------------------------------LGQL---------------------------------
A6EII6_9SPHI/56-192MMEVE--------------------------------------AGKI---------------------------------
Q210M7_RHOPB/37-173LFETG--------------------------------------SAKL---------------------------------
C6XDF2_METSD/33-170KAEIA--------------------------------------ASEM---------------------------------
A8EAJ0_BURPE/58-193KSEVQ--------------------------------------AGQL---------------------------------
A9HSC1_GLUDA/37-173AFEIA--------------------------------------TANL---------------------------------
A1K296_AZOSB/48-185QVEIE--------------------------------------GSRL---------------------------------
Q4ZL47_PSEU2/25-161IAEVQ--------------------------------------VGKL---------------------------------
B2FDC1_RHIME/28-164LFEME--------------------------------------AAKL---------------------------------
A1K6J4_AZOSB/48-184LGEVE--------------------------------------AGHL---------------------------------
C7PV19_CHIPD/48-184MLEVQ--------------------------------------AGKL---------------------------------
A3WXM9_9BRAD/46-182LAEVD--------------------------------------LGKL---------------------------------
A4YPU2_BRASO/40-175LSEVN--------------------------------------MGKL---------------------------------
A4CGT8_ROBBH/26-168QIDIE--------------------------------------FAEM---------------------------------
C1DPB0_AZOVD/26-162IAEIE--------------------------------------SGKL---------------------------------
C4WP31_9RHIZ/50-187MFEIE--------------------------------------SSKL---------------------------------
Q3SKS8_THIDA/41-177LAEVE--------------------------------------VGKI---------------------------------
Q2RUP1_RHORT/26-161LFEVE--------------------------------------SSKL---------------------------------
E6VQ01_RHOPX/36-173MYEIQ--------------------------------------SNQL---------------------------------
Q07KD9_RHOP5/36-173MFEIN--------------------------------------SAKL---------------------------------
E1TJA8_BURSG/45-179ATEIA--------------------------------------ASKV---------------------------------
A6UMR2_SINMW/24-160MFEIQ--------------------------------------SSQL---------------------------------
Q2IXV0_RHOP2/36-173MFEIQ--------------------------------------SNKL---------------------------------
C6B7S0_RHILS/38-175MFEIE--------------------------------------SSKL---------------------------------
A5VBV5_SPHWW/29-171AIDID--------------------------------------AGKL---------------------------------
B4R7U0_PHEZH/55-191MYEIQ--------------------------------------AGEM---------------------------------
A4X9Y5_SALTO/32-168LFEIS--------------------------------------KGEM---------------------------------
A4YTJ9_BRASO/36-173MFELQ--------------------------------------SNKL---------------------------------
C6X5B6_FLAB3/62-198MTEAM--------------------------------------LGQL---------------------------------
Q2IZZ6_RHOP2/43-180LFELA--------------------------------------TARL---------------------------------
A4XUL6_PSEMY/32-167VAEIE--------------------------------------TAKL---------------------------------
A1W2W2_ACISJ/28-163LYEVQ--------------------------------------AGKL---------------------------------
A8HXW5_AZOC5/37-175LFEIE--------------------------------------AAKL---------------------------------
A4WXT6_RHOS5/92-229MFEIE--------------------------------------SSRL---------------------------------
Q3KBI4_PSEPF/25-166IAEIE--------------------------------------TSRL---------------------------------
B0T245_CAUSK/55-193MYEIE--------------------------------------AAKL---------------------------------
D5WLX4_BURSC/38-172STEID--------------------------------------AAKL---------------------------------
B1G845_9BURK/54-190TAEID--------------------------------------LGQL---------------------------------
Q7WM56_BORBR/46-182HLEVE--------------------------------------GSKL---------------------------------
B1G087_9BURK/38-172STEID--------------------------------------ASKL---------------------------------
B8EIS3_METSB/37-174MFEIK--------------------------------------SSRL---------------------------------
B9B0D3_9BURK/83-218KTELL--------------------------------------ASQL---------------------------------
A7HWP1_PARL1/40-178LFEIQ--------------------------------------SSEI---------------------------------
Q2IP97_ANADE/111-254LSEVQ--------------------------------------MGEM---------------------------------
B3Q5A8_RHIE6/48-184LAEVE--------------------------------------LGKM---------------------------------
C6VZG6_DYAFD/31-167LFEIK--------------------------------------AGEL---------------------------------
D2ZGE9_9ENTR/52-189INEVA--------------------------------------AAKI---------------------------------
Q6N5I2_RHOPA/73-210LFETA--------------------------------------SARL---------------------------------
C7JB67_ACEP3/36-171IFEIQ--------------------------------------SSQQ---------------------------------
A7H8S3_ANADF/104-247QGEVQ--------------------------------------IAEL---------------------------------
B8H682_CAUCN/79-216MFEIE--------------------------------------AAKL---------------------------------
E1TCF2_BURSG/40-174ATQRD--------------------------------------AARI---------------------------------
C5AE76_BURGB/65-200KREVQ--------------------------------------ASQL---------------------------------
A2WFV6_9BURK/45-179STQHD--------------------------------------AARI---------------------------------
A9GDI6_SORC5/85-228KKEID--------------------------------------EAQL---------------------------------
A5VGP0_SPHWW/46-184AFEIE--------------------------------------TSKL---------------------------------
C6XDG6_METSD/26-163VMEME--------------------------------------FNRL---------------------------------
C7PPP6_CHIPD/45-181LKEIE--------------------------------------LGKL---------------------------------
B2H110_BURPE/47-181STQRD--------------------------------------AARI---------------------------------
Q5LX51_SILPO/25-167QLDIR--------------------------------------YAHL---------------------------------
C1CZB6_DEIDV/40-176LTEIA--------------------------------------TSRL---------------------------------
A5V2I5_SPHWW/61-199AFEIA--------------------------------------AARV---------------------------------
B1ZWK7_OPITP/63-194MEEVA--------------------------------------LSKL---------------------------------
Q0BSG9_GRABC/35-171LAEVQ--------------------------------------AGDL---------------------------------
B4W7Y0_9CAUL/55-193MYEIE--------------------------------------AAKV---------------------------------
A9IMD9_BORPD/32-169LFELR--------------------------------------AGDL---------------------------------
C3X6U1_OXAFO/26-168KAEIE--------------------------------------TSKL---------------------------------
A6EC23_9SPHI/68-203MTQIS--------------------------------------AARM---------------------------------
Q3KGN9_PSEPF/27-163MADIE--------------------------------------ASRL---------------------------------
C6B942_RHILS/26-162MFEIE--------------------------------------AAKI---------------------------------
D2QJS3_SPILD/61-198MMQLE--------------------------------------VSRL---------------------------------
Q2JZN3_RHIEC/26-162MFEVD--------------------------------------AAKI---------------------------------
C3X783_OXAFO/52-194KAQIE--------------------------------------TAQI---------------------------------
B5WV33_9BURK/27-168QAEIA--------------------------------------AAQT---------------------------------
D2PPQ1_KRIFD/35-171LAEIA--------------------------------------TGKL---------------------------------
C6W1M4_DYAFD/32-168LYQVN--------------------------------------AGKV---------------------------------
Q4UUM7_XANC8/84-221TSEIN--------------------------------------AANL---------------------------------
A4F0L3_9RHOB/59-201QIDIR--------------------------------------YAHL---------------------------------
B9KN92_RHOSK/33-169LFGVE--------------------------------------ASET---------------------------------
D9QKZ8_BRESC/54-192MYELA--------------------------------------AADI---------------------------------
B2JML1_BURP8/48-182ATQRD--------------------------------------AARI---------------------------------
Q2IPC5_ANADE/58-201AFEVD--------------------------------------AGQL---------------------------------
A6EI02_9SPHI/96-235MMESN--------------------------------------ISKI---------------------------------
Q8PKY1_XANAC/43-180TSEVN--------------------------------------AANL---------------------------------
Q7NGC4_GLOVI/47-190VRELA--------------------------------------LAEV---------------------------------
Q1NI17_9SPHN/59-197LFEIE--------------------------------------SSKA---------------------------------
C3KDG8_PSEFS/41-177MADIE--------------------------------------TSRM---------------------------------
Q1H3J6_METFK/38-175ILQIE--------------------------------------ASEL---------------------------------
Q9RUK1_DEIRA/23-161NFEIE--------------------------------------AAKL---------------------------------
Q7NHN8_GLOVI/69-212IRQIA--------------------------------------LAQL---------------------------------
Q5FUH2_GLUOX/43-180QTQIA--------------------------------------IATL---------------------------------
B0UDQ0_METS4/45-193SLALA--------------------------------------ASRL---------------------------------
Q1D3N0_MYXXD/108-250AGEVM--------------------------------------LGQV---------------------------------
A9GLZ6_SORC5/143-281QKEVD--------------------------------------LSQI---------------------------------
Q02LP9_PSEAB/21-152QAQVE--------------------------------------AAEQ---------------------------------
B6IR05_RHOCS/41-177LGELA--------------------------------------QVEL---------------------------------
C6XZD3_PEDHD/100-224QIEVK--------------------------------------RSEN---------------------------------
Q3BN66_XANC5/52-193DNEIA--------------------------------------LAKQ---------------------------------
B6QZY9_9RHOB/36-167PFSLA--------------------------------------ISEM---------------------------------

PF05067

YJQC_BACSU/1-278QYLFQ--------------------------------------GFNC---------------------------------
Q9I1T0_PSEAE/1-294RYFTQ--------------------------------------GLGE---------------------------------
Q9KAU6_BACHD/1-281QYLFQ--------------------------------------GWNT---------------------------------
COTJC_BACSU/1-189RYLNQ--------------------------------------RYTI---------------------------------
Q9KDZ2_BACHD/1-298NYMYQ--------------------------------------SFNF---------------------------------
MCAT_BACSU/1-273QYLFQ--------------------------------------GWNT---------------------------------

PF03713

A8LVC1_SALAI/31-177QGLEL--------------------------------------VGLA---------------------------------
Q5YML7_NOCFA/57-220QAVEM--------------------------------------SATA---------------------------------
Q6XN35_RHOER/37-208QAVEM--------------------------------------SSLA---------------------------------
A6W729_KINRD/39-201QAVAM--------------------------------------AYTA---------------------------------
Q5Z101_NOCFA/55-219QAVEM--------------------------------------AGIA---------------------------------
Q0SGM9_RHOSR/61-227QAVEM--------------------------------------SAIA---------------------------------
A4FN49_SACEN/88-259QAVTM--------------------------------------ATLA---------------------------------
A4FE15_SACEN/46-216QAAEL--------------------------------------ASLA---------------------------------
Q5YWT9_NOCFA/45-201QALLM--------------------------------------ADRL---------------------------------
Q0SK07_RHOSR/51-206QAVLI--------------------------------------AQTL---------------------------------
A3TIC0_9MICO/54-213QAVQM--------------------------------------SLLI---------------------------------
Q6SK75_ARTAU/34-199QAVDM--------------------------------------SMIV---------------------------------
A4AKP7_9ACTN/51-214QAIEM--------------------------------------STII---------------------------------
Q47S90_THEFY/23-182QAVEM--------------------------------------ALII---------------------------------
Q82AV5_STRAW/43-199QAVEM--------------------------------------SYIV---------------------------------
A4XAY7_SALTO/62-216QAVEM--------------------------------------GLIA---------------------------------
A0AW55_ARTS2/62-226QAVEM--------------------------------------ALLI---------------------------------
A6WGU5_KINRD/112-290QAVQM--------------------------------------SVLV---------------------------------
Q0RCA7_FRAAA/59-245QAVQM--------------------------------------AMIE---------------------------------
A8KZW0_FRASN/79-262QAVQM--------------------------------------AMVE---------------------------------
A4AKP3_9ACTN/56-207QALAM--------------------------------------CQRV---------------------------------
A6GQF3_9BURK/49-215QAIQM--------------------------------------SMMM---------------------------------
A1SNX0_NOCSJ/32-195QGLRM--------------------------------------VAMT---------------------------------
A1SDH4_NOCSJ/59-212QALAM--------------------------------------VDQT---------------------------------
Q1BFR6_MYCSS/55-200QALQL--------------------------------------VDLA---------------------------------
A4T3N9_MYCGI/55-203QGIEL--------------------------------------AKLV---------------------------------
A1T1H5_MYCVP/54-201QAIDL--------------------------------------SRTA---------------------------------
Q0RS99_FRAAA/44-228QAIEM--------------------------------------AELA---------------------------------
Q5YMP0_NOCFA/64-211QAIQM--------------------------------------ADLV---------------------------------
A3TRU4_9MICO/44-193QAVLM--------------------------------------AKMA---------------------------------
Q0JWQ8_STRAM/60-205QAVEM--------------------------------------ADLA---------------------------------
Q82E39_STRAW/71-222QAVEM--------------------------------------AELA---------------------------------
A6WGV6_KINRD/98-261GAIEM--------------------------------------AQMA---------------------------------
A3TK32_9MICO/55-197QAVEM--------------------------------------ADMA---------------------------------
Q5YT33_NOCFA/59-206QAVEM--------------------------------------AALV---------------------------------
A1TDH2_MYCVP/59-210QAIVM--------------------------------------SDII---------------------------------
A4T8S2_MYCGI/67-217QAIVM--------------------------------------SDII---------------------------------
Q1BC35_MYCSS/58-226QAVEM--------------------------------------SDML---------------------------------
A0R280_MYCS2/52-198QAVEM--------------------------------------SDII---------------------------------
Q1B113_MYCSS/53-222QAIEM--------------------------------------SDMV---------------------------------
A0K235_ARTS2/57-202QAVEM--------------------------------------SDMM---------------------------------
A4AG55_9ACTN/49-193QAVDM--------------------------------------ADLV---------------------------------
Q8NLI1_CORGL/71-217QAVEM--------------------------------------SEIL---------------------------------
A1UPV4_MYCSK/41-184QAIEM--------------------------------------SDLV---------------------------------
Q2N5S7_ERYLH/58-210QAVAM--------------------------------------TALV---------------------------------
A5PA80_9SPHN/57-209QAVDM--------------------------------------AQLV---------------------------------
A3UC46_9RHOB/55-216QAVEM--------------------------------------AELV---------------------------------
A3WF42_9SPHN/68-231QAVEM--------------------------------------AQLV---------------------------------
Q0ATP4_MARMM/56-229QAVAM--------------------------------------GELI---------------------------------
Q022J2_SOLUE/61-225QAVEM--------------------------------------VDLL---------------------------------
A4X6R2_SALTO/79-221QALEM--------------------------------------SELV---------------------------------
Q0H2Y8_SACER/71-240QALEM--------------------------------------TALA---------------------------------
Q9K3P2_STRCO/76-218QALKM--------------------------------------TELA---------------------------------
A3TNA7_9MICO/73-222QAIVM--------------------------------------VETV---------------------------------
Q9RVD0_DEIRA/33-176QALDL--------------------------------------AAPM---------------------------------
B0U8H5_METS4/225-369QGIVL--------------------------------------ARLA---------------------------------
Q9RRN7_DEIRA/55-183MALDM--------------------------------------AGQE---------------------------------
Q1J3D3_DEIGD/62-202SAIEM--------------------------------------SRAA---------------------------------
Q1J295_DEIGD/57-193GAVNM--------------------------------------ARAV---------------------------------
A6EJ19_9SPHI/53-195GAIDM--------------------------------------AEEE---------------------------------
Q7VFW4_HELHP/40-187GAIDA--------------------------------------SEIL---------------------------------
B9KE81_CAMLR/56-203GAIDS--------------------------------------SKLL---------------------------------
Q11UY7_CYTH3/68-211GALDM--------------------------------------ANYE---------------------------------
A7JSQ1_PASHA/104-245GAVEM--------------------------------------AKVQ---------------------------------
Q1QE07_PSYCK/97-242GAVDM--------------------------------------AKIE---------------------------------
A9AYN0_HERA2/50-184GAIAM--------------------------------------AKDA---------------------------------
A5V0R4_ROSS1/56-190GAITM--------------------------------------ARLA---------------------------------
A0ZFH3_NODSP/72-222GAVVM--------------------------------------AQEA---------------------------------
Q2JRB2_SYNJA/58-208GAVSM--------------------------------------AAEA---------------------------------
Q0YT76_9CHLB/64-193GAILL--------------------------------------AEKA---------------------------------
P72559_SYNE7/55-207GAIEM--------------------------------------AKVT---------------------------------
A3Z244_9SYNE/68-221GALRM--------------------------------------SEFV---------------------------------
Q55943_SYNY3/46-190DAIDM--------------------------------------AEMA---------------------------------
Q8ZSB7_NOSS1/59-222QAMEM--------------------------------------ADIA---------------------------------
Q31P39_SYNE7/58-213GAIAM--------------------------------------ADLA---------------------------------
A3YWB8_9SYNE/73-239GAIAM--------------------------------------ADLA---------------------------------
Q1AZS8_RUBXD/64-204GAVHM--------------------------------------ARVA---------------------------------
Q1D6W0_MYXXD/49-189MATEM--------------------------------------AMVE---------------------------------
Q3SJA1_THIDA/49-185MAVHM--------------------------------------GTMC---------------------------------
A7HAD4_ANADF/47-185MAVEM--------------------------------------GMAC---------------------------------
A1SIT5_NOCSJ/74-207EAVTA--------------------------------------AGEL---------------------------------
A3TP12_9MICO/50-191EAIVA--------------------------------------AGQL---------------------------------
A1UPT7_MYCSK/34-187QAVAL--------------------------------------SNQT---------------------------------
A3I411_9BACI/39-184AAIQM--------------------------------------SENV---------------------------------
A4F8Y7_SACEN/55-202QILDL--------------------------------------AELA---------------------------------
A5CV70_CLAM3/55-232GSVEL--------------------------------------AVAA---------------------------------

PF00268

RIR2_EBVA8/1-276VETHR--------------------------------------NRWF---------------------------------
RIR2_BHV1C/7-288SLSVA--------------------------------------NRWL---------------------------------
RIR2_HUMAN/70-351KKAEA--------------------------------------SFWT---------------------------------
RIR2_VZVD/1-280ALSIS--------------------------------------NRWL---------------------------------
RIR2_YEAST/76-358KRAEA--------------------------------------SFWT---------------------------------
RIR4_SALTY/1-281NRLTS--------------------------------------NFWL---------------------------------
RIR2_HHV11/28-314SLSIL--------------------------------------NRWL---------------------------------
RIR2_SCHPO/66-348KKAEA--------------------------------------SFWT---------------------------------
RIR2_DICDI/12-293KKALA--------------------------------------SHWV---------------------------------
RIR2_SHV21/1-279KETWK--------------------------------------NRWF---------------------------------
RIR2_EHV1B/12-295SLSVA--------------------------------------NRWL---------------------------------
RIR2_CAEEL/62-343KKAVA--------------------------------------SFWT---------------------------------
RIR2_ASFB7/9-294KKLES--------------------------------------LTWT---------------------------------

PF03232

COQ7_HUMAN/47-217IYAGQ---------------------------------MAVL-G...---------------------------------
Q6BPA8_DEBHA/54-250IYYGQ---------------------------------FTVL-AS..---------------------------------
Q2GE68_NEOSM/5-175IYRGQ---------------------------------LRGL-KN..---------------------------------
A5FUU9_ACICJ/16-182IYAGQ---------------------------------LAVL-G...---------------------------------
Q9TVU0_DROME/50-219IYAGQ---------------------------------MAIL-G...---------------------------------
Q4FNJ8_PELUB/7-177IYEGQ---------------------------------LLAL-NTFV---------------------------------
Q582P6_TRYB2/23-204ICKYQ---------------------------------LLWM-SP..---------------------------------
Q1GVM9_SPHAL/4-171IYAGQ---------------------------------LAVM-GD..---------------------------------
COQ7_SCHPO/41-216IYKGQ---------------------------------HFIL-QF..---------------------------------
Q7RZB1_NEUCR/74-256IYTGQ---------------------------------TPPL-VT..---------------------------------
Q4E674_TRYCC/24-205ICGYQ---------------------------------LLWM-SP..---------------------------------
Q73G62_WOLPM/16-180IYSGQ---------------------------------KFIL-K...---------------------------------
COQ7_CAEEL/17-187IYAGQ---------------------------------LAVL-Q...---------------------------------
Q2GCC1_NOVAD/3-170IYAGQ---------------------------------LAVM-GD..---------------------------------
Q2RNK3_RHORT/45-212IYQGQ---------------------------------LAVL-GR..---------------------------------
Q6J4P7_APILI/25-195IYAGQ---------------------------------MAVL-G...---------------------------------
A5P9R2_9SPHN/11-180IYAGQ---------------------------------LAVM-GD..---------------------------------
A7TK78_VANPO/55-238IYAGQ---------------------------------IFIL-SE..---------------------------------
Q5A1Q6_CANAL/50-246IYMGQ---------------------------------YAVL-AS..---------------------------------
A8F0U6_RICM5/20-188IYQGQ---------------------------------LKYI-K...---------------------------------
E0TD93_PARBH/31-201IYRGQ---------------------------------RAVF-EKVK---------------------------------
Q1N9T4_9SPHN/17-184IYAGQ---------------------------------LAVM-GD..---------------------------------
Q5KIZ4_CRYNJ/66-251IYRGQ---------------------------------KWAM-DVK.---------------------------------
E9AE97_LEIMA/97-280IARHQ---------------------------------LEWM-SP..---------------------------------
Q5HBV3_EHRRW/6-170IYHGQ---------------------------------ELVL-R...---------------------------------
Q2F6B9_BOMMO/27-196IYAGQ---------------------------------MAVL-G...---------------------------------
Q40K31_EHRCH/6-170IYSGQ---------------------------------ELIF-R...---------------------------------
Q5NLW7_ZYMMO/17-185IYAGQ---------------------------------LAIM-GD..---------------------------------
Q1RHH8_RICBR/11-179IYQGQ---------------------------------LKYT-K...---------------------------------
COQ7_DICDI/48-217IYEGQ---------------------------------LAVL-A...---------------------------------
A3UGP4_9RHOB/17-188IYQGQ---------------------------------RAVF-KGRP---------------------------------
A2RV27_DANRE/53-223IYAGQ---------------------------------MAVL-G...---------------------------------
A4TYY9_9PROT/18-184IYQGQ---------------------------------RAVL-G...---------------------------------
Q9A697_CAUCR/30-200IYRGQ---------------------------------AAVM-RAAP---------------------------------
A7HTM0_PARL1/20-193IYEGQ---------------------------------RAVF-RYLP---------------------------------
Q7Q596_ANOGA/22-194IYRGQ---------------------------------LVIL-G...---------------------------------
Q0BU90_GRABC/23-189IYAGQ---------------------------------LAVL-R...---------------------------------
Q75CT1_ASHGO/43-226IYAGQ---------------------------------FFVL-AN..---------------------------------
Q5D9V5_SCHJA/11-181IYQGQ---------------------------------LMVL-G...---------------------------------
Q2W739_MAGSA/17-185IYQGQ---------------------------------RAIL-GR..---------------------------------
CAT5_YEAST/50-233IYAGQ---------------------------------YFVL-AH..---------------------------------
Q6C5T9_YARLI/12-192IYRGQ---------------------------------YMVL-SR..---------------------------------
Q0AM53_MARMM/22-193IYQGQ---------------------------------RAVF-KALP---------------------------------
Q1HQL9_AEDAE/23-193IYKGQ---------------------------------LAVL-G...---------------------------------
Q5PBA0_ANAMM/4-170IYHGQ---------------------------------GIVF-S...---------------------------------
Q28EZ6_XENTR/52-222IYAGQ---------------------------------MAVL-G...---------------------------------
Q6FM78_CANGA/48-232IYAGQ---------------------------------YFIL-AN..---------------------------------

PF02915

Q8FZ24_BRUSU/20-157IYLAY---------------------------------ADGL-RDEF---------------------------------
O27405_METTH/16-131IYLAM---------------------------------ARQA-QREG---------------------------------
Q8U1L0_PYRFU/18-147FYSEL---------------------------------ATKL-GGL.---------------------------------
Q9X1L2_THEMA/5-141FYREL---------------------------------SEHF-NGE.---------------------------------
Q8RTU6_9PROT/83-214LYQEI---------------------------------EKNV-DN..---------------------------------
Q9WZC5_THEMA/7-123KYLIF---------------------------------ADEA-EQRG---------------------------------
ACSF2_SYNY3/89-222LFKEL---------------------------------SRRL-KNRS---------------------------------
Q9V073_PYRAB/23-158FYESF---------------------------------AEKI-DIEP---------------------------------
O58303_PYRHO/19-154FYESL---------------------------------AKHV-DSKP---------------------------------
Q8U1L6_PYRFU/22-157FYKSL---------------------------------AEKI-KIEA---------------------------------
ACSF1_SYNY3/89-222LYKEL---------------------------------GRRL-KNKN---------------------------------
O26912_METTH/5-120KYLAF---------------------------------AKKA-DEEG---------------------------------
O26850_METTH/9-145RYTFY---------------------------------AKIA-KKEG---------------