Sequence alignment for CL0046

PF02797

O81305_ARATH/238-383----------------------------------------------------------------------------ELHC
O23674_ARATH/245-393----------------------------------------------------------------------------ELHY
F2CYQ0_HORVD/240-390----------------------------------------------------------------------------QLVS
F6HP18_VITVI/238-388----------------------------------------------------------------------------QLVS
M1CL74_SOLTU/241-391----------------------------------------------------------------------------EIVS
Q7X795_ORYSJ/244-388----------------------------------------------------------------------------ELQF

PF08541

Q8ED66_SHEON/282-372--------------------------------------------------------------------------------
Q74CS1_GEOSL/237-326--------------------------------------------------------------------------------
Q7CTU0_AGRT5/239-328--------------------------------------------------------------------------------
FABH_PROMM/246-335--------------------------------------------------------------------------------
Q73Q42_TREDE/222-311--------------------------------------------------------------------------------
FABH_PSEAE/233-322--------------------------------------------------------------------------------
FABH_CHRVO/230-319--------------------------------------------------------------------------------
FABH_DESVH/241-330--------------------------------------------------------------------------------
Q5YPR0_NOCFA/241-333--------------------------------------------------------------------------------
FABH2_STRCO/230-319--------------------------------------------------------------------------------
Q5WEX8_BACSK/220-309--------------------------------------------------------------------------------
FABH_NOSS1/239-328--------------------------------------------------------------------------------
Q67RA0_SYMTH/248-336--------------------------------------------------------------------------------
Q5NF70_FRATT/234-323--------------------------------------------------------------------------------
Q7M7Z5_WOLSU/238-327--------------------------------------------------------------------------------
FABH2_VIBPA/235-324--------------------------------------------------------------------------------
Q7NZ26_CHRVO/282-372--------------------------------------------------------------------------------
FABH_AQUAE/220-309--------------------------------------------------------------------------------
FABH1_STRAW/264-354--------------------------------------------------------------------------------
FABH_TROWT/231-321--------------------------------------------------------------------------------
Q63N14_BURPS/258-347--------------------------------------------------------------------------------
FABH_HELHP/239-328--------------------------------------------------------------------------------
FABH3_STRCO/240-329--------------------------------------------------------------------------------
FABH_PROMP/245-334--------------------------------------------------------------------------------
Q65LQ9_BACLD/237-326--------------------------------------------------------------------------------
FABH_CLOAB/234-323--------------------------------------------------------------------------------
FABH_AROAE/232-321--------------------------------------------------------------------------------
FABH_ARATH/314-403--------------------------------------------------------------------------------
Q5FUN7_GLUOX/235-324--------------------------------------------------------------------------------
Q9L1V9_STRCO/246-337--------------------------------------------------------------------------------
FABH2_STRAW/225-314--------------------------------------------------------------------------------
Q87XT2_PSESM/282-372--------------------------------------------------------------------------------
Q884Y8_PSESM/221-307--------------------------------------------------------------------------------
FABH2_LACPL/239-328--------------------------------------------------------------------------------
FABH2_BACSU/234-323--------------------------------------------------------------------------------
FABH_RUEPO/234-323--------------------------------------------------------------------------------
FABH_HAEDU/227-316--------------------------------------------------------------------------------
Q7TTZ7_RHOBA/241-330--------------------------------------------------------------------------------
FABH_RHOBA/256-345--------------------------------------------------------------------------------
Q7NV97_CHRVO/234-323--------------------------------------------------------------------------------
Q5ZV11_LEGPH/238-327--------------------------------------------------------------------------------
Q97KV2_CLOAB/245-334--------------------------------------------------------------------------------
Q8XTB9_RALSO/282-372--------------------------------------------------------------------------------
Q6A930_PROAC/241-331--------------------------------------------------------------------------------
Q5SL76_THET8/230-319--------------------------------------------------------------------------------
Q7N8H1_PHOLL/221-311--------------------------------------------------------------------------------
FABH2_VIBVY/235-324--------------------------------------------------------------------------------
Q82PP5_STRAW/243-333--------------------------------------------------------------------------------
FABH_PROMA/245-334--------------------------------------------------------------------------------
FABH_BLOFL/229-318--------------------------------------------------------------------------------
Q8RHZ0_FUSNN/221-309--------------------------------------------------------------------------------
Q7X8V9_ORYSJ/337-426--------------------------------------------------------------------------------
FABH_CLOTE/244-333--------------------------------------------------------------------------------
Q88ES4_PSEPK/221-308--------------------------------------------------------------------------------
Q88EC1_PSEPK/299-389--------------------------------------------------------------------------------
FABH_THETN/240-329--------------------------------------------------------------------------------
FABH_STRMU/234-325--------------------------------------------------------------------------------
FABH1_BACAN/219-308--------------------------------------------------------------------------------
FABH_STRP1/233-324--------------------------------------------------------------------------------
FABH_SYNY3/241-330--------------------------------------------------------------------------------
FABH_LACLA/234-325--------------------------------------------------------------------------------
FABH5_STRCO/237-326--------------------------------------------------------------------------------
Q5YN70_NOCFA/251-341--------------------------------------------------------------------------------
FABH2_BACHD/236-325--------------------------------------------------------------------------------
Q5YNJ2_NOCFA/253-343--------------------------------------------------------------------------------
Q885B9_PSESM/249-338--------------------------------------------------------------------------------
Q82HI7_STRAW/252-343--------------------------------------------------------------------------------
Q6FAK4_ACIAD/280-370--------------------------------------------------------------------------------
Q6DAZ3_PECAS/249-337--------------------------------------------------------------------------------
FABH_SYMTH/239-328--------------------------------------------------------------------------------
Q8CV20_OCEIH/48-137--------------------------------------------------------------------------------
Q9HYV7_PSEAE/259-349--------------------------------------------------------------------------------
FABH_GEOKA/219-308--------------------------------------------------------------------------------
FABH2_VIBCH/235-324--------------------------------------------------------------------------------
Q6AQA3_DESPS/255-342--------------------------------------------------------------------------------
FABH1_LACPL/238-323--------------------------------------------------------------------------------
Q8EDA9_SHEON/231-320--------------------------------------------------------------------------------
Q6LQM2_PHOPR/234-323--------------------------------------------------------------------------------
Q63PP7_BURPS/254-343--------------------------------------------------------------------------------
FABH_COXBU/230-319--------------------------------------------------------------------------------
FABH2_BACAN/235-324--------------------------------------------------------------------------------
Q5NL87_ZYMMO/234-323--------------------------------------------------------------------------------
FABH_THEEB/239-328--------------------------------------------------------------------------------
Q5LUY4_RUEPO/282-372--------------------------------------------------------------------------------
Q98AW4_RHILO/238-327--------------------------------------------------------------------------------
Q6AET2_LEIXX/245-335--------------------------------------------------------------------------------
Q81JE9_BACAN/240-329--------------------------------------------------------------------------------
Q6MR21_BDEBA/243-332--------------------------------------------------------------------------------
FABH_STRA5/232-323--------------------------------------------------------------------------------
FABH_BORPE/239-328--------------------------------------------------------------------------------
FABH_NITEU/229-318--------------------------------------------------------------------------------
Q98K75_RHILO/223-313--------------------------------------------------------------------------------
Q9K3G9_STRCO/229-319--------------------------------------------------------------------------------
FABH_GLOVI/237-326--------------------------------------------------------------------------------
Q8EG66_SHEON/260-347--------------------------------------------------------------------------------
Q63PP9_BURPS/255-344--------------------------------------------------------------------------------
Q7NZW4_CHRVO/228-317--------------------------------------------------------------------------------
Q8RC85_THETN/250-338--------------------------------------------------------------------------------
Q6MAF5_PARUW/240-329--------------------------------------------------------------------------------
Q5QWT4_IDILO/232-321--------------------------------------------------------------------------------
Q67MB7_SYMTH/254-342--------------------------------------------------------------------------------
FABH1_DEIRA/233-322--------------------------------------------------------------------------------
Q9I4X1_PSEAE/253-342--------------------------------------------------------------------------------
FABH1_VIBCH/227-316--------------------------------------------------------------------------------
Q73S66_MYCPA/245-335--------------------------------------------------------------------------------
FABH_NEIG1/231-320--------------------------------------------------------------------------------
Q63N13_BURPS/243-332--------------------------------------------------------------------------------
FABH_PECAS/228-317--------------------------------------------------------------------------------
FABH_CLOPE/235-324--------------------------------------------------------------------------------
Q820X4_COXBU/239-326--------------------------------------------------------------------------------
FABH_PORGI/240-327--------------------------------------------------------------------------------
Q82NC9_STRAW/244-334--------------------------------------------------------------------------------
FABH_RHIME/234-323--------------------------------------------------------------------------------
FABH_RALSO/237-326--------------------------------------------------------------------------------
Q5ZTD0_LEGPH/246-335--------------------------------------------------------------------------------
Q82KT2_STRAW/240-329--------------------------------------------------------------------------------
Q8F686_LEPIN/233-322--------------------------------------------------------------------------------
FABH_OCEIH/221-310--------------------------------------------------------------------------------
FABH_SHEON/230-319--------------------------------------------------------------------------------
FABH_DESPS/235-324--------------------------------------------------------------------------------
FABH_XANCP/236-325--------------------------------------------------------------------------------
FABH_CHLTE/239-328--------------------------------------------------------------------------------
FABH_BURPS/240-329--------------------------------------------------------------------------------
Q8RC81_THETN/237-325--------------------------------------------------------------------------------
Q5YNV7_NOCFA/248-338--------------------------------------------------------------------------------
FABH_METCA/232-321--------------------------------------------------------------------------------
FABH2_DEIRA/239-328--------------------------------------------------------------------------------
PQSD_PSEAE/242-329--------------------------------------------------------------------------------
B9KJ28_ANAMF/234-322--------------------------------------------------------------------------------
D5AUL7_RHOCB/235-324--------------------------------------------------------------------------------
D6D672_9BACE/241-327--------------------------------------------------------------------------------
FABH_HELPY/239-327--------------------------------------------------------------------------------
FABH_CHLTR/238-325--------------------------------------------------------------------------------
FABH_STRR6/234-323--------------------------------------------------------------------------------
FABH_MYCTU/242-332--------------------------------------------------------------------------------
Q2YKB4_BRUA2/237-325--------------------------------------------------------------------------------
FABH_BRUA2/235-323--------------------------------------------------------------------------------
FABH_SYNE7/244-331--------------------------------------------------------------------------------
FABH_STAEQ/223-311--------------------------------------------------------------------------------
Q5LAY0_BACFN/240-327--------------------------------------------------------------------------------
FABH_STRT2/237-320--------------------------------------------------------------------------------
Q5ZTD4_LEGPH/263-346--------------------------------------------------------------------------------
FABH_BARHE/236-324--------------------------------------------------------------------------------
Q79ZF6_STRAW/239-330--------------------------------------------------------------------------------
Q79ZR7_STRAW/221-310--------------------------------------------------------------------------------
Q7KWI9_PLAF7/283-371--------------------------------------------------------------------------------
Q81RV7_BACAN/243-331--------------------------------------------------------------------------------
Q8P810_XANCP/349-438--------------------------------------------------------------------------------
FABH_FUSNN/237-326--------------------------------------------------------------------------------
FABH_LISMO/221-310--------------------------------------------------------------------------------
FABH_CAMJE/230-318--------------------------------------------------------------------------------
FABHL_CAMJE/252-337--------------------------------------------------------------------------------
FABH_RICPR/230-317--------------------------------------------------------------------------------
V6KTJ6_STRRC/242-332--------------------------------------------------------------------------------

PF02803

THIL_YEAST/274-397--------------------------------------------------------------------------------
FADA_ECOLI/261-386--------------------------------------------------------------------------------
YKA3_CAEEL/305-445--------------------------------------------------------------------------------
THIL_HUMAN/306-426--------------------------------------------------------------------------------
THLA_CLOAB/269-391--------------------------------------------------------------------------------
ATOB_ECOLI/270-392--------------------------------------------------------------------------------
THL_BACSU/270-392--------------------------------------------------------------------------------
THIL_CUPNH/270-392--------------------------------------------------------------------------------
THIM_HUMAN/273-395--------------------------------------------------------------------------------
THIKA_RAT/298-421--------------------------------------------------------------------------------
YQEF_ECOLI/269-391--------------------------------------------------------------------------------
THIK_YEAST/296-416--------------------------------------------------------------------------------
FADA4_MYCLE/270-392--------------------------------------------------------------------------------
THIK_YARLI/291-413--------------------------------------------------------------------------------
ECHB_RAT/332-472--------------------------------------------------------------------------------
ATOB_HAEIN/270-392--------------------------------------------------------------------------------
A1B3M4_PARDP/268-390--------------------------------------------------------------------------------
C5M4S8_CANTT/289-406--------------------------------------------------------------------------------
C5M6V3_CANTT/274-396--------------------------------------------------------------------------------
I3YE91_THIV6/271-393--------------------------------------------------------------------------------
FADA_PSESM/266-390--------------------------------------------------------------------------------

PF02801

PKSJ_BACSU/4829-4945--------------------------------------------------------------------------------
PKSL_BACSU/4322-4438--------------------------------------------------------------------------------
Q18559_CAEEL/5488-5604--------------------------------------------------------------------------------
Q18559_CAEEL/244-354--------------------------------------------------------------------------------
P95029_MYCTU/2816-2942--------------------------------------------------------------------------------
PKSF_BACSU/257-367--------------------------------------------------------------------------------
P74017_SYNY3/244-356--------------------------------------------------------------------------------
O67612_AQUAE/256-371--------------------------------------------------------------------------------
FABF_BACSU/254-369--------------------------------------------------------------------------------
FABF_SYNY3/258-373--------------------------------------------------------------------------------
Q9ZCH8_RICPR/269-384--------------------------------------------------------------------------------
CEM1_YEAST/273-391--------------------------------------------------------------------------------
OXSM_SCHPO/262-380--------------------------------------------------------------------------------
FABB_HAEIN/253-361--------------------------------------------------------------------------------
O84775_CHLTR/256-371--------------------------------------------------------------------------------
KASC1_ARATH/315-429--------------------------------------------------------------------------------
O54149_STRCO/253-365--------------------------------------------------------------------------------
Q9Z4Y3_STRCO/251-363--------------------------------------------------------------------------------
Q93458_CAEEL/101-214--------------------------------------------------------------------------------
KASA_STRCO/303-418--------------------------------------------------------------------------------
KAS1_STRCO/261-376--------------------------------------------------------------------------------
KASB_STRCO/251-361--------------------------------------------------------------------------------
KAS2_STRCO/264-377--------------------------------------------------------------------------------
FAS_HUMAN/243-360--------------------------------------------------------------------------------
FAS_CHICK/243-360--------------------------------------------------------------------------------
P91871_CAEEL/279-396--------------------------------------------------------------------------------
WA_EMENI/634-754--------------------------------------------------------------------------------
O54142_STRCO/811-926--------------------------------------------------------------------------------
P71718_MYCTU/262-379--------------------------------------------------------------------------------
O65933_MYCTU/289-405--------------------------------------------------------------------------------
O53901_MYCTU/271-385--------------------------------------------------------------------------------
Q49933_MYCLE/296-416--------------------------------------------------------------------------------
O86335_MYCTU/354-472--------------------------------------------------------------------------------
O54155_STRCO/1041-1159--------------------------------------------------------------------------------
Q18559_CAEEL/2133-2242--------------------------------------------------------------------------------
O06586_MYCTU/230-347--------------------------------------------------------------------------------
PKSR_BACSU/1766-1891--------------------------------------------------------------------------------
PKSM_BACSU/3776-3894--------------------------------------------------------------------------------
PKSL_BACSU/3126-3244--------------------------------------------------------------------------------
PKSJ_BACSU/2018-2137--------------------------------------------------------------------------------
PKSL_BACSU/2189-2307--------------------------------------------------------------------------------
PKSM_BACSU/2562-2680--------------------------------------------------------------------------------
PKSR_BACSU/785-903--------------------------------------------------------------------------------
PKSM_BACSU/655-773--------------------------------------------------------------------------------
PKSJ_BACSU/3597-3724--------------------------------------------------------------------------------
O54142_STRCO/307-424--------------------------------------------------------------------------------
A4F7N8_SACEN/2288-2403--------------------------------------------------------------------------------
A4F7P0_SACEN/288-406--------------------------------------------------------------------------------
A4F7P1_SACEN/285-403--------------------------------------------------------------------------------
A8XKG1_CAEBR/5528-5642--------------------------------------------------------------------------------
B2J2F3_NOSP7/310-427--------------------------------------------------------------------------------
B5HT08_9ACTO/261-376--------------------------------------------------------------------------------
B6H6U0_PENCW/303-422--------------------------------------------------------------------------------
B8CQB2_SHEPW/317-434--------------------------------------------------------------------------------
B8CQB4_SHEPW/303-420--------------------------------------------------------------------------------
B8NI04_ASPFN/629-749--------------------------------------------------------------------------------
B8NYX0_ASPFN/264-381--------------------------------------------------------------------------------
C9R299_AGGAD/260-369--------------------------------------------------------------------------------
F2RC16_STRVP/252-362--------------------------------------------------------------------------------
G0FS56_AMYMS/293-411--------------------------------------------------------------------------------
G3XDA2_PSEAE/255-370--------------------------------------------------------------------------------
H9JGF5_BOMMO/86-195--------------------------------------------------------------------------------
I6X8D2_MYCTU/374-491--------------------------------------------------------------------------------
I6Y231_MYCTU/264-376--------------------------------------------------------------------------------
N4VDN9_COLOR/639-759--------------------------------------------------------------------------------
O25284_HELPY/258-369--------------------------------------------------------------------------------
NODE_RHIME/247-359--------------------------------------------------------------------------------
FABF_ECOLI/255-370--------------------------------------------------------------------------------
FAB2_MYCTU/262-374--------------------------------------------------------------------------------
FAB1_MYCTU/262-374--------------------------------------------------------------------------------
PPSE_MYCTU/270-389--------------------------------------------------------------------------------
PPSA_MYCTU/359-477--------------------------------------------------------------------------------
Q0CJ59_ASPTN/303-419--------------------------------------------------------------------------------
Q4KCY8_PSEF5/298-415--------------------------------------------------------------------------------
Q4KCY9_PSEF5/270-383--------------------------------------------------------------------------------
Q5CUM8_CRYPI/1142-1260--------------------------------------------------------------------------------
Q7APV9_MYCLE/290-405--------------------------------------------------------------------------------
Q7RVN4_NEUCR/272-391--------------------------------------------------------------------------------
Q82BC0_STRAW/261-376--------------------------------------------------------------------------------
Q87N23_VIBPA/255-371--------------------------------------------------------------------------------
Q87W69_PSESM/297-414--------------------------------------------------------------------------------
Q87W70_PSESM/852-968--------------------------------------------------------------------------------
Q8YLE3_NOSS1/299-407--------------------------------------------------------------------------------
Q9CB70_MYCLE/293-407--------------------------------------------------------------------------------
Q9I3B2_PSEAE/252-360--------------------------------------------------------------------------------
Q9Z373_YERPE/285-402--------------------------------------------------------------------------------
W5XQV6_9CORY/55-180--------------------------------------------------------------------------------

PF08540

HMCS_SCHPO/176-446----------------------------------------------------------------------------IVFE
Q5A3Z7_CANAL/178-450----------------------------------------------------------------------------IVFD
HMCS_ARATH/175-451----------------------------------------------------------------------------IVFE
HMCS2_HUMAN/224-506----------------------------------------------------------------------------LALE
HMCS_CAEEL/183-448----------------------------------------------------------------------------IPID
HMCS_YEAST/217-490----------------------------------------------------------------------------IVFD
HMCS1_RAT/187-469----------------------------------------------------------------------------VIFD

PF00195

O23674_ARATH/11-236KLSSKSTRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDD.AFIKEKLEHLCKTTTVKTRYTVLTREILAKYP
F2CYQ0_HORVD/6-230..LKEVRMAQRAEGLATVLAIGTAVPANCVYQATYPDYYFRVTKSEHLADLKEKFQRMCDKSMIRKRHMHLTEEILIKNP
F6HP15_VITVI/3-228.SVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHP
Q7X795_ORYSJ/13-234....NGSRSQCSRGKAMLLALGKGLPEQVLPQEKVVETYLQDTICDD.PATRAKLERLCKTTTVRTRYTVMSKELLDEHP
Q8W3P6_VITVI/8-228......RNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENP

PF08545

Q8ED66_SHEON/150-221--------------------------------------------------------------------------------
Q74CS1_GEOSL/107-185--------------------------------------------------------------------------------
Q63N14_BURPS/119-199--------------------------------------------------------------------------------
Q6MR21_BDEBA/112-191--------------------------------------------------------------------------------
Q7CTU0_AGRT5/109-187--------------------------------------------------------------------------------
FABH1_BACTN/110-188--------------------------------------------------------------------------------
FABH_YERPE/106-183--------------------------------------------------------------------------------
FABH3_STRCO/108-188--------------------------------------------------------------------------------
FABH_GLOVI/106-183--------------------------------------------------------------------------------
FABH2_DEIRA/113-191--------------------------------------------------------------------------------
Q8EDA9_SHEON/104-182--------------------------------------------------------------------------------
Q8P810_XANCP/217-297--------------------------------------------------------------------------------
Q5FUN7_GLUOX/112-191--------------------------------------------------------------------------------
Q8XRP5_RALSO/110-188--------------------------------------------------------------------------------
FABH_THETN/110-188--------------------------------------------------------------------------------
FABH_CHLTE/107-186--------------------------------------------------------------------------------
Q7TTZ7_RHOBA/109-186--------------------------------------------------------------------------------
FABH2_BACAN/108-186--------------------------------------------------------------------------------
Q73Q42_TREDE/107-187--------------------------------------------------------------------------------
Q67RA0_SYMTH/112-193--------------------------------------------------------------------------------
FABH_HELPY/109-188--------------------------------------------------------------------------------
PQSD_PSEAE/107-188--------------------------------------------------------------------------------
FABH_CLOTE/108-185--------------------------------------------------------------------------------
FABH_RUEPO/108-191--------------------------------------------------------------------------------
FABH_PASMU/106-183--------------------------------------------------------------------------------
FABH_SYMTH/109-187--------------------------------------------------------------------------------
Q7NZ26_CHRVO/150-229--------------------------------------------------------------------------------
Q7NV97_CHRVO/105-183--------------------------------------------------------------------------------
FABH1_LACPL/108-188--------------------------------------------------------------------------------
Q820X4_COXBU/124-203--------------------------------------------------------------------------------
FABH1_STRAW/116-193--------------------------------------------------------------------------------
FABH_PROMP/113-191--------------------------------------------------------------------------------
FABH_PSEAE/105-185--------------------------------------------------------------------------------
FABH_AQUAE/105-183--------------------------------------------------------------------------------
FABH_HELHP/110-189--------------------------------------------------------------------------------
FABH_CAUCR/106-189--------------------------------------------------------------------------------
FABH_BLOFL/106-183--------------------------------------------------------------------------------
FABH_METCA/108-185--------------------------------------------------------------------------------
FABH2_VIBPA/107-185--------------------------------------------------------------------------------
Q6A930_PROAC/116-193--------------------------------------------------------------------------------
Q6FAK4_ACIAD/154-233--------------------------------------------------------------------------------
FABH_BRADU/109-193--------------------------------------------------------------------------------
FABH_SHEON/106-183--------------------------------------------------------------------------------
FABH_CLOAB/106-183--------------------------------------------------------------------------------
Q9K3G9_STRCO/109-186--------------------------------------------------------------------------------
Q73S66_MYCPA/111-193--------------------------------------------------------------------------------
Q81RV7_BACAN/105-186--------------------------------------------------------------------------------
Q5YNV7_NOCFA/117-194--------------------------------------------------------------------------------
FABH_NEIG1/108-185--------------------------------------------------------------------------------
Q6MAF5_PARUW/110-188--------------------------------------------------------------------------------
Q82PP5_STRAW/108-187--------------------------------------------------------------------------------
FABH2_LACPL/107-188--------------------------------------------------------------------------------
FABH2_STRCO/112-192--------------------------------------------------------------------------------
Q7U427_SYNPX/113-191--------------------------------------------------------------------------------
FABH_PHOLL/106-183--------------------------------------------------------------------------------
FABH4_STRCO/108-188--------------------------------------------------------------------------------
FABH_TROWT/107-184--------------------------------------------------------------------------------
FABHL_CAMJE/116-191--------------------------------------------------------------------------------
FABH_NOSS1/108-185--------------------------------------------------------------------------------
FABH_STRT2/106-183--------------------------------------------------------------------------------
Q9I4X1_PSEAE/123-201--------------------------------------------------------------------------------
Q7M7Z5_WOLSU/107-186--------------------------------------------------------------------------------
FABH_PORGI/110-188--------------------------------------------------------------------------------
Q5QWT4_IDILO/106-184--------------------------------------------------------------------------------
Q5NL87_ZYMMO/111-190--------------------------------------------------------------------------------
Q98K75_RHILO/87-167--------------------------------------------------------------------------------
FABH1_DEIRA/107-185--------------------------------------------------------------------------------
FABH_PROMA/113-191--------------------------------------------------------------------------------
Q5WEX8_BACSK/106-184--------------------------------------------------------------------------------
FABH_MYCPA/116-193--------------------------------------------------------------------------------
FABH_NITEU/106-183--------------------------------------------------------------------------------
Q74GF6_GEOSL/107-185--------------------------------------------------------------------------------
FABH_HAEIN/106-183--------------------------------------------------------------------------------
FABH_AGRT5/107-190--------------------------------------------------------------------------------
FABH5_STRCO/105-185--------------------------------------------------------------------------------
Q885B9_PSESM/110-188--------------------------------------------------------------------------------
Q63PP7_BURPS/122-199--------------------------------------------------------------------------------
FABH_STRMU/106-183--------------------------------------------------------------------------------
FABH_LACLA/106-184--------------------------------------------------------------------------------
Q97KV2_CLOAB/114-194--------------------------------------------------------------------------------
Q8F686_LEPIN/117-195--------------------------------------------------------------------------------
FABH_STAEQ/106-184--------------------------------------------------------------------------------
FABH_CHRVO/107-184--------------------------------------------------------------------------------
FABH1_BACCR/106-184--------------------------------------------------------------------------------
O30202_ARCFU/103-177--------------------------------------------------------------------------------
FABH_AROAE/109-186--------------------------------------------------------------------------------
FABH_SYNY3/110-187--------------------------------------------------------------------------------
Q8KE19_CHLTE/7-93--------------------------------------------------------------------------------
FABH2_BACSU/107-185--------------------------------------------------------------------------------
FABH_RALSO/114-191--------------------------------------------------------------------------------
FABH_CLOPE/106-184--------------------------------------------------------------------------------
Q6LQM2_PHOPR/106-184--------------------------------------------------------------------------------
FABH_CAMJE/108-185--------------------------------------------------------------------------------
Q5YPR0_NOCFA/115-192--------------------------------------------------------------------------------
FABH_COXBU/109-186--------------------------------------------------------------------------------
Q63N13_BURPS/108-189--------------------------------------------------------------------------------
Q82KT2_STRAW/108-188--------------------------------------------------------------------------------
Q65LQ9_BACLD/110-188--------------------------------------------------------------------------------
Q982F9_RHILO/108-186--------------------------------------------------------------------------------
Q81JE9_BACAN/109-187--------------------------------------------------------------------------------
Q5NF70_FRATT/108-185--------------------------------------------------------------------------------
FABH_PROMM/113-192--------------------------------------------------------------------------------
Q6AET2_LEIXX/120-197--------------------------------------------------------------------------------
Q7NZW4_CHRVO/106-186--------------------------------------------------------------------------------
FABH_DESPS/106-184--------------------------------------------------------------------------------
FABH_XANCP/110-187--------------------------------------------------------------------------------
Q8RC81_THETN/108-187--------------------------------------------------------------------------------
Q5YNJ2_NOCFA/116-193--------------------------------------------------------------------------------
Q67MB7_SYMTH/116-197--------------------------------------------------------------------------------
Q884Y8_PSESM/108-185--------------------------------------------------------------------------------
FABH2_BACHD/109-187--------------------------------------------------------------------------------
Q7KWI9_PLAF7/153-231--------------------------------------------------------------------------------
Q65LD5_BACLD/106-184--------------------------------------------------------------------------------
FABH_ENTFA/107-184--------------------------------------------------------------------------------
Q8RC85_THETN/112-193--------------------------------------------------------------------------------
FABH_OCEIH/106-184--------------------------------------------------------------------------------
FABH_THEEB/108-185--------------------------------------------------------------------------------
A8GFT0_SERP5/117-193--------------------------------------------------------------------------------
B9KJ28_ANAMF/108-190--------------------------------------------------------------------------------
C4YXG9_9RICK/106-183--------------------------------------------------------------------------------
D5AUL7_RHOCB/108-191--------------------------------------------------------------------------------
D7TN17_VITVI/170-249--------------------------------------------------------------------------------
E3PXS0_CLOSD/254-332--------------------------------------------------------------------------------
FABH_CHLTR/106-185--------------------------------------------------------------------------------
FABH_STRR6/106-183--------------------------------------------------------------------------------
Q2YKB4_BRUA2/110-185--------------------------------------------------------------------------------
FABH_SYNE7/111-188--------------------------------------------------------------------------------
Q5SL76_THET8/104-182--------------------------------------------------------------------------------
Q5ZTD0_LEGPH/115-194--------------------------------------------------------------------------------
Q5ZTD4_LEGPH/131-209--------------------------------------------------------------------------------
Q5ZV11_LEGPH/109-186--------------------------------------------------------------------------------
Q63PP9_BURPS/115-194--------------------------------------------------------------------------------
Q79ZR7_STRAW/89-169--------------------------------------------------------------------------------
FABH1_VIBVY/106-183--------------------------------------------------------------------------------
FABH_FUSNN/107-185--------------------------------------------------------------------------------
Q8RHZ0_FUSNN/90-165--------------------------------------------------------------------------------
FABH_LISMO/106-184--------------------------------------------------------------------------------
FABH_STRP1/106-183--------------------------------------------------------------------------------

PF08392

Q9FW59_ORYSJ/25-322ARSRRRR.....CYLLDYVCYKATDDRKLPTDLCGEIIQRNKLL.GLEE.........YKFLLKVIVNSGIGEETYGPRN
KCS3_ARATH/23-313IDSKRDQ.N...CYILDYQCHKPSDDRMVNTQFSGDIILRNKHL.RLNE.........YKFLLKAIVSSGIGEQTYAPRL
KCS11_ARATH/92-381YFMTRPR.P...VYLVNFSCFKPDESRKCTKKIFMDRSKLTGSF.TEEN.........LEFQRKILQRSGLGESTYLPEA
KCS16_ARATH/71-366YLMTRPK.P...VYLVDFSCYLPPSHLKASTQRIMQHVRLVREA.GAWKQES...DYLMDFCEKILERSGLGQETYVPEG
KCS2_ARATH/74-363FFMSRPR.S...IYLLDYSCYLPPSSQKVSYQKFMNNSSLIQDF.SETS.........LEFQRKILIRSGLGEETYLPDS
Q75M74_ORYSJ/23-315AAARRRQSR...CYLLDYVCHKPSDDRKVSTEAAGAVIERSKRL.SLPE.........YRFLLRVIVRSGIGEETYAPRN
KCS14_ARATH/52-334YSTTRSK.P...VYLVDFSCHQPTDSCKISSETFFNMAKGAQLY.TEET.........IQFMTRILNRSGLGDDTYSPRC
Q650T5_ORYSJ/56-349LYRSRRRAAAARVGLVDFACLRPPPRLRIPVAGLLEHFKLIGCF.DDGS.........VEFMTKVIEASGMGNETYFPPS
Q6K3E6_ORYSJ/23-314AAARRRRAT...CYLLDYACHKPSDDRKVTTELAGAIIERNKRL.GLPE.........YRFLLKVIVNSGIGEHTYSPRN
Q688V9_ORYSJ/93-381YVLTRPR.P...VYLVDFACYKPPDKLKVRFDEFLHHSKLC.GF.SDDC.........LEFQRKILERSGLSEETYVPEA
Q5Z6R6_ORYSJ/79-372RLVRRPH.S...VYLVDYACFRPQPSNRLPFATFAEHFRLSPHI.DDGS.........FRFVTRMMERSGLGERTYVPRG
Q8H7L2_ORYSJ/167-457YIMSRPR.P...VYLIDFACYKPADELKVSKAEFIDLARKSGKF.DEDS.........LAFQSRLLAKSGIGDESYMPRC
KCS7_ARATH/38-328YYFFKPRCI...IYLIDFSCYQPPDFLRAPVSNFIEHLTISGVF.DQES.........LDLQQKILERSGISDDASVPAT
Q8LQT7_ORYSJ/61-349VRARRAR.G...VYLVEYGCFRPRPCYRAPFATCLEHAHLMPYLVDEES.........VAFAIRLLERSGLGDETCVPDA
Q6Z6C7_ORYSJ/95-384RFLTRPR.P...VYLVDFACYKPPPERRCSRDAFMRCSRLAGCF.TAAS.........LDFQRRIVERSGLGDDTYLPAA
KCS20_ARATH/42-333YQRIRTRVK...VYLLDFTCYRAPDSNRVPMSTLIETIYLDDKL.DQES.........IDFQARILERSWLSNQTSIPRS
Q9XEP1_SORBI/93-380YLMRRPR.A...VYLLDLACYKPGAEHAVTRETFMRLVVGYGTF.SDDS.........LAFQRKILERSGLGQGTYLPKA
Q7XT16_ORYSJ/77-368WRARRRRGG...VYLVDYGCFLGEPRHRVPFATALEHGRLMTNLLDEES.........TNFMVRLHAKSGIGEETSVPDS
Q6K558_ORYSJ/43-332VLRRRRR.P...VYLLNYSCHLPDVDRKVNLEVCEYFGQRCRHY.SDDT.........ADFMRLIYRKSGLGQETYAPPF
KCS21_ARATH/24-318VFKRRNQRN...CYMLHYECYKGMEERKLDTETCAKVVQRNKNL.GLEE.........YRFLLRTMASSGIGEETYGPRN
Q6F365_ORYSJ/100-389YFLTRPR.P...VYLVDFACYKPDDERKCSRARFMNCTERLGTF.TPEN.........VEFQRKIIERSGLGEDTYLPEA
Q6TMJ4_DICDI/114-404FLSKRRR.E...VYLVDFSVFQPPEQYKISHEFFVEHTKSVGWF.DQDS.........VDFQTKLLYRTGLGNETYFPAG
Q75M84_ORYSJ/26-319AASRRRGMR...CYLLDYVCYKPADDLTLTTELACAIVQRNERL.GIPE.........FRFLVRLISRTGLGDRTYAPRN
Q5Z6S3_ORYSJ/79-368YLVMRPR.A...VYLVDYACFRTAPNCRVPFATFLEHARQVPTL.TERS.........VRFMTRLLERSGLGEETCLPPA
I1QUI1_ORYGL/97-386YAASRPR.P...VYLIDLAGYKAPREHEASRAKTIAHFGRCGRF.SGES.........MAFQKRMLERSGLGEATHFPTS
M4EUY8_BRARP/106-388YVTNRSK.P...VYLVDFSCYKPEDERKMSVDSFLKMTEQNGAF.TDDT.........VQFQQRISNRAGLGDETYLPRG
M4F0P0_BRARP/70-368YIATRPK.P...VYLVEYSCYLPPTHCRSSISKVMDIFYQVRKA.DPSRNGTCDDSSWLDFLRKIQERSGLGDETHGPEG

PF01154

HMCS1_RAT/13-186--------------------------------------------------------------------------------
HMCS2_RAT/50-223--------------------------------------------------------------------------------
HMCS_YEAST/45-216--------------------------------------------------------------------------------

PF00108

M0LND5_9EURY/4-224----VG-----VAGAGMTAFES.....ESDAGALE---LAERAAWRALDDAGD...VAPG.--DVTSVHVGN----MAAE
D2RWU3_HALTV/19-236----VA-----IAGAAMTPFGP......REASLLE---LLAEAGTDCLADAP....IGTD.--EVDHLFVAR----SGGA
E4NU18_HALBP/4-223----VA-----VISASMTQFGN.....REGQFILD---LLAEAGEACLDDVG....VSPD.--SVDHLYVSN----MASG
Q3IPN4_NATPD/4-222----VA-----VIGASMTNFGT......REKWIRE---LLAEAGKDCLDDAG....VTPG.--EVDHLYVSN----MASG
L0IDX7_HALRX/4-222----VA-----IIGTSMTQFGN......RSAWIRE---LLAEAGHSCLASAG....VDPN.--ALDHLYVSN----MAAG
M0LB34_9EURY/4-223----VA-----IIGASMTQFGQ.....REDEWILD---LLAEAGLECLEDAG....VDAA.--DVEHLYVSN----MASG
B9LX39_HALLT/5-223----VA-----IIGGSMTKFGE......RDAWVRE---LLAEAGEACLDDAG....VTPD.--DVEHVYVSN----MASG
M0JWJ2_9EURY/3-221----VA-----VIGASMTKFGQ......RDVWIRE---LLSQAGEECLTDAG....VAPD.--DVEHLYVSN----MASG
ECHB_RAT/55-325----IV-----VVEGVRIPFLL.SGTSYKDLMPHD---LARAALSGLLYRTN....IPKD.--VVDYIIFGT----VIQE
YKA3_CAEEL/26-298----IV-----LVDAVRTPFVV.SGTVFKDLMAVD---LQKEAIKALVEKTK....LPYE.--QLDHIICGT----VIQE
FADA_PSEFR/8-258----VV-----IVDFGRTPMGRSKGGMHRNTRAED---MSAHLISKVLERNSK...VDPG.--EVEDVIWGC----VNQT
A0A017HYH0_ECOLX/4-254----VV-----IVDAIRTPMGRSKGGAFRNVRAED---LSAHLMRSLLARNPA...LEAA.--ALDDIYWGC----VQQT
THIKA_RAT/38-291----VV-----VVHGRRTPIGRAGRGGFKDTTPDE---LLSAVLTAVLQDVK....LKPE.--CLGDISVGN----VLEP
THIK_YARLI/30-284----VV-----ITAAYRTAHTKGGKGLFKDTSSSE---LLASLLEGLVKESK....IDPK.--LIGDVVCGN----VLAA
A0A023ZC97_YEASX/36-289----VV-----IVAANRSAIGKGFKGAFKDVNTDY---LLYNFLNEFIGRFPEPLRADLN.--LIEEVACGN----VLNV
THIKA_CANTR/27-280----VV-----IVAAYRTAIGKGFKGSFRSVRSEF---ILTEFLKEFIKKTN....IDPS.--LIEDVAIGN----VLNQ
THIM_HUMAN/7-266----VF-----VVAAKRTPFGA.YGGLLKDFTATD---LSEFAAKAALSAGK....VSPE.--TVDSVIMGN----VLQS
H2Q4P9_PANTR/42-299----VV-----IVSATRTPIGS.FLGSLSLLPATK---LGSIAIQGAIEKAG....IPKE.--EVKEAYMGN----VLQG
THIB_CANTR/6-267----VY-----IVSTARTPIGS.FQGSLSSLTYSD---LGAHAVKAALAKVPQ...IKPQ.--DVDEIVFGG----VLQA
A0A023ZJC5_YEASX/5-267----VY-----IVSTARTPIGS.FQGSLSSKTAVE---LGAVALKGALAKVPE...LDASK--DFDEIIFGN----VLSA
G4EU09_BACIU/4-263----TV-----IVSAARTPFGK.FGGVLKEVKAAE---LGGIVMKEALQQAG....VSGD.--DVEGNVMGM----VVQA
B8ZR51_MYCLB/4-263----SV-----IVTGARTPIGK.LMGSLKDFSASD---LGAITIAAALKKAN....VAPS.--IVQYVIIGQ----VLTA
A0A017JC55_ECOLX/4-262----VV-----IVGALRTPIGC.FRGALAGHSAVE---LGSLVVKALIERTG....VPAY.--AVDEVILGQ----VLTA
THIL_PARDE/4-261----AV-----IVSAARTPVGS.FLGSFANLPAHE---LGAIVLKAVVERAG....IDPS.--EVSETILGQ----VLTA
THIL_ZOORA/6-262----.I-----VIASARTAVGS.FNGAFANTPAHE---LGATVISAVLERAG....VAAG.--EVNEVILGQ----VLPA
THIL_THIVI/5-264----IV-----IVDAGRTAIGT.FGGALSALQATD---IGTTVLKALIERTG....IAPE.--QVSEVILGQ----VLTA
D3UAK6_CUPNE/4-263----VV-----IVSAARTAVGK.FGGSLAKIPAPE---LGAVVIKAALERAG....VKPE.--QVSEVIMGQ----VLTA
F0K5D8_CLOAE/4-262----VV-----IASAVRTAIGS.YGKSLKDVPAVD---LGATAIKEAVKKAG....IKPE.--DVNEVILGN----VLQA
A4NPG8_HAEIF/4-263----VV-----IVSAVRTPIGS.FNGALSSVSAVD---LGAIVIQEAIKRAN....IESA.--LVNEVIMGN----VLQA
A0A017JHG0_ECOLX/4-263----CV-----IVSAVRTAIGS.FNGSLASTSAID---LGATVIKAAIERAK....IDSQ.--HVDEVIMGN----VLQA

PF00109

Q18559_CAEEL/1-236MSA.CL-----VGSWAKIPNGED.........GHE---MAENIFLNRNNIA....LLP......VEKNY...----..LS
Q18559_CAEEL/1888-2129ENPIGV-----MAAACRLPGGVS........SPSE---LWELLKIGKNASS....RIPATR.VPTRNTL...----ISGS
Q18559_CAEEL/4241-4474KSEIEI-----VGFDISLPYNQIS.......ENSE---NWQHLKTN.........TVKQKL.HNRSLKQ...----DHAR
Q18559_CAEEL/824-1057TSDINV-----IACDYQFAGVEG.........EKE---LWDTLLTSRLTTG....KIS........DIR...----..KK
FAS_HUMAN/1-239MEEVVI-----AGMSGKLPESEN.........LQE---FWDNLIGGVDMVT......DDDR.RWKAGLY...----GLPR
PKSM_BACSU/2319-2554SRDVAV-----IGISGRYPQAET.........AED---FWNNLKEGRNCIE....EIPKDR.WDWKAYY...----DKEK
PKSL_BACSU/433-687AGDIAI-----IGLAGRYPKAAN.........IHE---FWNNLKEGKDCVS....EIPESR.WDWQRLE...----GITS
PKSR_BACSU/1528-1758ADGIAI-----IGMSGQFPKANS.........VTE---FWDNLVQGKNCVS....EVPKER.WDWRKY....----.AAA
P91871_CAEEL/37-275QDDIVI-----SGVSGRFPRCDN.........VKM---FGDMLLAGEDLVT....EDS.LR.WTPGFCD...----..LP
PKSM_BACSU/393-647GEDIAI-----IGMAGRYPKAKN.........IQE---FWEQLKAGTDCIT....EIPNSR.WEWKESD...----GLDS
PKSJ_BACSU/4588-4821AEGIAV-----VGLSCRFPGAET.........LES---YWSLLSEGRSSIG....PIPAER.WGCKTPY...----....
PKSJ_BACSU/3339-3589FEPVAI-----VGISGRFPGAMD.........IDE---FWKNLEEGKDSIT....EVPKDR.WDWREHY...----GNPD
PKSL_BACSU/4082-4314AEDIAI-----IGLSCRFPGAET.........LEE---YWDLIRDGRSAIA....PVP......PERF....----....
PKSR_BACSU/527-777TEDIAI-----IGVSGRYPMSNS.........LEE---LWGHLIAGDNCIT....EAPESR.WRTSLLK..T----LSKD
PKSF_BACSU/6-249LPEVVV-----TGVGVTASIGQG.........KED---FASSLLSGRHAFD....VMK......RSGRQ...----KDSR
PKSJ_BACSU/1760-2010DDSVAI-----IGISCEFPGAKN.........HDE---FWENLRDGKESIA....FFN..K.EELQRFG...----ISKE
PKSL_BACSU/1926-2181TEEIAI-----IGISGRYPQADN.........IDE---LWEKLRDGRDCIT....EIPADR.WDHSLYY...----DEDK
PKSL_BACSU/2873-3118EDAIAI-----VGMSGRYPGARN.........VRE---YWDNLVHARNAIR....DIPTSR.WDVDKYY...----DPVL
PKSM_BACSU/3529-3768DEPIAI-----IGMSGRFPQADS.........VHE---LWDNLKNGKSCIS....DIPGER.RDWGRA....----...N
OXSM_SCHPO/1-253MKRVVI-----TGLGAVTPLGNG.........VKT---NWRNLIQGKSGIVS.LKGFP.......EYEQ...----.IPS
P95029_MYCTU/2548-2808AFVVSS-----EADARAFVEFDPEHTVIRPVPDST---DWQVIRKAGTEIR.....VPR.....KTKLS...----...R
O67612_AQUAE/2-247KRRVVI-----TGIGAVTPLGTG.........VKK---FWENLVKGVSGVDY.IKSFN......PDEYG...----.IPV
O54142_STRCO/518-803AEPIAI-----VGFGGRFADSPD.........ADG---FWRTMLSGRDRIG....PLPAEL.FDRDLYH...----APGA
Q9ZCH8_RICPR/7-260NKRVVI-----TGLGLVTPVGLN.........VSS---TWKNIVGGVSGIKT.ITEFD......TSKL....----..AC
WA_EMENI/376-626LSKIAI-----IGMSGRFPE...A......DSPQD---FWNLLYKGLDVHR....KVPEDR.WDADAHV...----DLTG
P71718_MYCTU/4-254NDPVVI-----VGLAIEAPGGVE........TADD---YWTLLSEQREGLG....PFPTDRGWALRELF..D----GSRR
FABF_SYNY3/6-249KKRVVV-----TGLGAITPIGNT.........LQD---YWQGLMEGRNGIGP.ITRFD......ASDQ....----..AC
O65933_MYCTU/33-281SEPVAV-----VGMGCRYPGGVD........SPET---LWELVAQGRDAVS....DFPADRGWDVDGLF...----DPDP
Q49933_MYCLE/34-288TEPIAV-----IGMGCRFPGGVN........NPEQ---FWDLLCDGRSGIV....RVPSDR.WDADAYY...----TDDH
O54142_STRCO/38-299AEPIAI-----VGMSALYPGAQG.........VED---LWRLLLADGPAPASGTGPAPGGLGDIEVDVARFG----IPPA
O54155_STRCO/797-1033DEPVAV-----IGIGCRFPGAPD.........PDS---YWRLLRDGRDAVG.....................----EAPA
KAS1_STRCO/3-252RRRVAV-----TGIGVVAPGGIG.........TPQ---FWRLLSEGRTATRR.ISLFD......PSGL....----..RS
O86335_MYCTU/106-346NEPVAV-----IGVGCRFPGDID........GPER---LWDFLTEKKCAIT....AYPD....RGFTN....----....
KASC1_ARATH/60-306KKRVVI-----TGMGLVSVFGND.........VDA---YYEKLLSGESGISL.IDRFD......ASKF....----..PT
CEM1_YEAST/2-265SRRVVI-----TGLGCVTPLGRS.........LSE---SWGNLLSSKNGLTP.ITSLPNYN..EDYKLREKS----IPST
O53901_MYCTU/14-263VTPVAV-----IGMGCRLPGGID........SPDR---LWEALLRGDDLVT....EIPADR.WDIDEYY...----DPEP
KASA_STRCO/45-294KRRVVI-----TGVGVRAPGGNG.........TRQ---FWELLTSGRTATRR.ISFFD......PSPY....----..RS
A4F7N8_SACEN/2032-2280DEPIAI-----VGMACRLPGEVD........SPER---LWELITSGRDSAA....EVPDDRGWVPDEL....----.MAS
A4F7P0_SACEN/31-280.DPIAI-----VSMACRLPGGVN........TPQR---LWELLREGGETLS....GFPTDRGWDLARLH...----HPDP
A4F7P1_SACEN/1486-1734.DPIAI-----VGMACRFPGGVH........NPGE---LWEFIVGGGDAVT....EMPTDRGWDLDALF...----DPDP
B2J2F3_NOSP7/22-302.NPIAI-----VGMASLLPQARN.........LRE---YWQNIVNKIDCIT....DVPSTH.WSVEDYY..D----PNPR
B6H6U0_PENCW/46-295.DDVAI-----IGMACRVPGDVN........SPSA---LWQFLLEKGDASG....DMPSWR.WDPYRQR...----HPRN
B6HS84_PENCW/33-281.NDVAV-----VGMACRVAGGNH........NPEL---LWQSLLSQKSAVS....EIPEMR.WEPYYRR...----DPRN
B8CQB2_SHEPW/32-309.MPVAI-----VGMASIFANSRY.........LNK---FWDLISEKIDAIT....ELPATH.WQKEDYF...----DANK
B8NYX0_ASPFN/9-256..DVAV-----VGMGCRLPGNNN........TPEE---LWRSILQKVDASS....EIPRMR.WEPYQQN...----AQNA
C9R299_AGGAD/1-252MKRVVI-----TGIGAVTAFGKT.........WQE---IKTAFQRKQNAVQ...AKAD.....WAERYP...----ELEA
F2RC16_STRVP/4-243..SVVV-----TGLGVAAPNGLG.........RED---FWASTLGGKSGIG....RLT..R.FDPTGY....----..PA
F6HGM7_VITVI/144-387.RRVVV-----TGMGVMSPIGHE.........PDS---FYNNLLEGVSGIS....EIES...FDCSHF....----..PT
G0FS55_AMYMS/632-879.EPIAI-----VGMACRLPGGVA........SPED---LWRLVAERVDAVS....EFPGDRGWDLDSLI...----DPDR
G0FS56_AMYMS/1717-1966.EPIAI-----VGMACRLPGGVM........SPDD---LWRMVAEGRDGMS....PFPGDRGWDLDGLF...----DSDP
G0FS56_AMYMS/35-284.EPVAI-----VSMACRYAGGIR........GPED---FWRVVSEGADVYT....GFPEDRGWDVEGLY...----HPDP
G0FS57_AMYMS/36-283.EPIAI-----VGMACRLPGGVT........GPGD---LWRLVAEGGDAVS....GFPTDRCWDLDTLF...----DPDP
G0FS59_AMYMS/1702-1949.EPIAI-----VGMACRLPGGVT........DPEG---LWRLVRDGLEGLS....PFPEDRGWDLENLF...----DDDP
G3XDA2_PSEAE/4-245.RRVVI-----TGMGMLSPLGLD.........VPS---SWEGILAGRSGIA....PIE..H.MDLSAY....----..ST
G6CI33_DANPL/25-260..EVLI-----TGISGYFPDSDS.........VLH---LQENLFNKVDLIS.....GDARR.WKLAHPE...----..IP
I6X8D2_MYCTU/118-366..DIAI-----VGLSTRFPGEMN........TPEQ---TWQALLEGRDGIT....DLPDGR.WSEFLEE..P----RLAA
I6Y231_MYCTU/6-255.TPVAV-----IGMGCRLPGGIN........SPDK---LWESLLRGDDLVT....EIPPDR.WDADDYY...----DPEP
K4RAF8_9ACTO/6-250.RTVVV-----TGIGATTPLGGD.........AAS---TWEGLVTGRSGVK....ALEQ.E.WAADQA....----...V
N4VDN9_COLOR/383-631..KLAI-----VGMAGRFPDAAS.........HEK---LWELLAKGLDVHR....VVPADR.FPVATHY...----DITG
O25284_HELPY/1-247MRRIVV-----TGMGMINSLGLN.........KED---SFLAIAKGECGIK....HIES...FDASAF....----..PV
NODE_RHIME/2-236DRRVVI-----TGMGGLCGLGTD.........TTS---IWKWMREGRSAIG....PLL......NTELH...----GLKG
FABF_ECOLI/4-245.RRVVV-----TGLGMLSPVGNT.........VES---TWKALLAGQSGIS....LID..H.FDTSAY....----..AT
PKS15_MYCTU/47-294.EPVAV-----VGIGCRFPGGVD........GPDG---LWDVVSAGRDVVS....EFPTDRGWDVEGLY...----DPDP
FAB2_MYCTU/13-253...VVV-----TGIAMTTALATD.........AET---TWKLLLDRQSGIR....TLDD....PFVEEF...----DLPV
FAB1_MYCTU/13-253..SVVV-----TAVTATTSISPD.........IES---TWKGLLAGESGIH....ALED....EFVTKW...----DLAV
PPSE_MYCTU/6-262.NAIAV-----VGMAGRFPGAKD.........VSA---FWSNLRRGKESIV....TLSEQE.LRDAGV....----.SDK
PPSA_MYCTU/101-351DEPIAV-----VGMGCRFPGGIS........CPEA---LWDFLCERRSSIS....QVPPQR.WQPFEGG...----PPEV
PHAS_MYCTU/25-274.TPVAV-----IGMACRLPGGID........SPEL---LWKALLRGDDLIT....EVPPDR.WDCDEFY...----DPQP
Q0CJ59_ASPTN/45-294.NEVAV-----VGMACRLAGGNN........SPEE---LWQSILNRKDASG....EIPSMR.WEPYYRR...----DIRN
Q2UG06_ASPOR/373-621..KLAI-----VSMSGRFPESPT.........TES---FWDLLYKGLDVCK....EVPRRR.WDINTHV...----DPSG
Q4KCY8_PSEF5/40-290.EPIAV-----VGLGCRLPGSAD........TPKR---LWSLLKHATDAVG....DMPSDR.LYGTDYY...----HPDP
Q4KCY9_PSEF5/1034-1273..SVAV-----VAMACRFPQADS.........PEA---LWKLMLEQTDTVG....PVP......PSRL....----..AG
Q5CUM8_CRYPI/886-1132..DIVV-----VGMSCSFPGGSS........TPGE---FWSLLQSGVDAIG....EIPKSR.WNIDEYY...----STDL
Q7APV9_MYCLE/33-282.EPIAV-----VGIGCRFPGDVT........GPDS---FWDLLIDGRNAIS....RVPADR.WDADAFY...----DPDP
Q7RVN4_NEUCR/1-262MRRVVV-----TGLGAITPLAVG.........IRP---TWRRLLDSHSGIV....SVAD.L.EPQDKWK...----ELTS
Q87N23_VIBPA/4-245.RRVVV-----TGMGMLSPVGNT.........VES---SWKALLEGKSGIV....NIE..H.FDTTNF....----..ST
Q87W69_PSESM/39-289.EPIAI-----VAMGCRLPGGLA........SPEA---LWRLVEAGEALSN....ALPSDRGWQLDSLF...----PADS
Q87W70_PSESM/593-844DEPIAI-----IGMSCRYPGGAN........SPEA---LWTLLMQERDAIS....EYPTDRGWDTTKLY...----DSEP
Q8YLE3_NOSS1/10-289.AKIAI-----VGMDAFFGECNG.........LDA---FERSIYDGKQHFI....TLPPKRWYGIDEQK..D----LLQE
Q9CB70_MYCLE/36-285.EPVAV-----VGIGCRFPGNVT........GPDS---FWQLLVDGGDAIS....EVPPDR.WDADAFY...----DPDP
Q9I3B2_PSEAE/1-241MRRVVI-----TGLGIVSCLGND.........KDT---VSANLRAGRPGIR....FNP......SYAEM...----GLRS
Q9Z373_YERPE/27-276.EPVAV-----IGYACHFPESPD.........GET---FWQNLLEGRECSR....RFTREE.LLAVGL....----.DAA

PF07451

A6TVT6_ALKMQ/4-333GRQTWIFDSKPTIVASAAVGGPFEAQGPLREDFDI---LHEDIWLGQDSFEKAERKLLEQACEIAIDKAGMKKE..DIHF
A6LRM0_CLOB8/7-335GNQTVKLDNPPKIISTHSIVGPKEGEGPLSKYFDE---ILNDDMLGKESFEKAESEMMFTAISQALKKGNLKET..DIDY
Q9KCK2_BACHD/4-332GRQTWEFENRPVILSSAATAGPFEANGPLADDFDI---LFEDMWLGEDSFEKAQKVLIEEAAKTAIEKAGIQND..DIQF
Q5WH23_BACSK/4-331SHRTMTFSNPVYIQSSGTAVGPKEGAGPLAGSFDY---RYTDIYCDEKSWEMAERALMKQAIKQCLTKNHLSID..SVDL
B8I4W4_CLOCE/7-335GKQTVILKNPPSIKATASFVGPKEGKGPLKDDFDY---IITDELWGEDSWEKAESKLVRETFAKVLQKAKLSND..QIDY
A6TQB0_ALKMQ/8-336GNQTIKLLNPPSIISTASIVGPKEGQGPLAKYFDQ---IIQDDLFGEKSWERAESKLIKETVKLALKKAGLHLN..DIDY
A4J4J1_DESRM/4-332GHQTWVFPSKPTILATGTVVGPFEGKGPLANDFDL---IHGDLWLGQDSYEKAEKKMLEEACEVAVNKSGLQKQ..DIQF
Q8ERC5_OCEIH/4-332GHRTWEFINRPSIITTGTVGGPFEANGSIPEAFDT---LHEDMWIKQDSFEKAQQKMLEEACQIAIKKSPIEKE..NVEF
Q2RIQ1_MOOTA/8-336GQHTLQFANPPVIVATASVVGPKEGEGPLGDTFDM---VIDDSYFGEETWEKAERKMLEEAVKMVIAKAQLKPQ..DIDF
Q67T05_SYMTH/7-337GAQTVRLEQPPVIVGAAAVAGPVEAQGPLGHEFDL---TYPDLTVGQDSFEKAERQMMIDACNLALRRAGIQQKPPAVDY
Q189X1_PEPD6/7-335GKRTVKLENKPTIISTGTIVGPKEGEGPLKDYFDM---IMTDDLYGEKTWELAESKMVETASQQAIQKAGKKLS..DVNY
A0PZS9_CLONN/6-338GKQTIKLENKPRIIATTSVVGPKEGEGPLKDYFDI---ILSDDLNGKDSFEKAESSIMYRAVQETLKKSNLEEK..DIHY
Q0AZ98_SYNWW/8-335GAQTLVFDQPPVITSWASIAGPKEGQGPWGQDFDW---SMEDYLFGEESWEKAENKMLRETVKKALNKRNFDEA..DTEI
Q891W9_CLOTE/6-334GKQTLKLETKPKLISTYSIVGPKEGEGPLNMYFDK---IIQDDLAGKDSFEKAESNFLYTAVTESIKNANLQED..DIDI
A5D2Y8_PELTS/8-335GLQTVWFQSPPVIISAASVVGFREGEGPLGKTFDK---VVYDSYYGEKTWEKAEQRMMLDAMKKALQKAGLQEK..DVDF
A8MHP8_ALKOO/7-335GSQTIKLLNPPSIISAGSIVGPKEGDGPLAQYFDK---IVQDDLLGEDSWEMAESALVKEAANIALGKVNLTLD..DMEY
A5N8K2_CLOK5/4-332GHQSWVFESKPAIIGCSTVGGPFEAKGALAKEFDL---LHEDIWIGQDSFEKAEKKLLEEACDLAVKNSKLKNE..NINF
Q97GR2_CLOAB/6-335GSQTARIDSKPRIVSAVSMVGPKEGRGPLKDYFDI---ILSDDMNGEESFEKAESNMLYTVITEVIKKSNLTEN..DIDY
A4XFR0_CALS8/5-335GKSTFKFENCPIISDCFTIVGKKEGEGPLGLFFDM---VVEDEYAGQKSWELAEGKLLNIAISKLIQKSGFTPD..EVDL
A9KI33_CLOPH/13-353GKQSVQFSNPPAIIGCASVAGQKEGEGPLGAFFDV---IEEDPMFGQKTWEEAESKMLGMAVDVAIHNAGLKKS..DIRY
Q9KCM9_BACHD/5-332RKQTLKFDKPVYIESTGTAVGPMEGAGPLRHTFDQ---AYDNLYCGEDSWELAERRLMQDAIEHCLKKVHVETE..RVSF
Q5WGZ4_BACSK/4-332GKQSWIFDSKPVITATGTVGGPFEANGAIPEAFDL---LHDDLWIGEDSYEKAQTVLIEGAVTETLKKASLKKE..DVNF
A5I6G6_CLOBH/6-334GEQTFKLDSKPKIIGTTSIVGPKEGEGPLKDYFDV---ILKDDLFNQESFEKAESAMLSTAISDVIKKCNLKDK..DIDM
SP5AD_BACSU/5-332GKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDK---TYDEMHCNQKSWEMAERQLMEDAVNVALQKNNLTKD..DIDL
Q24V53_DESHY/7-333GNQTVVFSNPSVILSSYSVVGPMEGQGPLGKTFNK---VWQDNINGNTSWEVAETKMLEEAMEGAVKQSQIKKD..EIDY
Q5KXJ7_GEOKA/5-332GKQTWVFDDGVYIQAAAAAVGPLEADGPLGSYFDV---CHRDLYCGEATWELAERRLMREAVDCCLQKAGVSAE..EVDL
Q5L1P1_GEOKA/4-332GHRTWVFANKPAIIATAAVGGPFEANGRLAEDFDL---LHEDLWLGEESYEKAHRVLMEEAAFQAMEKAGLEKE..KVQF
Q81MG1_BACAN/5-333GKQTWVFQNDIYVNATGTAVGPKEAEGPLGKEFDI---SYDDLHCGERNWELAERRLMSDSIQQVMQKANVETS..QIDF
Q81X67_BACAN/4-332GHRTWVFENKPVIISTGVVGGPFEAKGKIPEDFDT---LHEDLWLGQDSYEKAHKILFEEACSRATEKANLRKD..DIQF
Q8RAA4_THETN/7-333GAQTVKFKNPPSIIAGGTIVGPKEGEGPLRDYFDM---ILIDDTYGEKSWEKAESKMFQDAVNLALKKANLKIS..DIDY
Q8XIR8_CLOPE/9-337GSQTIELKSKPRIIATYSVVGPREGQGPLKEYFDK---ILQDDCNGCESFEKAESSLMITAIEGVIKKGNVKEE..DVDY
R6N984_9CLOT/6-333GRYTVVMERKPAILGYAAICGKKESEGPLGAAFDL---TYEDTTLGEKSWEKAESRLQKEAVNCAMKKAGVTAG..AVDY
R7D7M0_9FIRM/8-352GKASISFSRPVYIQSCASVVGPKEGDGPLKNCFDM---ICDDPMFGEKKWEAAESAMQKEAAVLAIGKAGLTPD..DIRF
R7FR34_9FIRM/4-332GKQSIAFEVSPYLEESASVVGKKEGEGPLGGMFDM---VAEEDLFGENTWEEAESTMQKEACLLALGKAHLAPE..SIRY
U5LA28_9BACI/4-335GKQSWIFQNRPVILSTGVSGGPFEAKGNLARDFDI---LHDDLWMGEDSYEKAHRVLMEEAAKTAMQKGSVEKD..DVQF

PF13723

X2H9N4_9NEIS/21-241--------------------------------WQK....WVAQRR...NIG-------------------------DLPA
Q7MMI9_VIBVY/35-248--------------------------------WLE....WANTGS...YPE-------------------------SFDI
Q5E6K7_VIBF1/27-240--------------------------------WLE....WRENNF..TWPE-------------------------NEKA
W0PHW4_9BURK/37-246--------------------------------EHN....RAQNPQ......-------------------------..EA
G0A1B0_METMM/37-247--------------------------------...........PGGQTLPN-------------------------QTGT
A6W243_MARMS/22-235--------------------------------WKD....WLYNQN..ELPT-------------------------DSAK
K4KXD4_SIMAS/26-238--------------------------------.AQ....WAAGER...APA-------------------------ESDQ
Q5F738_NEIG1/7-227--------------------------------WRQ....WAECPD...FAD-------------------------GLPD
F6AHI4_PSEF1/21-233--------------------------------WLA....WSKAPE..RLAD-------------------------SGEQ
V6EZ88_9PROT/10-227--------------------------------WAA....WDGHAD.VLAVG-------------------------GMVP
B2JEK1_BURP8/13-228--------------------------------WSS....WPAVAA......-------------------------..VA
Q8E9B8_SHEON/23-242--------------------------------WQT....WCKH........-------------------------.LAE
Q3IC51_PSEHT/11-232--------------------------------WIQ....PEQRQIESDHWY-------------------------DNSP
R7ICN1_9BURK/24-238--------------------------------WLP....WAESGAGIAPAA-------------------------PFTV
M4U150_9GAMM/24-238--------------------------------WHD....WSSSLM..QWPS-------------------------QLTP
A8AR40_CITK8/23-238--------------------------------WQQ....WSREPY....AI-------------------------DPAA
Q1QTW3_CHRSD/12-232--------------------------------WRA....WQPGRRDTAHSR-------------------------LSVE
Q6CYK1_PECAS/23-238--------------------------------WLT....WSRVPA....AI-------------------------NAEQ
Q088U8_SHEFN/23-254--------------------------------WLQ....WQQPNGNLAPKP-------------------------DSPP
H2IXQ6_RAHAC/23-237--------------------------------WIQ....WAQCSD..INTF-------------------------SGEN
Q6LKR1_PHOPR/24-249--------------------------------WQE....WASNQK..RWPE-------------------------PLTP
C9R2B5_AGGAD/33-245--------------------------------.....AHWQQNQA....NF-------------------------ADFS
E3HL09_ACHXA/22-238--------------------------------WLE....WAEHPF..CPIG-------------------------NQNP
Q4KJF9_PSEF5/22-236--------------------------------WQA....WSRQPA..LPEN-------------------------SDAA
Q87V50_PSESM/22-236--------------------------------WRQ....WSLNPT..LLET-------------------------SDAA
Q13V69_BURXL/13-242--------------------------------WSS....WPAAAS......-------------------------..AA
A8GA54_SERP5/11-225--------------------------------WRQ....WATGNA.ITAKY-------------------------PGVL
A0KNN6_AERHH/22-235--------------------------------WQA....WAQQGR...WPV-------------------------DPPF
A9ICW7_BORPD/22-238--------------------------------WRE....WACSPYCPYPAE-------------------------TEEL
D5CEN4_ENTCC/23-238--------------------------------WQA....WSRQSD....AI-------------------------DPAA
B2FNB7_STRMK/22-243--------------------------------WLG....WAEAPY...LPH-------------------------GGDT
F0LS02_VIBFN/28-238--------------------------------WKA....WSQTGV...WPQ-------------------------GAI.
A3QIS7_SHELP/23-236--------------------------------WQT....WPTPPADAEQLA-------------------------LAAP
B8CHL8_SHEPW/21-234--------------------------------WQA....WPAAISDIGATA-------------------------TAAP
M4RB67_BIBTR/27-246--------------------------------WQQGEAFWQANAE....RW-------------------------ETVS
G4SXC9_META2/10-226--------------------------------WSV....WPPLPL...QPA-------------------------NPAQ
F7YP97_VIBA7/32-242--------------------------------WQN....WAREEI...WPD-------------------------DNTL
G0AK33_COLFT/32-258--------------------------------WLG....WAAQPYAIEGSG-------------------------DA..
D8MQL2_ERWBE/23-238--------------------------------WQQ....WACQTP....EI-------------------------DASR
G8AJ88_AZOBR/25-240--------------------------------WRA....WAGAPA...MPD-------------------------DAPP
B7VKK6_VIBSL/28-249--------------------------------WQT....WSTHLD...WPQ-------------------------NGST
B0URR9_HISS2/28-245--------------------------------WQQGEQYWLESVA....KR-------------------------ETVA
Q1LF35_RALME/48-282--------------------------------WLA....WSRAPW...LPE-------------------------GADL
A7ZFF8_CAMC1/20-217--------------------------------LAR....YKKEF.......-------------------------....

PF02797

O81305_ARATH/238-383AMQQFLPQTQGVIDGRL--SEEGITFKLGRDLPQKIEDNVEEFCKKLVAKA-----------------------------
O23674_ARATH/245-393AVQQFLPGTQNVIEGRL--TEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-----------------------------
F2CYQ0_HORVD/240-390ASQTILPESEGAIDGHL--TEAGLTIHLLKDVPGLISENIEQALEDAFEPL-----------------------------
F6HP18_VITVI/238-388AAQTFIPNSAGAIAGNL--REVGLTFHLWPNVPTLISENIEKCLTQAFDPL-----------------------------
M1CL74_SOLTU/241-391AAQTFVPNGDCHLALHL--REMGLTFHCTRDVPPTIAKNVESCLIKAFEPL-----------------------------
Q7X795_ORYSJ/244-388STQEFLPGTDKVIDGKI--TEEGINFKLGRDLPEKIENRIEGFCRTLMDRV-----------------------------

PF08541

Q8ED66_SHEON/282-372-----------------------------------------------LAEQ-----------------------------
Q74CS1_GEOSL/237-326-----------------------------------------------LDAN-----------------------------
Q7CTU0_AGRT5/239-328-----------------------------------------------LHEA-----------------------------
FABH_PROMM/246-335-----------------------------------------------LKAT-----------------------------
Q73Q42_TREDE/222-311-----------------------------------------------LQKE-----------------------------
FABH_PSEAE/233-322-----------------------------------------------LDRV-----------------------------
FABH_CHRVO/230-319-----------------------------------------------LAEA-----------------------------
FABH_DESVH/241-330-----------------------------------------------LARN-----------------------------
Q5YPR0_NOCFA/241-333-----------------------------------------------IAAA-----------------------------
FABH2_STRCO/230-319-----------------------------------------------AAHA-----------------------------
Q5WEX8_BACSK/220-309-----------------------------------------------LSKA-----------------------------
FABH_NOSS1/239-328-----------------------------------------------LFEA-----------------------------
Q67RA0_SYMTH/248-336-----------------------------------------------CAQG-----------------------------
Q5NF70_FRATT/234-323-----------------------------------------------IQEA-----------------------------
Q7M7Z5_WOLSU/238-327-----------------------------------------------LERN-----------------------------
FABH2_VIBPA/235-324-----------------------------------------------LKAS-----------------------------
Q7NZ26_CHRVO/282-372-----------------------------------------------LGSL-----------------------------
FABH_AQUAE/220-309-----------------------------------------------LEKA-----------------------------
FABH1_STRAW/264-354-----------------------------------------------LDAA-----------------------------
FABH_TROWT/231-321-----------------------------------------------LDIN-----------------------------
Q63N14_BURPS/258-347-----------------------------------------------LRKT-----------------------------
FABH_HELHP/239-328-----------------------------------------------LNTH-----------------------------
FABH3_STRCO/240-329-----------------------------------------------LDRA-----------------------------
FABH_PROMP/245-334-----------------------------------------------FKKT-----------------------------
Q65LQ9_BACLD/237-326-----------------------------------------------LAQA-----------------------------
FABH_CLOAB/234-323-----------------------------------------------IEDS-----------------------------
FABH_AROAE/232-321-----------------------------------------------LDQA-----------------------------
FABH_ARATH/314-403-----------------------------------------------LQKA-----------------------------
Q5FUN7_GLUOX/235-324-----------------------------------------------LEAN-----------------------------
Q9L1V9_STRCO/246-337-----------------------------------------------LAEA-----------------------------
FABH2_STRAW/225-314-----------------------------------------------CERA-----------------------------
Q87XT2_PSESM/282-372-----------------------------------------------LQDN-----------------------------
Q884Y8_PSESM/221-307-----------------------------------------------LSES-----------------------------
FABH2_LACPL/239-328-----------------------------------------------LMQA-----------------------------
FABH2_BACSU/234-323-----------------------------------------------LHKA-----------------------------
FABH_RUEPO/234-323-----------------------------------------------LDKA-----------------------------
FABH_HAEDU/227-316-----------------------------------------------LQAN-----------------------------
Q7TTZ7_RHOBA/241-330-----------------------------------------------LTEN-----------------------------
FABH_RHOBA/256-345-----------------------------------------------LRAA-----------------------------
Q7NV97_CHRVO/234-323-----------------------------------------------MDAT-----------------------------
Q5ZV11_LEGPH/238-327-----------------------------------------------FAKA-----------------------------
Q97KV2_CLOAB/245-334-----------------------------------------------LKKN-----------------------------
Q8XTB9_RALSO/282-372-----------------------------------------------LQAL-----------------------------
Q6A930_PROAC/241-331-----------------------------------------------IAEA-----------------------------
Q5SL76_THET8/230-319-----------------------------------------------IEKA-----------------------------
Q7N8H1_PHOLL/221-311-----------------------------------------------LQQA-----------------------------
FABH2_VIBVY/235-324-----------------------------------------------LAHA-----------------------------
Q82PP5_STRAW/243-333-----------------------------------------------LSEA-----------------------------
FABH_PROMA/245-334-----------------------------------------------LQTY-----------------------------
FABH_BLOFL/229-318-----------------------------------------------LHAN-----------------------------
Q8RHZ0_FUSNN/221-309-----------------------------------------------LENN-----------------------------
Q7X8V9_ORYSJ/337-426-----------------------------------------------LEEA-----------------------------
FABH_CLOTE/244-333-----------------------------------------------LKDS-----------------------------
Q88ES4_PSEPK/221-308-----------------------------------------------LDAS-----------------------------
Q88EC1_PSEPK/299-389-----------------------------------------------LQEN-----------------------------
FABH_THETN/240-329-----------------------------------------------LERC-----------------------------
FABH_STRMU/234-325-----------------------------------------------IRKS-----------------------------
FABH1_BACAN/219-308-----------------------------------------------LDKA-----------------------------
FABH_STRP1/233-324-----------------------------------------------MAQS-----------------------------
FABH_SYNY3/241-330-----------------------------------------------LFKA-----------------------------
FABH_LACLA/234-325-----------------------------------------------LEKA-----------------------------
FABH5_STRCO/237-326-----------------------------------------------LDRT-----------------------------
Q5YN70_NOCFA/251-341-----------------------------------------------CDRL-----------------------------
FABH2_BACHD/236-325-----------------------------------------------LEKA-----------------------------
Q5YNJ2_NOCFA/253-343-----------------------------------------------LEVS-----------------------------
Q885B9_PSESM/249-338-----------------------------------------------LFDD-----------------------------
Q82HI7_STRAW/252-343-----------------------------------------------IEDA-----------------------------
Q6FAK4_ACIAD/280-370-----------------------------------------------LEKN-----------------------------
Q6DAZ3_PECAS/249-337-----------------------------------------------LDAS-----------------------------
FABH_SYMTH/239-328-----------------------------------------------VEKA-----------------------------
Q8CV20_OCEIH/48-137-----------------------------------------------LERN-----------------------------
Q9HYV7_PSEAE/259-349-----------------------------------------------LAAN-----------------------------
FABH_GEOKA/219-308-----------------------------------------------LEKA-----------------------------
FABH2_VIBCH/235-324-----------------------------------------------LARS-----------------------------
Q6AQA3_DESPS/255-342-----------------------------------------------FAAP-----------------------------
FABH1_LACPL/238-323-----------------------------------------------IASA-----------------------------
Q8EDA9_SHEON/231-320-----------------------------------------------LEKC-----------------------------
Q6LQM2_PHOPR/234-323-----------------------------------------------LHRA-----------------------------
Q63PP7_BURPS/254-343-----------------------------------------------LAFA-----------------------------
FABH_COXBU/230-319-----------------------------------------------IEKS-----------------------------
FABH2_BACAN/235-324-----------------------------------------------LHTA-----------------------------
Q5NL87_ZYMMO/234-323-----------------------------------------------LTAS-----------------------------
FABH_THEEB/239-328-----------------------------------------------LHRA-----------------------------
Q5LUY4_RUEPO/282-372-----------------------------------------------MAAE-----------------------------
Q98AW4_RHILO/238-327-----------------------------------------------LAAA-----------------------------
Q6AET2_LEIXX/245-335-----------------------------------------------LDAA-----------------------------
Q81JE9_BACAN/240-329-----------------------------------------------LMDT-----------------------------
Q6MR21_BDEBA/243-332-----------------------------------------------LDRI-----------------------------
FABH_STRA5/232-323-----------------------------------------------IETS-----------------------------
FABH_BORPE/239-328-----------------------------------------------CAEA-----------------------------
FABH_NITEU/229-318-----------------------------------------------LQAN-----------------------------
Q98K75_RHILO/223-313-----------------------------------------------LAEH-----------------------------
Q9K3G9_STRCO/229-319-----------------------------------------------LEAA-----------------------------
FABH_GLOVI/237-326-----------------------------------------------LAAC-----------------------------
Q8EG66_SHEON/260-347-----------------------------------------------LAQR-----------------------------
Q63PP9_BURPS/255-344-----------------------------------------------LALA-----------------------------
Q7NZW4_CHRVO/228-317-----------------------------------------------LDAL-----------------------------
Q8RC85_THETN/250-338-----------------------------------------------LRKS-----------------------------
Q6MAF5_PARUW/240-329-----------------------------------------------LVRA-----------------------------
Q5QWT4_IDILO/232-321-----------------------------------------------FQET-----------------------------
Q67MB7_SYMTH/254-342-----------------------------------------------AEQS-----------------------------
FABH1_DEIRA/233-322-----------------------------------------------LQKS-----------------------------
Q9I4X1_PSEAE/253-342-----------------------------------------------LEKA-----------------------------
FABH1_VIBCH/227-316-----------------------------------------------LKAN-----------------------------
Q73S66_MYCPA/245-335-----------------------------------------------CDRI-----------------------------
FABH_NEIG1/231-320-----------------------------------------------IEEA-----------------------------
Q63N13_BURPS/243-332-----------------------------------------------LDKH-----------------------------
FABH_PECAS/228-317-----------------------------------------------LQAA-----------------------------
FABH_CLOPE/235-324-----------------------------------------------LEKE-----------------------------
Q820X4_COXBU/239-326-----------------------------------------------LSKR-----------------------------
FABH_PORGI/240-327-----------------------------------------------MERN-----------------------------
Q82NC9_STRAW/244-334-----------------------------------------------CRRL-----------------------------
FABH_RHIME/234-323-----------------------------------------------FEAT-----------------------------
FABH_RALSO/237-326-----------------------------------------------LALA-----------------------------
Q5ZTD0_LEGPH/246-335-----------------------------------------------LKEL-----------------------------
Q82KT2_STRAW/240-329-----------------------------------------------AELA-----------------------------
Q8F686_LEPIN/233-322-----------------------------------------------LEKN-----------------------------
FABH_OCEIH/221-310-----------------------------------------------IEQL-----------------------------
FABH_SHEON/230-319-----------------------------------------------LRLN-----------------------------
FABH_DESPS/235-324-----------------------------------------------MEEV-----------------------------
FABH_XANCP/236-325-----------------------------------------------LAAN-----------------------------
FABH_CHLTE/239-328-----------------------------------------------MQRN-----------------------------
FABH_BURPS/240-329-----------------------------------------------LSKA-----------------------------
Q8RC81_THETN/237-325-----------------------------------------------VEKA-----------------------------
Q5YNV7_NOCFA/248-338-----------------------------------------------IDRA-----------------------------
FABH_METCA/232-321-----------------------------------------------LEQN-----------------------------
FABH2_DEIRA/239-328-----------------------------------------------MRQA-----------------------------
PQSD_PSEAE/242-329-----------------------------------------------LAAH-----------------------------
B9KJ28_ANAMF/234-322-----------------------------------------------LESS-----------------------------
D5AUL7_RHOCB/235-324-----------------------------------------------LAKA-----------------------------
D6D672_9BACE/241-327-----------------------------------------------.EKN-----------------------------
FABH_HELPY/239-327-----------------------------------------------LEKN-----------------------------
FABH_CHLTR/238-325-----------------------------------------------.TEA-----------------------------
FABH_STRR6/234-323-----------------------------------------------.DES-----------------------------
FABH_MYCTU/242-332-----------------------------------------------MDAA-----------------------------
Q2YKB4_BRUA2/237-325-----------------------------------------------LASA-----------------------------
FABH_BRUA2/235-323-----------------------------------------------.EAT-----------------------------
FABH_SYNE7/244-331-----------------------------------------------..HA-----------------------------
FABH_STAEQ/223-311-----------------------------------------------.EKA-----------------------------
Q5LAY0_BACFN/240-327-----------------------------------------------IERN-----------------------------
FABH_STRT2/237-320-----------------------------------------------....-----------------------------
Q5ZTD4_LEGPH/263-346-----------------------------------------------....-----------------------------
FABH_BARHE/236-324-----------------------------------------------.AAA-----------------------------
Q79ZF6_STRAW/239-330-----------------------------------------------CAQA-----------------------------
Q79ZR7_STRAW/221-310-----------------------------------------------LSRA-----------------------------
Q7KWI9_PLAF7/283-371-----------------------------------------------.QHS-----------------------------
Q81RV7_BACAN/243-331-----------------------------------------------LRKS-----------------------------
Q8P810_XANCP/349-438-----------------------------------------------LRDA-----------------------------
FABH_FUSNN/237-326-----------------------------------------------LEKA-----------------------------
FABH_LISMO/221-310-----------------------------------------------LERA-----------------------------
FABH_CAMJE/230-318-----------------------------------------------LAKN-----------------------------
FABHL_CAMJE/252-337-----------------------------------------------LEFS-----------------------------
FABH_RICPR/230-317-----------------------------------------------..AN-----------------------------
V6KTJ6_STRRC/242-332-----------------------------------------------LHEA-----------------------------

PF02803

THIL_YEAST/274-397-------------LKPL--AIIKGWGEAAHQP.ADFTWAPSLAVPKALKHA-----------------------------
FADA_ECOLI/261-386-------------LKPR--ARVRSMAVVGCDP.SIMGYGPVPASKLALKKA-----------------------------
YKA3_CAEEL/305-445-------------YKPK--AYLRDYLYVAQDPKDQLLLSPAYVIPKLLDKA-----------------------------
THIL_HUMAN/306-426-------------VTPL--ARIVAFADAAVEP.IDFPIAPVYAASMVLKDV-----------------------------
THLA_CLOAB/269-391-------------VKPL--AKIVSYGSAGVDP.AIMGYGPFYATKAAIEKA-----------------------------
ATOB_ECOLI/270-392-------------LTPL--ARIKSYASGGVPP.ALMGMGPVPATQKALQLA-----------------------------
THL_BACSU/270-392-------------KRPL--ATILGFSTTGMPA.HELAAAPGFAINKLLKKN-----------------------------
THIL_CUPNH/270-392-------------LTPL--ATIKSYANAGVDP.KVMGMGPVPASKRALSRA-----------------------------
THIM_HUMAN/273-395-------------FTPL--ARIVGYFVSGCDP.SIMGIGPVPAISGALKKA-----------------------------
THIKA_RAT/298-421-------------LPIL--GVLRSYAVVGVPP.DIMGIGPAYAIPAALQKA-----------------------------
YQEF_ECOLI/269-391-------------LPVL--ARIRAFASVGVDP.ALMGIAPVYATRRCLERV-----------------------------
THIK_YEAST/296-416-------------LPVL--GRYIDFQTVGVPP.EIMGVGPAYAIPKVLEAT-----------------------------
FADA4_MYCLE/270-392-------------LTWL--VEIGAHGVVAGPD.STLQSQPANAIKKAVDRE-----------------------------
THIK_YARLI/291-413-------------QPIL--AKFVHCKTVGVPP.ELMGIGPAYAIPAVLEDL-----------------------------
ECHB_RAT/332-472-------------YKPK--AYLRDFIYVSQDPKDQLLLGPTYATPKVLEKA-----------------------------
ATOB_HAEIN/270-392-------------LKAI--AKIRSYASGGVDP.SVMGLGPVPATQKALKKA-----------------------------
A1B3M4_PARDP/268-390-------------LTPL--ARIASYATAGVDP.QIMGSGPIPASRRALEKA-----------------------------
C5M4S8_CANTT/289-406-------------..IV--GKYVLCSTAGVPP.EIMGVGPAYAIPEVLKRT-----------------------------
C5M6V3_CANTT/274-396-------------LKPL--AKVSGWGEAARTP.FDFTIAPALAVPKAIKHA-----------------------------
I3YE91_THIV6/271-393-------------LTPM--ARLVAFASAGVDP.AIMGTGPIPASTKCLEKA-----------------------------
FADA_PSESM/266-390-------------.QPL--AVIRSMAVAGVDP.AIMGYGPVPATQKALKRA-----------------------------

PF02801

PKSJ_BACSU/4829-4945-----------------------------------------------YAVV-----------------------------
PKSL_BACSU/4322-4438-----------------------------------------------YAVI-----------------------------
Q18559_CAEEL/5488-5604-----------------------------------------------HFVI-----------------------------
Q18559_CAEEL/244-354-----------------------------------------------HCEC-----------------------------
P95029_MYCTU/2816-2942-----------------------------------------------LAVV-----------------------------
PKSF_BACSU/257-367-----------------------------------------------YAAL-----------------------------
P74017_SYNY3/244-356-----------------------------------------------YGEI-----------------------------
O67612_AQUAE/256-371-----------------------------------------------YAEL-----------------------------
FABF_BACSU/254-369-----------------------------------------------YGEI-----------------------------
FABF_SYNY3/258-373-----------------------------------------------YGEM-----------------------------
Q9ZCH8_RICPR/269-384-----------------------------------------------YCEV-----------------------------
CEM1_YEAST/273-391-----------------------------------------------ISEL-----------------------------
OXSM_SCHPO/262-380-----------------------------------------------YAEI-----------------------------
FABB_HAEIN/253-361-----------------------------------------------YAEI-----------------------------
O84775_CHLTR/256-371-----------------------------------------------FAEV-----------------------------
KASC1_ARATH/315-429-----------------------------------------------VAEY-----------------------------
O54149_STRCO/253-365-----------------------------------------------RARL-----------------------------
Q9Z4Y3_STRCO/251-363-----------------------------------------------LGRL-----------------------------
Q93458_CAEEL/101-214-----------------------------------------------LAEV-----------------------------
KASA_STRCO/303-418-----------------------------------------------HAEI-----------------------------
KAS1_STRCO/261-376-----------------------------------------------YCEV-----------------------------
KASB_STRCO/251-361-----------------------------------------------YGEL-----------------------------
KAS2_STRCO/264-377-----------------------------------------------RATV-----------------------------
FAS_HUMAN/243-360-----------------------------------------------YATI-----------------------------
FAS_CHICK/243-360-----------------------------------------------YATI-----------------------------
P91871_CAEEL/279-396-----------------------------------------------YATV-----------------------------
WA_EMENI/634-754-----------------------------------------------LGVI-----------------------------
O54142_STRCO/811-926-----------------------------------------------FGVL-----------------------------
P71718_MYCTU/262-379-----------------------------------------------LAEV-----------------------------
O65933_MYCTU/289-405-----------------------------------------------LALV-----------------------------
O53901_MYCTU/271-385-----------------------------------------------LAVI-----------------------------
Q49933_MYCLE/296-416-----------------------------------------------LAIV-----------------------------
O86335_MYCTU/354-472-----------------------------------------------LAIL-----------------------------
O54155_STRCO/1041-1159-----------------------------------------------HAVL-----------------------------
Q18559_CAEEL/2133-2242-----------------------------------------------MSTI-----------------------------
O06586_MYCTU/230-347-----------------------------------------------HAII-----------------------------
PKSR_BACSU/1766-1891-----------------------------------------------YSVI-----------------------------
PKSM_BACSU/3776-3894-----------------------------------------------YGCI-----------------------------
PKSL_BACSU/3126-3244-----------------------------------------------YGII-----------------------------
PKSJ_BACSU/2018-2137-----------------------------------------------YALL-----------------------------
PKSL_BACSU/2189-2307-----------------------------------------------YGII-----------------------------
PKSM_BACSU/2562-2680-----------------------------------------------YGVI-----------------------------
PKSR_BACSU/785-903-----------------------------------------------YAVI-----------------------------
PKSM_BACSU/655-773-----------------------------------------------YAVI-----------------------------
PKSJ_BACSU/3597-3724-----------------------------------------------YGVI-----------------------------
O54142_STRCO/307-424-----------------------------------------------YASV-----------------------------
A4F7N8_SACEN/2288-2403-----------------------------------------------LGVV-----------------------------
A4F7P0_SACEN/288-406-----------------------------------------------LAVV-----------------------------
A4F7P1_SACEN/285-403-----------------------------------------------LAVL-----------------------------
A8XKG1_CAEBR/5528-5642-----------------------------------------------.FVI-----------------------------
B2J2F3_NOSP7/310-427-----------------------------------------------YAVI-----------------------------
B5HT08_9ACTO/261-376-----------------------------------------------YAEI-----------------------------
B6H6U0_PENCW/303-422-----------------------------------------------LAVL-----------------------------
B8CQB2_SHEPW/317-434-----------------------------------------------YSVI-----------------------------
B8CQB4_SHEPW/303-420-----------------------------------------------YAVV-----------------------------
B8NI04_ASPFN/629-749-----------------------------------------------LGVI-----------------------------
B8NYX0_ASPFN/264-381-----------------------------------------------LATL-----------------------------
C9R299_AGGAD/260-369-----------------------------------------------IAEV-----------------------------
F2RC16_STRVP/252-362-----------------------------------------------YGEI-----------------------------
G0FS56_AMYMS/293-411-----------------------------------------------LAVI-----------------------------
G3XDA2_PSEAE/255-370-----------------------------------------------YAEL-----------------------------
H9JGF5_BOMMO/86-195-----------------------------------------------....-----------------------------
I6X8D2_MYCTU/374-491-----------------------------------------------LAVI-----------------------------
I6Y231_MYCTU/264-376-----------------------------------------------.AVV-----------------------------
N4VDN9_COLOR/639-759-----------------------------------------------LAVI-----------------------------
O25284_HELPY/258-369-----------------------------------------------YAEF-----------------------------
NODE_RHIME/247-359-----------------------------------------------LAEV-----------------------------
FABF_ECOLI/255-370-----------------------------------------------YAEL-----------------------------
FAB2_MYCTU/262-374-----------------------------------------------LARI-----------------------------
FAB1_MYCTU/262-374-----------------------------------------------LARL-----------------------------
PPSE_MYCTU/270-389-----------------------------------------------HAVI-----------------------------
PPSA_MYCTU/359-477-----------------------------------------------LAVI-----------------------------
Q0CJ59_ASPTN/303-419-----------------------------------------------.AII-----------------------------
Q4KCY8_PSEF5/298-415-----------------------------------------------LAVI-----------------------------
Q4KCY9_PSEF5/270-383-----------------------------------------------.AVI-----------------------------
Q5CUM8_CRYPI/1142-1260-----------------------------------------------YSVI-----------------------------
Q7APV9_MYCLE/290-405-----------------------------------------------LAVV-----------------------------
Q7RVN4_NEUCR/272-391-----------------------------------------------LAEL-----------------------------
Q82BC0_STRAW/261-376-----------------------------------------------YAEA-----------------------------
Q87N23_VIBPA/255-371-----------------------------------------------YAEL-----------------------------
Q87W69_PSESM/297-414-----------------------------------------------LAVI-----------------------------
Q87W70_PSESM/852-968-----------------------------------------------LGVI-----------------------------
Q8YLE3_NOSS1/299-407-----------------------------------------------..VI-----------------------------
Q9CB70_MYCLE/293-407-----------------------------------------------LAVV-----------------------------
Q9I3B2_PSEAE/252-360-----------------------------------------------YAEI-----------------------------
Q9Z373_YERPE/285-402-----------------------------------------------.SVI-----------------------------
W5XQV6_9CORY/55-180-----------------------------------------------YAVV-----------------------------

PF08540

HMCS_SCHPO/176-446PGLRGTYMQHAYDFYKP..DLTSEYPYVDGHFSLECYVKALDGAYANYNVRD....VAKN..GK----------------
Q5A3Z7_CANAL/178-450.SIRGSFMEHAYDFYKP..DFTSEYPVVDGHFSLSCYVKAVDNCYKNYSKK.....ITGD..AN----------------
HMCS_ARATH/175-451SKLRASHMAHVYDFYKP..NLASEYPVVDGKLSQTCYLMALDSCYKHLCNK..FEKIE......----------------
HMCS2_HUMAN/224-506RGLRGTHMENVYDFYKP..NLASEYPIVDGKLSIQCYLRALDRCYTSYRKK..IQNQWKQAGS.----------------
HMCS_CAEEL/183-448RQFSACHMKNTWDFFKPITPIPSEYPVVDGSLSLSSYLEAVRMTYTYFISK..VNRHT......----------------
HMCS_YEAST/217-490.SVRASYMEHAYDFYKP..DFTSEYPYVDGHFSLTCYVKALDQVYKSYSKKAISKGLVSDPAGS----------------
HMCS1_RAT/187-469RGLRGTHMQHAYDFYKP..DMLSEYPVVDGKLSIQCYLSALDRCYSVYRKK..IRAQWQKEGK.----------------

PF00195

O23674_ARATH/11-236ELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEW--------GRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGL---
F2CYQ0_HORVD/6-230KICAHMETSLDARHAIALVEVPKLGQGAAEKAIKEW--------GQPLSKITHLVFCTTSGVDMPGADYQLTKLLGL---
F6HP15_VITVI/3-228NIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEW--------GQPKSKITHLVFCTTSGVEMPGADYKLANLLGL---
Q7X795_ORYSJ/13-234ELRTEGTPTLTPRLDICNAAVLELGATAARAALGEW--------GRPAADITHLVYISSSELRLPGGDLFLATRLGL---
Q8W3P6_VITVI/8-228NVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEW--------GQPKSKITHLVFCTTSGVDMPGADYQLTKLLGL---

PF08545

Q8ED66_SHEON/150-221--------------------------------------------------------------------------------
Q74CS1_GEOSL/107-185--------------------------------------------------------------------------------
Q63N14_BURPS/119-199--------------------------------------------------------------------------------
Q6MR21_BDEBA/112-191--------------------------------------------------------------------------------
Q7CTU0_AGRT5/109-187--------------------------------------------------------------------------------
FABH1_BACTN/110-188--------------------------------------------------------------------------------
FABH_YERPE/106-183--------------------------------------------------------------------------------
FABH3_STRCO/108-188--------------------------------------------------------------------------------
FABH_GLOVI/106-183--------------------------------------------------------------------------------
FABH2_DEIRA/113-191--------------------------------------------------------------------------------
Q8EDA9_SHEON/104-182--------------------------------------------------------------------------------
Q8P810_XANCP/217-297--------------------------------------------------------------------------------
Q5FUN7_GLUOX/112-191--------------------------------------------------------------------------------
Q8XRP5_RALSO/110-188--------------------------------------------------------------------------------
FABH_THETN/110-188--------------------------------------------------------------------------------
FABH_CHLTE/107-186--------------------------------------------------------------------------------
Q7TTZ7_RHOBA/109-186--------------------------------------------------------------------------------
FABH2_BACAN/108-186--------------------------------------------------------------------------------
Q73Q42_TREDE/107-187--------------------------------------------------------------------------------
Q67RA0_SYMTH/112-193--------------------------------------------------------------------------------
FABH_HELPY/109-188--------------------------------------------------------------------------------
PQSD_PSEAE/107-188--------------------------------------------------------------------------------
FABH_CLOTE/108-185--------------------------------------------------------------------------------
FABH_RUEPO/108-191--------------------------------------------------------------------------------
FABH_PASMU/106-183--------------------------------------------------------------------------------
FABH_SYMTH/109-187--------------------------------------------------------------------------------
Q7NZ26_CHRVO/150-229--------------------------------------------------------------------------------
Q7NV97_CHRVO/105-183--------------------------------------------------------------------------------
FABH1_LACPL/108-188--------------------------------------------------------------------------------
Q820X4_COXBU/124-203--------------------------------------------------------------------------------
FABH1_STRAW/116-193--------------------------------------------------------------------------------
FABH_PROMP/113-191--------------------------------------------------------------------------------
FABH_PSEAE/105-185--------------------------------------------------------------------------------
FABH_AQUAE/105-183--------------------------------------------------------------------------------
FABH_HELHP/110-189--------------------------------------------------------------------------------
FABH_CAUCR/106-189--------------------------------------------------------------------------------
FABH_BLOFL/106-183--------------------------------------------------------------------------------
FABH_METCA/108-185--------------------------------------------------------------------------------
FABH2_VIBPA/107-185--------------------------------------------------------------------------------
Q6A930_PROAC/116-193--------------------------------------------------------------------------------
Q6FAK4_ACIAD/154-233--------------------------------------------------------------------------------
FABH_BRADU/109-193--------------------------------------------------------------------------------
FABH_SHEON/106-183--------------------------------------------------------------------------------
FABH_CLOAB/106-183--------------------------------------------------------------------------------
Q9K3G9_STRCO/109-186--------------------------------------------------------------------------------
Q73S66_MYCPA/111-193--------------------------------------------------------------------------------
Q81RV7_BACAN/105-186--------------------------------------------------------------------------------
Q5YNV7_NOCFA/117-194--------------------------------------------------------------------------------
FABH_NEIG1/108-185--------------------------------------------------------------------------------
Q6MAF5_PARUW/110-188--------------------------------------------------------------------------------
Q82PP5_STRAW/108-187--------------------------------------------------------------------------------
FABH2_LACPL/107-188--------------------------------------------------------------------------------
FABH2_STRCO/112-192--------------------------------------------------------------------------------
Q7U427_SYNPX/113-191--------------------------------------------------------------------------------
FABH_PHOLL/106-183--------------------------------------------------------------------------------
FABH4_STRCO/108-188--------------------------------------------------------------------------------
FABH_TROWT/107-184--------------------------------------------------------------------------------
FABHL_CAMJE/116-191--------------------------------------------------------------------------------
FABH_NOSS1/108-185--------------------------------------------------------------------------------
FABH_STRT2/106-183--------------------------------------------------------------------------------
Q9I4X1_PSEAE/123-201--------------------------------------------------------------------------------
Q7M7Z5_WOLSU/107-186--------------------------------------------------------------------------------
FABH_PORGI/110-188--------------------------------------------------------------------------------
Q5QWT4_IDILO/106-184--------------------------------------------------------------------------------
Q5NL87_ZYMMO/111-190--------------------------------------------------------------------------------
Q98K75_RHILO/87-167--------------------------------------------------------------------------------
FABH1_DEIRA/107-185--------------------------------------------------------------------------------
FABH_PROMA/113-191--------------------------------------------------------------------------------
Q5WEX8_BACSK/106-184--------------------------------------------------------------------------------
FABH_MYCPA/116-193--------------------------------------------------------------------------------
FABH_NITEU/106-183--------------------------------------------------------------------------------
Q74GF6_GEOSL/107-185--------------------------------------------------------------------------------
FABH_HAEIN/106-183--------------------------------------------------------------------------------
FABH_AGRT5/107-190--------------------------------------------------------------------------------
FABH5_STRCO/105-185--------------------------------------------------------------------------------
Q885B9_PSESM/110-188--------------------------------------------------------------------------------
Q63PP7_BURPS/122-199--------------------------------------------------------------------------------
FABH_STRMU/106-183--------------------------------------------------------------------------------
FABH_LACLA/106-184--------------------------------------------------------------------------------
Q97KV2_CLOAB/114-194--------------------------------------------------------------------------------
Q8F686_LEPIN/117-195--------------------------------------------------------------------------------
FABH_STAEQ/106-184--------------------------------------------------------------------------------
FABH_CHRVO/107-184--------------------------------------------------------------------------------
FABH1_BACCR/106-184--------------------------------------------------------------------------------
O30202_ARCFU/103-177--------------------------------------------------------------------------------
FABH_AROAE/109-186--------------------------------------------------------------------------------
FABH_SYNY3/110-187--------------------------------------------------------------------------------
Q8KE19_CHLTE/7-93--------------------------------------------------------------------------------
FABH2_BACSU/107-185--------------------------------------------------------------------------------
FABH_RALSO/114-191--------------------------------------------------------------------------------
FABH_CLOPE/106-184--------------------------------------------------------------------------------
Q6LQM2_PHOPR/106-184--------------------------------------------------------------------------------
FABH_CAMJE/108-185--------------------------------------------------------------------------------
Q5YPR0_NOCFA/115-192--------------------------------------------------------------------------------
FABH_COXBU/109-186--------------------------------------------------------------------------------
Q63N13_BURPS/108-189--------------------------------------------------------------------------------
Q82KT2_STRAW/108-188--------------------------------------------------------------------------------
Q65LQ9_BACLD/110-188--------------------------------------------------------------------------------
Q982F9_RHILO/108-186--------------------------------------------------------------------------------
Q81JE9_BACAN/109-187--------------------------------------------------------------------------------
Q5NF70_FRATT/108-185--------------------------------------------------------------------------------
FABH_PROMM/113-192--------------------------------------------------------------------------------
Q6AET2_LEIXX/120-197--------------------------------------------------------------------------------
Q7NZW4_CHRVO/106-186--------------------------------------------------------------------------------
FABH_DESPS/106-184--------------------------------------------------------------------------------
FABH_XANCP/110-187--------------------------------------------------------------------------------
Q8RC81_THETN/108-187--------------------------------------------------------------------------------
Q5YNJ2_NOCFA/116-193--------------------------------------------------------------------------------
Q67MB7_SYMTH/116-197--------------------------------------------------------------------------------
Q884Y8_PSESM/108-185--------------------------------------------------------------------------------
FABH2_BACHD/109-187--------------------------------------------------------------------------------
Q7KWI9_PLAF7/153-231--------------------------------------------------------------------------------
Q65LD5_BACLD/106-184--------------------------------------------------------------------------------
FABH_ENTFA/107-184--------------------------------------------------------------------------------
Q8RC85_THETN/112-193--------------------------------------------------------------------------------
FABH_OCEIH/106-184--------------------------------------------------------------------------------
FABH_THEEB/108-185--------------------------------------------------------------------------------
A8GFT0_SERP5/117-193--------------------------------------------------------------------------------
B9KJ28_ANAMF/108-190--------------------------------------------------------------------------------
C4YXG9_9RICK/106-183--------------------------------------------------------------------------------
D5AUL7_RHOCB/108-191--------------------------------------------------------------------------------
D7TN17_VITVI/170-249--------------------------------------------------------------------------------
E3PXS0_CLOSD/254-332--------------------------------------------------------------------------------
FABH_CHLTR/106-185--------------------------------------------------------------------------------
FABH_STRR6/106-183--------------------------------------------------------------------------------
Q2YKB4_BRUA2/110-185--------------------------------------------------------------------------------
FABH_SYNE7/111-188--------------------------------------------------------------------------------
Q5SL76_THET8/104-182--------------------------------------------------------------------------------
Q5ZTD0_LEGPH/115-194--------------------------------------------------------------------------------
Q5ZTD4_LEGPH/131-209--------------------------------------------------------------------------------
Q5ZV11_LEGPH/109-186--------------------------------------------------------------------------------
Q63PP9_BURPS/115-194--------------------------------------------------------------------------------
Q79ZR7_STRAW/89-169--------------------------------------------------------------------------------
FABH1_VIBVY/106-183--------------------------------------------------------------------------------
FABH_FUSNN/107-185--------------------------------------------------------------------------------
Q8RHZ0_FUSNN/90-165--------------------------------------------------------------------------------
FABH_LISMO/106-184--------------------------------------------------------------------------------
FABH_STRP1/106-183--------------------------------------------------------------------------------

PF08392

Q9FW59_ORYSJ/25-322IIGGGDARPD..RLAEGMEEMDETFHAVLDELFARSSAAGGGG.VRPA.DVDLLVVNVSMFSPAPSLSARVVRRYNL---
KCS3_ARATH/23-313FFEGREQ.RP..TLQDGLSEMEEFYIDTIEKVLKRN......K.ISPS.EIDILVVNVSMLNSTPSLSARIINHYKM---
KCS11_ARATH/92-381VLNVPPN..P..CMKEARKEAETVMFGAIDELLAKT......N.VNPK.DIGILIVNCSLFNPTPSLSAMVVNHYKL---
KCS16_ARATH/71-366LQTLPLQ..Q..NLAVSRIETEEVIIGAVDNLFRNT......G.ISPS.DIGILVVNSSTFNPTPSLSSILVNKFKL---
KCS2_ARATH/74-363IHSIPPR..P..TMAAAREEAEQVIFGALDNLFENT......K.INPR.EIGVLVVNCSLFNPTPSLSAMIVNKYKL---
Q75M74_ORYSJ/23-315VLDGREG.EP..THGDSLGEMEDFFGDSIAELFART......G.FGPR.DVDVLVVNASMFSPDPSLASMIVHRYGM---
KCS14_ARATH/52-334MLTSPPT..P..SMYEARHESELVIFGALNSLFKKT......G.IEPR.EVGIFIVNCSLFNPNPSLSSMIVNRYKL---
Q650T5_ORYSJ/56-349LHHIPPA..A..THGEAIREAHMLFFPALDDLFAKT......G.VPPS.SVGAVVVNCSGFCAAPSLSAIIANRYGM---
Q6K3E6_ORYSJ/23-314VLDARED.CP..TLRDALDEMDDFFDDAVAAVLARA......A.VSPR.DVDLLVINVGSFSPSPSLADRVVRRFGL---
Q688V9_ORYSJ/93-381MHLIPPE..P..TMANARAEAESVMFGALDKLFKFT......G.VKPK.DVGVLVVNCSLFNPTPSLSAMIVNKYKL---
Q5Z6R6_ORYSJ/79-372NLYLPPR..T..GMEEARDEAEIVVFAAVGDLLART......R.IRPE.EIDVLVTNCSVFSPTPSFADMVVNRFKL---
Q8H7L2_ORYSJ/167-457VFEPGTN.CA..TMKEGRAEASAAMFAALDELFDKC......R.VRPK.DVGVLVVNCSLFNPTPSLSAMIVNHYKM---
KCS7_ARATH/38-328VHEIPPN..A..SISAAREETHEILFAIVQDLFSKH......E.IDPK.SIDILVSNCSLFCPSPSITSMIINKFGM---
Q8LQT7_ORYSJ/61-349YHYMPPD..R..SLRASRDESELVIFSAVDDVFARS......A.LTPA.DIDVLIVNCSIFTPTPVFADMVVNRYKL---
Q6Z6C7_ORYSJ/95-384VLREPPN..P..SMAEARREAEAVMFGAVDDLLAKT......G.VSAK.EIGVLVVNCSLFNPTPSLSAMVVNHYKL---
KCS20_ARATH/42-333LMEIPLK..K..SLSSVKIETMTTIFTSVEDLLRKN......K.LSPR.SIDILITNCSLHSPSPSLSAMVINKFHM---
Q9XEP1_SORBI/93-380LTSSPPN..P..CMAEARREAEAVMFGAVDQLLAKT......G.VRAG.DIGIVVVNSGLFSPTPSLSAMIVHHYKL---
Q7XT16_ORYSJ/77-368FRYIPPE..S..GIEASREEAELVIFSAVDKAFAAA......TGLVPADDIGTVILACSFTTPTPSLADVVVRRYGL---
Q6K558_ORYSJ/43-332IFSGEFQ..K..TQAFAVQEAEEGLFATVAHLLAKS......D.VRPR.DVGFVVVACSMFSPAPSLASMIVRRFGM---
KCS21_ARATH/24-318VLEGRED.SP..TLLDAHSEMDEIMFDTLDKLFHKTK....GS.ISPS.DIDILVVNVSLFAPSPSLTSRVINRYKM---
Q6F365_ORYSJ/100-389VLNIPPN..P..SMANARKEAEMVMYGALDELLAKT......G.VNPK.DIGILVVNCSLFNPTPSLSAMVVNHYKL---
Q6TMJ4_DICDI/114-404ITKKSPD..V..SMESAREEAQLVLSGCLDSLFAKT......G.LKPQ.EIDILIVNCSLFNPTPSLAAMMMNRYKM---
Q75M84_ORYSJ/26-319LLDGREE.LA..AQRDSVDEMDACFDGAVPELLART......G.LRAR.DVDVLVVNVNGFFPEPCLASRVVRRYGM---
Q5Z6S3_ORYSJ/79-368HHYIPTY..KYCTLEAARAEVDLVVFSAVDELFAKT......G.VSPD.DVDILVVNCSLFCPTPSFVDMIVNRYKL---
I1QUI1_ORYGL/97-386LISLPVD..M..CLRTAREESHAVIFGVVDEVLRKS......G.VAAA.DVGVLIFNSSLLSPTPSFTSLIVNRYGM---
M4EUY8_BRARP/106-388ITSTPPK..L..NMSEARAEAEAVMFGALDSLFEKT......G.IKPA.EVGILIVNCSLFNPTPSLSAMIVNHYKM---
M4F0P0_BRARP/70-368LLQVPPR..K..TFAAAREETEQVIIGALENLFKNT......N.VNPK.DIGILVVNSSMFNPTPSLSAMVVNTFKL---

PF01154

HMCS1_RAT/13-186---------------------------------------------------------WPKDVGIVALEIYFPSQYVD---
HMCS2_RAT/50-223---------------------------------------------------------WPKDVGILALEVYFPAQYVD---
HMCS_YEAST/45-216---------------------------------------------------------RPQNVGIKGIQIYIPTQCVN---

PF00108

M0LND5_9EURY/4-224AFDERTGLENALCGALGV.DGATADRIENTSA-SGASAVLRAVDA-VRAGRSSVALVVGV-ETM---SAVDTDDATE---
D2RWU3_HALTV/19-236.YEGQSGLAAALAGELGI.RPAHAVAIEQTSS-SGAAAVYEAWKA-IASGTCEVALAVGG-ERM---THLSTATATD---
E4NU18_HALBP/4-223EFEGQTGIPNALAHDLSM.LPAYTTRIDQTSS-SGGAGVYAAWQS-IASGASEMTLLVGG-EKM---THRSTADTTD---
Q3IPN4_NATPD/4-222EFEGQTGIQNALAHDLSV.VPAYAQRVGQTSS-SGAAGIYAAWQS-IASGASEMTLLVGG-EKM---THRTTGESSD---
L0IDX7_HALRX/4-222EFEGQTGVSNALAHDLGA.LPAYTERVDQTSA-SGGAGIYAAWRS-IASGASDMTLLVGG-EKM---THRSTSEATD---
M0LB34_9EURY/4-223EFEGQTGVPNALAHDIDA.VPAYTQRVDQTSS-SGGAGIYAAWQS-VASGASDMTLLVGG-EKM---THRTTGEATD---
B9LX39_HALLT/5-223EFEGQTGIMNALAHDLGL.MPAYSQRIDQTSS-SGAAGIYGAWQS-VASGASDMTLLVGG-EKM---THKDTAGSTE---
M0JWJ2_9EURY/3-221EFEGQTGIMNLLAHDLGV.LPAYSERVDQTSS-SGGAGIYEAWQS-VASGASEMTLLVGG-EKM---THKTTGQATD---
ECHB_RAT/55-325.VKTSN.VAREAALGAGFSDKTPAHTVTMACI-SSNQAMTTAVGL-IASGQCDVVVAGGV-ELM---SDVPIRHSRN---
YKA3_CAEEL/26-298.CKTSN.IAREAALLAGVPDKIPAHTVTLACI-SSNVAMTTGMGM-LATGNANAIIAGGV-ELL---SDVPIRYNRN---
FADA_PSEFR/8-258LEQGWN.IARMASLMTQIPHTSAAQTVSRLCG-SSMSALHTAAQA-IMTGNGDVFVVGGV-EHM---GHVSMMHGVD---
A0A017HYH0_ECOLX/4-254LEQGFN.IARNAALLAEVPHSVPAVTVNRLCG-SSMQALHDAARM-IMTGDAQACLVGGV-EHM---GHVPMSHGVD---
THIKA_RAT/38-291.GAGAV.MARIAQFLSGIPETVPLSAVNRQCS-SGLQAVANIAGG-IRNGSYDIGMACGV-ESM---SLSNRGNPGN---
THIK_YARLI/30-284.GAGAT.EHRAACLVAGIPETVPFVALNRQCS-SGLMAVNDVANK-IRAGQIDIGIGCGV-ESM---SNQYGPNSVT---
A0A023ZC97_YEASX/36-289.GAGAT.EHRAACLASGIPYSTPFVALNRQCS-SGLTAVNDIANK-IKVGQIDIGLALGV-ESM---TNNYKNVNPL---
THIKA_CANTR/27-280.AAGAT.EHRGACLAAGIPYTAAFIAVNRFCS-SGLMAISDIANK-IKTGEIECGLAGGA-ESM---STNYRDPRVA---
THIM_HUMAN/7-266.SSDAIYLARHVGLRVGIPKETPALTINRLCG-SGFQSIVNGCQE-ICVKEAEVVLCGGT-ESM---SQAPYCVR.N---
H2Q4P9_PANTR/42-299.GEGQA.PTRQAVLGAGLPISTPCTTINKVCA-SGMKAIMMASQS-LMCGHQDVMVAGGM-ESM---SNVPYVM...---
THIB_CANTR/6-267.NVGQA.PARQVALKAGLPDSIIASTINKVCA-SGMKAVIIGAQN-IICGTSDIVVVGGA-ESM---SNTPYYLP.S---
A0A023ZJC5_YEASX/5-267.NLGQA.PARQVALAAGLSNHIVASTVNKVCA-SAMKAIILGAQS-IKCGNADVVVAGGC-ESM---TNAPYYMP.A---
G4EU09_BACIU/4-263.GSGQI.PSRQAARLAGMPWSVPSETLNKVCA-SGLRAVTLCDQM-IRAQDADILVAGGM-ESM---SNIPYAVP.A---
B8ZR51_MYCLB/4-263.GAGQM.PARQAAVAAGIGWDVPALTINKMCL-SGLDAIALADQL-IRAGEFDVVVAGGQ-ESM---TKAPHLLM.D---
A0A017JC55_ECOLX/4-262.GAGQN.PARQSAIKGGLPNSVSAITINDVCG-SGLKALHLATQA-IQCGEADIVIAGGQ-ENM---SRAPHVLT.D---
THIL_PARDE/4-261.AQGQN.PARQAHIKVGLPRESAAWVINQVCG-SGLRTVALAAQQ-VLLGDARIVVAGGQ-ESM---SLAPHAAYIA---
THIL_ZOORA/6-262.GEGQN.PARQAAMKAGVPQEATAWGMNQLCG-SGLRAVALGMQQ-IATGDASIIVAGGM-ESM---SMAPHCA..H---
THIL_THIVI/5-264.GCGQN.PARQTTLMAGLPHTVPAMTINKVCG-SGLKAVHLAMQA-VACGDAEIVIAGGQ-ESM---SQSSHVLP.R---
D3UAK6_CUPNE/4-263.GSGQN.PARQAAIKAGLPAMVPAMTINKVCG-SGLKAVMLAANA-IMAGDAEIVVAGGQ-ENM---SAAPHVLP.G---
F0K5D8_CLOAE/4-262.GLGQN.PARQASFKAGLPVEIPAMTINKVCG-SGLRTVSLAAQI-IKAGDADVIIAGGM-ENM---SRAPYLAN.N---
A4NPG8_HAEIF/4-263.GLGQN.PARQAALKAGIEKEIPSLTINKVCG-SGLKSVALGAQS-IISGDADIVVVGGM-ENM---SQAPYLLDSK---
A0A017JHG0_ECOLX/4-263.GLGQN.PARQALLKSGLAETVCGFTVNKVCG-SGLKSVALAAQA-IQAGQAQSIVAGGM-ENM---SLAPYLLDAK---

PF00109

Q18559_CAEEL/1-236DFREKH-PEVKAALVD..GIEYFDDQYFGTGE-SEAICMDPQQRM.LMQGVIKGLENAGI.TLE---MA....SEAR...
Q18559_CAEEL/1888-2129KYGNPV-EG..GNFITQ.DVTQFDPSFFKISK-SEAELIDPQQRL.LLECVQECLENSGV.IET---S............
Q18559_CAEEL/4241-4474VALLDS-DA...........RYWDPEYFGIRP-SEAKFIDPQQRL.LLCSVAKLLDSLLI.TS.---......LTSN...
Q18559_CAEEL/824-1057QCEGDA-GLEVGLLKQ..DISMFDNSFFAIAK-DEAEFLDPQHRL.LLNAAYNALEKSGL.TS.---.I....PDAD...
FAS_HUMAN/1-239RSGKLK-DL...........SRFDASFFGVHP-KQAHTMDPQLRL.LLEVTYEAIVDGGI.NPD---SL....RGTH...
PKSM_BACSU/2319-2554GKEGSI-YTKWGGFIK..DMDKFDPLFFQISP-LEAERMDPQERL.FLQTAYASIEDAGY.TPD---SL....CSSR...
PKSL_BACSU/433-687PSGKDI-SK.WGGFID..DPDCFDPQFFRITP-REAETMDPQERL.FLETCWETIEDAGY.TPK---TL....AKPKGRN
PKSR_BACSU/1528-1758DKEGQS-SLQWGGFIE..GIGEFDPLFFGISP-KEAANMDPQEFL.LLIHAWKAMEDAGL.TGQ---VL....SSRP...
P91871_CAEEL/37-275KRHGKL-KV..........LNKFDAGFFQVTP-KQANFMDPQVRL.LLEASWEAMVDAGI.NPT---DL....RGSK...
PKSM_BACSU/393-647PAGKPL-SK.WGGFIE..EADCFDPQFFRISP-REAEMMDPQERL.FLETCWEAIEDAGY.TPE---TI....ASPQGEN
PKSJ_BACSU/4588-4821.YAGVI-DG..........VSYFDPDFFLLHE-EDVRAMDPQALL.VLEECLKLLYHAGY.TPE---EI....KGKP...
PKSJ_BACSU/3339-3589TDVNKT-DIKWGGFID..GVAEFDPLFFGISP-READYVDPQQRL.LMTYVWKALEDAGC.SPQ---SL....SGTG...
PKSL_BACSU/4082-4314...GNS-SSNYAGLID..EMNRFDHDFFMMSE-SDVRAMDPQALA.VLEESLKLWYHAGY.TEK---EV....KGMR...
PKSR_BACSU/527-777PKKPAN-KKRYGGFLQ..DIEAFDHQLFEVEQ-NRVMEMTPELRL.CLETVWETFEDGGY.TRT---RL....DKLRD..
PKSF_BACSU/6-249FIGAEI-AS...........LSYPDRLSKKML-R...KASFSSRA.ALVTLTEAWEEAEL.DD.---.A....DSSR...
PKSJ_BACSU/1760-2010IAENAD-YVPAKASID..GKDRFDPSFFQISP-KDAEFMDPQLRM.LLTHSWKAIEDAGY.AAR---QI....PQ.....
PKSL_BACSU/1926-2181DKPGKT-YSKWGGFMK..DVDKFDPQFFHISP-REAKLMDPQERL.FLQCVYETMEDAGY.TRE---HL...GRKRDAE.
PKSL_BACSU/2873-3118NKKGKV-YCKSMGMLD..DIEHFDPLFFNIPP-SEAELMDPQHRI.FLQEGYKAFEDAGY.NAR---TL....NEKK...
PKSM_BACSU/3529-3768RDPEKA-VPRWGAFLK..DIDRFDPLFFQISP-KEAESMDPRQRI.FLEEAWHTFEDAGY.MGD---RI....KGKS...
OXSM_SCHPO/1-253KVAGVI-P...RGK..EKEEWNVLDYVDQGKL-R...EVATFTQL.ALTSAAEALKDARW.ID.---..I..DEQEK...
P95029_MYCTU/2548-2808VVGGQI-PTG............FDPTVWGISA-DMAGSIDRLAVW.NMVATVDAFLSSGF.SPA---EVM.RYVHPS...
O67612_AQUAE/2-247KIAAEV-KD...........FNPEDFMDKKEA-R...KASRFVQF.AIAAVKEALEDSG..LLE---S.....EYDP...
O54142_STRCO/518-803LALGRS-YTDLGAPVP...VPTQPPPGLRIPP-HRYAATDAAQRL.GLDVAAEMFARYGR.DPH---AL....DGVGT..
Q9ZCH8_RICPR/7-260KIAGVI-DNS......EQNGFKLENFTQADDI-NRLSKMDKFIHY.GIAAATEAVEDSGW.LPK---D.....EKSR...
WA_EMENI/376-626TATNTS-KVPYGCWIR..EPGLFDPRFFNMSP-REALQADPAQRL.ALLTAYEALEGAGF.VPD---S.....TPST...
P71718_MYCTU/4-254NGFKPI-HN.LGGFLS..SATTFDPEFFRISP-REATAMDPQQRV.GLRVAWRTLENSGI.NPD---DL....AGHD...
FABF_SYNY3/6-249RFGGEV-KD...........FDATQFLDRKEA-K...RMDRFCHF.AVCASQQAINDAK..LVI---N.....ELNA...
O65933_MYCTU/33-281DACGKM-YTRRGTFLE..HAGDFDAGFFGIGP-SEALAMDPQQRL.LLEVSWEALERTGI.DPT---KL....RGSA...
Q49933_MYCLE/34-288TVPGTI-CSTEGGFLTGWQPDEFDAEFFSISP-REASAMDPQQRL.LIEVAWEALEDAGV.APH---TI....RGTQ...
O54142_STRCO/38-299QAASMA-RLQLLMVEA..ARQCLDDATGSGAD-RGRTDVVVGTCLGLDRQYANALRVDGARYAR---DLT.EVLADG...
O54155_STRCO/797-1033DRHGDT-GGRPGGFLE..HVYDFDARFFGVSA-RETERMDPQQRL.LLEVAWQTFEDAGI.APS---SL....AGTD...
KAS1_STRCO/3-252QIAAEC-DFEPS...........DHGLGLATA-Q...RCDRYVQF.ALVAASEAVRDANL.DM.---.....NREDP...
O86335_MYCTU/106-346AGTFAE-S...GGFLK..DVAGFDNRFFDIPP-DEALRMDPQQRL.LLEVSWEALEHAGI.IPE---SL....RLSR...
KASC1_ARATH/60-306RFGGQI-RG...........FSSEGYIDGKNE-R...RLDDCLKY.CIVAGKKALESANL.GGD---KLN.TIDKRK...
CEM1_YEAST/2-265ITVGKI-PENFQNE.....NSAINKLLFTSQD-ER..RTSSFIKL.ALRTTYEALHNAGL.LNP---NDI.TINTSLCN.
O53901_MYCTU/14-263GVPGRT-DCKWGAYLD..NVGDFDPEFFGIGE-KEAIAIDPQHRL.LLETSWEAMEHGGL.TPN---QM....A.SR...
KASA_STRCO/45-294QVAAE.-.............ADFDPVAEGFGP-RELDRMDRASQF.AVACAREAFAASGL.DPD---TL....DPAR...
A4F7N8_SACEN/2032-2280DAAGTR-RA.HGNFMA..GAGDFDAAFFGISP-REALAMDPQQRQ.ALETTWEALESAGI.PPE---TL....RGSD...
A4F7P0_SACEN/31-280DNPGTS-YVDKGGFLD..DAAGFDAEFFGVSP-REAAAMDPQQRL.LLETSWELVENAGI.DPH---SL....RGTA...
A4F7P1_SACEN/1486-1734QRHGTS-YSRHGAFLD..GAADFDAAFFGISP-REALAMDPQQRQ.VLETTWELFENAGI.DPH---SL....RGSD...
B2J2F3_NOSP7/22-302TTEDKT-YCKRGGFLP...EVDFNPMEFGIPP-SILEVTDVSQLL.SLVVAKEAMEDAGY.GEK---RE....FNRE...
B6H6U0_PENCW/46-295AAVLAE-TTAKGYFLN..EIDQFDAAFFAVSP-REAEQMDPQQRI.ALEVAWEALEDAGI.SPS---RL....AGSN...
B6HS84_PENCW/33-281AKELKR-TTSYGYFLD..RLEDFDCQFFGISP-KEAEQMDPQQRV.SLEVASEALEDAGI.PAK---SL....SGSD...
B8CQB2_SHEPW/32-309STPDKS-YCKRGGFLP...DVDFNPMEFGLPP-NILELTDSSQLL.SLIVAKEVLADANL.PE.---.V....YDRD...
B8NYX0_ASPFN/9-256RSIGKV-PR.RGYFVK..NLENFDAGFFNISP-KEAEQMDPQQRL.VLEVTWEALENAGI.PLS---SL....SGSD...
C9R299_AGGAD/1-252RLGAEI-HG...........YQPPSHWNRKQL-R...SLGRVSQF.AVEAAERALANADL.LDE---NGDILAYLKD...
F2RC16_STRVP/4-243RLAGEV-PG...........FAAEEHLPSRLL-P...QTDRMTRL.ALVAADWALADAGV.RPE---EQ....DDFD...
F6HGM7_VITVI/144-387RIAGEI-KS...........FSTDGWIAPKLS-K...RMDKFMLY.MLTAGKKALADGGI.TED---VT....DELDK..
G0FS55_AMYMS/632-879ERAGTS-YVGQGGFLH..DAGEFDAGFFGISP-REAVAMDPQQRL.LLETSWEALENAGV.DPI---AL....KGTD...
G0FS56_AMYMS/1717-1966ERPGTA-YIRQGGFLH..EAALFDPGFFGISP-REALAMDPQQRL.LLEASWEALERAGI.DPT---KA....RGDA...
G0FS56_AMYMS/35-284DNPGTT-YVREGAFLQ..DAAQFDAGFFGISP-REALAMDPQQRQ.LLEVSWETLERAGI.DPH---SV....RGSD...
G0FS57_AMYMS/36-283DHAGTS-YTDQGGFLH..DAALFDPGFFGISP-REALAMDPQQRL.LLEASWEALEGVGL.DPA---SL....QGTD...
G0FS59_AMYMS/1702-1949DRSGTT-YTSRGGFLD..GAGLFDAGFFGISP-REALAMDPQQRL.LLEAAWEALEGTGV.DPG---SL....KGAD...
G3XDA2_PSEAE/4-245RFGGSV-KG...........FNVEEYLSAKEA-R...KLDLFIQY.GLAASFQAVRDSGL.EVT---DA....NRE....
G6CI33_DANPL/25-260QRTGKI-NN..........VNRFDASFFGVHF-KQAHTMDPMCRI.LLEKAYEAVIDAGL.NPK---EL....RGTK...
I6X8D2_MYCTU/118-366RVAGA.-.RTRGGYLK..DIKGFDSEFFAVAK-TEADNIDPQQRM.ALELTWEALEHARI.PAS---SL....RGQA...
I6Y231_MYCTU/6-255GVPGRS-VSRWGGFLD..DVAGFDAEFFGISE-REATSIDPQQRL.LLETSWEAIEHAGL.DPA---SL....AGSS...
K4RAF8_9ACTO/6-250RIAAPV-AV...............EPTEVIPR-PQARRLDRSAQF.ALIAAKEAWADAGF.TDR---AG....EDSNVD.
N4VDN9_COLOR/383-631KAVNTS-HSQYGCWIE..NPGYFDPRFFNMSP-REAFQTDPMQRM.ALTTAYEALEMCGY.VPN---RT....PSTRL..
O25284_HELPY/1-247RIAGEI-TD.............FDPTEVM.NP-KDVKKAGRFIQL.ALKATREAMKDSGI.LDA---HNR.CPE..EL..
NODE_RHIME/2-236IVGAEV-KA............LPDHNIDRKQL-V...SMDRISVL.AVIAAHEAMRQAGL.SCN---E......GNA...
FABF_ECOLI/4-245KFAGLV-KD...........FNCEDIISRKEQ-R...KMDAFIQY.GIVAGVQAMQDSGL.EIT---EE....NATR...
PKS15_MYCTU/47-294DAEGKT-YTRWGAFLD..DATGFDAGFFGIAP-SEVLAMDPQQRL.MLEVSWEALEHAGI.DPL---SL....RGSA...
FAB2_MYCTU/13-253RIGGHL-LE............EFDHQLTRIEL-R...RMGYLQRM.STVLSRRLWENAGS.PE.---.V....DTNR...
FAB1_MYCTU/13-253KIGGHL-KD............PVDSHMGRLDM-R...RMSYVQRM.GKLLGGQLWESAGS.PE.---.V....DPDR...
PPSE_MYCTU/6-262TLADPA-YVRRAPLLD..GIDEFDAGFFGFPP-LAAQVLDPQHRL.FLQCAWHALEDAGA.DPA---RF....DG.....
PPSA_MYCTU/101-351AAALAR-TTRWGSFLP..DIDAFDAEFFEISP-SEADKMDPQQRL.LLEVAWEALEHAGI.PPG---TL....RRSA...
PHAS_MYCTU/25-274GVPGRT-VCKWGGFLD..NPADFDCEFFGIGE-REAIAIDPQQRL.LLETSWEAMEHAGL.TQQ---TL....AGSA...
Q0CJ59_ASPTN/45-294PKILDQ-TTKRGYFLD..HVENFDAAFFGVSP-KEAEQMDPQQRL.SLEVTWEALEDAGI.PPQ---SL....SGSE...
Q2UG06_ASPOR/373-621KARNKG-ATKWGCWLD..FSGEFDPRFFGISP-KEAPQMDPAQRM.ALMSTYEAMERAGL.VPD---TT....PSTQR..
Q4KCY8_PSEF5/40-290QAPGKA-YVMRGGFIE..GVDQFDPGFFGISP-KEAEGMDPQQRL.ALEVAWEALENAAI.APD---SL....HGKK...
Q4KCY9_PSEF5/1034-1273AKPEET-FPRFASLIQ..RPEGFDEAFFRISP-KEARSMDPQQRL.LLMVAWEALERAGI.PQE---KL....LEQR...
Q5CUM8_CRYPI/886-1132DLENKM-YTKEGGFIE..NIDQFGASFFKISH-AEARSMDPQQRI.FLEKSFEALKDVGY.TID---TL....KKRN...
Q7APV9_MYCLE/33-282LTPGRM-TTKWGGFVS..DIAGFDAAFFGITP-REAAAMDPQQRI.LLEVAWEALENAGI.PPD---SL....GNSR...
Q7RVN4_NEUCR/1-262TVGGLV-PTPARNKQNV.DEQHTWKAADWLEP-SDQRRMSLFAQY.SVAATEMALQDAGW.KPT---RQ....EDLE...
Q87N23_VIBPA/4-245RFAGLV-KD...........FDCTEYMSKKDA-R...KMDLFIQY.GIAAGIQALDDSGL.QIT---EE....NAPR...
Q87W69_PSESM/39-289PLRERV-AGWRGGFLD..KVAGFDAAFFRISD-REALAMDPQQRL.LLEVCWEVLERAGI.VPD---TL....KNSA...
Q87W70_PSESM/593-844GRFGKI-STRTSGFLH..DASAFDPAFFGISP-REALTLEPQQRL.LLEVSWEALERAGI.DPA---SL....HGSL...
Q8YLE3_NOSS1/10-289YGLTDA-KAPVGAYIK...DFDLDTLAYKIPP-NEVEKLNPQQLL.LLTVADRALKDAKI.PE.---.......GGN...
Q9CB70_MYCLE/36-285SASGRM-TTKWGGFVP..DVDAFDAEFFGITP-REAVAMDPQHRM.LLEVAWESLEHAGI.APD---SL....SGTR...
Q9I3B2_PSEAE/1-241HVSGSV-DL............NLEELIDRKVF-R...FMGDAAAY.AYLAMEQAIKDSGL.TPE---QI....SNPR...
Q9Z373_YERPE/27-276IIDDPH-YVNIGTVLD..NADCFDATLFGYSR-QEAESMDPQQRL.FLQAVWHALEHAGY.APG---AV....PH.....

PF07451

A6TVT6_ALKMQ/4-333FLSGDLMNQITSSSFAARTLGMPYLGVFGACS-SSMESLALAALI-VDSGAGKNALAAAS-SHN---AA----VEKQ---
A6LRM0_CLOB8/7-335LFSGDLLNQIISSSFAAREFSIPFFGLYGACS-TMSESLSLASII-MDGGFAKYVVAATS-SHF---SS----AERQ---
Q9KCK2_BACHD/4-332VFAGDLLNQMTSTSFACRSLCIPYFGLFGACS-TSMEGLALAAFV-INHSGANYVLTGST-SHN---AA----IEKQ---
Q5WH23_BACSK/4-331FVAGDLSNQTTASSFVARDLQLPYIGTYSACA-TSVETLIISGVW-VSSGLADLVLAAAS-SHY---GA----CEKQ---
B8I4W4_CLOCE/7-335VLAGDLLNQCIAANYGLRETEVPFLGLYGACS-TMAESMSIGSLM-VEGGFAENLVCMTS-SHF---CS----AEKQ---
A6TQB0_ALKMQ/8-336MFGGDLLNQLMSTSFAARDLGIPFFGLYGACS-TMTESLALAAIM-IEGGYADNVIATTS-SHF---SS----AERQ---
A4J4J1_DESRM/4-332FLGGDLLNQIISSSFAARTMAVPYLGLFGACS-TSMEGLALGSLL-IDSKSAKYLICGTG-SHN---TA----VEKQ---
Q8ERC5_OCEIH/4-332FIAGDLINQITPTSFAAKTVGTPYLGVFSACA-TSMESLALAATI-INSGGANYILTGAS-SHN---AA----AEKQ---
Q2RIQ1_MOOTA/8-336LLAGDLLNQTISANYAARSLGIPFLGLYGACS-TMYEGMALAAML-IDGGFAHHVVAACS-SHY---DT----AERQ---
Q67T05_SYMTH/7-337FLAGDLLNQLITTAFSGLELGVPLYGLYGACS-TFTEALSLGAKL-IDGGFADRVLCAVS-SHY---GS----AERQ---
Q189X1_PEPD6/7-335MLGGDLINQIVPASFAARELAIPFLGIYGACS-TMAEGLCIGSML-IDGGFADLVLSGTS-SHY---CT----AERQ---
A0PZS9_CLONN/6-338LVAGDLLNQTAASNFAARDVDIPFLGLYGACS-TMSESLGVASML-VNAEYADYAVAATS-SHF---SS----AERQ---
Q0AZ98_SYNWW/8-335LMAGDLLNQLVSSNYAARELGIPFLGLYGACS-TMAESLLLAAIL-VDGEFFERVIAAAC-SHH---YT----AERQ---
Q891W9_CLOTE/6-334LFAGDLLNQLSSSSFAARDMNIPFIGLYGACS-TMSESLAMASMT-IDGDFANNVVAATS-SHF---SA----AERQ---
A5D2Y8_PELTS/8-335ILAGDLLNQIISANFTASSMSVPFLGLYGACS-TMYEGMALGAML-IDGGFADRVLVATS-SHY---ST----AERQ---
A8MHP8_ALKOO/7-335MFGGDLLNQIMSTSFAARDMKVPFFGLYGACS-NFTESLSLASMI-VDGGYADQVITTTS-SHF---SS----AERQ---
A5N8K2_CLOK5/4-332FVSGDLMNQIITSSFAARTLKIPYLGVFGACS-SSMEGLALASFI-IDNNGAEYVLCGTS-SHN---AA----AEKQ---
Q97GR2_CLOAB/6-335LFAGDLLNQITSSSFAARDAKIPFYGLYGACS-TMTESLSIAAMI-MDGGFADYTIAATS-SHF---SA----AERQ---
A4XFR0_CALS8/5-335ILSGDLLNQLTSSHFAARDLNIPFIGLYGACS-TFALSVGLACVF-VDGGFAKNIIAATS-SHF---CS----AEKQ---
A9KI33_CLOPH/13-353LVGGDLLGQLIATSFGIENFEIPLIGVYGACS-TMGESIVVASMI-IDGGFADRTLAITS-SHF---AG----AEKQ---
Q9KCM9_BACHD/5-332MIAGDLLNQNITANYVARALGIPFLGTFSACA-TSMETLAVGSII-VHGGFAQRVITATS-SHY---AT----AERQ---
Q5WGZ4_BACSK/4-332MLAGDLVNQLTPSSFAGRTIGIPYLGMFGACS-TSMEGLAIGAMI-MEANGARHIISVAS-SHN---TA----TEKQ---
A5I6G6_CLOBH/6-334LCAGDLLNQTISSSFAARNLDIPFIGLYGACS-TMTESLSVASML-MDGEFANYAVAATS-SHF---SA----AERQ---
SP5AD_BACSU/5-332LLAGDLLNQNVTANYVARHLKIPFLCMFGACS-TSMETVAVASAL-VDGGFAKRALAATS-SHN---AT----AERQ---
Q24V53_DESHY/7-333LLAGDLLNQIISANFAARTMGIPFIGLYGACS-TMALSMSVGTML-IDGGFARKVLVGVS-SHH---DT----AERQ---
Q5KXJ7_GEOKA/5-332FLAGDLLNQNATSNYVARELPIPFLCLFGACS-TSMQTLAAAAAF-VAGGLADRALAATS-SHN---AT----AERQ---
Q5L1P1_GEOKA/4-332LIAGDLINQMTPTSFAARTLGMPYLGVFGACS-TSMEGLALSAFI-TNYGGADYILTGAS-SHN---AA----VEKQ---
Q81MG1_BACAN/5-333FLAGDLLNQTVTANYVARKWGIPFLGMFSACA-TSMETLAVGSAF-IDGGFANRVLATVS-SHN---AT----AERQ---
Q81X67_BACAN/4-332VLAGDLINQITPTSFACRTLGTPYLGLFGACS-TSMEGLALGASI-VNAKGAKYLLTGAS-SHN---TA----VEKQ---
Q8RAA4_THETN/7-333LLGGDLLNQIISANFAARQLNVPHFGLYGACS-TMTEGLTLGAML-IDGGYADYVIAATS-SHF---ST----AERQ---
Q8XIR8_CLOPE/9-337LFSGDLLNQLTSTNFVAREFKIPFFGVYGACS-TMAESLSLSSMI-MDGDFAKYAIASTS-SHF---SS----AERQ---
R6N984_9CLOT/6-333IFAGDLLNQCISSTFGLRSLGIPFLGQYGACS-TMAQTLAMSSFL-VDGGMANLCVAVTS-SHF---CS----AERQ---
R7D7M0_9FIRM/8-352VFAGDLLAQTIASSFGIAEMGIPFFGLYGACS-TMGESLSLGAIA-VSAGYGHHILCATS-SHF---AT----AEKE---
R7FR34_9FIRM/4-332LFGGDLLRQGVATSMGVETLQIPMFGLYGACS-TSGEALALASMS-VAAGYGERMLAVTS-SHF---GS----AEKE---
U5LA28_9BACI/4-335FIAGDLINQITPSSLAARTIQLPYFGVFGACS-TSMEGLALSAFI-INYGGAKKIITGAS-SHN---SA----VEKQ---

PF13723

X2H9N4_9NEIS/21-241KDV...------------.......DLSFLPA.MKRRRLGSAARL-MFAASWPLLQED..-ASC...PVVFVSHDGE---
Q7MMI9_VIBVY/35-248......------------.......TASNIPA.MMRRRMSSLSKL-AVHAAIELLNQN..-DVD...YMVFSSRHGE---
Q5E6K7_VIBF1/27-240......------------.......PVDKIPA.MARRRMSSLSKL-AVQTALTLAEEN..-DID...YLVFSSQHGE---
W0PHW4_9BURK/37-246P.....------------.......TLSFLPA.MQRRRLSPLSRL-IFATAWPILENH..-PQC...PVVFSSRNGE---
G0A1B0_METMM/37-247A.....------------.......DVNFLPM.LQRRRLSPLARA-ACAVAWHCRLNC..-GDM...PAVFFSCHGE---
A6W243_MARMS/22-235P.....------------.......GLKNIPV.MLRRRFTAIGKY-SVEAATPLLKED..-EQI...PLVFASRHGD---
K4KXD4_SIMAS/26-238P.....------------.......DVAAVPA.MLRRRLGPLGKP-VAAVAWDMLEPG..-DHQ...SLVFASRHGD---
Q5F738_NEIG1/7-227VRR...------------.......ELPFLPA.MRRRRLSKAARL-VCDAAWDIASAH..-PGS...PVVYASHDGE---
F6AHI4_PSEF1/21-233P.....------------.......DVGFLPA.LQRRRLSRLARM-MFQVAWPLAEGH..-SAL...PLVFASRHGE---
V6EZ88_9PROT/10-227P.....------------.......ARPALPS.LLRRRVSAIGRK-ALEAAWTVLPTD..-GEP...RLILASRHGE---
B2JEK1_BURP8/13-228P.....------------.......DVGFIEP.MVRRRLSTLSRI-ALKVAHDCAADK..-PSV...RIVFASRHGE---
Q8E9B8_SHEON/23-242TTKEHD------------LTDGISPALPQVPA.MQRRRFSRLTKM-MLDVSFQCDAP...-PNC...RSIFASRHGE---
Q3IC51_PSEHT/11-232I.....------------.......TLDWVAP.MQRRRMTRFSKM-VLHSAQQVSSADQY-TNL...SAVFSSRHGD---
R7ICN1_9BURK/24-238P.....------------.........KTLPL.MTSRRLSPGARA-GIECSIAAAGST..-VPD...FVVTASRDAE---
M4U150_9GAMM/24-238V.....------------.......PISLIKP.MMRRRMSSLSKI-AVQAALQLSAQE..-QVD...YIVFASRHGE---
A8AR40_CITK8/23-238PQA...------------.......KLHELPM.MTARRLSSGSKL-AVECGLAMLRRH..-DID...AVLYTSRHGE---
Q1QTW3_CHRSD/12-232EKP...------------.......AGAQVPA.MLRRRLTSIGRA-LCDMLAELDAEADY-......PLLYASRHGD---
Q6CYK1_PECAS/23-238PLD...------------.......KCRHLPM.MMARRLNQGSRL-AVDSGLALLHRQ..-SVD...AIVFTSRHGE---
Q088U8_SHEFN/23-254......------------........LAHIPA.MQRRRFSRLTKM-MLTAAYQCQPE...-NNC...RSIFSSRHGE---
H2IXQ6_RAHAC/23-237P.....------------.......RSQQIPM.MSARRMSIGSRF-AVDAGLTLLTNN..-NVD...AAIFTSRHGE---
Q6LKR1_PHOPR/24-249V.....------------.......PHHLIPPMMMRRRMSTLSKL-AMQTALALTEGH..-NVD...YIVFASRHGE---
C9R2B5_AGGAD/33-245P.....------------.......KLAFLPP.LKRRRLSDSARL-FFEAAWDLVEEQ..-SNL...PVVYASANSE---
E3HL09_ACHXA/22-238P.....------------.......RLDFLPP.LQRRRLSPLARG-VFDCAWPIAEGR..-PAM...PLVFASRHGE---
Q4KJF9_PSEF5/22-236P.....------------.......DVSFLPA.MQRRRLSRLARM-AFSVGWPLAEGL..-EQL...PLVFISRHGE---
Q87V50_PSESM/22-236P.....------------.......DVSFLPA.MQRRRLGRMARM-AFAVGWPLTEGY..-GRV...PLVFVSRHGE---
Q13V69_BURXL/13-242P.....------------.......DIGFVEP.IVRRRLSTLSRV-ALKVAHDCVARDAA-......RVVFASRHGE---
A8GA54_SERP5/11-225P.....------------.......GCSHIPM.MSLRRMSIGTRL-AVESGLILLNDY..-PAD...MAIFTSRHGE---
A0KNN6_AERHH/22-235P.....------------.......ATPLLPM.MMARRLSQGARL-AVQVGLSLLARH..-QID...SAVFVSRHGE---
A9ICW7_BORPD/22-238P.....------------.......STHFLPA.MQRRRLSPLARM-VFGCAWPLAENL..-APM...PVVFASRHGE---
D5CEN4_ENTCC/23-238PLA...------------.......KLTDLPM.MTARRLNSGSKL-AVDIGLAMLRKH..-RID...AVVYSSRHGE---
B2FNB7_STRMK/22-243P.....------------.......ALAEVPA.MQRRRIERLGRM-AIQTACWCEDGQ..-GADSDVPLVFASRHGD---
F0LS02_VIBFN/28-238......------------.......EAGLIPA.MMRRRMSQLSKL-AVQTALTLMNAH..-RVD...YLVFASRHGE---
A3QIS7_SHELP/23-236......------------.......ALKQVPA.MQRRRFSKLTKM-LLDVAFQCDAP...-AQC...RTIFASRHGE---
B8CHL8_SHEPW/21-234......------------.......KLPQVPA.MQRRRLSKLTKI-ILDSIFQCEPP...-AQC...RSIFASQHGE---
M4RB67_BIBTR/27-246P.....------------.......KLAFLPP.LKRRRLSDAARL-FFESAWELTAEG..-ENL...PVVYASQNSE---
G4SXC9_META2/10-226......------------.......WLANVPP.MLKRRLTPLAKT-VFCAVAQCLDED..-VMV...PAVFSSAHGE---
F7YP97_VIBA7/32-242......------------.......NTDHIPP.MMRRRMSRLSKL-AVQTALTAIESQ..-HID...YMVFSCRHGE---
G0AK33_COLFT/32-258......------------.......AVAAMPA.MLRRRAGAMGKM-ALEAAYRCLDGK..-TGV...PTVFCSRHGE---
D8MQL2_ERWBE/23-238PMA...------------.......KTRFLPM.MTARRLMGGSRA-AVESGLALMARQ..-RVD...AIVFTSRHGE---
G8AJ88_AZOBR/25-240P.....------------..........ALPM.MLRRRTSPIGQK-LIAAALACGNAA..-HTA...RYVLASGHGE---
B7VKK6_VIBSL/28-249......------------.......EFKAIPP.MMRRRMSMQSKL-AVQTALTLLKDT..-SID...YLVFASRHGE---
B0URR9_HISS2/28-245P.....------------.......KLAFLPP.LKRRRLSESARL-FFEAAWPLTEQE..-NNL...PVVYASLNGE---
Q1LF35_RALME/48-282P.....------------.......ALAAMAP.MLRRRVNATGRA-ALHPAYEIAANDA.-GVM...PAVFASRHGD---
A7ZFF8_CAMC1/20-217......------------.......DLAKIPP.MQRRRLSSAAK.-...CAFSLLSGFDK-IDM...PVIFSSYEGE---

PF02797

O81305_ARATH/238-383--------------------------------------------------------------------------------
O23674_ARATH/245-393--------------------------------------------------------------------------------
F2CYQ0_HORVD/240-390--------------------------------------------------------------------------------
F6HP18_VITVI/238-388--------------------------------------------------------------------------------
M1CL74_SOLTU/241-391--------------------------------------------------------------------------------
Q7X795_ORYSJ/244-388--------------------------------------------------------------------------------

PF08541

Q8ED66_SHEON/282-372--------------------------------------------------------------------------------
Q74CS1_GEOSL/237-326--------------------------------------------------------------------------------
Q7CTU0_AGRT5/239-328--------------------------------------------------------------------------------
FABH_PROMM/246-335--------------------------------------------------------------------------------
Q73Q42_TREDE/222-311--------------------------------------------------------------------------------
FABH_PSEAE/233-322--------------------------------------------------------------------------------
FABH_CHRVO/230-319--------------------------------------------------------------------------------
FABH_DESVH/241-330--------------------------------------------------------------------------------
Q5YPR0_NOCFA/241-333--------------------------------------------------------------------------------
FABH2_STRCO/230-319--------------------------------------------------------------------------------
Q5WEX8_BACSK/220-309--------------------------------------------------------------------------------
FABH_NOSS1/239-328--------------------------------------------------------------------------------
Q67RA0_SYMTH/248-336--------------------------------------------------------------------------------
Q5NF70_FRATT/234-323--------------------------------------------------------------------------------
Q7M7Z5_WOLSU/238-327--------------------------------------------------------------------------------
FABH2_VIBPA/235-324--------------------------------------------------------------------------------
Q7NZ26_CHRVO/282-372--------------------------------------------------------------------------------
FABH_AQUAE/220-309--------------------------------------------------------------------------------
FABH1_STRAW/264-354--------------------------------------------------------------------------------
FABH_TROWT/231-321--------------------------------------------------------------------------------
Q63N14_BURPS/258-347--------------------------------------------------------------------------------
FABH_HELHP/239-328--------------------------------------------------------------------------------
FABH3_STRCO/240-329--------------------------------------------------------------------------------
FABH_PROMP/245-334--------------------------------------------------------------------------------
Q65LQ9_BACLD/237-326--------------------------------------------------------------------------------
FABH_CLOAB/234-323--------------------------------------------------------------------------------
FABH_AROAE/232-321--------------------------------------------------------------------------------
FABH_ARATH/314-403--------------------------------------------------------------------------------
Q5FUN7_GLUOX/235-324--------------------------------------------------------------------------------
Q9L1V9_STRCO/246-337--------------------------------------------------------------------------------
FABH2_STRAW/225-314--------------------------------------------------------------------------------
Q87XT2_PSESM/282-372--------------------------------------------------------------------------------
Q884Y8_PSESM/221-307--------------------------------------------------------------------------------
FABH2_LACPL/239-328--------------------------------------------------------------------------------
FABH2_BACSU/234-323--------------------------------------------------------------------------------
FABH_RUEPO/234-323--------------------------------------------------------------------------------
FABH_HAEDU/227-316--------------------------------------------------------------------------------
Q7TTZ7_RHOBA/241-330--------------------------------------------------------------------------------
FABH_RHOBA/256-345--------------------------------------------------------------------------------
Q7NV97_CHRVO/234-323--------------------------------------------------------------------------------
Q5ZV11_LEGPH/238-327--------------------------------------------------------------------------------
Q97KV2_CLOAB/245-334--------------------------------------------------------------------------------
Q8XTB9_RALSO/282-372--------------------------------------------------------------------------------
Q6A930_PROAC/241-331--------------------------------------------------------------------------------
Q5SL76_THET8/230-319--------------------------------------------------------------------------------
Q7N8H1_PHOLL/221-311--------------------------------------------------------------------------------
FABH2_VIBVY/235-324--------------------------------------------------------------------------------
Q82PP5_STRAW/243-333--------------------------------------------------------------------------------
FABH_PROMA/245-334--------------------------------------------------------------------------------
FABH_BLOFL/229-318--------------------------------------------------------------------------------
Q8RHZ0_FUSNN/221-309--------------------------------------------------------------------------------
Q7X8V9_ORYSJ/337-426--------------------------------------------------------------------------------
FABH_CLOTE/244-333--------------------------------------------------------------------------------
Q88ES4_PSEPK/221-308--------------------------------------------------------------------------------
Q88EC1_PSEPK/299-389--------------------------------------------------------------------------------
FABH_THETN/240-329--------------------------------------------------------------------------------
FABH_STRMU/234-325--------------------------------------------------------------------------------
FABH1_BACAN/219-308--------------------------------------------------------------------------------
FABH_STRP1/233-324--------------------------------------------------------------------------------
FABH_SYNY3/241-330--------------------------------------------------------------------------------
FABH_LACLA/234-325--------------------------------------------------------------------------------
FABH5_STRCO/237-326--------------------------------------------------------------------------------
Q5YN70_NOCFA/251-341--------------------------------------------------------------------------------
FABH2_BACHD/236-325--------------------------------------------------------------------------------
Q5YNJ2_NOCFA/253-343--------------------------------------------------------------------------------
Q885B9_PSESM/249-338--------------------------------------------------------------------------------
Q82HI7_STRAW/252-343--------------------------------------------------------------------------------
Q6FAK4_ACIAD/280-370--------------------------------------------------------------------------------
Q6DAZ3_PECAS/249-337--------------------------------------------------------------------------------
FABH_SYMTH/239-328--------------------------------------------------------------------------------
Q8CV20_OCEIH/48-137--------------------------------------------------------------------------------
Q9HYV7_PSEAE/259-349--------------------------------------------------------------------------------
FABH_GEOKA/219-308--------------------------------------------------------------------------------
FABH2_VIBCH/235-324--------------------------------------------------------------------------------
Q6AQA3_DESPS/255-342--------------------------------------------------------------------------------
FABH1_LACPL/238-323--------------------------------------------------------------------------------
Q8EDA9_SHEON/231-320--------------------------------------------------------------------------------
Q6LQM2_PHOPR/234-323--------------------------------------------------------------------------------
Q63PP7_BURPS/254-343--------------------------------------------------------------------------------
FABH_COXBU/230-319--------------------------------------------------------------------------------
FABH2_BACAN/235-324--------------------------------------------------------------------------------
Q5NL87_ZYMMO/234-323--------------------------------------------------------------------------------
FABH_THEEB/239-328--------------------------------------------------------------------------------
Q5LUY4_RUEPO/282-372--------------------------------------------------------------------------------
Q98AW4_RHILO/238-327--------------------------------------------------------------------------------
Q6AET2_LEIXX/245-335--------------------------------------------------------------------------------
Q81JE9_BACAN/240-329--------------------------------------------------------------------------------
Q6MR21_BDEBA/243-332--------------------------------------------------------------------------------
FABH_STRA5/232-323--------------------------------------------------------------------------------
FABH_BORPE/239-328--------------------------------------------------------------------------------
FABH_NITEU/229-318--------------------------------------------------------------------------------
Q98K75_RHILO/223-313--------------------------------------------------------------------------------
Q9K3G9_STRCO/229-319--------------------------------------------------------------------------------
FABH_GLOVI/237-326--------------------------------------------------------------------------------
Q8EG66_SHEON/260-347--------------------------------------------------------------------------------
Q63PP9_BURPS/255-344--------------------------------------------------------------------------------
Q7NZW4_CHRVO/228-317--------------------------------------------------------------------------------
Q8RC85_THETN/250-338--------------------------------------------------------------------------------
Q6MAF5_PARUW/240-329--------------------------------------------------------------------------------
Q5QWT4_IDILO/232-321--------------------------------------------------------------------------------
Q67MB7_SYMTH/254-342--------------------------------------------------------------------------------
FABH1_DEIRA/233-322--------------------------------------------------------------------------------
Q9I4X1_PSEAE/253-342--------------------------------------------------------------------------------
FABH1_VIBCH/227-316--------------------------------------------------------------------------------
Q73S66_MYCPA/245-335--------------------------------------------------------------------------------
FABH_NEIG1/231-320--------------------------------------------------------------------------------
Q63N13_BURPS/243-332--------------------------------------------------------------------------------
FABH_PECAS/228-317--------------------------------------------------------------------------------
FABH_CLOPE/235-324--------------------------------------------------------------------------------
Q820X4_COXBU/239-326--------------------------------------------------------------------------------
FABH_PORGI/240-327--------------------------------------------------------------------------------
Q82NC9_STRAW/244-334--------------------------------------------------------------------------------
FABH_RHIME/234-323--------------------------------------------------------------------------------
FABH_RALSO/237-326--------------------------------------------------------------------------------
Q5ZTD0_LEGPH/246-335--------------------------------------------------------------------------------
Q82KT2_STRAW/240-329--------------------------------------------------------------------------------
Q8F686_LEPIN/233-322--------------------------------------------------------------------------------
FABH_OCEIH/221-310--------------------------------------------------------------------------------
FABH_SHEON/230-319--------------------------------------------------------------------------------
FABH_DESPS/235-324--------------------------------------------------------------------------------
FABH_XANCP/236-325--------------------------------------------------------------------------------
FABH_CHLTE/239-328--------------------------------------------------------------------------------
FABH_BURPS/240-329--------------------------------------------------------------------------------
Q8RC81_THETN/237-325--------------------------------------------------------------------------------
Q5YNV7_NOCFA/248-338--------------------------------------------------------------------------------
FABH_METCA/232-321--------------------------------------------------------------------------------
FABH2_DEIRA/239-328--------------------------------------------------------------------------------
PQSD_PSEAE/242-329--------------------------------------------------------------------------------
B9KJ28_ANAMF/234-322--------------------------------------------------------------------------------
D5AUL7_RHOCB/235-324--------------------------------------------------------------------------------
D6D672_9BACE/241-327--------------------------------------------------------------------------------
FABH_HELPY/239-327--------------------------------------------------------------------------------
FABH_CHLTR/238-325--------------------------------------------------------------------------------
FABH_STRR6/234-323--------------------------------------------------------------------------------
FABH_MYCTU/242-332--------------------------------------------------------------------------------
Q2YKB4_BRUA2/237-325--------------------------------------------------------------------------------
FABH_BRUA2/235-323--------------------------------------------------------------------------------
FABH_SYNE7/244-331--------------------------------------------------------------------------------
FABH_STAEQ/223-311--------------------------------------------------------------------------------
Q5LAY0_BACFN/240-327--------------------------------------------------------------------------------
FABH_STRT2/237-320--------------------------------------------------------------------------------
Q5ZTD4_LEGPH/263-346--------------------------------------------------------------------------------
FABH_BARHE/236-324--------------------------------------------------------------------------------
Q79ZF6_STRAW/239-330--------------------------------------------------------------------------------
Q79ZR7_STRAW/221-310--------------------------------------------------------------------------------
Q7KWI9_PLAF7/283-371--------------------------------------------------------------------------------
Q81RV7_BACAN/243-331--------------------------------------------------------------------------------
Q8P810_XANCP/349-438--------------------------------------------------------------------------------
FABH_FUSNN/237-326--------------------------------------------------------------------------------
FABH_LISMO/221-310--------------------------------------------------------------------------------
FABH_CAMJE/230-318--------------------------------------------------------------------------------
FABHL_CAMJE/252-337--------------------------------------------------------------------------------
FABH_RICPR/230-317--------------------------------------------------------------------------------
V6KTJ6_STRRC/242-332--------------------------------------------------------------------------------

PF02803

THIL_YEAST/274-397--------------------------------------------------------------------------------
FADA_ECOLI/261-386--------------------------------------------------------------------------------
YKA3_CAEEL/305-445--------------------------------------------------------------------------------
THIL_HUMAN/306-426--------------------------------------------------------------------------------
THLA_CLOAB/269-391--------------------------------------------------------------------------------
ATOB_ECOLI/270-392--------------------------------------------------------------------------------
THL_BACSU/270-392--------------------------------------------------------------------------------
THIL_CUPNH/270-392--------------------------------------------------------------------------------
THIM_HUMAN/273-395--------------------------------------------------------------------------------
THIKA_RAT/298-421--------------------------------------------------------------------------------
YQEF_ECOLI/269-391--------------------------------------------------------------------------------
THIK_YEAST/296-416--------------------------------------------------------------------------------
FADA4_MYCLE/270-392--------------------------------------------------------------------------------
THIK_YARLI/291-413--------------------------------------------------------------------------------
ECHB_RAT/332-472--------------------------------------------------------------------------------
ATOB_HAEIN/270-392--------------------------------------------------------------------------------
A1B3M4_PARDP/268-390--------------------------------------------------------------------------------
C5M4S8_CANTT/289-406--------------------------------------------------------------------------------
C5M6V3_CANTT/274-396--------------------------------------------------------------------------------
I3YE91_THIV6/271-393--------------------------------------------------------------------------------
FADA_PSESM/266-390--------------------------------------------------------------------------------

PF02801

PKSJ_BACSU/4829-4945--------------------------------------------------------------------------------
PKSL_BACSU/4322-4438--------------------------------------------------------------------------------
Q18559_CAEEL/5488-5604--------------------------------------------------------------------------------
Q18559_CAEEL/244-354--------------------------------------------------------------------------------
P95029_MYCTU/2816-2942--------------------------------------------------------------------------------
PKSF_BACSU/257-367--------------------------------------------------------------------------------
P74017_SYNY3/244-356--------------------------------------------------------------------------------
O67612_AQUAE/256-371--------------------------------------------------------------------------------
FABF_BACSU/254-369--------------------------------------------------------------------------------
FABF_SYNY3/258-373--------------------------------------------------------------------------------
Q9ZCH8_RICPR/269-384--------------------------------------------------------------------------------
CEM1_YEAST/273-391--------------------------------------------------------------------------------
OXSM_SCHPO/262-380--------------------------------------------------------------------------------
FABB_HAEIN/253-361--------------------------------------------------------------------------------
O84775_CHLTR/256-371--------------------------------------------------------------------------------
KASC1_ARATH/315-429--------------------------------------------------------------------------------
O54149_STRCO/253-365--------------------------------------------------------------------------------
Q9Z4Y3_STRCO/251-363--------------------------------------------------------------------------------
Q93458_CAEEL/101-214--------------------------------------------------------------------------------
KASA_STRCO/303-418--------------------------------------------------------------------------------
KAS1_STRCO/261-376--------------------------------------------------------------------------------
KASB_STRCO/251-361--------------------------------------------------------------------------------
KAS2_STRCO/264-377--------------------------------------------------------------------------------
FAS_HUMAN/243-360--------------------------------------------------------------------------------
FAS_CHICK/243-360--------------------------------------------------------------------------------
P91871_CAEEL/279-396--------------------------------------------------------------------------------
WA_EMENI/634-754--------------------------------------------------------------------------------
O54142_STRCO/811-926--------------------------------------------------------------------------------
P71718_MYCTU/262-379--------------------------------------------------------------------------------
O65933_MYCTU/289-405--------------------------------------------------------------------------------
O53901_MYCTU/271-385--------------------------------------------------------------------------------
Q49933_MYCLE/296-416--------------------------------------------------------------------------------
O86335_MYCTU/354-472--------------------------------------------------------------------------------
O54155_STRCO/1041-1159--------------------------------------------------------------------------------
Q18559_CAEEL/2133-2242--------------------------------------------------------------------------------
O06586_MYCTU/230-347--------------------------------------------------------------------------------
PKSR_BACSU/1766-1891--------------------------------------------------------------------------------
PKSM_BACSU/3776-3894--------------------------------------------------------------------------------
PKSL_BACSU/3126-3244--------------------------------------------------------------------------------
PKSJ_BACSU/2018-2137--------------------------------------------------------------------------------
PKSL_BACSU/2189-2307--------------------------------------------------------------------------------
PKSM_BACSU/2562-2680--------------------------------------------------------------------------------
PKSR_BACSU/785-903--------------------------------------------------------------------------------
PKSM_BACSU/655-773--------------------------------------------------------------------------------
PKSJ_BACSU/3597-3724--------------------------------------------------------------------------------
O54142_STRCO/307-424--------------------------------------------------------------------------------
A4F7N8_SACEN/2288-2403--------------------------------------------------------------------------------
A4F7P0_SACEN/288-406--------------------------------------------------------------------------------
A4F7P1_SACEN/285-403--------------------------------------------------------------------------------
A8XKG1_CAEBR/5528-5642--------------------------------------------------------------------------------
B2J2F3_NOSP7/310-427--------------------------------------------------------------------------------
B5HT08_9ACTO/261-376--------------------------------------------------------------------------------
B6H6U0_PENCW/303-422--------------------------------------------------------------------------------
B8CQB2_SHEPW/317-434--------------------------------------------------------------------------------
B8CQB4_SHEPW/303-420--------------------------------------------------------------------------------
B8NI04_ASPFN/629-749--------------------------------------------------------------------------------
B8NYX0_ASPFN/264-381--------------------------------------------------------------------------------
C9R299_AGGAD/260-369--------------------------------------------------------------------------------
F2RC16_STRVP/252-362--------------------------------------------------------------------------------
G0FS56_AMYMS/293-411--------------------------------------------------------------------------------
G3XDA2_PSEAE/255-370--------------------------------------------------------------------------------
H9JGF5_BOMMO/86-195--------------------------------------------------------------------------------
I6X8D2_MYCTU/374-491--------------------------------------------------------------------------------
I6Y231_MYCTU/264-376--------------------------------------------------------------------------------
N4VDN9_COLOR/639-759--------------------------------------------------------------------------------
O25284_HELPY/258-369--------------------------------------------------------------------------------
NODE_RHIME/247-359--------------------------------------------------------------------------------
FABF_ECOLI/255-370--------------------------------------------------------------------------------
FAB2_MYCTU/262-374--------------------------------------------------------------------------------
FAB1_MYCTU/262-374--------------------------------------------------------------------------------
PPSE_MYCTU/270-389--------------------------------------------------------------------------------
PPSA_MYCTU/359-477--------------------------------------------------------------------------------
Q0CJ59_ASPTN/303-419--------------------------------------------------------------------------------
Q4KCY8_PSEF5/298-415--------------------------------------------------------------------------------
Q4KCY9_PSEF5/270-383--------------------------------------------------------------------------------
Q5CUM8_CRYPI/1142-1260--------------------------------------------------------------------------------
Q7APV9_MYCLE/290-405--------------------------------------------------------------------------------
Q7RVN4_NEUCR/272-391--------------------------------------------------------------------------------
Q82BC0_STRAW/261-376--------------------------------------------------------------------------------
Q87N23_VIBPA/255-371--------------------------------------------------------------------------------
Q87W69_PSESM/297-414--------------------------------------------------------------------------------
Q87W70_PSESM/852-968--------------------------------------------------------------------------------
Q8YLE3_NOSS1/299-407--------------------------------------------------------------------------------
Q9CB70_MYCLE/293-407--------------------------------------------------------------------------------
Q9I3B2_PSEAE/252-360--------------------------------------------------------------------------------
Q9Z373_YERPE/285-402--------------------------------------------------------------------------------
W5XQV6_9CORY/55-180--------------------------------------------------------------------------------

PF08540

HMCS_SCHPO/176-446--------------------------------------------------------------------------------
Q5A3Z7_CANAL/178-450--------------------------------------------------------------------------------
HMCS_ARATH/175-451--------------------------------------------------------------------------------
HMCS2_HUMAN/224-506--------------------------------------------------------------------------------
HMCS_CAEEL/183-448--------------------------------------------------------------------------------
HMCS_YEAST/217-490--------------------------------------------------------------------------------
HMCS1_RAT/187-469--------------------------------------------------------------------------------

PF00195

O23674_ARATH/11-236--------------------------------------------------------------------------------
F2CYQ0_HORVD/6-230--------------------------------------------------------------------------------
F6HP15_VITVI/3-228--------------------------------------------------------------------------------
Q7X795_ORYSJ/13-234--------------------------------------------------------------------------------
Q8W3P6_VITVI/8-228--------------------------------------------------------------------------------

PF08545

Q8ED66_SHEON/150-221--------------------------------------------------------------------------------
Q74CS1_GEOSL/107-185--------------------------------------------------------------------------------
Q63N14_BURPS/119-199--------------------------------------------------------------------------------
Q6MR21_BDEBA/112-191--------------------------------------------------------------------------------
Q7CTU0_AGRT5/109-187--------------------------------------------------------------------------------
FABH1_BACTN/110-188--------------------------------------------------------------------------------
FABH_YERPE/106-183--------------------------------------------------------------------------------
FABH3_STRCO/108-188--------------------------------------------------------------------------------
FABH_GLOVI/106-183--------------------------------------------------------------------------------
FABH2_DEIRA/113-191--------------------------------------------------------------------------------
Q8EDA9_SHEON/104-182--------------------------------------------------------------------------------
Q8P810_XANCP/217-297--------------------------------------------------------------------------------
Q5FUN7_GLUOX/112-191--------------------------------------------------------------------------------
Q8XRP5_RALSO/110-188--------------------------------------------------------------------------------
FABH_THETN/110-188--------------------------------------------------------------------------------
FABH_CHLTE/107-186--------------------------------------------------------------------------------
Q7TTZ7_RHOBA/109-186--------------------------------------------------------------------------------
FABH2_BACAN/108-186--------------------------------------------------------------------------------
Q73Q42_TREDE/107-187--------------------------------------------------------------------------------
Q67RA0_SYMTH/112-193--------------------------------------------------------------------------------
FABH_HELPY/109-188--------------------------------------------------------------------------------
PQSD_PSEAE/107-188--------------------------------------------------------------------------------
FABH_CLOTE/108-185--------------------------------------------------------------------------------
FABH_RUEPO/108-191--------------------------------------------------------------------------------
FABH_PASMU/106-183--------------------------------------------------------------------------------
FABH_SYMTH/109-187--------------------------------------------------------------------------------
Q7NZ26_CHRVO/150-229--------------------------------------------------------------------------------
Q7NV97_CHRVO/105-183--------------------------------------------------------------------------------
FABH1_LACPL/108-188--------------------------------------------------------------------------------
Q820X4_COXBU/124-203--------------------------------------------------------------------------------
FABH1_STRAW/116-193--------------------------------------------------------------------------------
FABH_PROMP/113-191--------------------------------------------------------------------------------
FABH_PSEAE/105-185--------------------------------------------------------------------------------
FABH_AQUAE/105-183--------------------------------------------------------------------------------
FABH_HELHP/110-189--------------------------------------------------------------------------------
FABH_CAUCR/106-189--------------------------------------------------------------------------------
FABH_BLOFL/106-183--------------------------------------------------------------------------------
FABH_METCA/108-185--------------------------------------------------------------------------------
FABH2_VIBPA/107-185--------------------------------------------------------------------------------
Q6A930_PROAC/116-193--------------------------------------------------------------------------------
Q6FAK4_ACIAD/154-233--------------------------------------------------------------------------------
FABH_BRADU/109-193--------------------------------------------------------------------------------
FABH_SHEON/106-183--------------------------------------------------------------------------------
FABH_CLOAB/106-183--------------------------------------------------------------------------------
Q9K3G9_STRCO/109-186--------------------------------------------------------------------------------
Q73S66_MYCPA/111-193--------------------------------------------------------------------------------
Q81RV7_BACAN/105-186--------------------------------------------------------------------------------
Q5YNV7_NOCFA/117-194--------------------------------------------------------------------------------
FABH_NEIG1/108-185--------------------------------------------------------------------------------
Q6MAF5_PARUW/110-188--------------------------------------------------------------------------------
Q82PP5_STRAW/108-187--------------------------------------------------------------------------------
FABH2_LACPL/107-188--------------------------------------------------------------------------------
FABH2_STRCO/112-192--------------------------------------------------------------------------------
Q7U427_SYNPX/113-191--------------------------------------------------------------------------------
FABH_PHOLL/106-183--------------------------------------------------------------------------------
FABH4_STRCO/108-188--------------------------------------------------------------------------------
FABH_TROWT/107-184--------------------------------------------------------------------------------
FABHL_CAMJE/116-191--------------------------------------------------------------------------------
FABH_NOSS1/108-185--------------------------------------------------------------------------------
FABH_STRT2/106-183--------------------------------------------------------------------------------
Q9I4X1_PSEAE/123-201--------------------------------------------------------------------------------
Q7M7Z5_WOLSU/107-186--------------------------------------------------------------------------------
FABH_PORGI/110-188--------------------------------------------------------------------------------
Q5QWT4_IDILO/106-184--------------------------------------------------------------------------------
Q5NL87_ZYMMO/111-190--------------------------------------------------------------------------------
Q98K75_RHILO/87-167--------------------------------------------------------------------------------
FABH1_DEIRA/107-185--------------------------------------------------------------------------------
FABH_PROMA/113-191--------------------------------------------------------------------------------
Q5WEX8_BACSK/106-184--------------------------------------------------------------------------------
FABH_MYCPA/116-193--------------------------------------------------------------------------------
FABH_NITEU/106-183--------------------------------------------------------------------------------
Q74GF6_GEOSL/107-185--------------------------------------------------------------------------------
FABH_HAEIN/106-183--------------------------------------------------------------------------------
FABH_AGRT5/107-190--------------------------------------------------------------------------------
FABH5_STRCO/105-185--------------------------------------------------------------------------------
Q885B9_PSESM/110-188--------------------------------------------------------------------------------
Q63PP7_BURPS/122-199--------------------------------------------------------------------------------
FABH_STRMU/106-183--------------------------------------------------------------------------------
FABH_LACLA/106-184--------------------------------------------------------------------------------
Q97KV2_CLOAB/114-194--------------------------------------------------------------------------------
Q8F686_LEPIN/117-195--------------------------------------------------------------------------------
FABH_STAEQ/106-184--------------------------------------------------------------------------------
FABH_CHRVO/107-184--------------------------------------------------------------------------------
FABH1_BACCR/106-184--------------------------------------------------------------------------------
O30202_ARCFU/103-177--------------------------------------------------------------------------------
FABH_AROAE/109-186--------------------------------------------------------------------------------
FABH_SYNY3/110-187--------------------------------------------------------------------------------
Q8KE19_CHLTE/7-93--------------------------------------------------------------------------------
FABH2_BACSU/107-185--------------------------------------------------------------------------------
FABH_RALSO/114-191--------------------------------------------------------------------------------
FABH_CLOPE/106-184--------------------------------------------------------------------------------
Q6LQM2_PHOPR/106-184--------------------------------------------------------------------------------
FABH_CAMJE/108-185--------------------------------------------------------------------------------
Q5YPR0_NOCFA/115-192--------------------------------------------------------------------------------
FABH_COXBU/109-186--------------------------------------------------------------------------------
Q63N13_BURPS/108-189--------------------------------------------------------------------------------
Q82KT2_STRAW/108-188--------------------------------------------------------------------------------
Q65LQ9_BACLD/110-188--------------------------------------------------------------------------------
Q982F9_RHILO/108-186--------------------------------------------------------------------------------
Q81JE9_BACAN/109-187--------------------------------------------------------------------------------
Q5NF70_FRATT/108-185--------------------------------------------------------------------------------
FABH_PROMM/113-192--------------------------------------------------------------------------------
Q6AET2_LEIXX/120-197--------------------------------------------------------------------------------
Q7NZW4_CHRVO/106-186--------------------------------------------------------------------------------
FABH_DESPS/106-184--------------------------------------------------------------------------------
FABH_XANCP/110-187--------------------------------------------------------------------------------
Q8RC81_THETN/108-187--------------------------------------------------------------------------------
Q5YNJ2_NOCFA/116-193--------------------------------------------------------------------------------
Q67MB7_SYMTH/116-197--------------------------------------------------------------------------------
Q884Y8_PSESM/108-185--------------------------------------------------------------------------------
FABH2_BACHD/109-187--------------------------------------------------------------------------------
Q7KWI9_PLAF7/153-231--------------------------------------------------------------------------------
Q65LD5_BACLD/106-184--------------------------------------------------------------------------------
FABH_ENTFA/107-184--------------------------------------------------------------------------------
Q8RC85_THETN/112-193--------------------------------------------------------------------------------
FABH_OCEIH/106-184--------------------------------------------------------------------------------
FABH_THEEB/108-185--------------------------------------------------------------------------------
A8GFT0_SERP5/117-193--------------------------------------------------------------------------------
B9KJ28_ANAMF/108-190--------------------------------------------------------------------------------
C4YXG9_9RICK/106-183--------------------------------------------------------------------------------
D5AUL7_RHOCB/108-191--------------------------------------------------------------------------------
D7TN17_VITVI/170-249--------------------------------------------------------------------------------
E3PXS0_CLOSD/254-332--------------------------------------------------------------------------------
FABH_CHLTR/106-185--------------------------------------------------------------------------------
FABH_STRR6/106-183--------------------------------------------------------------------------------
Q2YKB4_BRUA2/110-185--------------------------------------------------------------------------------
FABH_SYNE7/111-188--------------------------------------------------------------------------------
Q5SL76_THET8/104-182--------------------------------------------------------------------------------
Q5ZTD0_LEGPH/115-194--------------------------------------------------------------------------------
Q5ZTD4_LEGPH/131-209--------------------------------------------------------------------------------
Q5ZV11_LEGPH/109-186--------------------------------------------------------------------------------
Q63PP9_BURPS/115-194--------------------------------------------------------------------------------
Q79ZR7_STRAW/89-169--------------------------------------------------------------------------------
FABH1_VIBVY/106-183--------------------------------------------------------------------------------
FABH_FUSNN/107-185--------------------------------------------------------------------------------
Q8RHZ0_FUSNN/90-165--------------------------------------------------------------------------------
FABH_LISMO/106-184--------------------------------------------------------------------------------
FABH_STRP1/106-183--------------------------------------------------------------------------------

PF08392

Q9FW59_ORYSJ/25-322--------------------------------------------------------------------------------
KCS3_ARATH/23-313--------------------------------------------------------------------------------
KCS11_ARATH/92-381--------------------------------------------------------------------------------
KCS16_ARATH/71-366--------------------------------------------------------------------------------
KCS2_ARATH/74-363--------------------------------------------------------------------------------
Q75M74_ORYSJ/23-315--------------------------------------------------------------------------------
KCS14_ARATH/52-334--------------------------------------------------------------------------------
Q650T5_ORYSJ/56-349--------------------------------------------------------------------------------
Q6K3E6_ORYSJ/23-314--------------------------------------------------------------------------------
Q688V9_ORYSJ/93-381--------------------------------------------------------------------------------
Q5Z6R6_ORYSJ/79-372--------------------------------------------------------------------------------
Q8H7L2_ORYSJ/167-457--------------------------------------------------------------------------------
KCS7_ARATH/38-328--------------------------------------------------------------------------------
Q8LQT7_ORYSJ/61-349--------------------------------------------------------------------------------
Q6Z6C7_ORYSJ/95-384--------------------------------------------------------------------------------
KCS20_ARATH/42-333--------------------------------------------------------------------------------
Q9XEP1_SORBI/93-380--------------------------------------------------------------------------------
Q7XT16_ORYSJ/77-368--------------------------------------------------------------------------------
Q6K558_ORYSJ/43-332--------------------------------------------------------------------------------
KCS21_ARATH/24-318--------------------------------------------------------------------------------
Q6F365_ORYSJ/100-389--------------------------------------------------------------------------------
Q6TMJ4_DICDI/114-404--------------------------------------------------------------------------------
Q75M84_ORYSJ/26-319--------------------------------------------------------------------------------
Q5Z6S3_ORYSJ/79-368--------------------------------------------------------------------------------
I1QUI1_ORYGL/97-386--------------------------------------------------------------------------------
M4EUY8_BRARP/106-388--------------------------------------------------------------------------------
M4F0P0_BRARP/70-368--------------------------------------------------------------------------------

PF01154

HMCS1_RAT/13-186--------------------------------------------------------------------------------
HMCS2_RAT/50-223--------------------------------------------------------------------------------
HMCS_YEAST/45-216--------------------------------------------------------------------------------

PF00108

M0LND5_9EURY/4-224--LI.............SRLVHDREYE--------------------------------QGLTLPS...--------...
D2RWU3_HALTV/19-236--IV.............SGITHPAEYR--------------------------------HGITIPS...--------...
E4NU18_HALBP/4-223--II.............ASITHPVEYK--------------------------------HGITLPT...--------...
Q3IPN4_NATPD/4-222--II.............ASITHPVEYK--------------------------------HGVTLPS...--------...
L0IDX7_HALRX/4-222--VI.............ASLTHPVEYK--------------------------------HGLTLPS...--------...
M0LB34_9EURY/4-223--VI.............ASLTHPAEYK--------------------------------HGVTLPS...--------...
B9LX39_HALLT/5-223--VI.............ASITHPEEYK--------------------------------HGVTLPS...--------...
M0JWJ2_9EURY/3-221--II.............ASITHPDEYK--------------------------------HGVTLPS...--------...
ECHB_RAT/55-325--MRKMMLDLNKAKTLAQRLSLLTKFR--------------------------------LNFLSPELPA--------VAE
YKA3_CAEEL/26-298--ARKAMLGMNKAKDVPSKLKIGGQIV--------------------------------KNLLSPELPA--------VAE
FADA_PSEFR/8-258--PN.............PHMSLYAAKA--------------------------------SGMM......--------...
A0A017HYH0_ECOLX/4-254--FH.............PGLSRNVAKA--------------------------------AGMM......--------...
THIKA_RAT/38-291--I..............SSRLLESDKA--------------------------------RDCLIPM...--------...
THIK_YARLI/30-284--PF.............SNKFQNNEEA--------------------------------KKCLIPM...--------...
A0A023ZC97_YEASX/36-289--GM...........ISSEELQKNREA--------------------------------KKCLIPM...--------...
THIKA_CANTR/27-280--PR............IDPHLADDAQM--------------------------------EKCLIPM...--------...
THIM_HUMAN/7-266--VR.............FGTKLGSDIK--------------------------------LEDSLWV..S--------LTD
H2Q4P9_PANTR/42-299--NR.............GSTPYGGVKL--------------------------------EDLIVKD..G--------LTD
THIB_CANTR/6-267--AR.............SGARYGDAVM--------------------------------VDGVQKD..G--------LLD
A0A023ZJC5_YEASX/5-267--AR.............AGAKFGQTVL--------------------------------VDGVERD..G--------LND
G4EU09_BACIU/4-263--GR.............WGARMGDGEL--------------------------------RDLMVYD..G--------LTC
B8ZR51_MYCLB/4-263--SR.............SGYKYGDVTI--------------------------------VDHLAYD..G--------LHD
A0A017JC55_ECOLX/4-262--SR.............TGAQLGNSQL--------------------------------VDSLVHD..G--------LWD
THIL_PARDE/4-261--...............PGQKMGDMKM--------------------------------LDTMIKD..G--------LWD
THIL_ZOORA/6-262--LA.............GGVKMGDFKM--------------------------------IDTMIKD..G--------LTD
THIL_THIVI/5-264--SR.............EGQRMGDWPM--------------------------------KDTMIVD..G--------LWD
D3UAK6_CUPNE/4-263--SR.............DGFRMGDAKL--------------------------------VDTMIVD..G--------LWD
F0K5D8_CLOAE/4-262--AR.............WGYRMGNAKF--------------------------------VDEMITD..G--------LWD
A4NPG8_HAEIF/4-263--VR.............QGVKMGNLTL--------------------------------RDTMIED..G--------LTC
A0A017JHG0_ECOLX/4-263--AR.............SGYRLGDGQV--------------------------------YDVILRD..G--------LMC

PF00109

Q18559_CAEEL/1-236....-------------VAVYTAAWCY..........DY....................KD..LLPPDQ...........
Q18559_CAEEL/1888-2129...N-------------VGVFVGLMEK..........EY.........................QDMME........SSS
Q18559_CAEEL/4241-4474....-------------TGVFIGCSAN..........EF....................SHIVYAYGYKD.......PRA
Q18559_CAEEL/824-1057....-------------..LFLAISAH................................SEYRALAEKHI......NELD
FAS_HUMAN/1-239....-------------TGVWVGVSGS..........ET....................SE..ALSRDPE.......TLV
PKSM_BACSU/2319-2554...K-------------IGVFAGVMNK..........NY.........................................
PKSL_BACSU/433-687KRQH-------------VGVFAGVMHK..........DY........................TLVGAEE.......ASA
PKSR_BACSU/1528-1758....-------------TGVFVAAGNT..........DT....................AV...................
P91871_CAEEL/37-275....-------------TGVFVGCSAS..........ET....................SGMLTQDPDT.........VT
PKSM_BACSU/393-647KRQH-------------VGVFAGVMHK..........DY........................SLIGAEA.......LSE
PKSJ_BACSU/4588-4821....-------------VGVYIGGRSQ..........HK....................PDEDSLDHAK...........
PKSJ_BACSU/3339-3589....-------------TGIFIGTGNT..........GY....................KD...LFHRAN......LPIE
PKSL_BACSU/4082-4314....-------------AGVYIGGRSQ..........HK....................PDPASLSKAK...........
PKSR_BACSU/527-777.DDG-------------VGVFIGNMYN..........QY.........................FWNIPS.......LEQ
PKSF_BACSU/6-249....-------------IGLVVGGSNF.........QQR....................ENFEVYERYQD......RSGF
PKSJ_BACSU/1760-2010....-------------TSVFMSASNN..........SY....................RALLPSDTTES.....LETPD
PKSL_BACSU/1926-2181LGGS-------------VGVYVGVMYE..........EY........................QLYGAQE.......QVR
PKSL_BACSU/2873-3118....-------------CGVYLGIMSN..........EY....................GVMLNRQSRAN..........
PKSM_BACSU/3529-3768....-------------CGVYVGVEEG..........EY....................AH...LTGDTD.......Y..
OXSM_SCHPO/1-253..LA-------------TGVCFGTGIG.........NLDD.................ALNENGVLN.KAG.......IRK
P95029_MYCTU/2548-2808...L-------------VANTQGTGMG................................GGTSMQTMYHG........NL
O67612_AQUAE/2-247..YR-------------VGVIIGTGIG.........GLKD.................IEDQTLILK.EKG.......ARR
O54142_STRCO/518-803..VV-------------VGSNLGLSRERRLHTGLCLDDLEAD.............VRSLAALAALGPDDVEA..VTKLVR
Q9ZCH8_RICPR/7-260..DR-------------TGLILGSGIG.........GLKM.................IEDTSIKLY.KEN.......NGK
WA_EMENI/376-626....-------------QRDRVGIFYG..........MT....................SDDYREVNSG.......QDID
P71718_MYCTU/4-254....-------------VGCYVGASAL..........EY....................GP..ALTEFS........HHS
FABF_SYNY3/6-249..DE-------------IGVLIGTGIG.........GLKV.................LEDQQTILL.DKG.......PSR
O65933_MYCTU/33-281....-------------TGVFAGVIHA..........GY....................GG..Q..LSGE........LE
Q49933_MYCLE/34-288....-------------TSVFVGVTAY..........DY....................ML..TLAGRLR.....PEDLD
O54142_STRCO/38-299....-------------AWRDTGIDAR................................AAGQELNDALS......RRLG
O54155_STRCO/797-1033....-------------TGVFVGISGH..........DY....................ADLQMP.HPDVV....DM...
KAS1_STRCO/3-252..WR-------------AGATLGTAVG.........GTTR.................LEHDYVLVSERGSRW..DVDDRR
O86335_MYCTU/106-346....-------------TGVFVGVSST..........DY....................VRLVSASAQQKS....TI...
KASC1_ARATH/60-306....-------------AGVLVGTGMG.........GLTV.................FSEGVQNLIEKG........HRR
CEM1_YEAST/2-265.LDH-------------FGCLIGSGIG.........SIQ...................DIYQTSLQFHND.......NKR
O53901_MYCTU/14-263....-------------TGVFVGLVHT..........DY....................IL..VHADNQ.......TFEG
KASA_STRCO/45-294....-------------VGVSLGSAVA.........AATS.................LEREYLLLSDSGRDW..EVDAAW
A4F7N8_SACEN/2032-2280....-------------TGVFVGMSHQ..........GY....................ATGRPRPEDG.........VD
A4F7P0_SACEN/31-280....-------------TGVFLGVAKF..........GY....................GEDTAAAE..........DVE
A4F7P1_SACEN/1486-1734....-------------TGVFLGAAYQ..........GY....................GQDAVVPED..........SE
B2J2F3_NOSP7/22-302...M-------------VGVILGVAMA..........KQLGMPLSARLEYPIWEKALKSS..GLSDEDTQKI..VDKIKS
B6H6U0_PENCW/46-295....-------------TSVYMGVNSD..........DY....................AKLVLEDLPNV.........G
B6HS84_PENCW/33-281....-------------TAVFWGVNSD..........DY....................SKLVLEDLPN.........VE
B8CQB2_SHEPW/32-309...K-------------IGITLGVGGG..........QKISHSLTARL..QYPVLKKVFANSGISDEDSEML..IKKFQD
B8NYX0_ASPFN/9-256....-------------AAVFMGVNSD..........DY....................GKLLLEDLPH.........VE
C9R299_AGGAD/1-252..GR-------------MGVACGSSTG..........STN.................DIKDAAELLMTGK........SD
F2RC16_STRVP/4-243....-------------MGVVTASASG.........GFEF.................GQGELQKLWSQG........SQY
F6HGM7_VITVI/144-387..SR-------------CGVLIGSAMGGI......KVFN....................DAIEALR..V.......SYRK
G0FS55_AMYMS/632-879....-------------TGVFSGLMGQ..........GY....................GSGAVAPE...........LE
G0FS56_AMYMS/1717-1966....-------------VGVFSGVSIH..........DY......................LESLSNMPA.......ELE
G0FS56_AMYMS/35-284....-------------IGVYAGVVHQ..........DY....................AP..DLSGFEG.......FMS
G0FS57_AMYMS/36-283....-------------VGVFTGAGGS..........GY....................GG..GLTGPE..........M
G0FS59_AMYMS/1702-1949....-------------VGVFAGVSNQ..........GY....................GMGADP...A........ELA
G3XDA2_PSEAE/4-245...R-------------IGVSMGSGIGG........LTNI..................ENNCRSLFEQG........PRR
G6CI33_DANPL/25-260....-------------TGVFIGACFS..........ES....................EKTWFYEKMQ.........VN
I6X8D2_MYCTU/118-366....-------------VGVYIGSSTN..........DY....................SFLAVSDPTV.........AH
I6Y231_MYCTU/6-255....-------------TAVFTGLTHE..........DY......................LVLTTTAGG.........L
K4RAF8_9ACTO/6-250.PDR-------------LGAVIASGIGG........VTTL..................LDQYDVLKEKGV........RR
N4VDN9_COLOR/383-631..DR-------------IGTFYGQTSD..........DW....................REINAAQ...........EVD
O25284_HELPY/1-247.ANR-------------MGVSSGSGIGG........LGNI..................EANSIFCFEKG........PRK
NODE_RHIME/2-236..LR-------------FGATVGVGLG..........GWDA................TEKAYRTLLVDGG......TRTE
FABF_ECOLI/4-245....-------------IGAAIGSGIGGL......GLIE....................ENHTSLMNGG........PRK
PKS15_MYCTU/47-294....-------------TGVYTGIFAA..........SY....................GN...RD.TGG........LQ
FAB2_MYCTU/13-253....-------------LMVSIGTGLG..........SA....................EELVFSYDDMRA....RGMKA
FAB1_MYCTU/13-253....-------------FAVVVGTGLG.........GAER.................IVESYDLMN.AGG.......PRK
PPSE_MYCTU/6-262...S-------------IGVYGTSSPS..........GYL..................LHNLLSHRDPNAVLAEGLN.FD
PPSA_MYCTU/101-351....-------------TGVFAGACLS..........EY....................GAMASADLSQ.........VD
PHAS_MYCTU/25-274....-------------TGVFAGVTHG..........DY....................TMVAADA.KQ........LEE
Q0CJ59_ASPTN/45-294....-------------TAVFMGVNSD..........DY....................SKLLLEDIPN.........VE
Q2UG06_ASPOR/373-621..DR-------------IGVFHGVTSN..........DW....................ME....TNTAQ.......NID
Q4KCY8_PSEF5/40-290....-------------LGVFMGVSTN..........DY....................VRLRQQLGAVE.......DVN
Q4KCY9_PSEF5/1034-1273....-------------VGVFVGANSH..........DY.....................ETRVLGSAQG........VD
Q5CUM8_CRYPI/886-1132....-------------ISVFAGCCSN..........DW....................THVCKSEANS........NIG
Q7APV9_MYCLE/33-282....-------------TGVMIGVYFN..........EY....................QSMLASSLEN.........VD
Q7RVN4_NEUCR/1-262...A-------------TGVCMGSGIGNL......DDFY....................NTSVTYDKEG........YKR
Q87N23_VIBPA/4-245....-------------VGVAIGSGIGG........LDLI..................ETGHSALVEKG........PRK
Q87W69_PSESM/39-289....-------------TGVFLGATQN..........GY...................LADLQRRN...P.......AAD
Q87W70_PSESM/593-844....-------------TGVYAGIMGT..........EY....................GTQIQHASE.........DVT
Q8YLE3_NOSS1/10-289....-------------VAVIIAAEAELSV....HKLQQRWDSSW.......QVKDGLNAAEITLPSPQVSQ..LESIVK
Q9CB70_MYCLE/36-285....-------------TAVMMGLSSW..........DY....................TIVNIER.RA........DID
Q9I3B2_PSEAE/1-241....-------------TGLIAGSGGA..........STLN................QMEAIDTLREKGV........KR
Q9Z373_YERPE/27-276...K-------------TGVFASSRMS..........TY....................PGREALNVTEV......AQVK

PF07451

A6TVT6_ALKMQ/4-333-----------------FRYPTEYGAQ--------------------------------KPPTAQW-----------TVT
A6LRM0_CLOB8/7-335-----------------FRFPLEYGSQ--------------------------------RPATAQW-----------TVT
Q9KCK2_BACHD/4-332-----------------FRYPTEYGAQ--------------------------------KPPTAQW-----------TAT
Q5WH23_BACSK/4-331-----------------FRYPTEFAVQ--------------------------------KPETAQT-----------TVT
B8I4W4_CLOCE/7-335-----------------FRFPLELGSQ--------------------------------RTPTSQW-----------TVT
A6TQB0_ALKMQ/8-336-----------------FRFPLELGNQ--------------------------------RPLTSQW-----------TVT
A4J4J1_DESRM/4-332-----------------FRYPTEYGGQ--------------------------------KPPTAQW-----------TVT
Q8ERC5_OCEIH/4-332-----------------FRYPTEYGGQ--------------------------------KPPTAQW-----------TVT
Q2RIQ1_MOOTA/8-336-----------------YRFPTEQGIQ--------------------------------RPPTAQW-----------TVT
Q67T05_SYMTH/7-337-----------------YRYPTEYGSQ--------------------------------RKPYAQH-----------TVT
Q189X1_PEPD6/7-335-----------------FRFPLELGNQ--------------------------------KPMTAQW-----------TVT
A0PZS9_CLONN/6-338-----------------FRFPLEMGSQ--------------------------------RTPTAQW-----------TVT
Q0AZ98_SYNWW/8-335-----------------FRFPTEQGIQ--------------------------------KTPSSQW-----------TAT
Q891W9_CLOTE/6-334-----------------FRYPLEFGSQ--------------------------------RAPTAQW-----------TVT
A5D2Y8_PELTS/8-335-----------------YRFPTELGIQ--------------------------------RPLTAQW-----------TVT
A8MHP8_ALKOO/7-335-----------------YRFPLESGNQ--------------------------------RPLTSQW-----------TVT
A5N8K2_CLOK5/4-332-----------------FRYPTEYGGQ--------------------------------KPPTAQW-----------TVT
Q97GR2_CLOAB/6-335-----------------FRYPLEYGSQ--------------------------------RKPDAQW-----------TVT
A4XFR0_CALS8/5-335-----------------FRYPLELGCQ--------------------------------RPPTAQW-----------TVT
A9KI33_CLOPH/13-353-----------------FRFPLAYGNQ--------------------------------RPKAASW-----------TVT
Q9KCM9_BACHD/5-332-----------------FRQPTEFAKQ--------------------------------KPDSATY-----------TVT
Q5WGZ4_BACSK/4-332-----------------FRYPTEYGSQ--------------------------------KPPTAQW-----------TAT
A5I6G6_CLOBH/6-334-----------------FRFPLEYGAQ--------------------------------RSPTSQW-----------TVT
SP5AD_BACSU/5-332-----------------FRYPTEYGGQ--------------------------------KPDTATS-----------TVT
Q24V53_DESHY/7-333-----------------YRLPTEQGGQ--------------------------------RAMSAQW-----------TVT
Q5KXJ7_GEOKA/5-332-----------------FRYPTELGVQ--------------------------------KPKTATF-----------TVT
Q5L1P1_GEOKA/4-332-----------------FRYPTEYGGQ--------------------------------KPPTAQW-----------TVT
Q81MG1_BACAN/5-333-----------------FRYPTEYGGQ--------------------------------KPGTANS-----------TVT
Q81X67_BACAN/4-332-----------------FRYPTEYGGQ--------------------------------KPPTAQW-----------TVT
Q8RAA4_THETN/7-333-----------------FRYPLEQGIQ--------------------------------RPFTSQW-----------TVT
Q8XIR8_CLOPE/9-337-----------------FRFPLEYGCQ--------------------------------RKEYSQW-----------TVT
R6N984_9CLOT/6-333-----------------FRFPLEYGGQ--------------------------------RTPTAQW-----------TVT
R7D7M0_9FIRM/8-352-----------------FRFPLGYGCQ--------------------------------RPLSATW-----------TVT
R7FR34_9FIRM/4-332-----------------FRFPLGYANQ--------------------------------RPLSAHW-----------TVT
U5LA28_9BACI/4-335-----------------FRYPTEYGGQ--------------------------------KPPTAQW-----------TVT

PF13723

X2H9N4_9NEIS/21-241-----------------INRSFQLWKS--------------------------------------------------LIQ
Q7MMI9_VIBVY/35-248-----------------LHRSIALVKD--------------------------------------------------ILL
Q5E6K7_VIBF1/27-240-----------------LTRTVALLED--------------------------------------------------ILN
W0PHW4_9BURK/37-246-----------------INRSFQLLIE--------------------------------------------------LAK
G0A1B0_METMM/37-247-----------------SQYYLEILSG--------------------------------------------------LAS
A6W243_MARMS/22-235-----------------VDLTLSLLKS--------------------------------------------------IAD
K4KXD4_SIMAS/26-238-----------------QAKTLQLLSE--------------------------------------------------IGA
Q5F738_NEIG1/7-227-----------------MARSFDLWLE--------------------------------------------------LLK
F6AHI4_PSEF1/21-233-----------------TPRNLAILKD--------------------------------------------------LAV
V6EZ88_9PROT/10-227-----------------YVRTFDLLNA--------------------------------------------------LAE
B2JEK1_BURP8/13-228-----------------LRRTTDILRN--------------------------------------------------ISA
Q8E9B8_SHEON/23-242-----------------LHRTIGLLED--------------------------------------------------IIA
Q3IC51_PSEHT/11-232-----------------FHKTANLLVD--------------------------------------------------IVN
R7ICN1_9BURK/24-238-----------------LPRCEKILTG--------------------------------------------------LAD
M4U150_9GAMM/24-238-----------------LTRTVKLLED--------------------------------------------------IIK
A8AR40_CITK8/23-238-----------------LERNYRILHA--------------------------------------------------LAM
Q1QTW3_CHRSD/12-232-----------------GERTLAMLEA--------------------------------------------------LAD
Q6CYK1_PECAS/23-238-----------------LERNLSILKA--------------------------------------------------LSE
Q088U8_SHEFN/23-254-----------------LTRTLGLLKD--------------------------------------------------ITQ
H2IXQ6_RAHAC/23-237-----------------LEKTGRILHS--------------------------------------------------LSE
Q6LKR1_PHOPR/24-249-----------------LTRTVKLMQD--------------------------------------------------ILV
C9R2B5_AGGAD/33-245-----------------INRNFTLWYS--------------------------------------------------LLT
E3HL09_ACHXA/22-238-----------------TTRNFGLLQA--------------------------------------------------LAA
Q4KJF9_PSEF5/22-236-----------------TPRTFEILSD--------------------------------------------------LAA
Q87V50_PSESM/22-236-----------------TPRTFEILRD--------------------------------------------------LAA
Q13V69_BURXL/13-242-----------------LRRTTEILRA--------------------------------------------------ISA
A8GA54_SERP5/11-225-----------------LERTHKILQH--------------------------------------------------LHQ
A0KNN6_AERHH/22-235-----------------LARSMTLLQA--------------------------------------------------LAN
A9ICW7_BORPD/22-238-----------------TTRSFRLLRD--------------------------------------------------LAA
D5CEN4_ENTCC/23-238-----------------LERNYRILQA--------------------------------------------------LAT
B2FNB7_STRMK/22-243-----------------VARSMDLLGA--------------------------------------------------LVG
F0LS02_VIBFN/28-238-----------------LHRSADLIKD--------------------------------------------------ILN
A3QIS7_SHELP/23-236-----------------LNRTVDLLQD--------------------------------------------------IVR
B8CHL8_SHEPW/21-234-----------------INRTINLLND--------------------------------------------------IVD
M4RB67_BIBTR/27-246-----------------INRSFALWES--------------------------------------------------LLK
G4SXC9_META2/10-226-----------------LAKSLSMMEM--------------------------------------------------LEA
F7YP97_VIBA7/32-242-----------------LHRSVEIVKS--------------------------------------------------ILI
G0AK33_COLFT/32-258-----------------CARSIELLAD--------------------------------------------------LAQ
D8MQL2_ERWBE/23-238-----------------LERNLRILTS--------------------------------------------------LAK
G8AJ88_AZOBR/25-240-----------------LARTVGIIDS--------------------------------------------------LRQ
B7VKK6_VIBSL/28-249-----------------LHRTVALIQS--------------------------------------------------ILE
B0URR9_HISS2/28-245-----------------INRSFALWHS--------------------------------------------------LLT
Q1LF35_RALME/48-282-----------------SRRAFSMLSE--------------------------------------------------LAA
A7ZFF8_CAMC1/20-217-----------------INRCFELETA--------------------------------------------------LAK

PF02797

O81305_ARATH/238-383----------------------------------------------------GSG-ALELN---DLFWAVHPGGPAI---
O23674_ARATH/245-393----------------------------------------------------GDE-SMEFN---DMFWAVHPGGPAI---
F2CYQ0_HORVD/240-390----------------------------------------------------GIH-..NWN---SIFWIAHPGGPAI---
F6HP18_VITVI/238-388----------------------------------------------------GIS-..DWN---SLFWIAHPGGPAI---
M1CL74_SOLTU/241-391----------------------------------------------------GIS-..DWN---SVFWILHPGGNAI---
Q7X795_ORYSJ/244-388----------------------------------------------------GIK-..EFN---DVFWAVHPGGPAI---

PF08541

Q8ED66_SHEON/282-372---------------------------------------------------.SLT-PQSFK-----RLWLHQANINM---
Q74CS1_GEOSL/237-326---------------------------------------------------.GLT-PADIS-----LFIPHQANRRI---
Q7CTU0_AGRT5/239-328---------------------------------------------------.ELT-AADIS-----RFVPHQANARM---
FABH_PROMM/246-335---------------------------------------------------.NTA-PESLD-----WLLLHQANQRI---
Q73Q42_TREDE/222-311---------------------------------------------------.NIN-MEDVD-----LVVCHQANKRI---
FABH_PSEAE/233-322---------------------------------------------------.GWQ-ASDLH-----HLVPHQANTRI---
FABH_CHRVO/230-319---------------------------------------------------.GVE-QASLD-----WLVPHQANLRI---
FABH_DESVH/241-330---------------------------------------------------.GFT-TEDVD-----LVIPHQANLRI---
Q5YPR0_NOCFA/241-333---------------------------------------------------GGVG-LDEIE-----VFIPHQANLRI---
FABH2_STRCO/230-319---------------------------------------------------.GWD-LADVD-----AFVGHQANLRI---
Q5WEX8_BACSK/220-309---------------------------------------------------.GLG-KEDVD-----FLVPHQANIRI---
FABH_NOSS1/239-328---------------------------------------------------.QLT-VDQID-----WLLLHQANQRI---
Q67RA0_SYMTH/248-336---------------------------------------------------.GYR-TQDID-----YLAILHMKRSA---
Q5NF70_FRATT/234-323---------------------------------------------------.GIK-ASDID-----WLVPHQANYRI---
Q7M7Z5_WOLSU/238-327---------------------------------------------------.HLT-SKEIH-----HFIPHQANYRI---
FABH2_VIBPA/235-324---------------------------------------------------.QLT-TEQID-----VVIPHQANIRI---
Q7NZ26_CHRVO/282-372---------------------------------------------------.DIA-PEGVR-----RFWLHQANLAM---
FABH_AQUAE/220-309---------------------------------------------------.GVK-PEEVS-----LVIPHQANVRI---
FABH1_STRAW/264-354---------------------------------------------------.GIT-SDDLD-----VFIPHQANERI---
FABH_TROWT/231-321---------------------------------------------------.QVQ-PGDLN-----AFIPHQANIRI---
Q63N14_BURPS/258-347---------------------------------------------------.GLR-TDDID-----AMVFHQPSEIL---
FABH_HELHP/239-328---------------------------------------------------.HIN-PQDVS-----FFIPHQANLRI---
FABH3_STRCO/240-329---------------------------------------------------.GWR-VADVD-----WLVSHQANHRI---
FABH_PROMP/245-334---------------------------------------------------.NFN-SEKIN-----WLLLHQANQRI---
Q65LQ9_BACLD/237-326---------------------------------------------------.EME-LKDID-----WFVPHSANLRM---
FABH_CLOAB/234-323---------------------------------------------------.GLN-IEDID-----YIVPHQANIRI---
FABH_AROAE/232-321---------------------------------------------------.GVT-VDSVD-----WLIPHQANIRI---
FABH_ARATH/314-403---------------------------------------------------.GLP-ASAID-----WLLLHQANQRI---
Q5FUN7_GLUOX/235-324---------------------------------------------------.GLT-GQDIQ-----WMVPHQANLRI---
Q9L1V9_STRCO/246-337---------------------------------------------------.GLE-PGDVT-----RVCHVFTGQES---
FABH2_STRAW/225-314---------------------------------------------------.GLT-PADLA-----GVVLHQANLRI---
Q87XT2_PSESM/282-372---------------------------------------------------.GIN-ISDVK-----RFWLHQANLSM---
Q884Y8_PSESM/221-307---------------------------------------------------.DLT-PDDID-----AFCIHQGSAAI---
FABH2_LACPL/239-328---------------------------------------------------.RLE-SSDIK-----AFVLHQANARI---
FABH2_BACSU/234-323---------------------------------------------------.GLS-SDDLD-----WFVPHSANLRM---
FABH_RUEPO/234-323---------------------------------------------------.GLS-SADVD-----WIVPHQANIRI---
FABH_HAEDU/227-316---------------------------------------------------.NLQ-KADLD-----WLVPHQANIRI---
Q7TTZ7_RHOBA/241-330---------------------------------------------------.GLS-DDEIG-----HYLFHQATWKM---
FABH_RHOBA/256-345---------------------------------------------------.NVS-SDQLS-----LVVLHQANQRI---
Q7NV97_CHRVO/234-323---------------------------------------------------.PGG-LNSID-----CVVPHQASHLG---
Q5ZV11_LEGPH/238-327---------------------------------------------------.SIT-LNDVD-----WVVPHQASLLA---
Q97KV2_CLOAB/245-334---------------------------------------------------.NLK-KSDIK-----KYFLSQFAVQS---
Q8XTB9_RALSO/282-372---------------------------------------------------.GHA-PADVR-----RFWLHQANLGM---
Q6A930_PROAC/241-331---------------------------------------------------.GIT-PADLD-----VFIPHQANDRI---
Q5SL76_THET8/230-319---------------------------------------------------.GLT-PEDIR-----LFVPHQANLRI---
Q7N8H1_PHOLL/221-311---------------------------------------------------.DIT-MDDIS-----YIIPHNVNILI---
FABH2_VIBVY/235-324---------------------------------------------------.GMS-KDDIN-----VVIPHQANIRI---
Q82PP5_STRAW/243-333---------------------------------------------------.QVG-VEDIS-----RVVMPLIHRGV---
FABH_PROMA/245-334---------------------------------------------------.GIV-PESLD-----WLLLHQANQRI---
FABH_BLOFL/229-318---------------------------------------------------.NLQ-QDELD-----WLVPHQANLRI---
Q8RHZ0_FUSNN/221-309---------------------------------------------------.NMK-ISDID-----MVIPHQAS.VA---
Q7X8V9_ORYSJ/337-426---------------------------------------------------.GLP-ASSID-----WLLLHQANQRI---
FABH_CLOTE/244-333---------------------------------------------------.NLE-LKDIN-----YIIPHQANLRI---
Q88ES4_PSEPK/221-308---------------------------------------------------.GLK-SSDID-----AFCIHQGSAAI---
Q88EC1_PSEPK/299-389---------------------------------------------------.GLQ-PGDVK-----RFWLHQANLSM---
FABH_THETN/240-329---------------------------------------------------.GLT-PEDID-----MLIPHQANTRI---
FABH_STRMU/234-325---------------------------------------------------.DMP-VEAID-----YFLLHQANIRI---
FABH1_BACAN/219-308---------------------------------------------------.GLT-KEDVD-----FLVPHQANIRI---
FABH_STRP1/233-324---------------------------------------------------.DIT-KDDID-----YCLLHQANRRI---
FABH_SYNY3/241-330---------------------------------------------------.QLT-TSDLD-----WVILHQANQRI---
FABH_LACLA/234-325---------------------------------------------------.NLS-AEEVD-----YYLLHQANSRI---
FABH5_STRCO/237-326---------------------------------------------------.GWS-PASVD-----RFVGHQANARI---
Q5YN70_NOCFA/251-341---------------------------------------------------.GIA-GRDVD-----AFVTNQPNRLF---
FABH2_BACHD/236-325---------------------------------------------------.AMK-RNEID-----WFVPHSANLRM---
Q5YNJ2_NOCFA/253-343---------------------------------------------------.GVS-KEDIE-----VFVPHQANARI---
Q885B9_PSESM/249-338---------------------------------------------------.EVG-VSDVD-----LFVFHQANHFM---
Q82HI7_STRAW/252-343---------------------------------------------------.GLR-PSDIT-----RVTHVLSGGPE---
Q6FAK4_ACIAD/280-370---------------------------------------------------.QVN-PQDIK-----RFWLHQANLNM---
Q6DAZ3_PECAS/249-337---------------------------------------------------.GFT-LEQMA-----AVVPHQASHLS---
FABH_SYMTH/239-328---------------------------------------------------.GLT-VGDID-----LLVPHQANVRI---
Q8CV20_OCEIH/48-137---------------------------------------------------.KLN-IKDVD-----AFCFSQFALTN---
Q9HYV7_PSEAE/259-349---------------------------------------------------.EIQ-VAEVK-----RFWLHQANLNM---
FABH_GEOKA/219-308---------------------------------------------------.GLT-KDDVD-----FLIPHQANIRI---
FABH2_VIBCH/235-324---------------------------------------------------.GLS-TEEID-----VVIPHQANIRI---
Q6AQA3_DESPS/255-342---------------------------------------------------.GWR-NEEVD-----AYCCHQVGVAH---
FABH1_LACPL/238-323---------------------------------------------------.QLT-PSDLQ-----YVICHQANLRI---
Q8EDA9_SHEON/231-320---------------------------------------------------.GVD-KDEVD-----LVIPHQANERI---
Q6LQM2_PHOPR/234-323---------------------------------------------------.ELD-SNDID-----IVIPHQANKRI---
Q63PP7_BURPS/254-343---------------------------------------------------.NTS-VDQYD-----AFLFHQANLFM---
FABH_COXBU/230-319---------------------------------------------------.GLK-QSDID-----WLIPHQANLRI---
FABH2_BACAN/235-324---------------------------------------------------.NMK-MDDID-----WFIPHSANLRM---
Q5NL87_ZYMMO/234-323---------------------------------------------------.GFS-ASQVD-----WVVPHQANARI---
FABH_THEEB/239-328---------------------------------------------------.GCT-VEEID-----WLVLHQANQRI---
Q5LUY4_RUEPO/282-372---------------------------------------------------.GVA-NTHLK-----RLWLHQANKTM---
Q98AW4_RHILO/238-327---------------------------------------------------.RMR-PQDID-----RFVPHQANARI---
Q6AET2_LEIXX/245-335---------------------------------------------------.GVA-PEHLA-----AFIPHQANMRI---
Q81JE9_BACAN/240-329---------------------------------------------------.GYS-LADID-----LIVPHQASGPA---
Q6MR21_BDEBA/243-332---------------------------------------------------.QKK-PSDIK-----HFFITQFNVQS---
FABH_STRA5/232-323---------------------------------------------------.YLE-KEDID-----YLFLHQANRRI---
FABH_BORPE/239-328---------------------------------------------------.GVE-VDDID-----WLIPHQANVRI---
FABH_NITEU/229-318---------------------------------------------------.QLQ-PSDID-----WLIPHQANIRI---
Q98K75_RHILO/223-313---------------------------------------------------.GLT-PQAIR-----RFWLHQANARM---
Q9K3G9_STRCO/229-319---------------------------------------------------.GLT-WDDIG-----AFVPHQCNGRL---
FABH_GLOVI/237-326---------------------------------------------------.GVA-PEQVK-----AYLLHQANQRI---
Q8EG66_SHEON/260-347---------------------------------------------------.NWL-VEQVD-----KVICHQVGASN---
Q63PP9_BURPS/255-344---------------------------------------------------.GEP-RENID-----CFVLHQANRFM---
Q7NZW4_CHRVO/228-317---------------------------------------------------.GRS-LAEVR-----YLLINHGDEDM---
Q8RC85_THETN/250-338---------------------------------------------------.GYT-PSDIG-----YLAILHMKRSA---
Q6MAF5_PARUW/240-329---------------------------------------------------.ELQ-ESDVS-----WLIPHQANKRI---
Q5QWT4_IDILO/232-321---------------------------------------------------.GMT-TDDID-----ALIPHQANKRL---
Q67MB7_SYMTH/254-342---------------------------------------------------.GFR-PEEIR-----FVGMLHTKRSL---
FABH1_DEIRA/233-322---------------------------------------------------.GLS-NADVD-----WLIPHQANIRI---
Q9I4X1_PSEAE/253-342---------------------------------------------------.GLG-SDDID-----YFVFHQPAPFL---
FABH1_VIBCH/227-316---------------------------------------------------.NMH-KSELD-----WLVPHQANYRI---
Q73S66_MYCPA/245-335---------------------------------------------------.GLP-AKDID-----LLVTNQPNRAF---
FABH_NEIG1/231-320---------------------------------------------------.GYT-AEQID-----WIVPHQANRRI---
Q63N13_BURPS/243-332---------------------------------------------------.RLA-LGDIG-----LVVPHQPNLRI---
FABH_PECAS/228-317---------------------------------------------------.QLD-KSELD-----WLVPHQANLRI---
FABH_CLOPE/235-324---------------------------------------------------.NIK-IEDIA-----AIIPHQANLRI---
Q820X4_COXBU/239-326---------------------------------------------------NAVN-LNEI.-----YFIGHQANLMM---
FABH_PORGI/240-327---------------------------------------------------.NLS-HDDIT-----WVVPHQANLRI---
Q82NC9_STRAW/244-334---------------------------------------------------.GVA-TADID-----VLITNQPNRTF---
FABH_RHIME/234-323---------------------------------------------------.GTT-ADDID-----WLVPHQANRRI---
FABH_RALSO/237-326---------------------------------------------------.EVE-SSQID-----WLIPHQANIRI---
Q5ZTD0_LEGPH/246-335---------------------------------------------------.NLT-ISDIQ-----WLVPHQGNKNL---
Q82KT2_STRAW/240-329---------------------------------------------------.DWR-IDDVD-----RFAAHQANARI---
Q8F686_LEPIN/233-322---------------------------------------------------.GLT-IDDVD-----WVVPHPGTDVV---
FABH_OCEIH/221-310---------------------------------------------------.GLS-RDDVD-----YLVPHQANIRI---
FABH_SHEON/230-319---------------------------------------------------.NID-KSEID-----WLVPHQANFRI---
FABH_DESPS/235-324---------------------------------------------------.GVS-PHEIK-----LLIPHQANIRI---
FABH_XANCP/236-325---------------------------------------------------.GLD-THDLD-----WLIPHQANLRI---
FABH_CHLTE/239-328---------------------------------------------------.NLT-AETID-----WLVPHQANQRI---
FABH_BURPS/240-329---------------------------------------------------.ELA-SEQVD-----WLIPHQANIRI---
Q8RC81_THETN/237-325---------------------------------------------------.GYK-VKDID-----HIFFTQINKSV---
Q5YNV7_NOCFA/248-338---------------------------------------------------.GLS-TDDLR-----AMIPHQANGRI---
FABH_METCA/232-321---------------------------------------------------.GLQ-KSDVD-----WLVPHQANIRI---
FABH2_DEIRA/239-328---------------------------------------------------.GKT-TADID-----WLVPHQANIRI---
PQSD_PSEAE/242-329---------------------------------------------------.ELT-LDDID-----HVICHQPNLRI---
B9KJ28_ANAMF/234-322---------------------------------------------------.ALD-VDSID-----WFIPHQANVRI---
D5AUL7_RHOCB/235-324---------------------------------------------------.GLT-PEDVS-----WIVPHQANLRI---
D6D672_9BACE/241-327---------------------------------------------------.GLT-KDNIN-----WIVPHQANVRI---
FABH_HELPY/239-327---------------------------------------------------.ALK-PEDVR-----LFIPHQANFRI---
FABH_CHLTR/238-325---------------------------------------------------.GLQ-EKDID-----WLVPHQANERI---
FABH_STRR6/234-323---------------------------------------------------.PIE-VTDLD-----YLLLHQANDRI---
FABH_MYCTU/242-332---------------------------------------------------.GVR-PDQID-----VFVPHQANSRI---
Q2YKB4_BRUA2/237-325---------------------------------------------------.AML-PQAID-----RFFPHQANIRI---
FABH_BRUA2/235-323---------------------------------------------------.GLT-AEDID-----WFVPHQANKRI---
FABH_SYNE7/244-331---------------------------------------------------.GID-RQEVD-----WLLLHQANQRI---
FABH_STAEQ/223-311---------------------------------------------------.GLS-SEDID-----LFVPHQANIRI---
Q5LAY0_BACFN/240-327---------------------------------------------------.QLT-KDEID-----WVVPHQANQRI---
FABH_STRT2/237-320---------------------------------------------------....-.GEPD-----YFLLHQANIRI---
Q5ZTD4_LEGPH/263-346---------------------------------------------------...E-KNEIT-----WVIPHQVNRKL---
FABH_BARHE/236-324---------------------------------------------------.GMD-SSQLD-----WFVPHQANKRI---
Q79ZF6_STRAW/239-330---------------------------------------------------.DVK-LGDID-----WYVLPNLGRTR---
Q79ZR7_STRAW/221-310---------------------------------------------------.GWK-TDDVD-----HFVPHQANLRI---
Q7KWI9_PLAF7/283-371---------------------------------------------------.NIN-IEDIN-----YFIFHQANIRI---
Q81RV7_BACAN/243-331---------------------------------------------------.GYT-PKDIK-----VLLPLHTKRSM---
Q8P810_XANCP/349-438---------------------------------------------------.GTE-TTALR-----CLIPHQASGGG---
FABH_FUSNN/237-326---------------------------------------------------.KLK-VNDLS-----MVFPHQANLRI---
FABH_LISMO/221-310---------------------------------------------------.GLE-KEDLD-----LLIPHQANIRI---
FABH_CAMJE/230-318---------------------------------------------------.NIL-AQEID-----LFIPHQANLRI---
FABHL_CAMJE/252-337---------------------------------------------------.KVD-EKDIA-----FHLFHQSNAYL---
FABH_RICPR/230-317---------------------------------------------------.QFS-VSDID-----YFIPHQANIRI---
V6KTJ6_STRRC/242-332---------------------------------------------------.GVD-ARDIK-----TVVIHSMPRQA---

PF02803

THIL_YEAST/274-397----------------------------------------------------GIEDINSVD-----YFEFNEAFSVV---
FADA_ECOLI/261-386----------------------------------------------------GLS.ASDIG-----VFEMNEAFAAQ---
YKA3_CAEEL/305-445----------------------------------------------------GLT.LKDVD-----VFEIHEAFAGQ---
THIL_HUMAN/306-426----------------------------------------------------GLK.KEDIA-----MWEVNEAFSLV---
THLA_CLOAB/269-391----------------------------------------------------GWT.VDELD-----LIESNEAFAAQ---
ATOB_ECOLI/270-392----------------------------------------------------GLQ.LADID-----LIEANEAFAAQ---
THL_BACSU/270-392----------------------------------------------------GLT.VQDID-----LFEVNEAFASV---
THIL_CUPNH/270-392----------------------------------------------------EWT.PQDLD-----LMEINEAFAAQ---
THIM_HUMAN/273-395----------------------------------------------------GLS.LKDMD-----LVEVNEAFAPQ---
THIKA_RAT/298-421----------------------------------------------------GLT.VNDID-----IFEINEAFASQ---
YQEF_ECOLI/269-391----------------------------------------------------GWQ.LAEVD-----LIEANEAFAAQ---
THIK_YEAST/296-416----------------------------------------------------GLQ.VQDID-----IFEINEAFAAQ---
FADA4_MYCLE/270-392----------------------------------------------------GIS.VEQLD-----VVEINEAFAAV---
THIK_YARLI/291-413----------------------------------------------------GLT.VNDVD-----VFEINEAFASQ---
ECHB_RAT/332-472----------------------------------------------------GLT.MNDID-----AFEFHEAFSGQ---
ATOB_HAEIN/270-392----------------------------------------------------GIN.LDDID-----LIEANEAFASQ---
A1B3M4_PARDP/268-390----------------------------------------------------GWS.VGDLN-----LVEANEAFAAQ---
C5M4S8_CANTT/289-406----------------------------------------------------GLT.VEDID-----VFEINEAFAAQ---
C5M6V3_CANTT/274-396----------------------------------------------------GLS.LDKVD-----FFELNEAFSVV---
I3YE91_THIV6/271-393----------------------------------------------------GWT.PADLD-----LIEANEAFAAQ---
FADA_PSESM/266-390----------------------------------------------------GLS.ISDID-----FFELNEAFAAQ---

PF02801

PKSJ_BACSU/4829-4945---------------------------------------------------KAAS-VNNDG...RTAGPATPNLEAQ..K
PKSL_BACSU/4322-4438---------------------------------------------------KAAA-INNDG...RTAGPSSPNLEAQ..K
Q18559_CAEEL/5488-5604---------------------------------------------------KDFA-INNDGH..SRASFMAPNPAGQ..L
Q18559_CAEEL/244-354---------------------------------------------------VGSA-FNSDG...KTPSLTAPNPISQ..Y
P95029_MYCTU/2816-2942---------------------------------------------------AFAQ-SFG.DG..VHTSIPAPGLGALGAG
PKSF_BACSU/257-367---------------------------------------------------SGWS-IKLDG.....NRNPDPSLEGE..I
P74017_SYNY3/244-356---------------------------------------------------LGWG-FSCDAL..HRSTPAFDNHSAQ...
O67612_AQUAE/256-371---------------------------------------------------VGYG-ATD.DA..YHITSPHECGEGA..Y
FABF_BACSU/254-369---------------------------------------------------VGYG-STG.DA..YHITAPAQDGEGG..A
FABF_SYNY3/258-373---------------------------------------------------VGYA-MTC.DA..YHITAPVPDGRGA..T
Q9ZCH8_RICPR/269-384---------------------------------------------------IGYG-STG.DA..YHMTAPHPKGRGA..Y
CEM1_YEAST/273-391---------------------------------------------------VGYG-LSS.DA..CHITSPPADGNGA..K
OXSM_SCHPO/262-380---------------------------------------------------VGYG-LAS.DS..YHITAPNPNGDAA..Y
FABB_HAEIN/253-361---------------------------------------------------VGYG-ATS.DG..YDMVAP..SGEGA..E
O84775_CHLTR/256-371---------------------------------------------------LGTY-TTC.DA..FHITAPRDDGEGI..T
KASC1_ARATH/315-429---------------------------------------------------LGGA-VNC.DA..HHMTDPRADGLGV..S
O54149_STRCO/253-365---------------------------------------------------LGHG-ASA.DA..HHVTAPDPEGAGA..L
Q9Z4Y3_STRCO/251-363---------------------------------------------------LGHA-DTS.DA..HHPTAPRPDGAGA..A
Q93458_CAEEL/101-214---------------------------------------------------VGYG-ISS.DC..YHISTPDPSAIGA..V
KASA_STRCO/303-418---------------------------------------------------SGYA-TRC.NA..YHMTGLKADGREM..A
KAS1_STRCO/261-376---------------------------------------------------SGYA-TFG.NA..YHMTGLTKEGLEM..A
KASB_STRCO/251-361---------------------------------------------------AGCA-STF.DP..APGSGRP...AGL..E
KAS2_STRCO/264-377---------------------------------------------------AGHA-ATFTGA..GRWAESR...EGL..A
FAS_HUMAN/243-360---------------------------------------------------LNAG-TNTDGF..KEQGVTFPSGDIQ..E
FAS_CHICK/243-360---------------------------------------------------VNAG-SNTDGF..KEQGVTFPSGEMQ..Q
P91871_CAEEL/279-396---------------------------------------------------VHAK-SNTDGH..KEHGITFPSGERQ..A
WA_EMENI/634-754---------------------------------------------------NGAY-TNHSAE..A.VSITRPHVGAQ..A
O54142_STRCO/811-926---------------------------------------------------RAVG-ASN.....DAKSLIAPDADGQ..A
P71718_MYCTU/262-379---------------------------------------------------RASC-LNSDG...LSDGLTAPSGDAQ..T
O65933_MYCTU/289-405---------------------------------------------------RGSA-VNQDG...ASNGLTAPNGPSQ..Q
O53901_MYCTU/271-385---------------------------------------------------RGTA-ANQDG...HTVNIATPSRSAQ..V
Q49933_MYCLE/296-416---------------------------------------------------RGSA-VNQDG...ASSGVTVPNGPAQ..Q
O86335_MYCTU/354-472---------------------------------------------------TGSA-VNQDG...KSNGIMAPNPSAQ..I
O54155_STRCO/1041-1159---------------------------------------------------TGSA-LGHGG...RANGLTAPRSTAQ..R
Q18559_CAEEL/2133-2242---------------------------------------------------QSVN-VNHGG...RSVSLTAPNGVAH..K
O06586_MYCTU/230-347---------------------------------------------------RGSA-VGNAGH..SATGLTVPSVAGQ..V
PKSR_BACSU/1766-1891---------------------------------------------------KGSG-VSHGG...RGMSLHAPNPAGM..K
PKSM_BACSU/3776-3894---------------------------------------------------KASG-VNYDG...KTNGITAPNPFSQ..A
PKSL_BACSU/3126-3244---------------------------------------------------IGSG-INQDG...KTNGITAPSAKSQ..M
PKSJ_BACSU/2018-2137---------------------------------------------------RGIG-VNNDGA..DKVGFYAPSVKGQ..A
PKSL_BACSU/2189-2307---------------------------------------------------KGTA-INHGG...KTNGYSVPNPNAQ..A
PKSM_BACSU/2562-2680---------------------------------------------------KASA-INSGG...KTNGYTVPNPHAQ..A
PKSR_BACSU/785-903---------------------------------------------------KSSF-ANHSG...GRQMYTAPDPKQQ..A
PKSM_BACSU/655-773---------------------------------------------------KGSA-INHVG...KVSGITVPSPVAQ..A
PKSJ_BACSU/3597-3724---------------------------------------------------RGTA-ENHGG...RANTLTSPNPKAQ..A
O54142_STRCO/307-424---------------------------------------------------LDCA-LRHEAR..PGIFRYSLSAAHR..R
A4F7N8_SACEN/2288-2403---------------------------------------------------AGSA-VNQDG...ASNGLSAPSGVAQ..Q
A4F7P0_SACEN/288-406---------------------------------------------------RGSA-LNQDG...ASNGLSAPSGPAQ..R
A4F7P1_SACEN/285-403---------------------------------------------------RGSA-VNQDG...ASNGLTAPSGPAQ..Q
A8XKG1_CAEBR/5528-5642---------------------------------------------------KDFA-ISNDGI..SRASFMAPNPAGQ..Q
B2J2F3_NOSP7/310-427---------------------------------------------------KGIG-TSSDG...RYKSIYAPRKEGQ..V
B5HT08_9ACTO/261-376---------------------------------------------------AGYA-TRS.NA..YHMTGLRPDGAEM..A
B6H6U0_PENCW/303-422---------------------------------------------------KGSA-VASDG...KTLGIMAPNAQAQ..L
B8CQB2_SHEPW/317-434---------------------------------------------------KGIG-SSSDG...KFKSIYAPRPEGQ..A
B8CQB4_SHEPW/303-420---------------------------------------------------SGVG-LSNDG...KGQFVLSPNPKGQ..V
B8NI04_ASPFN/629-749---------------------------------------------------LDAK-TNHSA...MSESMTRPHVGAQ..I
B8NYX0_ASPFN/264-381---------------------------------------------------KGTA-VAQDG...RTNGIMAPNQKAQ..E
C9R299_AGGAD/260-369---------------------------------------------------VGYG-ANSDG...A..HVTRPQKDTM..Q
F2RC16_STRVP/252-362---------------------------------------------------AGYG-STF.DP..RPGSGRE...PGL..R
G0FS56_AMYMS/293-411---------------------------------------------------RGSA-VNQDG...ASNGLTAPNGPAQ..Q
G3XDA2_PSEAE/255-370---------------------------------------------------VGFG-MSG.DA..FHMTAPPEDGAGA..A
H9JGF5_BOMMO/86-195---------------------------------------------------...K-TNYGTNVNADEFLPIREPKEI..Q
I6X8D2_MYCTU/374-491---------------------------------------------------AGSA-VNHDG...RSNGLIAPNQDAQ..A
I6Y231_MYCTU/264-376---------------------------------------------------RGTA-TNQDG...RTETLTMPSEDAQ..V
N4VDN9_COLOR/639-759---------------------------------------------------LGTA-TNHSA...DAISITHPHGPTQ..S
O25284_HELPY/258-369---------------------------------------------------AGYG-ESG.DA..NHITAPAPEGEGA..F
NODE_RHIME/247-359---------------------------------------------------AGVG-LSADA...FHITAPAVHGPES...
FABF_ECOLI/255-370---------------------------------------------------VGFG-MSSD.A..YHMTSPPENGAGA..A
FAB2_MYCTU/262-374---------------------------------------------------MGAS-ITSDG...FHMVAPDPNGERA..G
FAB1_MYCTU/262-374---------------------------------------------------LGAG-ITSD.A..FHMVAPAADGVRA..G
PPSE_MYCTU/270-389---------------------------------------------------RGSA-INNDGS..AKMGYAAPNPAAQ..A
PPSA_MYCTU/359-477---------------------------------------------------CGSA-VNQDG...RSNGLMAPNPAAQ..M
Q0CJ59_ASPTN/303-419---------------------------------------------------KGSA-VAQDG...KTNGIMAPNAKAQ..E
Q4KCY8_PSEF5/298-415---------------------------------------------------EGSA-VNNDG...ASSGITVPNIHAQ..E
Q4KCY9_PSEF5/270-383---------------------------------------------------RGSA-INQDG...ASAGQTVPNANAQ..A
Q5CUM8_CRYPI/1142-1260---------------------------------------------------KGSS-VNHNG...RSASLTAPNGISQ..Q
Q7APV9_MYCLE/290-405---------------------------------------------------RGSA-VNQDG...RSNGVTAPNTAAQ..C
Q7RVN4_NEUCR/272-391---------------------------------------------------TGYG-CSG.DA..HHMTAPRDDGSGA..F
Q82BC0_STRAW/261-376---------------------------------------------------VGQG-ISADS...HDIVQPEPEGRGI..S
Q87N23_VIBPA/255-371---------------------------------------------------VGFG-MSG.DA..YHMTSPSEDGSGG..A
Q87W69_PSESM/297-414---------------------------------------------------RGTA-INQDG...ASNGLTAPSGSAQ..E
Q87W70_PSESM/852-968---------------------------------------------------RGSA-VNQDG...ASNGLTAPNGTAQ..Q
Q8YLE3_NOSS1/299-407---------------------------------------------------DAIS-IGQ........SHTKVDGESV..N
Q9CB70_MYCLE/293-407---------------------------------------------------RGSA-TNQDG...RSNGMTAPNALAQ..R
Q9I3B2_PSEAE/252-360---------------------------------------------------VGYG-ATSDG...Y..DMVAPSGEGA..I
Q9Z373_YERPE/285-402---------------------------------------------------LSSA-VNNDGN..RKVGYTAPSVAGQ..Q
W5XQV6_9CORY/55-180---------------------------------------------------AHAA-SYGDG...AHTSIPAPGLGAL..G

PF08540

HMCS_SCHPO/176-446---------------------------------------------------SQGLGLDRFD-----YCIFHAPTCKQ---
Q5A3Z7_CANAL/178-450---------------------------------------------------KTVGVYDHFD-----FSAFHVPTCKL---
HMCS_ARATH/175-451---------------------------------------------------GKEFSINDAD-----YIVFHSPYNKL---
HMCS2_HUMAN/224-506---------------------------------------------------DRPFTLDDLQ-----YMIFHTPFCKM---
HMCS_CAEEL/183-448---------------------------------------------------TGIDGLNSFD-----GVFLHSPFTKM---
HMCS_YEAST/217-490---------------------------------------------------DALNVLKYFD-----YNVFHVPTCKL---
HMCS1_RAT/187-469---------------------------------------------------DKDFTLNDFG-----FMIFHSPYCKL---

PF00195

O23674_ARATH/11-236---------------------------------------------------RNDVNRVMLY-----FLGCYGG-VTG---
F2CYQ0_HORVD/6-230---------------------------------------------------SPTVKRLMMY-----QQGCFGG-ATV---
F6HP15_VITVI/3-228---------------------------------------------------ETSVRRVMLY-----HQGCYAG-GTV---
Q7X795_ORYSJ/13-234---------------------------------------------------HPNTVRTSLL-----FLGCSGG-AAA---
Q8W3P6_VITVI/8-228---------------------------------------------------RPSVKRFMMY-----QQGCFAG-GTV---

PF08545

Q8ED66_SHEON/150-221---------------------------------------------------------YDMQ-----V.ACSSA-TFA---
Q74CS1_GEOSL/107-185---------------------------------------------------------YDIS-----A.ACSGF-IYA---
Q63N14_BURPS/119-199---------------------------------------------------------ADVE-----M.ECASF-VLQ---
Q6MR21_BDEBA/112-191---------------------------------------------------------YDIN-----T.ACAGF-VVG---
Q7CTU0_AGRT5/109-187---------------------------------------------------------IDLA-----G.ACSGF-LYA---
FABH1_BACTN/110-188---------------------------------------------------------FDMQ-----A.VCSGF-LYA---
FABH_YERPE/106-183---------------------------------------------------------FDLA-----A.ACAGF-TYA---
FABH3_STRCO/108-188---------------------------------------------------------FDVS-----A.VCSGF-LYG---
FABH_GLOVI/106-183---------------------------------------------------------FDLT-----A.ACSGF-VFA---
FABH2_DEIRA/113-191---------------------------------------------------------FDVS-----V.ACSGF-LYA---
Q8EDA9_SHEON/104-182---------------------------------------------------------FDIN-----A.ACSGF-LYG---
Q8P810_XANCP/217-297---------------------------------------------------------FDVN-----A.TCLSF-LVA---
Q5FUN7_GLUOX/112-191---------------------------------------------------------FDIS-----A.ACSGF-VYA---
Q8XRP5_RALSO/110-188---------------------------------------------------------GVFS-----S.ECGNM-VAA---
FABH_THETN/110-188---------------------------------------------------------FDIS-----V.GCSGF-IYG---
FABH_CHLTE/107-186---------------------------------------------------------FDLS-----A.ACSGF-VYG---
Q7TTZ7_RHOBA/109-186---------------------------------------------------------IDFN-----L.GCSGF-VYG---
FABH2_BACAN/108-186---------------------------------------------------------FDLN-----A.TCAGF-TYG---
Q73Q42_TREDE/107-187---------------------------------------------------------FDLS-----A.ACSGF-LYA---
Q67RA0_SYMTH/112-193---------------------------------------------------------FDAQ-----L.RCGTW-VLG---
FABH_HELPY/109-188---------------------------------------------------------FDIS-----A.ACTGF-IYL---
PQSD_PSEAE/107-188---------------------------------------------------------LDIR-----A.QCSGL-LYG---
FABH_CLOTE/108-185---------------------------------------------------------FDIS-----A.ACSGF-TYG---
FABH_RUEPO/108-191---------------------------------------------------------FDVQ-----A.VCAGF-VYA---
FABH_PASMU/106-183---------------------------------------------------------FDVA-----A.ACSGF-VYA---
FABH_SYMTH/109-187---------------------------------------------------------FDLS-----A.ACPGW-IYG---
Q7NZ26_CHRVO/150-229---------------------------------------------------------FDMN-----V.ACSSA-TFG---
Q7NV97_CHRVO/105-183---------------------------------------------------------FDVN-----T.SCLSF-LSA---
FABH1_LACPL/108-188---------------------------------------------------------FDLS-----A.ACAGF-TFG---
Q820X4_COXBU/124-203---------------------------------------------------------IDIN-----T.ACSSF-ATQ---
FABH1_STRAW/116-193---------------------------------------------------------FDIS-----A.GCAGF-GYG---
FABH_PROMP/113-191---------------------------------------------------------FDLT-----A.ACSGF-LFA---
FABH_PSEAE/105-185---------------------------------------------------------FDLS-----A.ACTGF-VYG---
FABH_AQUAE/105-183---------------------------------------------------------FDIS-----A.ACSGF-IYA---
FABH_HELHP/110-189---------------------------------------------------------FDIS-----A.ACSGF-VYL---
FABH_CAUCR/106-189---------------------------------------------------------FDVQ-----A.VCSGF-VYA---
FABH_BLOFL/106-183---------------------------------------------------------FDLS-----A.ACSGF-VYA---
FABH_METCA/108-185---------------------------------------------------------FDVQ-----A.ACSGF-IFA---
FABH2_VIBPA/107-185---------------------------------------------------------FDLN-----A.ACTGF-VYG---
Q6A930_PROAC/116-193---------------------------------------------------------FDLN-----G.ACAGF-CYS---
Q6FAK4_ACIAD/154-233---------------------------------------------------------YDMN-----V.ACSAA-TFG---
FABH_BRADU/109-193---------------------------------------------------------FDLQ-----A.VCSGF-VFA---
FABH_SHEON/106-183---------------------------------------------------------FDIA-----A.ACSGF-VYA---
FABH_CLOAB/106-183---------------------------------------------------------FDLN-----A.ACTGF-IFA---
Q9K3G9_STRCO/109-186---------------------------------------------------------FDLN-----G.GCAGF-GYG---
Q73S66_MYCPA/111-193---------------------------------------------------------LDLN-----NGGCAAF-VLA---
Q81RV7_BACAN/105-186---------------------------------------------------------FEIM-----N.VSSCF-PIA---
Q5YNV7_NOCFA/117-194---------------------------------------------------------FDIS-----A.GCAGF-CHA---
FABH_NEIG1/108-185---------------------------------------------------------FDVQ-----A.VCAGF-MYA---
Q6MAF5_PARUW/110-188---------------------------------------------------------MDIQ-----A.ACTGF-LYG---
Q82PP5_STRAW/108-187---------------------------------------------------------FDLQ-----Q.RCNAG-LGS---
FABH2_LACPL/107-188---------------------------------------------------------FDIN-----V.ACAGF-VYG---
FABH2_STRCO/112-192---------------------------------------------------------FDLS-----A.VCSGF-VYG---
Q7U427_SYNPX/113-191---------------------------------------------------------FDLT-----A.ACSGF-LFA---
FABH_PHOLL/106-183---------------------------------------------------------FDIS-----A.ACSGF-VYA---
FABH4_STRCO/108-188---------------------------------------------------------LDLN-----V.VCAGF-THA---
FABH_TROWT/107-184---------------------------------------------------------LDIN-----A.ACAGF-SYA---
FABHL_CAMJE/116-191---------------------------------------------------------FDLG-----Q.ACAGY-LYG---
FABH_NOSS1/108-185---------------------------------------------------------FDLT-----A.ACSGF-VFG---
FABH_STRT2/106-183---------------------------------------------------------FDIT-----A.ACSGF-VFA---
Q9I4X1_PSEAE/123-201---------------------------------------------------------LDSQ-----M.ECASF-LLN---
Q7M7Z5_WOLSU/107-186---------------------------------------------------------FDIS-----A.ACSGF-IYL---
FABH_PORGI/110-188---------------------------------------------------------FDMQ-----A.ACPTF-IYA---
Q5QWT4_IDILO/106-184---------------------------------------------------------FDLN-----A.ACSSF-LYA---
Q5NL87_ZYMMO/111-190---------------------------------------------------------FDVQ-----A.VCSGF-LYA---
Q98K75_RHILO/87-167---------------------------------------------------------FDMG-----L.GCSSA-AAA---
FABH1_DEIRA/107-185---------------------------------------------------------YDLS-----T.ACSGF-VYA---
FABH_PROMA/113-191---------------------------------------------------------FDLT-----A.ACSGF-LFG---
Q5WEX8_BACSK/106-184---------------------------------------------------------MDIS-----A.ACAGF-IYG---
FABH_MYCPA/116-193---------------------------------------------------------FDIS-----A.GCAGF-GYA---
FABH_NITEU/106-183---------------------------------------------------------FDVQ-----A.VCSGF-IYA---
Q74GF6_GEOSL/107-185---------------------------------------------------------FDMN-----A.VCSGF-VFG---
FABH_HAEIN/106-183---------------------------------------------------------FDLA-----A.ACTGF-VYA---
FABH_AGRT5/107-190---------------------------------------------------------FDMQ-----A.VCSGF-VYA---
FABH5_STRCO/105-185---------------------------------------------------------YDIA-----A.VCSGF-IYG---
Q885B9_PSESM/110-188---------------------------------------------------------FDFN-----Q.GCSGF-IYG---
Q63PP7_BURPS/122-199---------------------------------------------------------LDVN-----L.GCSGY-PQA---
FABH_STRMU/106-183---------------------------------------------------------FDLT-----A.ACSGF-IFA---
FABH_LACLA/106-184---------------------------------------------------------YDLT-----A.ACSGF-VFA---
Q97KV2_CLOAB/114-194---------------------------------------------------------YDLN-----A.NCAGM-LVA---
Q8F686_LEPIN/117-195---------------------------------------------------------FDVS-----T.ACTGF-VHG---
FABH_STAEQ/106-184---------------------------------------------------------MDQL-----A.ACSGF-MYS---
FABH_CHRVO/107-184---------------------------------------------------------FDVQ-----A.VCAGF-VYA---
FABH1_BACCR/106-184---------------------------------------------------------MDLS-----A.ACAGF-MYG---
O30202_ARCFU/103-177---------------------------------------------------------MDIT-----D.TMRAA-TDA---
FABH_AROAE/109-186---------------------------------------------------------FDVQ-----A.VCSGF-VYG---
FABH_SYNY3/110-187---------------------------------------------------------FDIT-----A.ACSGF-VVG---
Q8KE19_CHLTE/7-93---------------------------------------------------------FDVT-----N.ACNSF-LQA---
FABH2_BACSU/107-185---------------------------------------------------------LDIN-----A.TCAGL-TYG---
FABH_RALSO/114-191---------------------------------------------------------FDLQ-----A.VCSGF-VYG---
FABH_CLOPE/106-184---------------------------------------------------------FDIN-----A.ACTGF-IYA---
Q6LQM2_PHOPR/106-184---------------------------------------------------------FDMN-----A.ACTGF-LYG---
FABH_CAMJE/108-185---------------------------------------------------------FDIS-----A.ACSGF-IYL---
Q5YPR0_NOCFA/115-192---------------------------------------------------------FDIS-----A.GCSGL-AHG---
FABH_COXBU/109-186---------------------------------------------------------FDIN-----A.ACAGF-VYA---
Q63N13_BURPS/108-189---------------------------------------------------------FDIR-----A.QCSGG-LYG---
Q82KT2_STRAW/108-188---------------------------------------------------------FDVA-----A.VCSGF-LFG---
Q65LQ9_BACLD/110-188---------------------------------------------------------VDVN-----A.TCAGL-AYG---
Q982F9_RHILO/108-186---------------------------------------------------------VDLT-----A.ACAGF-IYA---
Q81JE9_BACAN/109-187---------------------------------------------------------FDIN-----S.TCLSF-ITA---
Q5NF70_FRATT/108-185---------------------------------------------------------FDIS-----A.ACSGF-VYA---
FABH_PROMM/113-192---------------------------------------------------------FDLT-----A.ACSGF-LFA---
Q6AET2_LEIXX/120-197---------------------------------------------------------YDMN-----A.ACAGY-AYG---
Q7NZW4_CHRVO/106-186---------------------------------------------------------FEVT-----N.FCNAA-WTA---
FABH_DESPS/106-184---------------------------------------------------------FDVN-----A.ACSGF-LYA---
FABH_XANCP/110-187---------------------------------------------------------FDVN-----A.ACSGF-VYA---
Q8RC81_THETN/108-187---------------------------------------------------------FDIN-----A.SCAGF-AGS---
Q5YNJ2_NOCFA/116-193---------------------------------------------------------FDLT-----S.GCGGF-GYG---
Q67MB7_SYMTH/116-197---------------------------------------------------------FEVA-----A.VSAGC-PIA---
Q884Y8_PSESM/108-185---------------------------------------------------------FDIS-----L.GCSGY-VYG---
FABH2_BACHD/109-187---------------------------------------------------------IDLN-----A.ACAGF-TYG---
Q7KWI9_PLAF7/153-231---------------------------------------------------------MDLT-----A.ACTGF-IFA---
Q65LD5_BACLD/106-184---------------------------------------------------------MDIS-----A.ACAGF-MYG---
FABH_ENTFA/107-184---------------------------------------------------------FDIS-----A.ACSGF-VYA---
Q8RC85_THETN/112-193---------------------------------------------------------FDMA-----L.RCGTA-VAA---
FABH_OCEIH/106-184---------------------------------------------------------MDVS-----A.ACAGF-MYG---
FABH_THEEB/108-185---------------------------------------------------------FDLT-----A.ACSGF-LFA---
A8GFT0_SERP5/117-193---------------------------------------------------------FDIN-----S.SCVSF-ISA---
B9KJ28_ANAMF/108-190---------------------------------------------------------FDIN-----A.ACSGF-LYA---
C4YXG9_9RICK/106-183---------------------------------------------------------FDLQ-----A.VCAGF-VYG---
D5AUL7_RHOCB/108-191---------------------------------------------------------FDVQ-----A.VCAGF-VFA---
D7TN17_VITVI/170-249---------------------------------------------------------YDIT-----A.ACSGF-VLG---
E3PXS0_CLOSD/254-332---------------------------------------------------------.DTR-----G.FCAGP-THA---
FABH_CHLTR/106-185---------------------------------------------------------FDCL-----A.ACTGF-LYG---
FABH_STRR6/106-183---------------------------------------------------------FDLT-----A.ACSGF-VFA---
Q2YKB4_BRUA2/110-185---------------------------------------------------------.DLA-----G.ACTGF-LYA---
FABH_SYNE7/111-188---------------------------------------------------------FDLT-----A.ACSGF-LFA---
Q5SL76_THET8/104-182---------------------------------------------------------YDLL-----A.GCPGW-IYA---
Q5ZTD0_LEGPH/115-194---------------------------------------------------------FDIG-----A.ACAGF-VVG---
Q5ZTD4_LEGPH/131-209---------------------------------------------------------YDLK-----T.GCSTS-LST---
Q5ZV11_LEGPH/109-186---------------------------------------------------------FDIN-----S.TCLSF-LTA---
Q63PP9_BURPS/115-194---------------------------------------------------------LDVN-----L.GCSGY-VYG---
Q79ZR7_STRAW/89-169---------------------------------------------------------FDIS-----A.VCTGF-VYG---
FABH1_VIBVY/106-183---------------------------------------------------------FDLA-----A.ACSGF-VYA---
FABH_FUSNN/107-185---------------------------------------------------------FDLN-----A.ACTGF-IYG---
Q8RHZ0_FUSNN/90-165---------------------------------------------------------LDIN-----T.TCTSF-ITA---
FABH_LISMO/106-184---------------------------------------------------------MDVE-----A.ACAGF-TFG---
FABH_STRP1/106-183---------------------------------------------------------FDMT-----A.ACSGF-VFA---

PF08392

Q9FW59_ORYSJ/25-322---------------------------------------------------REDVKVYNLT-----GMGCSAT-LIA---
KCS3_ARATH/23-313---------------------------------------------------REDIKVFNLT-----AMGCSAS-VIS---
KCS11_ARATH/92-381---------------------------------------------------RGNILSYNLG-----GMGCSAG-LIS---
KCS16_ARATH/71-366---------------------------------------------------RDNIKSLNLG-----GMGCSAG-VIA---
KCS2_ARATH/74-363---------------------------------------------------RGNIKSFNLG-----GMGCSAG-VIA---
Q75M74_ORYSJ/23-315---------------------------------------------------REDVAAYSLA-----GMGCSAG-LIS---
KCS14_ARATH/52-334---------------------------------------------------KTDVKTYNLS-----G......-.IS---
Q650T5_ORYSJ/56-349---------------------------------------------------PSDVRTCNLS-----GMGCAAG-AIG---
Q6K3E6_ORYSJ/23-314---------------------------------------------------RDDVMAYNLS-----GMGCSAG-LVS---
Q688V9_ORYSJ/93-381---------------------------------------------------RGNIKSFNLG-----GMGCSAG-VIA---
Q5Z6R6_ORYSJ/79-372---------------------------------------------------RGDVRAVHLS-----GMGCSAG-LIA---
Q8H7L2_ORYSJ/167-457---------------------------------------------------RGNILSYNLG-----GMGCSAG-VIA---
KCS7_ARATH/38-328---------------------------------------------------RSDIKSFSLS-----GMGCSAG-ILS---
Q8LQT7_ORYSJ/61-349---------------------------------------------------RAEVQNVNLS-----GMGCSAG-LVS---
Q6Z6C7_ORYSJ/95-384---------------------------------------------------RGNIVSYNLG-----GMGCSAG-LLA---
KCS20_ARATH/42-333---------------------------------------------------RSNIKSFNLS-----GMGCAAG-ILS---
Q9XEP1_SORBI/93-380---------------------------------------------------RRDVSSYNLA-----GMGCSAS-LIS---
Q7XT16_ORYSJ/77-368---------------------------------------------------RADVRSVNLS-----GMGCSGA-LIA---
Q6K558_ORYSJ/43-332---------------------------------------------------PPGTRTYSLA-----GMGCSAG-TVG---
KCS21_ARATH/24-318---------------------------------------------------REDIKSYNLS-----GLGCSAS-VIS---
Q6F365_ORYSJ/100-389---------------------------------------------------RGNVVSYNLG-----GMGCSAG-LIS---
Q6TMJ4_DICDI/114-404---------------------------------------------------RSDVLSYNLS-----GMGCSAG-AIS---
Q75M84_ORYSJ/26-319---------------------------------------------------REDVAAYNLS-----GMGCSAT-LVA---
Q5Z6S3_ORYSJ/79-368---------------------------------------------------RSDIRSMHLS-----GMGCSAS-LIS---
I1QUI1_ORYGL/97-386---------------------------------------------------RPGVVSHNLS-----GMGCSAG-IIA---
M4EUY8_BRARP/106-388---------------------------------------------------REDIKSYNLG-----GMGCSAG-LIS---
M4F0P0_BRARP/70-368---------------------------------------------------RSNVRSFNLG-----GMGCSAG-VIA---

PF01154

HMCS1_RAT/13-186---------------------------------------------------QAELEKYD---------GVDAG-KYT---
HMCS2_RAT/50-223---------------------------------------------------QTDLEKFN---------NVEAG-KYT---
HMCS_YEAST/45-216---------------------------------------------------QSELEKFD---------GVSQG-KYT---

PF00108

M0LND5_9EURY/4-224.....FAG----LAAD----------------R-YLETTGADEDALAA---VAVKNHRNGA-----ANPYAQ.FQRE---
D2RWU3_HALTV/19-236.....FAG----LTAR----------------R-YLERYDAPRTALAK---VAVKNHAHGV-----ANPKAH.FRRE---
E4NU18_HALBP/4-223.....FAG----LTAR----------------R-YLHEYDAPRESLAR---VAVKNHANGV-----DNPHAQ.FRKE---
Q3IPN4_NATPD/4-222.....FAG----LAAR----------------L-YLDEYDAPRESLAE---VAVKNHHNGV-----KNPDAQ.FKKK---
L0IDX7_HALRX/4-222.....FAG----LTAR----------------R-YLDRYEAPRESLAS---VAAKNHRNGV-----DNPKAQ.FQKA---
M0LB34_9EURY/4-223.....FAG----LTAR----------------H-YLEKFDAPRESLAK---VAVKNHRNGV-----DNPNAQ.FRKE---
B9LX39_HALLT/5-223.....FAG----MTAR----------------L-YLDKYDAPRESLAK---VAIKNHKNGV-----DNPKAQ.FQKE---
M0JWJ2_9EURY/3-221.....FAG----MTAR----------------H-YLERFDAPRESLAR---VAVKNHRNGV-----DNPKAQ.FQKE---
ECHB_RAT/55-325FSTNETMG----HSAD----------------R-LAAAFAVSRMEQDK---YALRSHSLAK-----KAQDEGHLSD.---
YKA3_CAEEL/26-298FSTGETMG----HSGD----------------R-LAAAFNVSRREQDE---FAIRSHTLAS-----EAAKNGKFTD.---
FADA_PSEFR/8-258.......G----LTAE----------------M-LGKMHGISREQQDA---FAVRSHQLAH-----KATVEGKFKDE---
A0A017HYH0_ECOLX/4-254.......G----LTAE----------------M-LARMHGISREMQDA---FAARSHARAW-----AATQSAAFKNE---
THIKA_RAT/38-291.......G----ITSE----------------N-VAERFGISRQKQDA---FALASQQKAA-----SAQSKGCFRAE---
THIK_YARLI/30-284.......G----ITSE----------------N-VAAKYNVSRKAQDA---FAAKSYEKAA-----AAQAAGKFDQE---
A0A023ZC97_YEASX/36-289.......G----ITNE----------------N-VAANFKISRKDQDE---FAANSYQKAY-----KAKNEGLFEDE---
THIKA_CANTR/27-280.......G----ITNE----------------N-VANQFNISRERQDE---FAAKSYNKAA-----KAVAAGAFKSE---
THIM_HUMAN/7-266QHVQLPMA----MTAE----------------N-LAVKHKISREECDK---YALQSQQRWK-----AANDAGYFNDE---
H2Q4P9_PANTR/42-299VYNKIHMG----SCAE----------------N-TAKKLNIARNEQDA---YAINSYTRSK-----AAWEAGKFGNE---
THIB_CANTR/6-267VYEEKLMG----VAAE----------------K-CAKDHGFSREDQDN---FAINSYKKAG-----KALSEGKFKSE---
A0A023ZJC5_YEASX/5-267AYDGLAMG----VHAE----------------K-CARDWDITREQQDN---FAIESYQKSQ-----KSQKEGKFDNE---
G4EU09_BACIU/4-263AFDEVHMA----VHGN----------------T-AAKEYAISRREQDE---WALRSHARAA-----KAADEGKFQDE---
B8ZR51_MYCLB/4-263VFTNQPMG----ALTE----------------Q-RNDVEKFTRQEQDE---FAARSHQKAA-----AAWKDGVFADE---
A0A017JC55_ECOLX/4-262AFNDYHIG----VTAE----------------N-LAREYGISRQLQDA---YALSSQQKAR-----AAIDAGRFKDE---
THIL_PARDE/4-261AFNDYHMG----TTAE----------------N-VAGKWEISRAEQDQ---FAVASQNKAE-----AAQKAGKFADE---
THIL_ZOORA/6-262AFYGYHMG----TTAE----------------N-VAKQWQLSRDEQDA---FAVASQNKAE-----AAQKDGRFKDE---
THIL_THIVI/5-264AFNQCHMG----VTAE----------------N-IAKKYAFTREAQDA---FAAASQQKAE-----AAIQSGRFADE---
D3UAK6_CUPNE/4-263VYNQYHMG----ITAE----------------N-VAKEYGITREAQDE---FAVGSQNKAE-----AAQKAGKFDEE---
F0K5D8_CLOAE/4-262AFNDYHMG----ITAE----------------N-IAERWNISREEQDE---FALASQKKAE-----EAIKSGQFKDE---
A4NPG8_HAEIF/4-263ASNHYHMG----ITAE----------------N-IAEQYGISRQAQDE---LALRSQTLAS-----QAVQLGVFDKE---
A0A017JHG0_ECOLX/4-263ATHGYHMG----ITAE----------------N-VAKEYGITREMQDE---LALHSQRKAA-----AAIESGAFTAE---

PF00109

Q18559_CAEEL/1-236.YM..ATG----N...----------------.-..SASVMCGRITYF...LNSRGAAVGI-----ETACSSS.LVA---
Q18559_CAEEL/1888-2129ILA..MLG----S...----------------.-..MAAVIAGRVNYI...FGCYGPSVTI-----DTACSSS.LVA---
Q18559_CAEEL/4241-4474EWS...GG----T...----------------.-..SNSALAGRIAHW...LKLKGPVVTL-----DTACSSS.FYA---
Q18559_CAEEL/824-1057ERL..WMG----T...----------------.-..VHSMVAGRLAVL...MGIRGRAMIV-----DTTCSSV.ATA---
FAS_HUMAN/1-239GYS..MVG----C...----------------.-..QRAMMANRLSFF...FDFRGPSIAL-----DTACSSS.LMA---
PKSM_BACSU/2319-2554.....PTG----Y...----------------.-..GYWSIANRISYL...LNFQGPSLAV-----DTACSSS.LTA---
PKSL_BACSU/433-687ENV.FPLS----L...----------------.-..NYAQIANRVSYF...CNFHGPSMAV-----DTVCSSS.LTA---
PKSR_BACSU/1528-1758........----....----------------.-..VPSLIPNRISYA...LDVKGPSEYY-----EAACSSA.LVA---
P91871_CAEEL/37-275GYT..LTG----C...----------------.-..VRSMFSNRISYT...FDLQGPSFSV-----DTACSSS.LLA---
PKSM_BACSU/393-647HNP.FPLS----L...----------------.-..NYAQIANRVSYY...CNFHGPSMAV-----DTVCSSS.LTA---
PKSJ_BACSU/4588-4821.NP..IVT----V...----------------.-..GQNYLAANLSQF...FDVRGPSVVV-----DTACSSA.LVG---
PKSJ_BACSU/3339-3589GHA..ATG----H...----------------.-.MIPSVGPNRMSYF...LNIHGPSEPV-----ETACSSS.LVA---
PKSL_BACSU/4082-4314.NP..IVA----G...----------------.-..GQNYLAANISQF...FDLKGPSIVL-----DTACSSA.LVG---
PKSR_BACSU/527-777AVL..SSN----G...----------------.-..GDWHIANRVSHF...FNLTGPSIAV-----SSACSSS.LNA---
PKSF_BACSU/6-249ISP..AYG----L...----------------.-SFMDSDLCGICTDQ...FGITGLAYTV-----GGASASGQLAV---
PKSJ_BACSU/1760-2010GYV.SWVL----A...----------------.-..QSGTIPTMISHK...LGLRGPSYFV-----HANCSSS.LIG---
PKSL_BACSU/1926-2181GRS.LALT----G...----------------.-..NPSSIANRVSYY...FDFHGPSIAL-----DTMCSSS.LTA---
PKSL_BACSU/2873-3118.....ATG----N...----------------.-..SFAIAAARIPYF...LNLKGPAIPI-----DTACSSS.LVG---
PKSM_BACSU/3529-3768.....ING----T...----------------.-..QNATLSARIAYA...LDLKGPNMAL-----TAACSSG.LVA---
OXSM_SCHPO/1-253VSP.RVIS----K...----------------.-.ILINMPAGYISQR...YGFTALNHTT-----TTACAAGCHAI---
P95029_MYCTU/2548-2808LGRNKPND----IF..----------------Q-EVLPNIIAAHVVQS..YVGSYGAMIHP-----VAACATA.AVS---
O67612_AQUAE/2-247VSP.FFIP----Y...----------------.-.GISNMASGLVAIK...WGFKGPNYCV-----TSACATGNHAI---
O54142_STRCO/518-803DRFGEAGP----DDLP----------------T-TWDGCVASGIAALLGNEHGLDAVPVAV-----EAACASS.LAA---
Q9ZCH8_RICPR/7-260VSP.FFIP----A...----------------.-.SLINLLSGLVSIK...YGFSGPNQAA-----VTACSTGAHAI---
WA_EMENI/376-626TYF..IPG----G...----------------.-..NRAFTPGRINYY...FKFSGPSVSV-----DTACSSS.LAA---
P71718_MYCTU/4-254GHL..ITG----T...----------------.-..SLGVISGRIAYT...LDLAGPALTV-----DTSCSSA.LAA---
FABF_SYNY3/6-249CSP.FMIP----M...----------------.-.MIANMASGLTAIN...LGAKGPNNCT-----VTACAAGSNAI---
O65933_MYCTU/33-281GYG..LTG----S...----------------.-..TLSVASGRVAYV...LGLEGPAVSV-----DTACSSS.LVA---
Q49933_MYCLE/34-288AYI..PTG----N...----------------.-..SANFAAGRLAYI...LGVRGPAVVI-----DTACSSS.LVA---
O54142_STRCO/38-299ASPHDRVG----....----------------.-.EMASTIPARIASA...FKLRGRTLAV-----ESADATS.YLA---
O54155_STRCO/797-1033.YS..ATG----N...----------------.-..AQSVAAGRLSYF...FDLTGPSLAL-----DTACSSS.LAA---
KAS1_STRCO/3-252SEP.HLER----A...----------------.-.FTPATLSSAVAEE...FGVRGPVQTV-----STGCTSGLDAV---
O86335_MYCTU/106-346.WD..NTG----G...----------------.-..SSSIIANRISYF...LDIQGPSIVI-----DTACSSS.LVA---
KASC1_ARATH/60-306ISP.FFIP----Y...----------------.-.AITNMGSALLAID...LGLMGPNYSI-----STACATSNYCF---
CEM1_YEAST/2-265INP.YFVP----K...----------------.-.ILTNMAAGNVSIK...FNLRGLSHSV-----STACATGNNSI---
O53901_MYCTU/14-263PYG..NTG----T...----------------.-..NACFASGRVAYA...MGLQGPAITV-----DTACSSG.LTA---
KASA_STRCO/45-294LSR.HMFD----Y...----------------.-.LVPSVMPAEVAWA...VGAEGPVTMV-----STGCTSGLDSV---
A4F7N8_SACEN/2032-2280GYL..LTG----N...----------------.-..TASVASGRIAYV...LGLEGPALTV-----DTACSSS.LVA---
A4F7P0_SACEN/31-280GYS..VTG----V...----------------.-..APAVASGRISYT...MGLEGPSISV-----DTACSSS.LVA---
A4F7P1_SACEN/1486-1734GYL..LTG----N...----------------.-..SSAVVSGRVAYV...LGLEGPAVTV-----DTACSSS.LVA---
B2J2F3_NOSP7/22-302AYVKWDEN----AF..----------------P-GMLANVVAGRIANR...LNFGGMNCVV-----DAACASS.FGA---
B6H6U0_PENCW/46-295AHM..GVG----T...----------------.-..AYCGIPSRISYL...LDLMGPSVAL-----DAACASS.LVA---
B6HS84_PENCW/33-281AWM..GIG----T...----------------.-..AYCGVPNRISYH...LNLMGPSTAV-----DAACASS.LVA---
B8CQB2_SHEPW/32-309QYV.HWEE----NSF.----------------P-GSLGNVIAGRIANR...FDFGGMNCVV-----DAACAGS.LAA---
B8NYX0_ASPFN/9-256PWM..GIG----T...----------------.-..AYCGVANRISYH...LNLMGPSTAV-----DAACASS.LVA---
C9R299_AGGAD/1-252GFNANTYV----R...----------------.-.MMPHTTTANIGIF...FGLTGRIIPT-----SSACSSGSQGI---
F2RC16_STRVP/4-243VSA.YQSF----A...----------------.-.WFYAVNSGQISIR...NGMKGPSGVV-----VSDQAGG.LDA---
F6HGM7_VITVI/144-387MNP.FCVP----F...----------------.-.ATTNMGSAMLAMD...LGWMGPNYSI-----STACATSNFCI---
G0FS55_AMYMS/632-879GFV..TTG----V...----------------.-..ASSVASGRVSYV...LGLEGPAVTV-----DTACSSS.LVA---
G0FS56_AMYMS/1717-1966GFV..TTA----....----------------.-.TAGSVASGRVSYT...FGFEGPAVTV-----DTACSSS.LVA---
G0FS56_AMYMS/35-284LER..ALG----T...----------------.-..AGGVASGRVAYT...LGLEGPAVTV-----DTMCSSS.LVA---
G0FS57_AMYMS/36-283QSF.AGTG----L...----------------.-..ASSVASGRVSYV...FGFEGPAVTI-----DTACSSS.LVA---
G0FS59_AMYMS/1702-1949GYA..STA----G...----------------.-..ASSVVSGRVSYV...FGFEGPAVTI-----DTACSSS.LVA---
G3XDA2_PSEAE/4-245ISP.FFVP----G...----------------.-.SIINMVSGFLSIH...LGLQGPNYAL-----TTACTTGTHSI---
G6CI33_DANPL/25-260GFG..VTG----C...----------------.-..SRAMLANRISYW...LGVTGPSYTV-----DSACSSS.LYA---
I6X8D2_MYCTU/118-366PYA..ITG----T...----------------.-..SSSIIANRVSYF...YDFHGPSVTI-----DTACSSS.LVA---
I6Y231_MYCTU/6-255ASP.YVVT----G...----------------.-.LNNSVASGRIAHT...LGLHGPAMTF-----DTACSSG.LMA---
K4RAF8_9ACTO/6-250VSP.HTVP----M...----------------.-.LMPNGPSANVGLA...VGARAGVHTP-----VSACASG.AEA---
N4VDN9_COLOR/383-631TYY..ITG----G...----------------.-..VRAFGPGRINYH...FGFSGPSLNV-----DTACSSS.AAA---
O25284_HELPY/1-247VNP.FFIT----S...----------------.-.ALVNMIGGFTSIE...FGIKGPNLSS-----VTACAAGTHAI---
NODE_RHIME/2-236IFT..GVK----A...----------------.-..MPSAAACQVSMS...LGLRGPVFGV-----TSACSSA.NHA---
FABF_ECOLI/4-245ISP.FFVP----S...----------------.-.TIVNMVAGHLTIM...YGLRGPSISI-----ATACTSGVHNI---
PKS15_MYCTU/47-294GYG..LTG----T...----------------.-..SISVASGRVSYV...LGLQGPAVSV-----DTACSSS.LVA---
FAB2_MYCTU/13-253VSP.LTVQ----K...----------------.-.YMPNGAAAAVGLE...RHAKAGVMTP-----VSACASG.AEA---
FAB1_MYCTU/13-253VSP.LAVQ----M...----------------.-.IMPNGAAAVIGLQ...LGARAGVMTP-----VSACSSGSEAI---
PPSE_MYCTU/6-262QFS.LFLQ----N...----------------.-..DKDFLATRISHA...FNLRGPSIAV-----QTACSSS.LVA---
PPSA_MYCTU/101-351GWS..NSG----G...----------------.-..AMSIIANRLSYF...LDLRGPSVAV-----DTACSSS.LVA---
PHAS_MYCTU/25-274PYG..YLG----N...----------------.-..SFSMASGRVAYA...MRLHGPAITV-----DTACSSG.LTA---
Q0CJ59_ASPTN/45-294AWM..GIG----T...----------------.-..AYCGVPNRISYH...LNLMGPSTAV-----DAACASS.LVA---
Q2UG06_ASPOR/373-621TYF..ITG----G...----------------.-..NRGFIPGRINFC...FEFAGPSYTN-----DTACSSS.LAA---
Q4KCY8_PSEF5/40-290AYQ..FYG----E...----------------.-...TSFVAGRIAYT...LGSRGPAVVL-----DTSCSSS.LVA---
Q4KCY9_PSEF5/1034-1273AHY..GTG----S...----------------.-..SFSAICGRLSHF...LGVRGPSLTV-----DTACSSS.LTA---
Q5CUM8_CRYPI/886-1132TYA..ATS----H...----------------.-..AASIIANRVSYT...LGLTGSSVTV-----DSACSAS.IVA---
Q7APV9_MYCLE/33-282AYS..GTG----N...----------------.-..AHSITVGRISYL...LGLRGPSVAV-----DTACSSS.LVA---
Q7RVN4_NEUCR/1-262VSP.LFVP----K...----------------.-.ILINLGAGHIAMR...YGFRGPNHSA-----TTACTTGAHSI---
Q87N23_VIBPA/4-245VSP.FFVP----S...----------------.-.TIVNMVAGNLSIM...RGLRGPNIAI-----STACTTGLHNI---
Q87W69_PSESM/39-289GYR..LQG----G...----------------.-..LSSIISGRIAFV...LGLRGPAVTV-----DTACSAS.LTA---
Q87W70_PSESM/593-844GYG..YMG----T...----------------.-..ATCVAAGRVSYC...LGLQGPALAI-----DTACSSS.LVA---
Q8YLE3_NOSS1/10-289DSVHHQVE----IGEY----------------L-SYITNIMASRISSL...WNFTGPSFTL-----TAVESSA.FKA---
Q9CB70_MYCLE/36-285AYL..STG----T...----------------.-..PHCAAVGRISYL...LGLRGPAMAV-----DTACSSS.LVA---
Q9I3B2_PSEAE/1-241IGP.YRVT----R...----------------.-.TMGSTVSACLATP...FQIKGVNYSI-----SSACATSAHCI---
Q9Z373_YERPE/27-276GLQ.SLMG----N...----------------.-..DKDYIATRAAYK...LNLHGPALSV-----QTACSSS.LVA---

PF07451

A6TVT6_ALKMQ/4-333GAGAAVVA...R.DGD................G.PEILWATIGRVVD----MGISDPFNMG-----AAMAPAA-VDT---
A6LRM0_CLOB8/7-335GSGALILG....HEGN................Y.PEITYVTTGKVKD----YGQKDANNMG-----AAMAPAA-ADT---
Q9KCK2_BACHD/4-332AAGVGVVA...K.VGS................G.PVVTSATIGKVVD----MGLSDPFNMG-----EAMAPAA-ADT---
Q5WH23_BACSK/4-331GAGAVLLG....KKRT................E.IQLTEATIGRVQD----LGITDPMSLG-----AAMAPAA-AEV---
B8I4W4_CLOCE/7-335GSGAVVLS....SKGT................G.PYIKHVTTGKIND----LGITDANNMG-----AAMAPAA-ADT---
A6TQB0_ALKMQ/8-336GSGAVILS....TKSE................G.PYITYITPGKVID----YGISDPNNMG-----AAMAPAA-VHT---
A4J4J1_DESRM/4-332GAGVALLG...P.EGD................G.PRVTSATIGKVVD----MGLSDPFNMG-----GAMAPAA-VDT---
Q8ERC5_OCEIH/4-332GAGCALVA...K.QGN................G.PYVTSATIGKIVD----MGMTDPFNMG-----GAMAAAA-ADT---
Q2RIQ1_MOOTA/8-336GAGAVLMA....PVGN................G.PRITHATIGRVLD----VGIKDPNDMG-----SAMAPAA-VDT---
Q67T05_SYMTH/7-337GAGAVVLA....SAGE................G.PRITYCTTGKVVD----WGVADPLNQG-----AAMAPAA-VDT---
Q189X1_PEPD6/7-335GAGSVLLA....PNGD................G.PKVKYVTVGKVID----EGIDDGNNMG-----PAMAPAA-IDT---
A0PZS9_CLONN/6-338GSGAMLIARDGIREGK................F.PYASYFTVGKIKD----YGQTDTSDMG-----SAMAPAA-VDT---
Q0AZ98_SYNWW/8-335AAGAVLLE....PVGT................G.PRITAVSIGKVID----MDQKDVSDMG-----SAMAPAA-AHT---
Q891W9_CLOTE/6-334GSGAVVLS....REGN................F.PYVTYVTIGKVKD----YGITDANNMG-----ASMAPAA-VST---
A5D2Y8_PELTS/8-335GAGAMLLA....REGT................G.PVITHATIGRAID----MGQGDPMDMG-----AAMAPAA-ADT---
A8MHP8_ALKOO/7-335GAGATIIS....SVGE................G.PYITYVTTGKVID----FGIKDAANMG-----AAMAPAA-VDT---
A5N8K2_CLOK5/4-332GAGAAVIG...K.AND................R.PKVTTATIGKVVD----MGVSDPFNMG-----AAMAAAA-VDT---
Q97GR2_CLOAB/6-335GAGAMLLA....RQGD................F.PYITFVTAGKVKD----YGITSPDSMG-----EAMAPAA-VDT---
A4XFR0_CALS8/5-335GAASFLIK...PEDGT................QKPKITHFTVGKILD----YGIKDSNNMG-----ACMAPAA-FDT---
A9KI33_CLOPH/13-353GSGAVILG....HEPEKDSEFA....KQFSPVM.IKVKGITIGKIVD----YGIKDSLNMG-----ACMAPAA-CET---
Q9KCM9_BACHD/5-332GAGAALVS....NRPS................K.VRIESATIGHVVD----YGLKNPLDLG-----SAMAPAA-AHT---
Q5WGZ4_BACSK/4-332AAGACLLE...K.TGT................G.PVVTKATIGRIVD----MGLSDPYDMG-----GAMAPAA-ADT---
A5I6G6_CLOBH/6-334GAGAMVLG....KEGN................Y.PCITYVTIGKVKD----YGVKNVDKMG-----SSMVPAA-VAT---
SP5AD_BACSU/5-332GSGAVVIS....QTPG................D.IQITSATVGKVSD----LGITDPFDMG-----SAMAPAA-ADT---
Q24V53_DESHY/7-333GAGSLVLG....QSGE................G.PRITAATIGRIVD----FGETDANNMG-----AAMAPAV-ADT---
Q5KXJ7_GEOKA/5-332GAGAALVG....RAPG................R.WRVRAATIGKVVD----AGLKNPLDMG-----AAMAPAA-ADT---
Q5L1P1_GEOKA/4-332GAGVAIVS....PKGD................G.PRVTAATIGRVVD----MGLADPFNMG-----GAMAPAA-VDT---
Q81MG1_BACAN/5-333GAGSILIS....KEKS................A.IKITAATIGKVQD----LGIANPLDMG-----SAMAPAA-AHT---
Q81X67_BACAN/4-332GAGAAILS....DTGH................G.PRVTSATIGRVVD----MGLTDPFNMG-----GAMAPAA-VDT---
Q8RAA4_THETN/7-333GAGATILA....STGE................G.PYITHATTGKVVD----LGMKDANNMG-----AAMAPAA-ADT---
Q8XIR8_CLOPE/9-337GSGAMLLG....KSGD................Y.PYVTHVTTGIVKD----YGIKDADNMG-----AAMAPAA-VDT---
R6N984_9CLOT/6-333GSGAAVVG....KGEG................V.PYVSAVTVGRIAD----LGIKDAANMG-----AAMAPAA-AQT---
R7D7M0_9FIRM/8-352GSAACILS....PEAPHPSEIVGSSLLRSTLGS.VAITGITTGKVID----FGFRDSLNMG-----GCMAPAA-CDT---
R7FR34_9FIRM/4-332GSGAFIVG....KNRS................H.VRITGVTVGKIVD----YGLKDSQNMG-----ACMAPAA-CDT---
U5LA28_9BACI/4-335GGGAALVGE.NTGQKD................M.PAAVSATIGKVID----MGLSDPFNMG-----GAMAPAA-ADT---

PF13723

X2H9N4_9NEIS/21-241QEELSPTS------------------------FALSVHNAIIGQWSLM---RGDMSESIAL-----TARYNGL-EIG---
Q7MMI9_VIBVY/35-248GEEASPMA------------------------FSQSVHNTAAGLTTIA---TKKPIPLTSI-----AAGKNTF-QSA---
Q5E6K7_VIBF1/27-240GDDASPMA------------------------FSQSVHNTAAGLFTIT---AKKAIPVTSI-----AAGENTF-HSA---
W0PHW4_9BURK/37-246GNGVSPTS------------------------FGLSVHNAIAGQLAIH---HGNYAEQSAI-----SADSNGL-ENA---
G0A1B0_METMM/37-247DGSVSPSR------------------------FSLCVHNAIGGLHSLH---SESLQAYVSL-----AGGSEGF-FTP---
A6W243_MARMS/22-235NEPLSPTS------------------------FSLAVHNAISGLFSIA---RKDRRETTAI-----SATENLI-PFA---
K4KXD4_SIMAS/26-238GSPLSPAA------------------------FSMSVHNATAGLLSIA---KKATGPHTAL-----SANSRLL-SAA---
Q5F738_NEIG1/7-227SHTVSPTS------------------------FGLSVHNATAGQWSIL---RRDMSEQTAL-----AVCADGV-ETA---
F6AHI4_PSEF1/21-233KEPLSPTQ------------------------FSLSVHNAIIGQWSIM---RGDTSEMTAL-----AGEGDGL-EMA---
V6EZ88_9PROT/10-227SGEVSPAE------------------------FSLAVHHALAGLLSIA---TGNRQGHSAV-----AAGPDSF-GYG---
B2JEK1_BURP8/13-228GEPVSPTS------------------------FSLSVLNAMTGVFGIA---RGDRSAASAL-----SAGAETL-GYA---
Q8E9B8_SHEON/23-242KQPLSPLG------------------------FSQSVHNTGSGIFGIL---AHNTAPSTSV-----AAGTETL-SQA---
Q3IC51_PSEHT/11-232QQPLSPTG------------------------FGLSVHNAAAGLFSII---KSNTCAMNAI-----AAGAESF-MCA---
R7ICN1_9BURK/24-238GDPESPTD------------------------FTMSVHNAAEGTLLIA---KRWKVPGTSV-----AAGPRTF-FAG---
M4U150_9GAMM/24-238GDDASPLA------------------------FSQSVHNIAAGLFTIC---SGRATPVTSI-----AAVESSL-HHG---
A8AR40_CITK8/23-238EQALSPTD------------------------FALSVHNSAVGNLTIA---AKQPVVSSSL-----SAGRDTF-QQG---
Q1QTW3_CHRSD/12-232EAPLSPAR------------------------FGLSVHNAIPGVYSIG---RGNRRTQQAI-----AASGDEF-AAL---
Q6CYK1_PECAS/23-238NKNVSPTD------------------------FAMSVHNAAVGSLTIT---AKAPLVSTSI-----AAGMDSF-QQG---
Q088U8_SHEFN/23-254QQALSPMA------------------------FSQSVHNTASGIFGIV---NNNTASSTSI-----AAGEQTL-TQA---
H2IXQ6_RAHAC/23-237EEALSPTE------------------------FSMSVHNTAAGWLTII---SKNPLPVTSL-----AAGKDSF-QQG---
Q6LKR1_PHOPR/24-249GEDASPIA------------------------FSQSVHNTAAGLYTIA---TKQAIPVTSV-----GACENTL-HAA---
C9R2B5_AGGAD/33-245EGDVSPTS------------------------FSLSVHNALIGQWSEF---RQVKAETTAL-----TANKDNL-EVA---
E3HL09_ACHXA/22-238DEPLSPTA------------------------FGLSVHNAIAAQWSII---RRETTESVAL-----SAEDDGL-EHA---
Q4KJF9_PSEF5/22-236EQPLSPTQ------------------------FSLSVHNAVIGLWSIM---RGETSEMTAL-----AAAGDGL-EHG---
Q87V50_PSESM/22-236EEPLSPTQ------------------------FSLSVHNAVIGLWSIM---RGETSEMTAL-----AAAGDGL-EYG---
Q13V69_BURXL/13-242GEPVSPTA------------------------FSLSVLNAMTGVFGIA---RGDRSAASAI-----SAGAETL-GYA---
A8GA54_SERP5/11-225QQPLSPTD------------------------FAMSVHNTAAGWLTIM---AKNTLPTTSL-----AAGEGSF-QQG---
A0KNN6_AERHH/22-235GQALSPTD------------------------FSMSVHNTAAGLCSIQ---GKAAIPMTSL-----AAGENSL-MAG---
A9ICW7_BORPD/22-238GEPLSPTA------------------------FGLSVHNAILGQWSIV---RKETEETIAL-----AGDTDML-EHA---
D5CEN4_ENTCC/23-238EQPVSPTD------------------------FAMSVHNAAVGNLTIT---AGQPIVSSSV-----SAGMDTF-QQS---
B2FNB7_STRMK/22-243DQPLSPTG------------------------FGLSVHNAIAALYSIA---RGHRGNYLAL-----AAGQATV-EAA---
F0LS02_VIBFN/28-238GEEASPMS------------------------FSQSVHNTAAGLSTIA---SHQAIPVTSI-----VAGENTF-HSA---
A3QIS7_SHELP/23-236QQPISPIG------------------------FSQSVHNTASGIFSIL---TDNRAPSTSI-----AAGEATL-IQA---
B8CHL8_SHEPW/21-234QSPLSPTA------------------------FSQSVHNTASGIYSIL---SQNQNASTSI-----AAGSETL-HQA---
M4RB67_BIBTR/27-246EGDVSPTS------------------------FSLSVHNALVGQWSEM---RRVKAETTAI-----AAQQDNL-ETA---
G4SXC9_META2/10-226GEEVSPTG------------------------FSLSVHNAIAGLFSMA---WKNKLQCTVL-----APGEEGM-APA---
F7YP97_VIBA7/32-242GEEASPMA------------------------FSQSVHNTAAGLATIA---SKQPIPLTSI-----AAAQNTF-QSA---
G0AK33_COLFT/32-258DQPLSPTS------------------------FSLSVHNAAAGLFSIA---RKDQASHTAL-----AAGHSGV-EHA---
D8MQL2_ERWBE/23-238EESLSPTD------------------------FAMSVHNAAVGSLTIA---AAAPLVSTSL-----AAGVDSF-QQG---
G8AJ88_AZOBR/25-240GELPSPAE------------------------FSLSVHHGLAGLLSIH---TGNRRGHTAL-----AAGPDSF-GFG---
B7VKK6_VIBSL/28-249GDDASPMA------------------------FSQSVHNTAAGLTTIA---AKAPIPLTSI-----ASGQDTF-HNA---
B0URR9_HISS2/28-245EGDVSPTS------------------------FSLSVHNALVGQWSEM---RQVKNETTAI-----TALKDSL-EIA---
Q1LF35_RALME/48-282GEPLSPTA------------------------FGLSVHNAIGAMFSID---RSAASNIQAL-----SGGKDTV-EAA---
A7ZFF8_CAMC1/20-217AEPVSPTS------------------------FSLSVHNAISSLLSIE---AKNHNEILAI-----SS.FSPV-EDA---

PF02797

O81305_ARATH/238-383---------LSG-LE---TKL---KLK-P-----------------EKLEC-----SRRALMDY----------------
O23674_ARATH/245-393---------LNR-LE---TKL---KLE-K-----------------EKLES-----SRRALVDY----------------
F2CYQ0_HORVD/240-390---------LDR-VE---DRV---GLD-K-----------------KRMRA-----SREVLSEY----------------
F6HP18_VITVI/238-388---------LDA-VE---AKL---NLE-K-----------------KKLEA-----TRHVLSEY----------------
M1CL74_SOLTU/241-391---------VDQ-VE---STL---GLE-P-----------------DKLRA-----TRNILREY----------------
Q7X795_ORYSJ/244-388---------LNR-LE---VCL---ELQ-P-----------------EKLKI-----SRKALMNY----------------

PF08541

Q8ED66_SHEON/282-372---------NLF.VV---KKLLGDEVA.P-----------------E..QA-----PVVL.DEY----------------
Q74CS1_GEOSL/237-326---------IDA.IG---KRL...GLP.G-----------------E..KV-----YVNL.DRF----------------
Q7CTU0_AGRT5/239-328---------SDA.VC---GNL...GIE.R-----------------E..KT-----VRTI.GSF----------------
FABH_PROMM/246-335---------LDA.VA---NRF...AIP.Q-----------------A..KV-----LSNL.AEY----------------
Q73Q42_TREDE/222-311---------LEA.AA---KRL...NTD.M-----------------S..KF-----ACNM.ENY----------------
FABH_PSEAE/233-322---------LAA.VA---DQL...DLP.V-----------------E..RV-----VSNI.AEV----------------
FABH_CHRVO/230-319---------IES.TA---KHL...GLP.M-----------------D..KV-----VVTL.PEQ----------------
FABH_DESVH/241-330---------IEA.VG---DRL...GFA.S-----------------E..KV-----FVNV.HDF----------------
Q5YPR0_NOCFA/241-333---------IDG.VV---RKL...GWR.D-----------------DSVVV-----ADDV.RRA----------------
FABH2_STRCO/230-319---------LTS.VA---KRL...RLP.P-----------------E..RV-----VSNI.ADV----------------
Q5WEX8_BACSK/220-309---------MEA.SR---ERL...ELP.R-----------------E..KM-----SVNV.NKY----------------
FABH_NOSS1/239-328---------LDT.VA---QRL...NIP.A-----------------H..KV-----ISNL.ANY----------------
Q67RA0_SYMTH/248-336---------HQA.LI---EQL...GIP.V-----------------D..RA-----.IYL.EEY----------------
Q5NF70_FRATT/234-323---------LNS.TA---KKI...DMP.M-----------------P..KV-----VTTL.QDH----------------
Q7M7Z5_WOLSU/238-327---------IKA.VG---DLL...DFT.P-----------------E..QI-----AITV.DRF----------------
FABH2_VIBPA/235-324---------IQT.LC---DLS...GIP.Q-----------------D..KA-----FVNI.QNY----------------
Q7NZ26_CHRVO/282-372---------NQLIAR---RVL...GRE.A-----------------DTVEA-----PVIL.DRY----------------
FABH_AQUAE/220-309---------INA.LA---EKL...NIP.K-----------------E..KV-----FVNI.QKY----------------
FABH1_STRAW/264-354---------IDS.MV---KTL...KLP.E-----------------H.VTV-----ARDV.RTT----------------
FABH_TROWT/231-321---------IDE.LA---KQI...GLE.E-----------------N.VLI-----AQDI.CKT----------------
Q63N14_BURPS/258-347---------VRA.WA---QRL...GLA.P-----------------D..QY-----VIRL.ADC----------------
FABH_HELHP/239-328---------INA.VG---ENL...NFT.P-----------------E..QI-----VVSI.QKY----------------
FABH3_STRCO/240-329---------TAR.LA---DEI...GIP.R-----------------E..RS-----VSNI.AEV----------------
FABH_PROMP/245-334---------LDS.VG---ERL...NVS.T-----------------E..KI-----LSNL.SNY----------------
Q65LQ9_BACLD/237-326---------IES.IC---EKT...EIP.A-----------------E..KA-----LTSV.EWF----------------
FABH_CLOAB/234-323---------IEF.AA---KKL...GLS.M-----------------D..KF-----FINL.QNY----------------
FABH_AROAE/232-321---------LQA.TA---RRL...GVS.M-----------------D..KV-----ITTV.DHH----------------
FABH_ARATH/314-403---------IDS.VA---TRL...HFP.P-----------------E..RV-----ISNL.ANY----------------
Q5FUN7_GLUOX/235-324---------IEG.MA---KKL...ALP.A-----------------D..RV-----VVTV.DRH----------------
Q9L1V9_STRCO/246-337---------YLKVIL---DPM...GLS.P-----------------D..QG-----LLDFGRNL----------------
FABH2_STRAW/225-314---------IEP.LA---AKI...GAV.N-----------------A..VV-----ARDV.VES----------------
Q87XT2_PSESM/282-372---------NHLITR---KLL...GRD.A-----------------TVEEA-----PVIL.DTY----------------
Q884Y8_PSESM/221-307---------VDA.VA---RRF...EDK.P-----------------E..KF-----LKDM.VET----------------
FABH2_LACPL/239-328---------VKS.VG---QKL...NLA.T-----------------E..QL-----PMNI.AQY----------------
FABH2_BACSU/234-323---------IES.IC---EKT...PFP.I-----------------E..KT-----LTSV.EHY----------------
FABH_RUEPO/234-323---------IQG.TA---KKM...GLP.M-----------------D..KV-----VVTV.QDH----------------
FABH_HAEDU/227-316---------IAA.TA---KKL...EME.M-----------------S..QV-----VLTV.EKY----------------
Q7TTZ7_RHOBA/241-330---------LDQ.LR---KRM...EIS.P-----------------E..RL-----PVDL.ADV----------------
FABH_RHOBA/256-345---------IDS.AV---SDL...NVP.P-----------------E..KV-----FVNL.DKY----------------
Q7NV97_CHRVO/234-323---------MQH.MA---KRL...GIA.A-----------------G..RI-----VDIY.ASH----------------
Q5ZV11_LEGPH/238-327---------MHH.IR---KKL...GIP.G-----------------E..KF-----VDIY.TTH----------------
Q97KV2_CLOAB/245-334---------IQY.IC---AQL...NED.E-----------------N..KF-----VFIG.DKY----------------
Q8XTB9_RALSO/282-372---------NQLIGK---RLL...GRD.A-----------------TADDA-----PVIL.DEF----------------
Q6A930_PROAC/241-331---------TDV.VS---RHL...KLP.E-----------------S.VTV-----CHDI.ADM----------------
Q5SL76_THET8/230-319---------IDA.AR---ERL...GLP.W-----------------E..RV-----AVNV.DRY----------------
Q7N8H1_PHOLL/221-311---------WRQ.AA---KFM...NIP.I-----------------E..KI-----FLKNISET----------------
FABH2_VIBVY/235-324---------IQT.LC---DLS...GID.Q-----------------S..KA-----FVNI.QKY----------------
Q82PP5_STRAW/243-333---------SPE.NY---ELL...GFT.E-----------------K..QS-----TWDLGRLV----------------
FABH_PROMA/245-334---------LNA.VA---DRF...SIP.H-----------------H..KV-----LTNL.ANY----------------
FABH_BLOFL/229-318---------ISK.AA---KRL...NID.M-----------------E..KI-----IITL.HKH----------------
Q8RHZ0_FUSNN/221-309---------MPL.IM---EKL...GVP.E-----------------G..KY-----IDEV.KEF----------------
Q7X8V9_ORYSJ/337-426---------IDA.AA---SRL...DIP.S-----------------D..KV-----ISNL.ANY----------------
FABH_CLOTE/244-333---------IEH.VA---KKL...GID.E-----------------N..KF-----YINI.NHY----------------
Q88ES4_PSEPK/221-308---------VDA.VA---RRF...EEQHP-----------------E..KF-----VKDM.LET----------------
Q88EC1_PSEPK/299-389---------NQLIVK---KLL...GRE.V-----------------AEEEA-----PVIL.DRY----------------
FABH_THETN/240-329---------IEA.AR---KRL...KLT.N-----------------D..KV-----YINL.DKY----------------
FABH_STRMU/234-325---------LDK.MA---KKI...GAD.R-----------------E..KF-----PANM.MKY----------------
FABH1_BACAN/219-308---------MES.AR---ERL...NLP.Q-----------------E..KM-----SMTI.EKF----------------
FABH_STRP1/233-324---------LDK.IA---RKI...DVP.R-----------------E..KF-----LENM.MRY----------------
FABH_SYNY3/241-330---------MDA.VG---DRL...GIP.S-----------------E..KI-----ISNV.GEY----------------
FABH_LACLA/234-325---------LDK.MA---KKL...GVT.R-----------------Q..KF-----LQNM.QEY----------------
FABH5_STRCO/237-326---------LHA.VA---DQL...RID.G-----------------A..RT-----VIDL.DRV----------------
Q5YN70_NOCFA/251-341---------LRN.WR---EAL...ELP.P-----------------E..RH-----PDTF.DRC----------------
FABH2_BACHD/236-325---------IES.IC---DKS...GIP.L-----------------E..QT-----LYSL.VQY----------------
Q5YNJ2_NOCFA/253-343---------NEL.MK---KNL...GLA.D-----------------D.IPM-----ANDI.ENT----------------
Q885B9_PSESM/249-338---------LDA.LR---RRL...KLP.A-----------------E..KF-----VSAF.QHC----------------
Q82HI7_STRAW/252-343---------YIRAVL---EPL...GID.P-----------------A..RG-----VLDFGRHL----------------
Q6FAK4_ACIAD/280-370---------NQLIAK---LVL...GKE.A-----------------EAERT-----PIIL.DEF----------------
Q6DAZ3_PECAS/249-337---------LEH.MR---KRL...AIP.T-----------------E..RL-----IDIY.RYH----------------
FABH_SYMTH/239-328---------IDS.AV---KRL...GLA.P-----------------E..KV-----VVNL.DRY----------------
Q8CV20_OCEIH/48-137---------ILK.IQ---DHF...NIQ.E-----------------E..KV-----VYIG.DKY----------------
Q9HYV7_PSEAE/259-349---------NLLITR---KLL...GRD.A-----------------EAHEA-----PVIL.DSY----------------
FABH_GEOKA/219-308---------VEA.AR---QRL...ELP.E-----------------E..KI-----STTI.RRY----------------
FABH2_VIBCH/235-324---------IQT.LC---DLA...GIA.Q-----------------D..KA-----FVNI.HRY----------------
Q6AQA3_DESPS/255-342---------FRM.LF---DRL...GLS.E-----------------E..KN-----FQTL.PFL----------------
FABH1_LACPL/238-323---------IEK.IA---ANL...ALP.M-----------------T..KF-----PHNV.DHY----------------
Q8EDA9_SHEON/231-320---------IDT.LV---SRM...KIP.K-----------------E..KA-----FVNI.ANY----------------
Q6LQM2_PHOPR/234-323---------IEA.LC---DHA...KIP.L-----------------D..KA-----FINI.HKY----------------
Q63PP7_BURPS/254-343---------LKH.LA---KKA...GLP.A-----------------E..RV-----PINI.GTY----------------
FABH_COXBU/230-319---------IEA.TA---KRL...GLP.R-----------------E..RV-----ILTI.EQH----------------
FABH2_BACAN/235-324---------IES.IC---EKS...QIP.I-----------------H..KT-----LTSV.EYM----------------
Q5NL87_ZYMMO/234-323---------LSA.TA---QKL...GVP.S-----------------E..QV-----VMTV.DRH----------------
FABH_THEEB/239-328---------LDA.VA---ERL...GIP.Q-----------------E..KV-----ISNV.GQC----------------
Q5LUY4_RUEPO/282-372---------NDFIGK---KVL...GRE.P-----------------EPGEQ-----PNIL.QDY----------------
Q98AW4_RHILO/238-327---------FDA.VG---RNL...GIA.D-----------------E..AI-----VKTI.AEY----------------
Q6AET2_LEIXX/245-335---------VDE.FA---KQL...KLP.E-----------------T.VAI-----ARDI.ETT----------------
Q81JE9_BACAN/240-329---------MRL.IR---KKL...GVD.E-----------------E..RF-----MTIF.EDY----------------
Q6MR21_BDEBA/243-332---------IYE.TL---DKL...ELP.R-----------------D..RA-----HYVM.DRF----------------
FABH_STRA5/232-323---------LDK.MS---RKI...DIA.R-----------------D..KF-----PENM.MDY----------------
FABH_BORPE/239-328---------LNF.LA---RKL...RVP.T-----------------E..RV-----VITM.DQH----------------
FABH_NITEU/229-318---------ITS.TA---KKL...GIP.E-----------------E..KV-----VATV.SQH----------------
Q98K75_RHILO/223-313---------NAMILK---LSF...GHD.V-----------------DHDRA-----PMVL.ERL----------------
Q9K3G9_STRCO/229-319---------IDA.MV---RRL...RPP.E-----------------H.VAI-----ARSI.VTD----------------
FABH_GLOVI/237-326---------LDS.VA---SRL...HVA.P-----------------E..RM-----ASNL.ADY----------------
Q8EG66_SHEON/260-347---------RKQ.VL---SAL...NIP.P-----------------E..KE-----FPTY.QLL----------------
Q63PP9_BURPS/255-344---------LDA.LR---KKM...KIP.E-----------------H..KF-----PVLM.EHC----------------
Q7NZW4_CHRVO/228-317---------HRS.LL---ARL...DLS.E-----------------E..RT-----VFNY.HRL----------------
Q8RC85_THETN/250-338---------HEF.IL---NEL...GLS.P-----------------D..KS-----.IYL.ENY----------------
Q6MAF5_PARUW/240-329---------IDA.IA---KNF...NFP.D-----------------E..KV-----YQTV.HKY----------------
Q5QWT4_IDILO/232-321---------IDF.LG---KMC...KVP.S-----------------E..KT-----VINI.QNY----------------
Q67MB7_SYMTH/254-342---------FDQ.VM---AAL...GIP.P-----------------E..RQ-----.VYL.DEY----------------
FABH1_DEIRA/233-322---------IEA.AT---QRF...GIP.M-----------------E..KT-----VINL.DRY----------------
Q9I4X1_PSEAE/253-342---------VKA.WA---EGI...GAR.P-----------------E..QY-----QLTM.GDT----------------
FABH1_VIBCH/227-316---------ISA.TA---KKL...SMS.L-----------------D..QV-----VITL.DRH----------------
Q73S66_MYCPA/245-335---------LRN.WR---DAL...ELP.P-----------------A..RH-----LDTF.DEC----------------
FABH_NEIG1/231-320---------IES.TA---KHL...GLS.M-----------------D..KV-----VLTV.QDH----------------
Q63N13_BURPS/243-332---------IDA.VI---EQL...GLP.R-----------------E..RC-----MISV.EDL----------------
FABH_PECAS/228-317---------ISA.TA---KKL...GMG.M-----------------D..KV-----VVTL.DRH----------------
FABH_CLOPE/235-324---------IDY.VV---KRL...GIP.R-----------------E..KF-----ITNL.QNY----------------
Q820X4_COXBU/239-326---------LQS.AA---SRA...GIA.P-----------------E..KH-----FYNV.DRF----------------
FABH_PORGI/240-327---------IDA.VA---RRM...GVP.Y-----------------E..KV-----MVNI.ERY----------------
Q82NC9_STRAW/244-334---------LRN.WR---EAL...QLP.P-----------------E..RH-----LNTF.DQY----------------
FABH_RHIME/234-323---------IDG.SA---KKL...GIP.L-----------------E..KV-----VVTV.DLH----------------
FABH_RALSO/237-326---------MQG.TA---KKL...GLP.G-----------------E..RM-----VVTV.DEH----------------
Q5ZTD0_LEGPH/246-335---------VLS.VA---KQL...GFP.E-----------------E..KT-----IKTV.EET----------------
Q82KT2_STRAW/240-329---------LDS.VA---ERL...GVP.A-----------------E..RQ-----LTNI.ARV----------------
Q8F686_LEPIN/233-322---------VQD.VL---KRT...RFP.K-----------------E..KI-----LMNF.DKV----------------
FABH_OCEIH/221-310---------MEA.AR---ERL...GIS.E-----------------D..KM-----AKSI.EKF----------------
FABH_SHEON/230-319---------INA.TA---KKL...DMS.L-----------------D..KV-----VLTL.AKH----------------
FABH_DESPS/235-324---------IKN.LG---ERL...GLS.S-----------------E..QV-----FVNI.ANY----------------
FABH_XANCP/236-325---------IEA.TA---KRL...DLP.M-----------------E..QV-----VVTV.DRH----------------
FABH_CHLTE/239-328---------IHA.TA---ERM...GIT.E-----------------E..KV-----MMNI.ARY----------------
FABH_BURPS/240-329---------MTS.TC---RKL...GLP.Q-----------------E..RM-----IVTV.DEH----------------
Q8RC81_THETN/237-325---------ILE.VM---DTL...GLD.R-----------------S..KT-----TTIM.EKY----------------
Q5YNV7_NOCFA/248-338---------IEI.MA---RVL...KLP.E-----------------D.CAL-----ANDI.EET----------------
FABH_METCA/232-321---------IAA.TA---KKL...QLP.M-----------------E..RV-----VVTV.DEQ----------------
FABH2_DEIRA/239-328---------IEA.AC---ERF...GLP.I-----------------E..RA-----VTNL.DRY----------------
PQSD_PSEAE/242-329---------LDA.VQ---EQL...GIP.Q-----------------H..KF-----AVTV.DRL----------------
B9KJ28_ANAMF/234-322---------IDL.VI---NRL...GLS.R-----------------D..KV-----ILSI.DEH----------------
D5AUL7_RHOCB/235-324---------ITA.TA---ERM...GVP.M-----------------E..RV-----VVTV.ADH----------------
D6D672_9BACE/241-327---------IEA.VA---HRM...EVP.M-----------------D..KV-----LVNI.EHY----------------
FABH_HELPY/239-327---------IQA.VR---EHL...DFK.D-----------------E..QV-----VLTV.HKY----------------
FABH_CHLTR/238-325---------IDA.IA---KRF...AVK.D-----------------S..RV-----FKTL.AKY----------------
FABH_STRR6/234-323---------LDK.MA---RKI...GVD.R-----------------A..KL-----PANM.MEY----------------
FABH_MYCTU/242-332---------NEL.LV---KNL...QLR.P-----------------D.AVV-----ANDI.EHT----------------
Q2YKB4_BRUA2/237-325---------VDK.VC---ETI...GVP.R-----------------A..KA-----ASTL.ETY----------------
FABH_BRUA2/235-323---------IDA.SA---KKL...HIA.E-----------------E..KV-----VITV.DRH----------------
FABH_SYNE7/244-331---------LDA.VA---DRL...DIS.R-----------------D..RV-----LSNL.VNY----------------
FABH_STAEQ/223-311---------MES.AR---ERL...GIE.R-----------------E..KM-----SVSV.NKY----------------
Q5LAY0_BACFN/240-327---------ISA.VA---QRL...DVP.L-----------------E..KV-----MINI.EHY----------------
FABH_STRT2/237-320---------LDT.MA---KKI...DVS.R-----------------D..KF-----LANM.MSY----------------
Q5ZTD4_LEGPH/263-346---------IDQ.VL---HEN...NLN.N-----------------K..II-----IWDA.DTI----------------
FABH_BARHE/236-324---------IEA.SA---KKL...GIS.I-----------------D..KV-----VITV.DRH----------------
Q79ZF6_STRAW/239-330---------MRAQYF---DPF...GID.P-----------------Q..RS-----TWSWGRRV----------------
Q79ZR7_STRAW/221-310---------LHS.VA---DDL...GLP.R-----------------E..RC-----VTHV.ESV----------------
Q7KWI9_PLAF7/283-371---------IET.VA---KNL...NIP.M-----------------S..KV-----LVNL.DEY----------------
Q81RV7_BACAN/243-331---------LIE.LI---QGL...GLT.E-----------------E..QV-----.VYL.DHY----------------
Q8P810_XANCP/349-438---------LDH.VV---QAL...GLR.P-----------------E..QV-----VRIL.HAH----------------
FABH_FUSNN/237-326---------IES.AA---KRM...KFP.L-----------------E..KF-----YMNL.SRY----------------
FABH_LISMO/221-310---------MEA.SR---ERL...NLP.E-----------------E..KL-----MKTV.HKY----------------
FABH_CAMJE/230-318---------IKA.VQ---EKL...NLS.D-----------------E..KC-----VITV.QKY----------------
FABHL_CAMJE/252-337---------VDC.IK---EEL...KLN.D-----------------D..KV-----PNFIMEKY----------------
FABH_RICPR/230-317---------INK.LA---ELL...NIE.E-----------------H..KV-----VKTV.EKH----------------
V6KTJ6_STRRC/242-332---------AAS.YL---KIL...GFS.L-----------------E..SS-----TWEFSRTT----------------

PF02803

THIL_YEAST/274-397---------GLV-NT---KIL---KLD-P.................S--KVNVYGGAVALGHPL----------------
FADA_ECOLI/261-386---------ILP-CI---KDL---GLI-EQ..............IDE--KINLNGGAIALGHPL----------------
YKA3_CAEEL/305-445---------VLA-NL---NAM---DSD-YFCKEQMKRSGKFGRVPMD--KLNLWGGSLSIGHPF----------------
THIL_HUMAN/306-426---------VLA-NI---KML---EID-P.................Q--KVNINGGAVSLGHPI----------------
THLA_CLOAB/269-391---------SLA-VA---KDL---KFD-M.................N--KVNVNGGAIALGHPI----------------
ATOB_ECOLI/270-392---------FLA-VG---KNL---GFD-S.................E--KVNVNGGAIALGHPI----------------
THL_BACSU/270-392---------VLT-CE---KIV---GFD-L.................E--KVNVNGGAIALGHPI----------------
THIL_CUPNH/270-392---------ALA-VH---QQM---GWD-T.................S--KVNVNGGAIAIGHPI----------------
THIM_HUMAN/273-395---------YLA-VE---RSL---DLD-I.................S--KTNVNGGAIALGHPL----------------
THIKA_RAT/298-421---------ALY-CV---EKL---GIP-A.................E--KVNPLGGAIALGHPL----------------
YQEF_ECOLI/269-391---------ALS-VG---KML---EWD-E.................R--RVNVNGGAIALGHPI----------------
THIK_YEAST/296-416---------ALY-CI---HKL---GID-L.................N--KVNPRGGAIALGHPL----------------
FADA4_MYCLE/270-392---------ALA-SA---REL---GIA-P.................E--LVNVNGGAIAVGHPL----------------
THIK_YARLI/291-413---------ALF-SI---QHC---GID-E.................S--KVNPRGGAIAIGHPL----------------
ECHB_RAT/332-472---------ILA-NF---KAM---DSD-WFAQNYMGRKTKVGAPPLE--KFNIWGGSLSLGHPF----------------
ATOB_HAEIN/270-392---------FLG-VG---KDL---NLD-M.................N--KTNIHGGAIALGHPI----------------
A1B3M4_PARDP/268-390---------AIA-VN---RDM---GWD-P.................S--IVNVNGGAIAIGHPI----------------
C5M4S8_CANTT/289-406---------CLY-SA---EQV---NVP-E.................E--KLNINGGAIALGHPL----------------
C5M6V3_CANTT/274-396---------GLA-NA---ELV---NIP-L.................E--KLNVYGGAVAMGHPL----------------
I3YE91_THIV6/271-393---------AMS-VN---QDM---GWD-L.................S--KVNVNGGAISIGHPI----------------
FADA_PSESM/266-390---------ALP-VL---KDL---KVL-DK..............MNE--KVNLHGGAIALGHPF----------------

PF02801

PKSJ_BACSU/4829-4945EV.......MKD-AL---FKS---GKK.P-----------------E---------DISYLEAN----------------
PKSL_BACSU/4322-4438DV.......MLS-AL---EKS---GKK.T-----------------E---------EISYLEAN----------------
Q18559_CAEEL/5488-5604KC.......MTD-VL---ARF---TNKEK-----------------E---------RISFVECH----------------
Q18559_CAEEL/244-354EV.......QLE-AL---KNI---DKD..-----------------.---------SVQLVTCH----------------
P95029_MYCTU/2816-2942RGGK..DSPLAR-AL---AKL---GVA.A-----------------D---------DVAVISKH----------------
PKSF_BACSU/257-367HV.......IQK-AL---ERA---RLL.P-----------------E---------DIDYINPH----------------
P74017_SYNY3/244-356QA.......VKH-CL---TRS---GLT.P-----------------E---------QIDLIHPH----------------
O67612_AQUAE/256-371EC.......MRL-AL---EDA---GIK.P-----------------E---------EVDYINAH----------------
FABF_BACSU/254-369RA.......MQE-AI---KDA---GIA.P-----------------E---------EIDYINAH----------------
FABF_SYNY3/258-373RA.......IAW-AL---KDS---GLK.P-----------------E---------MVSYINAH----------------
Q9ZCH8_RICPR/269-384RA.......MSE-AL---QDA---DIT.P-----------------S---------MIDYINAH----------------
CEM1_YEAST/273-391RA.......IEM-AL---KMA---RLE.P-----------------T---------DVDYVNAH----------------
OXSM_SCHPO/262-380YA.......MKR-SL---KQA---GLS.A-----------------S---------QLDYINAH----------------
FABB_HAEIN/253-361RC.......MKQ-AM---ATV---DTP..-----------------.---------.IDYINVH----------------
O84775_CHLTR/256-371AC.......ILG-AL---NKA---GIP.K-----------------E---------RVNYINAH----------------
KASC1_ARATH/315-429SC.......IER-CL---EDA---GVS.P-----------------E---------EVNYINAH----------------
O54149_STRCO/253-365RA.......MEA-AL---AQA---GVT.G-----------------R---------DIDHVNAH----------------
Q9Z4Y3_STRCO/251-363AA.......VER-AL---AAA---RMS.V-----------------R---------NVTTVNAH----------------
Q93458_CAEEL/101-214LS.......MNR-AI---GNA---HLE.P-----------------K---------DIGYVNAH----------------
KASA_STRCO/303-418ET.......IRV-AL---DES---RTD.A-----------------T---------DIDYINAH----------------
KAS1_STRCO/261-376RA.......IDT-AL---DMA---ELD.G-----------------S---------AIDYVNAH----------------
KASB_STRCO/251-361RA.......IRL-AL---NDA---GTG.P-----------------E---------DVDVVFAD----------------
KAS2_STRCO/264-377RA.......IQG-AL---AEA---GCR.P-----------------E---------EVDVVFAD----------------
FAS_HUMAN/243-360QL.......IRS-LY---QSA---GVA.P-----------------E---------SFEYIEAH----------------
FAS_CHICK/243-360QL.......VGS-LY---REC---GIK.P-----------------G---------DVEYVEAH----------------
P91871_CAEEL/279-396QL.......LQE-VY---SEA---GID.P-----------------N---------SVYYVEAH----------------
WA_EMENI/634-754FI.......FKK-LL---NEA---NVD.P-----------------K---------NISYIEMH----------------
O54142_STRCO/811-926RA.......VRQ-AF---AQV---DFG.P-----------------D---------EVDYLEAH----------------
P71718_MYCTU/262-379RL.......LRR-AI---AQA---AVV.P-----------------A---------DVGMVEGH----------------
O65933_MYCTU/289-405RV.......IRA-AL---ASA---RLR.A-----------------V---------EVDVVEGH----------------
O53901_MYCTU/271-385AA.......YRE-AL---DVA---GVD.P-----------------A---------TVGMVEAH----------------
Q49933_MYCLE/296-416EL.......LRT-AL---ASS---KLT.A-----------------A---------DIDYIEAH----------------
O86335_MYCTU/354-472GV.......LEN-AC---KSA---RVD.P-----------------L---------EIGYVEAH----------------
O54155_STRCO/1041-1159AV.......MTG-AL---ERA---GVQ.P-----------------G---------QIDYVEAH----------------
Q18559_CAEEL/2133-2242ML.......LTS-VI---NQS---PSL..-----------------.---------AIDYWEAH----------------
O06586_MYCTU/230-347DV.......IRR-AM---SGA---GVD.C-----------------H---------QVHYVEAH----------------
PKSR_BACSU/1766-1891DA.......MLK-AY---QGA---QID.P-----------------K---------TVTYIEAH----------------
PKSM_BACSU/3776-3894EL.......I