Sequence alignment for CL0046

PF00195

CHS3_BROFI/3-229PAMEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITK-SEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKEN
2PS_GERHY/7-233DDVEVIREAGRAQGLATILAIGTATPPNCVAQADYADYYFRVTK-SEHMVDLKEKFKRICEKTAIKKRYLALTEDYLQEN
O82145_HYDMC/6-232VAVEEMCKAQKAGGPATILAIGTAVPSNCYYQSEYPDFYFRVTK-SDHLTDLKSKFKRMCERSSIKKRYMHLTEEILEEN
O23674_ARATH/11-236KLSSKSTRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTK-CDD.AFIKEKLEHLCKTTTVKTRYTVLTREILAKY
CHSD_PETHY/2-228VTVEEVRNAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITD-SEHKTELKEKFKRICDKSMIKKRYMHLTEKILKEN
O81305_ARATH/4-229SARVEKQKRVAYQGKATVLALGKALPSNVVSQENLVEEYLREIK-CDN.LSIKDKLQHLCKSTTVKTRYTVMSRETLHKY
VPS_HUMLU/4-230VTVEQIRKAQRAEGPATILAIGTAVPANCFNQADFPDYYFRVTK-SEHMTDLKKKFQRMCEKSTIKKRYLHLTEEHLKQN
CHSA_IPOPU/8-234LTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITN-SEHLLEHKEKFRRICNKSKIMKRHLVITEELLKKN
O24484_PINRA/9-234GVVAVKSRRQHRPGKTTAMAFGRAFPDQLVMQEFLVDGYFRNTN-CQD.PVLRQKLERLCKTTTVKTRYVVMSDEILAQH
O23811_ORYSA/9-234ARSGNGSRSQCSRGKAMLLALGKGLPEQVLPQEKVVETYLQDTI-CDD.PATRAKLERLCKTTTVRTRYTVMSKELLDEH
THS1_VITVI/2-228ASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTK-SEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEH
CHSF_PETHY/2-228VSVEEVRRAQRREGPATILAIGTATPLNCVDQTTYPDYFFRVTN-SDHKTELKEKFKRMFERSMIKKSYLHLTEEILKEN
CHS2_HORVU/4-230VRLKEVRMAQRAEGLATVLAIGTAVPANCVYQATYPDYYFRVTK-SEHLADLKEKFQRMCDKSMIRKRHMHLTEEILIKN
CHSB_PETHY/5-231NGQLQGWWAQRAEGPAKILAIGTATPFHWVDQNSYPDYYFRVTN-SQHLVDLKEKFRRICSKTMIKKRHMFLTEELLRKN
O22122_SCUBA/2-228VTVEEFHRATRAEGPATVLAIGTANPPNCVEQSTYADYYFRICK-SEHLTDLKKKFDRMCEKSCIKKRYMHLTEEFLKEN
CHS3_GERHY/8-234IDVETIRKAQRAEGPATILAIGTATPANCVYQADYPDYYFRVTE-SEHMVDLKEKFQRMCDKSMIRKRYMHITEEFLKEN
CHSG_PETHY/2-231ATVEEIRKAQRAEGPATVLAIGTANPSNCVDQSAYPDFLFRITT-SDHKTELKEKFKHMCEGSMIKKRYLHLTEEILKNN
CHSY_PINSY/7-233KDLEAFRKAQRADGPATILAIGTATPPNAVDQSSYPDYYFKITN-SEHMTELKEKFRRMCDKSAIKKRYMYLTEEILKEN
BBS_PHASS/2-228LSLESIKKAPRADGFASILAIGRANPDNIIEQSAYPDFYFRVTN-SEHLVDLKKKFQRICEKTAIRKRHFVWNEEFLTAN
THS1_ARAHY/2-228VSVSGIRKVQRAEGPATVLAIGTANPPNCVDQSTYADYYFRVTN-GEHMTDLKKKFQRICERTQIKNRHMYLTEEILKEN
DPS1_PINST/7-234IDLEAFRKSQRADGFASILAIGTANPPNVVDQSTYPDYYFRVTN-NEDNTDLKDKFKRICERSAIKKRHMYLTEEILKKN

PF08545

FABH_STRPQ/106-183--------------------------------------------------------------------------------
FABH1_VIBVU/106-183--------------------------------------------------------------------------------
O68915_9ACTO/119-188--------------------------------------------------------------------------------
Q7P488_FUSNV/107-185--------------------------------------------------------------------------------
O65985_THETR/112-190--------------------------------------------------------------------------------
Q63N14_BURPS/119-199--------------------------------------------------------------------------------
Q6MR21_BDEBA/112-191--------------------------------------------------------------------------------
Q7CTU0_AGRT5/109-187--------------------------------------------------------------------------------
FABH1_BACTN/110-188--------------------------------------------------------------------------------
FABH_YERPE/106-183--------------------------------------------------------------------------------
Q8ED66_SHEON/118-189--------------------------------------------------------------------------------
FABH3_STRCO/108-188--------------------------------------------------------------------------------
FABH_GLOVI/106-183--------------------------------------------------------------------------------
FABH2_DEIRA/113-191--------------------------------------------------------------------------------
Q8EDA9_SHEON/104-182--------------------------------------------------------------------------------
FABH_STRLI/115-192--------------------------------------------------------------------------------
Q8P810_XANCP/217-297--------------------------------------------------------------------------------
Q5FUN7_GLUOX/112-191--------------------------------------------------------------------------------
Q8XRP5_RALSO/110-188--------------------------------------------------------------------------------
FABH_THETN/110-188--------------------------------------------------------------------------------
FABH_CHLTE/107-186--------------------------------------------------------------------------------
Q7TTZ7_RHOBA/109-186--------------------------------------------------------------------------------
FABH2_BACAN/108-186--------------------------------------------------------------------------------
Q73Q42_TREDE/107-187--------------------------------------------------------------------------------
FABH_SPIOL/175-254--------------------------------------------------------------------------------
Q9A8B2_CAUCR/171-240--------------------------------------------------------------------------------
FABH_LISMF/106-184--------------------------------------------------------------------------------
Q67RA0_SYMTH/112-193--------------------------------------------------------------------------------
FABH_HELPY/109-188--------------------------------------------------------------------------------
Q72LL0_THET2/104-182--------------------------------------------------------------------------------
PQSD_PSEAE/107-188--------------------------------------------------------------------------------
FABH_CLOTE/108-185--------------------------------------------------------------------------------
FABH_SILPO/108-191--------------------------------------------------------------------------------
FABH_BARQU/107-191--------------------------------------------------------------------------------
FABH_PASMU/106-183--------------------------------------------------------------------------------
Q5WUL0_LEGPL/115-194--------------------------------------------------------------------------------
FABH_SYMTH/109-187--------------------------------------------------------------------------------
Q7NZ26_CHRVO/150-229--------------------------------------------------------------------------------
O04439_ALLPO/173-252--------------------------------------------------------------------------------
FABH_RHOCA/108-191--------------------------------------------------------------------------------
Q64Y53_BACFR/101-177--------------------------------------------------------------------------------
Q7NV97_CHRVO/105-183--------------------------------------------------------------------------------
FABH1_LACPL/108-188--------------------------------------------------------------------------------
Q820X4_COXBU/124-203--------------------------------------------------------------------------------
Q8RL75_PSEFL/107-186--------------------------------------------------------------------------------
FABH1_STRAW/116-193--------------------------------------------------------------------------------
FABH_PROMP/113-191--------------------------------------------------------------------------------
FABH_PSEAE/105-185--------------------------------------------------------------------------------
FABH_AQUAE/105-183--------------------------------------------------------------------------------
FABH_HELHP/110-189--------------------------------------------------------------------------------
FABH_CAUCR/106-189--------------------------------------------------------------------------------
FABH_BLOFL/106-183--------------------------------------------------------------------------------
FABH_RICCN/106-184--------------------------------------------------------------------------------
FABH2_STAES/108-186--------------------------------------------------------------------------------
FABH_METCA/108-185--------------------------------------------------------------------------------
Q577P4_BRUAB/109-185--------------------------------------------------------------------------------
FABH2_VIBPA/107-185--------------------------------------------------------------------------------
Q6A930_PROAC/116-193--------------------------------------------------------------------------------
Q74CS1_GEOSL/106-184--------------------------------------------------------------------------------
Q6FAK4_ACIAD/154-233--------------------------------------------------------------------------------
FABH_BRAJA/109-193--------------------------------------------------------------------------------
Q8DBH1_VIBVU/106-187--------------------------------------------------------------------------------
FABH_SHEON/106-183--------------------------------------------------------------------------------
FABH_CLOAB/106-183--------------------------------------------------------------------------------
Q9K3G9_STRCO/109-186--------------------------------------------------------------------------------
Q73S66_MYCPA/111-193--------------------------------------------------------------------------------
Q81RV7_BACAN/105-186--------------------------------------------------------------------------------
Q5YNV7_NOCFA/117-194--------------------------------------------------------------------------------
Q93H15_STRAW/88-168--------------------------------------------------------------------------------
FABH_NEIG1/108-185--------------------------------------------------------------------------------
FABH_ANAMM/107-189--------------------------------------------------------------------------------
Q6MAF5_PARUW/110-188--------------------------------------------------------------------------------
Q82PP5_STRAW/108-187--------------------------------------------------------------------------------
FABH2_LACPL/107-188--------------------------------------------------------------------------------
FABH_EHRRG/107-186--------------------------------------------------------------------------------
FABH2_STRCO/112-192--------------------------------------------------------------------------------
Q7U427_SYNPX/113-191--------------------------------------------------------------------------------
FABH_PHOLL/106-183--------------------------------------------------------------------------------
Q9KHD3_STRGR/140-219--------------------------------------------------------------------------------
Q8L2P3_PSEFL/107-183--------------------------------------------------------------------------------
Q5X5H2_LEGPA/108-187--------------------------------------------------------------------------------
FABH4_STRCO/108-188--------------------------------------------------------------------------------
FABH_TROWT/107-184--------------------------------------------------------------------------------
FABHL_CAMJE/116-191--------------------------------------------------------------------------------
Q66B09_YERPS/117-195--------------------------------------------------------------------------------
FABH_WOLTR/107-194--------------------------------------------------------------------------------
FABH_NOSS1/108-185--------------------------------------------------------------------------------
FABH_DESVH/108-177--------------------------------------------------------------------------------
FABH_STRT2/106-183--------------------------------------------------------------------------------
Q9I4X1_PSEAE/123-201--------------------------------------------------------------------------------
Q7M7Z5_WOLSU/107-186--------------------------------------------------------------------------------
FABH_PORGI/110-188--------------------------------------------------------------------------------
Q5QWT4_IDILO/106-184--------------------------------------------------------------------------------
Q6MLJ5_BDEBA/110-190--------------------------------------------------------------------------------
Q5NL87_ZYMMO/111-190--------------------------------------------------------------------------------
Q98K75_RHILO/87-167--------------------------------------------------------------------------------
FABH1_DEIRA/107-185--------------------------------------------------------------------------------
FABH_PROMA/113-191--------------------------------------------------------------------------------
Q5WEX8_BACSK/106-184--------------------------------------------------------------------------------
FABH_MYCPA/116-193--------------------------------------------------------------------------------
FABH_NITEU/106-183--------------------------------------------------------------------------------
Q74GF6_GEOSL/107-185--------------------------------------------------------------------------------
FABH_HAEIN/106-183--------------------------------------------------------------------------------
Q62FY9_BURMA/115-194--------------------------------------------------------------------------------
Q8GE37_HELMO/110-188--------------------------------------------------------------------------------
FABH_AGRT5/107-190--------------------------------------------------------------------------------
FABH5_STRCO/105-185--------------------------------------------------------------------------------
Q847B9_NODSP/110-191--------------------------------------------------------------------------------
Q885B9_PSESM/110-188--------------------------------------------------------------------------------
Q63PP7_BURPS/122-199--------------------------------------------------------------------------------
FABH_STRMU/106-183--------------------------------------------------------------------------------
FABH_SYNP6/111-188--------------------------------------------------------------------------------
FABH_LACLA/106-184--------------------------------------------------------------------------------
FABH_STRPN/106-183--------------------------------------------------------------------------------
Q97KV2_CLOAB/114-194--------------------------------------------------------------------------------
Q8F686_LEPIN/117-195--------------------------------------------------------------------------------
FABH_STAEQ/106-184--------------------------------------------------------------------------------
FABH_CHRVO/107-184--------------------------------------------------------------------------------
FABH1_BACCR/106-184--------------------------------------------------------------------------------
O30202_ARCFU/103-177--------------------------------------------------------------------------------
FABH_AROAE/109-186--------------------------------------------------------------------------------
Q64Y55_BACFR/113-190--------------------------------------------------------------------------------
FABH_MYCBO/116-193--------------------------------------------------------------------------------
Q5KSM6_9ACTO/107-185--------------------------------------------------------------------------------
FABH_SYNY3/110-187--------------------------------------------------------------------------------
Q8KE19_CHLTE/7-93--------------------------------------------------------------------------------
FABH2_BACSU/107-185--------------------------------------------------------------------------------
FABH_RALSO/114-191--------------------------------------------------------------------------------
FABH_CLOPE/106-184--------------------------------------------------------------------------------
FABH_PORPU/105-182--------------------------------------------------------------------------------
Q9EV93_CLOST/253-336--------------------------------------------------------------------------------
Q8KND4_MICEC/107-187--------------------------------------------------------------------------------
Q7P5B4_FUSNV/90-168--------------------------------------------------------------------------------
Q7B6G5_STRHY/115-192--------------------------------------------------------------------------------
Q6LQM2_PHOPR/106-184--------------------------------------------------------------------------------
FABH_CAMJE/108-185--------------------------------------------------------------------------------
Q5YPR0_NOCFA/115-192--------------------------------------------------------------------------------
FABH_COXBU/109-186--------------------------------------------------------------------------------
Q63N13_BURPS/108-189--------------------------------------------------------------------------------
Q82KT2_STRAW/108-188--------------------------------------------------------------------------------
Q65LQ9_BACLD/110-188--------------------------------------------------------------------------------
Q982F9_RHILO/108-186--------------------------------------------------------------------------------
Q81JE9_BACAN/109-187--------------------------------------------------------------------------------
Q5NF70_FRATT/108-185--------------------------------------------------------------------------------
FABH_PROMM/113-192--------------------------------------------------------------------------------
Q6AET2_LEIXX/120-197--------------------------------------------------------------------------------
Q7NZW4_CHRVO/106-186--------------------------------------------------------------------------------
Q6AQA3_DESPS/118-189--------------------------------------------------------------------------------
FABH_GRATL/107-186--------------------------------------------------------------------------------
FABH_CHLPN/114-193--------------------------------------------------------------------------------
FABH_DESPS/106-184--------------------------------------------------------------------------------
FABH_XANCP/110-187--------------------------------------------------------------------------------
Q767G6_9ACTO/120-198--------------------------------------------------------------------------------
Q8RC81_THETN/108-187--------------------------------------------------------------------------------
Q5YNJ2_NOCFA/116-193--------------------------------------------------------------------------------
Q67MB7_SYMTH/116-197--------------------------------------------------------------------------------
FABH_CHLMU/106-185--------------------------------------------------------------------------------
Q5QZ39_IDILO/107-184--------------------------------------------------------------------------------
Q884Y8_PSESM/108-185--------------------------------------------------------------------------------
Q9KHD4_STRGR/142-220--------------------------------------------------------------------------------
FABH2_BACHD/109-187--------------------------------------------------------------------------------
Q5X356_LEGPA/131-209--------------------------------------------------------------------------------
Q5X4S4_LEGPA/109-187--------------------------------------------------------------------------------
Q7KWI9_PLAF7/153-231--------------------------------------------------------------------------------
Q65LD5_BACLD/106-184--------------------------------------------------------------------------------
FABH_ENTFA/107-184--------------------------------------------------------------------------------
Q8RC85_THETN/112-193--------------------------------------------------------------------------------
Q93HA0_STRAW/106-185--------------------------------------------------------------------------------
FABH_OCEIH/106-184--------------------------------------------------------------------------------
FABH_THEEB/108-185--------------------------------------------------------------------------------

PF08392

Q9FW59_ORYSJ/25-322ARSRRRR.....CYLLDYVCYKATDDRKLPTDLCGEIIQRNKLL.GLEE.........YKFLLKVIVNSGIGEETYGPRN
KCS3_ARATH/23-313IDSKRDQ.N...CYILDYQCHKPSDDRMVNTQFSGDIILRNKHL.RLNE.........YKFLLKAIVSSGIGEQTYAPRL
Q8RXA6_TROMA/89-378YFLTRPT.P...VYLLNFSCYKPDAIHKCDRRRFMDTIRGMGTY.TEEN.........IEFQRKVLERSGIGESSYLPPT
KCS11_ARATH/92-381YFMTRPR.P...VYLVNFSCFKPDESRKCTKKIFMDRSKLTGSF.TEEN.........LEFQRKILQRSGLGESTYLPEA
KCS16_ARATH/71-366YLMTRPK.P...VYLVDFSCYLPPSHLKASTQRIMQHVRLVREA.GAWKQES...DYLMDFCEKILERSGLGQETYVPEG
O23738_BRANA/70-368YIATRPK.P...VYLVEYSCYLPPTHCRSSISKVMDIFYQVRKA.DPSRNGTCDDSSWLDFLRKIQERSGLGDETHGPEG
KCS2_ARATH/74-363FFMSRPR.S...IYLLDYSCYLPPSSQKVSYQKFMNNSSLIQDF.SETS.........LEFQRKILIRSGLGEETYLPDS
Q84K36_TROMA/115-405YFMSRPR.S...IYLIDFACYRAHDDLKVTKAEFIEQARKSGKF.DEAS.........LDFQQRILESSGIGDETYIPKS
Q75M74_ORYSJ/23-315AAARRRQSR...CYLLDYVCHKPSDDRKVSTEAAGAVIERSKRL.SLPE.........YRFLLRVIVRSGIGEETYAPRN
KCS14_ARATH/52-334YSTTRSK.P...VYLVDFSCHQPTDSCKISSETFFNMAKGAQLY.TEET.........IQFMTRILNRSGLGDDTYSPRC
Q41301_SIMCH/101-390HFLTRPR.N...VYLVDFACYKPHPNLITSHEMFMDRTSRAGSF.SKEN.........IEFQRKILERAGMGRETYVPKS
Q650T5_ORYSJ/56-349LYRSRRRAAAARVGLVDFACLRPPPRLRIPVAGLLEHFKLIGCF.DDGS.........VEFMTKVIEASGMGNETYFPPS
Q7XZE7_MARPO/111-400YVMSRPR.P...VYLVDYACHLPAENTRVKFSLFMDHSEKSGFF.DERA.........LEFQRKILERSGLGEETHLPVS
Q9FV67_LIMDO/93-382YFMTRPR.P...VYLMDFACYKPDETRKSTREHFMKCGESLGSF.TEDN.........IDFQRKLVARSGLGDATYLPEA
Q6DUV5_BRANA/114-403YVTNRSK.P...VYLVDFSCYKPEDERKMSVDSFLKMTEQNGAF.TDDT.........VQFQQRISNRAGLGDETYFPRG
Q6K3E6_ORYSJ/23-314AAARRRRAT...CYLLDYACHKPSDDRKVTTELAGAIIERNKRL.GLPE.........YRFLLKVIVNSGIGEHTYSPRN
Q688V9_ORYSJ/93-381YVLTRPR.P...VYLVDFACYKPPDKLKVRFDEFLHHSKLC.GF.SDDC.........LEFQRKILERSGLSEETYVPEA
Q5Z6R6_ORYSJ/79-372RLVRRPH.S...VYLVDYACFRPQPSNRLPFATFAEHFRLSPHI.DDGS.........FRFVTRMMERSGLGERTYVPRG
Q8H7L2_ORYSJ/167-457YIMSRPR.P...VYLIDFACYKPADELKVSKAEFIDLARKSGKF.DEDS.........LAFQSRLLAKSGIGDESYMPRC
KCS7_ARATH/38-328YYFFKPRCI...IYLIDFSCYQPPDFLRAPVSNFIEHLTISGVF.DQES.........LDLQQKILERSGISDDASVPAT
Q8LQT7_ORYSJ/61-349VRARRAR.G...VYLVEYGCFRPRPCYRAPFATCLEHAHLMPYLVDEES.........VAFAIRLLERSGLGDETCVPDA
Q6Z6C7_ORYSJ/95-384RFLTRPR.P...VYLVDFACYKPPPERRCSRDAFMRCSRLAGCF.TAAS.........LDFQRRIVERSGLGDDTYLPAA
KCS20_ARATH/42-333YQRIRTRVK...VYLLDFTCYRAPDSNRVPMSTLIETIYLDDKL.DQES.........IDFQARILERSWLSNQTSIPRS
Q84VI8_MARPO/119-408YFMSRPH.P...VYLVDFACYKPIDERKVTREIFMECSRITGNF.NEKS.........LEFQRKILERSGLGQDTYLPPA
Q9XEP1_SORBI/93-380YLMRRPR.A...VYLLDLACYKPGAEHAVTRETFMRLVVGYGTF.SDDS.........LAFQRKILERSGLGQGTYLPKA
Q7XZE8_MARPO/116-405YFMSRPR.P...VYLVEFACYRPDERLKVSKDFFLDMSRRTGLF.SSSS.........MDFQTKITQRSGLGDETYLPPA
Q7XT16_ORYSJ/77-368WRARRRRGG...VYLVDYGCFLGEPRHRVPFATALEHGRLMTNLLDEES.........TNFMVRLHAKSGIGEETSVPDS
Q670P4_LESFE/67-364YFLTRPR.P...VYLVDYSCHLPPPHQKITVKKIVENVNKNREL.DASHNSKI.PESSLDFVLRLLERSGLGEETYIPDS
Q6K558_ORYSJ/43-332VLRRRRR.P...VYLLNYSCHLPDVDRKVNLEVCEYFGQRCRHY.SDDT.........ADFMRLIYRKSGLGQETYAPPF
Q93XD5_LESFE/69-366YIVTKPK.Q...IYLVDYSCYLPPDHLKVSISSVMDIFYELRKV.DPLCEVGC.DDSSLEFMRKVLERSGLGDETYVPLG
KCS21_ARATH/24-318VFKRRNQRN...CYMLHYECYKGMEERKLDTETCAKVVQRNKNL.GLEE.........YRFLLRTMASSGIGEETYGPRN
Q6F365_ORYSJ/100-389YFLTRPR.P...VYLVDFACYKPDDERKCSRARFMNCTERLGTF.TPEN.........VEFQRKIIERSGLGEDTYLPEA
Q6TMJ4_DICDI/114-404FLSKRRR.E...VYLVDFSVFQPPEQYKISHEFFVEHTKSVGWF.DQDS.........VDFQTKLLYRTGLGNETYFPAG
Q75M84_ORYSJ/26-319AASRRRGMR...CYLLDYVCYKPADDLTLTTELACAIVQRNERL.GIPE.........FRFLVRLISRTGLGDRTYAPRN
Q5Z6S3_ORYSJ/79-368YLVMRPR.A...VYLVDYACFRTAPNCRVPFATFLEHARQVPTL.TERS.........VRFMTRLLERSGLGEETCLPPA
Q7XEM4_ORYSJ/93-383YAASRPR.P...VYLIDLAGYKAPREHEASRAKTIAHFGRCGRF.SGES.........MAFQKRMLERSGLGEATHFPTS
O81658_HEMSP/97-387YYTRRPR.P...VYLVDFACYKPEDEHKISNEGFLEMTESTTAF.NDKS.........LDFQTKITVRSGLGDETYLPPG

PF01154

HMCS1_RAT/13-186--------------------------------------------------------------------------------
HMCS2_RAT/50-223--------------------------------------------------------------------------------
HMCS2_BLAGE/4-176--------------------------------------------------------------------------------
HMCS_YEAST/45-216--------------------------------------------------------------------------------

PF02797

THS1_VITVI/238-388-------------------------------------------QLVSAAQTFIPNSAGAIAGNLREVGLTFHLWPNVPT-
O81305_ARATH/238-383-------------------------------------------ELHCAMQQFLPQTQGVIDGRLSEEGITFKLGRDLPQ-
O23811_ORYSA/244-389-------------------------------------------ELQFSTQEFLPGTDKVIDGKITEEGINFKLGRDLPE-
CHSF_PETHY/238-388-------------------------------------------ELVSAAQTLVPDCGHKIYGKTSDVGLTFHLHKDVPR-
CHSG_PETHY/241-391-------------------------------------------ELVFATQTLIPDSGHVICANLTEAGLIPHLLKDAPI-
CHSA_IPOPU/244-394-------------------------------------------ELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPS-
CHS3_BROFI/239-389-------------------------------------------QLVSASQTILPESEGAIDGHLREIGLTFHLLKDVPG-
O23674_ARATH/245-393-------------------------------------------ELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQ-
O22122_SCUBA/238-388-------------------------------------------QLVSAAQTILPDSEGAIDGHVREVGLTFHLLKDVPG-
O24484_PINRA/245-390-------------------------------------------ELDWAVQQFLPDTHGTINGRLTEEGINFKLGRELPQ-
BBS_PHASS/239-389-------------------------------------------VIVSTSQVLLPDSAGAIGGHVSEGGLLATLHRDVPQ-
VPS_HUMLU/241-391-------------------------------------------ELVSAAQTILPNSDGAIAGHVTEAGLTFHLLRDVPG-
DPS1_PINST/244-394-------------------------------------------EIVWTAQTVVPNSDGAISGKLREVGLTFQLKGAVPD-
CHS2_HORVU/240-390-------------------------------------------QLVSASQTILPESEGAIDGHLTEAGLTIHLLKDVPG-
CHSB_PETHY/241-391-------------------------------------------EIFSAAQTFVPNGDCHLALHLREMGLTFHCTKDVPP-
CHS3_GERHY/244-394-------------------------------------------EMVSAAQTILPDSEGAIDGHLKEVGLTFHLLKDVPA-
CHSD_PETHY/238-388-------------------------------------------ELVSAAQTLLPDSKNSICGELREIGLTFHLLKDVAE-
O82145_HYDMC/242-398-------------------------------------------QIMSASQIIVADSEGAIDGHLRQEGLTFHLRKDVPS-
2PS_GERHY/243-393-------------------------------------------EIVSTDQTILPDTEKAMKLHLREGGLTFQLHRDVPL-
CHSY_PINSY/243-393-------------------------------------------ELMWTAQTILPDSDGAIDGHLREVGLTFHLLKDVPG-
THS1_ARAHY/238-388-------------------------------------------EIVSTDQQLVPNSHGAIGGLLREVGLTFYLNKSVPD-

PF08541

Q7CTU0_AGRT5/239-328-------------------------------------------------------------------------LHEA.E-
FABH_PROMM/246-335-------------------------------------------------------------------------LKAT.N-
Q73Q42_TREDE/222-311-------------------------------------------------------------------------LQKE.N-
FABH_PSEAE/233-322-------------------------------------------------------------------------LDRV.G-
FABH_CHRVO/230-319-------------------------------------------------------------------------LAEA.G-
Q6RC13_MYCUL/216-307-------------------------------------------------------------------------LEEA.Q-
FABH_DESVH/241-330-------------------------------------------------------------------------LARN.G-
FABH_LISMF/221-310-------------------------------------------------------------------------LERA.G-
Q5YPR0_NOCFA/241-333-------------------------------------------------------------------------IAAAGG-
FABH2_STRCO/230-319-------------------------------------------------------------------------AAHA.G-
Q5KSM6_9ACTO/237-326-------------------------------------------------------------------------LHKC.G-
Q5WEX8_BACSK/220-309-------------------------------------------------------------------------LSKA.G-
FABH_NOSS1/239-328-------------------------------------------------------------------------LFEA.Q-
Q67RA0_SYMTH/248-336-------------------------------------------------------------------------CAQG.G-
Q5NF70_FRATT/234-323-------------------------------------------------------------------------IQEA.G-
Q7M7Z5_WOLSU/238-327-------------------------------------------------------------------------LERN.H-
FABH2_VIBPA/235-324-------------------------------------------------------------------------LKAS.Q-
Q847B9_NODSP/248-337-------------------------------------------------------------------------LQKS.G-
Q7NZ26_CHRVO/282-372-------------------------------------------------------------------------LGSL.D-
FABH_AQUAE/220-309-------------------------------------------------------------------------LEKA.G-
FABH1_STRAW/264-354-------------------------------------------------------------------------LDAA.G-
FABH_TROWT/231-321-------------------------------------------------------------------------LDIN.Q-
Q63N14_BURPS/258-347-------------------------------------------------------------------------LRKT.G-
FABH_HELHP/239-328-------------------------------------------------------------------------LNTH.H-
Q8PJG1_XANAC/243-332-------------------------------------------------------------------------LHEA.G-
FABH3_STRCO/240-329-------------------------------------------------------------------------LDRA.G-
FABH_PROMP/245-334-------------------------------------------------------------------------FKKT.N-
Q65LQ9_BACLD/237-326-------------------------------------------------------------------------LAQA.E-
FABH_CLOAB/234-323-------------------------------------------------------------------------IEDS.G-
FABH_AROAE/232-321-------------------------------------------------------------------------LDQA.G-
Q7X5N4_PSEAI/289-378-------------------------------------------------------------------------LDYA.G-
FABH_ARATH/314-403-------------------------------------------------------------------------LQKA.G-
FABH_STRPN/233-324-------------------------------------------------------------------------IDES.P-
Q5FUN7_GLUOX/235-324-------------------------------------------------------------------------LEAN.G-
Q93KW7_STRVR/244-335-------------------------------------------------------------------------LAGA.G-
Q9L1V9_STRCO/246-337-------------------------------------------------------------------------LAEA.G-
Q8GHC0_9ACTO/249-339-------------------------------------------------------------------------LHEA.G-
Q8DBH1_VIBVU/241-329-------------------------------------------------------------------------FCSS.P-
Q67G55_9ACTO/244-335-------------------------------------------------------------------------LSDA.G-
Q63CM4_BACCZ/243-331-------------------------------------------------------------------------LRKS.G-
FABH2_STRAW/225-314-------------------------------------------------------------------------CERA.G-
O34266_XANCA/346-435-------------------------------------------------------------------------LRDA.G-
Q87XT2_PSESM/282-372-------------------------------------------------------------------------LQDN.G-
Q884Y8_PSESM/221-307-------------------------------------------------------------------------LSES.D-
FABH_STRT1/232-320-------------------------------------------------------------------------LVE...-
Q93HA0_STRAW/239-330-------------------------------------------------------------------------CAQA.D-
FABH2_LACPL/239-328-------------------------------------------------------------------------LMQA.R-
FABH2_BACSU/234-323-------------------------------------------------------------------------LHKA.G-
Q767G6_9ACTO/250-339-------------------------------------------------------------------------LKDA.G-
FABH_SILPO/234-323-------------------------------------------------------------------------LDKA.G-
FABH_HAEDU/227-316-------------------------------------------------------------------------LQAN.N-
Q7TTZ7_RHOBA/241-330-------------------------------------------------------------------------LTEN.G-
Q64Y53_BACFR/237-323-------------------------------------------------------------------------MKIT.D-
FABH_RHOBA/256-345-------------------------------------------------------------------------LRAA.N-
Q7NV97_CHRVO/234-323-------------------------------------------------------------------------MDAT.P-
Q5ZV11_LEGPH/238-327-------------------------------------------------------------------------FAKA.S-
Q97KV2_CLOAB/245-334-------------------------------------------------------------------------LKKN.N-
Q8XTB9_RALSO/282-372-------------------------------------------------------------------------LQAL.G-
Q6A930_PROAC/241-331-------------------------------------------------------------------------IAEA.G-
FABH_STRLI/241-331-------------------------------------------------------------------------LEVA.G-
FABH_SYNP6/242-331-------------------------------------------------------------------------LFHA.G-
Q8ED66_SHEON/250-340-------------------------------------------------------------------------LAEQ.S-
Q5SL76_THET8/230-319-------------------------------------------------------------------------IEKA.G-
Q7P488_FUSNV/237-326-------------------------------------------------------------------------LEKA.K-
Q9KHD3_STRGR/256-345-------------------------------------------------------------------------LARS.G-
Q7N8H1_PHOLL/221-311-------------------------------------------------------------------------LQQA.D-
Q6MLJ5_BDEBA/242-331-------------------------------------------------------------------------LEHN.K-
FABH2_VIBVY/235-324-------------------------------------------------------------------------LAHA.G-
Q82PP5_STRAW/243-333-------------------------------------------------------------------------LSEA.Q-
FABH_PORPU/236-325-------------------------------------------------------------------------LNDV.N-
FABH_PROMA/245-334-------------------------------------------------------------------------LQTY.G-
O68915_9ACTO/245-335-------------------------------------------------------------------------LRES.G-
FABH_BLOFL/229-318-------------------------------------------------------------------------LHAN.N-
Q8RHZ0_FUSNN/221-309-------------------------------------------------------------------------LENN.N-
Q7X8V9_ORYSJ/337-426-------------------------------------------------------------------------LEEA.G-
Q93H15_STRAW/220-309-------------------------------------------------------------------------LSRA.G-
FABH_CHLCV/243-332-------------------------------------------------------------------------IAEA.G-
FABH_CLOTE/244-333-------------------------------------------------------------------------LKDS.N-
Q88ES4_PSEPK/221-308-------------------------------------------------------------------------LDAS.G-
Q88EC1_PSEPK/299-389-------------------------------------------------------------------------LQEN.G-
FABH_THETN/240-329-------------------------------------------------------------------------LERC.G-
FABH_STRMU/234-325-------------------------------------------------------------------------IRKS.D-
FABH1_BACAN/219-308-------------------------------------------------------------------------LDKA.G-
FABH_STRP1/233-324-------------------------------------------------------------------------MAQS.D-
FABH_SYNY3/241-330-------------------------------------------------------------------------LFKA.Q-
Q64RC8_BACFR/240-327-------------------------------------------------------------------------IERN.Q-
FABH_LACLA/234-325-------------------------------------------------------------------------LEKA.N-
Q64NV1_BACFR/240-327-------------------------------------------------------------------------AEKN.G-
FABH5_STRCO/237-326-------------------------------------------------------------------------LDRT.G-
Q5YN70_NOCFA/251-341-------------------------------------------------------------------------CDRL.G-
FABH_BRUME/234-323-------------------------------------------------------------------------FEAT.G-
FABH2_BACHD/236-325-------------------------------------------------------------------------LEKA.A-
Q5YNJ2_NOCFA/253-343-------------------------------------------------------------------------LEVS.G-
FABH_CHLPN/245-334-------------------------------------------------------------------------IALA.G-
Q885B9_PSESM/249-338-------------------------------------------------------------------------LFDD.E-
Q82HI7_STRAW/252-343-------------------------------------------------------------------------IEDA.G-
Q6FAK4_ACIAD/280-370-------------------------------------------------------------------------LEKN.Q-
Q8VWB0_9ACTO/262-353-------------------------------------------------------------------------LAAA.G-
Q6DAZ3_ERWCT/249-337-------------------------------------------------------------------------LDAS.G-
FABH_SYMTH/239-328-------------------------------------------------------------------------VEKA.G-
Q8CV20_OCEIH/48-137-------------------------------------------------------------------------LERN.K-
Q9HYV7_PSEAE/259-349-------------------------------------------------------------------------LAAN.E-
Q5HTA7_CAMJR/252-338-------------------------------------------------------------------------LEFS.K-
FABH_GEOKA/219-308-------------------------------------------------------------------------LEKA.G-
FABH2_VIBCH/235-324-------------------------------------------------------------------------LARS.G-
Q6AQA3_DESPS/255-342-------------------------------------------------------------------------FAAP.G-
FABH1_LACPL/238-323-------------------------------------------------------------------------IASA.Q-
Q9KHD4_STRGR/257-346-------------------------------------------------------------------------LERN.G-
FABH_CHLMU/237-326-------------------------------------------------------------------------ITEA.G-
Q64Y55_BACFR/251-340-------------------------------------------------------------------------LEKL.Q-
Q8EDA9_SHEON/231-320-------------------------------------------------------------------------LEKC.G-
Q6LQM2_PHOPR/234-323-------------------------------------------------------------------------LHRA.E-
Q63PP7_BURPS/254-343-------------------------------------------------------------------------LAFA.N-
FABH_COXBU/230-319-------------------------------------------------------------------------IEKS.G-
Q8KND4_MICEC/245-336-------------------------------------------------------------------------LAEA.G-
FABH_ANAMM/233-322-------------------------------------------------------------------------LESS.A-
FABH2_BACAN/235-324-------------------------------------------------------------------------LHTA.N-
Q5NL87_ZYMMO/234-323-------------------------------------------------------------------------LTAS.G-
FABH_RHOCA/235-324-------------------------------------------------------------------------LAKA.G-
FABH_THEEB/239-328-------------------------------------------------------------------------LHRA.G-
Q5LUY4_SILPO/282-372-------------------------------------------------------------------------MAAE.G-
FABH1_STAES/222-311-------------------------------------------------------------------------VEKA.G-
Q98AW4_RHILO/238-327-------------------------------------------------------------------------LAAA.R-
Q8FHY5_ECOL6/258-346-------------------------------------------------------------------------LQKS.S-
Q6AET2_LEIXX/245-335-------------------------------------------------------------------------LDAA.G-
Q81JE9_BACAN/240-329-------------------------------------------------------------------------LMDT.G-
Q6MR21_BDEBA/243-332-------------------------------------------------------------------------LDRI.Q-
FABH_STRA5/232-323-------------------------------------------------------------------------IETS.Y-
Q5QZ39_IDILO/231-320-------------------------------------------------------------------------LAEN.Q-
FABH_BORPE/239-328-------------------------------------------------------------------------CAEA.G-
Q74CS1_GEOSL/236-325-------------------------------------------------------------------------LDAN.G-
FABH_NITEU/229-318-------------------------------------------------------------------------LQAN.Q-
FABH_WOLTR/237-326-------------------------------------------------------------------------LRCN.N-
Q98K75_RHILO/223-313-------------------------------------------------------------------------LAEH.G-
Q9K3G9_STRCO/229-319-------------------------------------------------------------------------LEAA.G-
FABH_GLOVI/237-326-------------------------------------------------------------------------LAAC.G-
Q5WUL5_LEGPL/257-346-------------------------------------------------------------------------LLPT.D-
Q8EG66_SHEON/260-347-------------------------------------------------------------------------LAQR.N-
Q63PP9_BURPS/255-344-------------------------------------------------------------------------LALA.G-
Q7NZW4_CHRVO/228-317-------------------------------------------------------------------------LDAL.G-
Q8RC85_THETN/250-338-------------------------------------------------------------------------LRKS.G-
Q6MAF5_PARUW/240-329-------------------------------------------------------------------------LVRA.E-
FABH_EHRRG/230-319-------------------------------------------------------------------------LNKN.N-
Q5QWT4_IDILO/232-321-------------------------------------------------------------------------FQET.G-
Q67MB7_SYMTH/254-342-------------------------------------------------------------------------AEQS.G-
Q8CL25_YERPE/90-178-------------------------------------------------------------------------LEKS.G-
FABH1_DEIRA/233-322-------------------------------------------------------------------------LQKS.G-
Q9I4X1_PSEAE/253-342-------------------------------------------------------------------------LEKA.G-
Q7B6G5_STRHY/240-330-------------------------------------------------------------------------LDAA.G-
FABH_GRATL/239-328-------------------------------------------------------------------------LNAL.H-
FABH1_VIBCH/227-316-------------------------------------------------------------------------LKAN.N-
O77078_PLAFA/282-371-------------------------------------------------------------------------IQHS.N-
Q73S66_MYCPA/245-335-------------------------------------------------------------------------CDRI.G-
FABH_HELPJ/239-328-------------------------------------------------------------------------LEKN.A-
FABH_NEIG1/231-320-------------------------------------------------------------------------IEEA.G-
Q63N13_BURPS/243-332-------------------------------------------------------------------------LDKH.R-
FABH2_STAES/235-324-------------------------------------------------------------------------LNQS.N-
FABH_ERWCT/228-317-------------------------------------------------------------------------LQAA.Q-
Q8FWG7_BRUSU/237-326-------------------------------------------------------------------------LASA.A-
FABH_CLOPE/235-324-------------------------------------------------------------------------LEKE.N-
Q820X4_COXBU/239-326-------------------------------------------------------------------------LSKRNA-
FABH_PORGI/240-327-------------------------------------------------------------------------MERN.N-
Q72KF2_THET2/241-329-------------------------------------------------------------------------LEEA.G-
FABH_BARQU/235-324-------------------------------------------------------------------------FAAA.G-
FABH_CAMJR/230-319-------------------------------------------------------------------------LAKN.N-
Q82NC9_STRAW/244-334-------------------------------------------------------------------------CRRL.G-
FABH_RHIME/234-323-------------------------------------------------------------------------FEAT.G-
FABH_RALSO/237-326-------------------------------------------------------------------------LALA.E-
Q5ZTD0_LEGPH/246-335-------------------------------------------------------------------------LKEL.N-
Q82KT2_STRAW/240-329-------------------------------------------------------------------------AELA.D-
Q8GE37_HELMO/240-329-------------------------------------------------------------------------LEIA.D-
Q8F686_LEPIN/233-322-------------------------------------------------------------------------LEKN.G-
FABH_RICTY/228-317-------------------------------------------------------------------------LHAN.Q-
Q54816_STRPE/249-340-------------------------------------------------------------------------LEAA.G-
FABH_OCEIH/221-310-------------------------------------------------------------------------IEQL.G-
FABH_SHEON/230-319-------------------------------------------------------------------------LRLN.N-
FABH_DESPS/235-324-------------------------------------------------------------------------MEEV.G-
FABH_XANCP/236-325-------------------------------------------------------------------------LAAN.G-
FABH_CHLTE/239-328-------------------------------------------------------------------------MQRN.N-
Q5ZVP7_LEGPH/228-317-------------------------------------------------------------------------LEAS.H-
FABH_BURPS/240-329-------------------------------------------------------------------------LSKA.E-
FABH_MYCBO/242-332-------------------------------------------------------------------------MDAA.G-
Q8RC81_THETN/237-325-------------------------------------------------------------------------VEKA.G-
Q5YNV7_NOCFA/248-338-------------------------------------------------------------------------IDRA.G-
FABH_METCA/232-321-------------------------------------------------------------------------LEQN.G-
FABH2_DEIRA/239-328-------------------------------------------------------------------------MRQA.G-
PQSD_PSEAE/242-329-------------------------------------------------------------------------LAAH.E-

PF02803

FADA_PSEFR/265-390-----------------------------------------LEPLAVIRSMAVAGVDP.AIMGYGPVPATQKALKRA-G-
THIL_ZOORA/269-391-----------------------------------------IQPLGRIVSWATVGVDP.KVMGTGPIPASRKALERA-G-
THIL_YEAST/274-397-----------------------------------------LKPLAIIKGWGEAAHQP.ADFTWAPSLAVPKALKHA-G-
THIB_CANTR/274-396-----------------------------------------LKPLAKISGWGEAARTP.FDFTIAPALAVPKAVKHA-G-
FADA_ECOLI/261-386-----------------------------------------LKPRARVRSMAVVGCDP.SIMGYGPVPASKLALKKA-G-
YKA3_CAEEL/305-445-----------------------------------------YKPKAYLRDYLYVAQDPKDQLLLSPAYVIPKLLDKA-G-
THIL_HUMAN/306-426-----------------------------------------VTPLARIVAFADAAVEP.IDFPIAPVYAASMVLKDV-G-
THLA_CLOAB/269-391-----------------------------------------VKPLAKIVSYGSAGVDP.AIMGYGPFYATKAAIEKA-G-
ATOB_ECOLI/270-392-----------------------------------------LTPLARIKSYASGGVPP.ALMGMGPVPATQKALQLA-G-
THL_BACSU/270-392-----------------------------------------KRPLATILGFSTTGMPA.HELAAAPGFAINKLLKKN-G-
THIL_CUPNH/270-392-----------------------------------------LTPLATIKSYANAGVDP.KVMGMGPVPASKRALSRA-E-
THIM_HUMAN/273-395-----------------------------------------FTPLARIVGYFVSGCDP.SIMGIGPVPAISGALKKA-G-
THIKA_RAT/298-421-----------------------------------------LPILGVLRSYAVVGVPP.DIMGIGPAYAIPAALQKA-G-
YQEF_ECOLI/269-391-----------------------------------------LPVLARIRAFASVGVDP.ALMGIAPVYATRRCLERV-G-
THIK_YEAST/296-416-----------------------------------------LPVLGRYIDFQTVGVPP.EIMGVGPAYAIPKVLEAT-G-
THIKA_CANTR/287-407-----------------------------------------YPIIGKYVLCSTAGVPP.EIMGVGPAYAIPEVLKRT-G-
FADA4_MYCLE/270-392-----------------------------------------LTWLVEIGAHGVVAGPD.STLQSQPANAIKKAVDRE-G-
THIL_PARDE/268-390-----------------------------------------LTPLARIASYATAGVDP.QIMGTGPIPASRKALEKA-G-
THIL_THIVI/271-393-----------------------------------------LTPMARLVAFSSAGVDP.AIMGTGPIPASTDCLKKA-G-
THIK_YARLI/291-413-----------------------------------------QPILAKFVHCKTVGVPP.ELMGIGPAYAIPAVLEDL-G-
ECHB_RAT/332-472-----------------------------------------YKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKA-G-
ATOB_HAEIN/270-392-----------------------------------------LKAIAKIRSYASGGVDP.SVMGLGPVPATQKALKKA-G-

PF02801

PKSJ_BACSU/4829-4945-------------------------------------------------------------------------YAVVKA-
PKSL_BACSU/4322-4438-------------------------------------------------------------------------YAVIKA-
Q44222_NOSS1/297-409-------------------------------------------------------------------------YAVIDA-
Q18559_CAEEL/5488-5604-------------------------------------------------------------------------HFVIKD-
Q17301_CAEBR/2504-2620-------------------------------------------------------------------------HFVIKD-
O33906_9GAMM/317-434-------------------------------------------------------------------------YAVVSG-
Q18559_CAEEL/244-354-------------------------------------------------------------------------HCECVG-
Q17301_CAEBR/1503-1611-------------------------------------------------------------------------MASIVD-
P95029_MYCTU/2816-2942-------------------------------------------------------------------------LAVVAF-
Q59497_CORAM/2789-2913-------------------------------------------------------------------------YAVVAH-
PKSF_BACSU/257-367-------------------------------------------------------------------------YAALSG-
P74017_SYNY3/244-356-------------------------------------------------------------------------YGEILG-
FABF_SHIFL/255-370-------------------------------------------------------------------------YAELVG-
FABF_VIBHA/255-371-------------------------------------------------------------------------YAELVG-
O54440_PSEAI/255-370-------------------------------------------------------------------------YAELVG-
O67612_AQUAE/256-371-------------------------------------------------------------------------YAELVG-
FABF_BACSU/254-369-------------------------------------------------------------------------YGEIVG-
FABF_SYNY3/258-373-------------------------------------------------------------------------YGEMVG-
Q9ZCH8_RICPR/269-384-------------------------------------------------------------------------YCEVIG-
O13355_NEUCS/272-392-------------------------------------------------------------------------LAELTG-
CEM1_YEAST/273-391-------------------------------------------------------------------------ISELVG-
OXSM_SCHPO/262-380-------------------------------------------------------------------------YAEIVG-
Q9ZLS2_HELPJ/258-370-------------------------------------------------------------------------YAEFAG-
Q54208_STRGA/261-376-------------------------------------------------------------------------YAEAVG-
O33878_PSEAI/252-360-------------------------------------------------------------------------YAEIVG-
FABB_HAEIN/253-361-------------------------------------------------------------------------YAEIVG-
FABB_ECOLI/254-362-------------------------------------------------------------------------YAEIVG-
O84775_CHLTR/256-371-------------------------------------------------------------------------FAEVLG-
O82520_CAPCH/330-444-------------------------------------------------------------------------IAEYLG-
KASC1_ARATH/315-429-------------------------------------------------------------------------VAEYLG-
O54149_STRCO/253-365-------------------------------------------------------------------------RARLLG-
Q9Z4Y3_STRCO/251-363-------------------------------------------------------------------------LGRLLG-
FAB1_MYCTU/262-374-------------------------------------------------------------------------LARLLG-
FAB2_MYCTU/262-375-------------------------------------------------------------------------LARIMG-
Q93458_CAEEL/101-214-------------------------------------------------------------------------LAEVVG-
P70719_AGGAC/260-369-------------------------------------------------------------------------IAEVVG-
Q48375_KIBAR/261-376-------------------------------------------------------------------------YAEIAG-
Q9ZGD7_STRCY/261-376-------------------------------------------------------------------------YAEIAG-
KAS1_STRCM/259-373-------------------------------------------------------------------------YAEIAG-
KAS1_STRVN/260-375-------------------------------------------------------------------------YAEVGG-
Q53671_STRAA/259-374-------------------------------------------------------------------------YAEISG-
KAS1_STRRM/264-379-------------------------------------------------------------------------YAEIAG-
KASA_STRCO/303-418-------------------------------------------------------------------------HAEISG-
Q54217_STRGR/260-375-------------------------------------------------------------------------YAEIAG-
KAS1_STRCO/261-376-------------------------------------------------------------------------YCEVSG-
KAS1_STRCN/260-375-------------------------------------------------------------------------YCEIGG-
O32451_9ACTO/267-382-------------------------------------------------------------------------YCEVAG-
KAS1_STRGA/264-379-------------------------------------------------------------------------YAEVRG-
Q54495_STRNO/265-380-------------------------------------------------------------------------YAEIAG-
Q54994_9ACTO/260-375-------------------------------------------------------------------------YALVSG-
NOE4_RHIML/246-359-------------------------------------------------------------------------LAEVAG-
NODE_RHIS3/247-360-------------------------------------------------------------------------IAEIAG-
NODE_RHILT/247-360-------------------------------------------------------------------------LAEVAG-
Q53672_STRAA/255-365-------------------------------------------------------------------------YGVFAG-
Q54496_STRNO/253-363-------------------------------------------------------------------------YGRIDG-
Q54995_9ACTO/268-378-------------------------------------------------------------------------YGELAG-
KAS2_STRVN/258-365-------------------------------------------------------------------------YVRSPL-
O32452_9ACTO/253-363-------------------------------------------------------------------------YGRIAG-
Q54815_STRPE/272-382-------------------------------------------------------------------------YGSIAG-
KAS2_STRGA/256-366-------------------------------------------------------------------------YGRIAG-
KASB_STRCO/251-361-------------------------------------------------------------------------YGELAG-
Q54174_STRFR/256-366-------------------------------------------------------------------------YGVIAG-
Q56164_9ACTO/252-362-------------------------------------------------------------------------YGEIAG-
Q48376_KIBAR/256-366-------------------------------------------------------------------------YGEICG-
Q9ZGD6_STRCY/253-363-------------------------------------------------------------------------YGEIAG-
Q54282_SACHI/249-359-------------------------------------------------------------------------YGEIAG-
Q54218_STRGR/260-370-------------------------------------------------------------------------HAELAG-
KAS2_STRCM/252-360-------------------------------------------------------------------------YGEAGP-
KAS2_STRCO/264-377-------------------------------------------------------------------------RATVAG-
KAS2_STRCN/263-375-------------------------------------------------------------------------RATVAG-
FAS_HUMAN/243-360-------------------------------------------------------------------------YATILN-
FAS_CHICK/243-360-------------------------------------------------------------------------YATIVN-
P91871_CAEEL/279-396-------------------------------------------------------------------------YATVVH-
O01678_BOMMO/265-382-------------------------------------------------------------------------YAQLLH-
O01677_BOMMO/269-386-------------------------------------------------------------------------YSEVYY-
WA_EMENI/634-754-------------------------------------------------------------------------LGVING-
PKSL1_ASPPA/629-750-------------------------------------------------------------------------LGVILD-
P79068_GLOLA/639-760-------------------------------------------------------------------------LAVILG-
O54142_STRCO/811-926-------------------------------------------------------------------------FGVLRA-
P71718_MYCTU/262-379-------------------------------------------------------------------------LAEVRA-
O33954_STRFR/2834-2952-------------------------------------------------------------------------LAVVCG-
O30480_STRHY/290-406-------------------------------------------------------------------------LAVVRG-
O30482_STRHY/292-408-------------------------------------------------------------------------LAVVRG-
O30479_STRHY/1233-1349-------------------------------------------------------------------------LGVVRG-
O30481_STRHY/292-408-------------------------------------------------------------------------LGVVRG-
Q9ZGI5_9ACTO/1367-1485-------------------------------------------------------------------------LAVVRG-
Q9ZGI2_9ACTO/293-411-------------------------------------------------------------------------LAVVRG-
Q9ZGI3_9ACTO/295-413-------------------------------------------------------------------------LAVVRG-
O65933_MYCTU/289-405-------------------------------------------------------------------------LALVRG-
P95814_STRSQ/5664-5780-------------------------------------------------------------------------LAVVRG-
Q54299_STRHY/5475-5591-------------------------------------------------------------------------LATVRG-
OL56_STRAT/296-414-------------------------------------------------------------------------LAVVRG-
O52789_AMYMD/1984-2100-------------------------------------------------------------------------LAVLRG-
O54593_AMYMD/1958-2076-------------------------------------------------------------------------LAVLRG-
O54593_AMYMD/287-403-------------------------------------------------------------------------LAVLRG-
O52790_AMYMD/292-408-------------------------------------------------------------------------LAVLRG-
O54666_AMYMD/888-1004-------------------------------------------------------------------------LAVLRG-
O52545_AMYMD/293-411-------------------------------------------------------------------------LAVIRG-
O54666_AMYMD/3430-3546-------------------------------------------------------------------------LAVLRG-
Q50469_MYCTU/301-419-------------------------------------------------------------------------LAVVRG-
O53490_MYCTU/289-408-------------------------------------------------------------------------LAVVVG-
Q54297_STRHY/5130-5246-------------------------------------------------------------------------LAVVRS-
O54666_AMYMD/2452-2568-------------------------------------------------------------------------LAVVRG-
O33956_STRFR/1814-1932-------------------------------------------------------------------------LAVVRG-
O33955_STRFR/283-401-------------------------------------------------------------------------LAVIRG-
O30767_9ACTO/301-418-------------------------------------------------------------------------LAVVRG-
O30764_9ACTO/1265-1382-------------------------------------------------------------------------LAVVRG-
O30768_9ACTO/298-415-------------------------------------------------------------------------LAVVRG-
O30766_9ACTO/1721-1838-------------------------------------------------------------------------LAVVRG-
O33958_STRFR/296-414-------------------------------------------------------------------------LGLVTG-
ERYA2_SACER/288-406-------------------------------------------------------------------------LAVVRG-
ERYA3_SACER/285-403-------------------------------------------------------------------------LAVLAG-
Q9Z3T8_PSESX/297-415-------------------------------------------------------------------------LAVIRG-
ERYA2_SACER/1747-1863-------------------------------------------------------------------------LAVLRG-
Q9ZGA4_9ACTO/3036-3152-------------------------------------------------------------------------LAVVRG-
ERYA1_SACER/763-879-------------------------------------------------------------------------LAVLRG-
Q9ZGI5_9ACTO/2862-2980-------------------------------------------------------------------------LAVVRG-
Q9ZGA4_9ACTO/1436-1552-------------------------------------------------------------------------LAVVRG-
Q9Z3T9_PSESX/864-981-------------------------------------------------------------------------LGVIRG-
Q9ZGA4_9ACTO/6250-6366-------------------------------------------------------------------------LAVVRG-
ERYA3_SACER/1748-1866-------------------------------------------------------------------------LGVVAG-
ERYA1_SACER/2234-2352-------------------------------------------------------------------------LGVVAG-
MCAS_MYCBO/263-377-------------------------------------------------------------------------FAVVRG-
O53901_MYCTU/271-385-------------------------------------------------------------------------LAVIRG-
PHAS_MYCTU/282-396-------------------------------------------------------------------------LAVIRG-
O50436_MYCTU/264-378-------------------------------------------------------------------------LAIVRG-
O05170_STRVR/291-409-------------------------------------------------------------------------LAVLRG-
Q49932_MYCLE/290-405-------------------------------------------------------------------------LAVVRG-
Q49940_MYCLE/293-408-------------------------------------------------------------------------LAVVRG-
Q49933_MYCLE/296-416-------------------------------------------------------------------------LAIVRG-
Q92217_COCHE/272-388-------------------------------------------------------------------------RAVIRG-
O86335_MYCTU/354-472-------------------------------------------------------------------------LAILTG-
P78584_ASPPA/269-387-------------------------------------------------------------------------LATLKG-
Q00290_ASPTE/302-420-------------------------------------------------------------------------RAIIKG-
MSAS_PENPA/290-408-------------------------------------------------------------------------LAVIKG-
P87001_PENPA/302-422-------------------------------------------------------------------------LAVLKG-
Q9ZGI5_9ACTO/346-464-------------------------------------------------------------------------LAVIRG-
O30764_9ACTO/259-377-------------------------------------------------------------------------YCVVRG-
O33954_STRFR/279-399-------------------------------------------------------------------------YCVIKG-
O54155_STRCO/1041-1159-------------------------------------------------------------------------HAVLTG-
PPSA_MYCTU/359-477-------------------------------------------------------------------------LAVICG-
O53579_MYCTU/374-492-------------------------------------------------------------------------LAVIAG-
O51828_PSEFL/298-416-------------------------------------------------------------------------LAVIEG-
O51827_PSEFL/1281-1399-------------------------------------------------------------------------VATILG-
O51827_PSEFL/269-384-------------------------------------------------------------------------QAVIRG-
Q18559_CAEEL/2133-2242-------------------------------------------------------------------------MSTIQS-
O96554_CRYPV/3296-3416-------------------------------------------------------------------------LGRIKG-
O96554_CRYPV/5522-5642-------------------------------------------------------------------------IAYVLG-
O96554_CRYPV/1142-1260-------------------------------------------------------------------------YSVIKG-
O06586_MYCTU/230-347-------------------------------------------------------------------------HAIIRG-
O54511_YEREN/284-402-------------------------------------------------------------------------ISVILS-
PPSE_MYCTU/270-390-------------------------------------------------------------------------HAVIRG-
PKSR_BACSU/1766-1891-------------------------------------------------------------------------YSVIKG-
PKSM_BACSU/3776-3894-------------------------------------------------------------------------YGCIKA-
PKSL_BACSU/3126-3244-------------------------------------------------------------------------YGIIIG-
PKSJ_BACSU/2018-2137-------------------------------------------------------------------------YALLRG-
PKSL_BACSU/2189-2307-------------------------------------------------------------------------YGIIKG-
PKSM_BACSU/2562-2680-------------------------------------------------------------------------YGVIKA-
PKSR_BACSU/785-903-------------------------------------------------------------------------YAVIKS-
PKSM_BACSU/655-773-------------------------------------------------------------------------YAVIKG-
PKSL_BACSU/695-813-------------------------------------------------------------------------YAVIKG-
PKSJ_BACSU/3597-3724-------------------------------------------------------------------------YGVIRG-
O30776_NOSP7/342-460-------------------------------------------------------------------------YAVIKG-
O33904_9GAMM/316-434-------------------------------------------------------------------------YSVIKG-
O54142_STRCO/307-424-------------------------------------------------------------------------YASVLD-

PF08540

HMCS_SCHPO/176-446---------------------------------IVFEPGLRGTYMQHAYDFYKP..DLTSEYPYVDGHFSLECYVKALD-
Q5A3Z7_CANAL/178-450---------------------------------IVFD.SIRGSFMEHAYDFYKP..DFTSEYPVVDGHFSLSCYVKAVD-
HMCS_ARATH/175-451---------------------------------IVFESKLRASHMAHVYDFYKP..NLASEYPVVDGKLSQTCYLMALD-
HMCS2_BLAGE/177-455---------------------------------IVIDRGVRASHMKHAYDFYKP..DLMSEYPVVDGKLSVQCYLSALD-
HMCS2_HUMAN/224-506---------------------------------LALERGLRGTHMENVYDFYKP..NLASEYPIVDGKLSIQCYLRALD-
HMCS_CAEEL/183-448---------------------------------IPIDRQFSACHMKNTWDFFKPITPIPSEYPVVDGSLSLSSYLEAVR-
HMCS1_BLAGE/174-451---------------------------------LVFDRGVRSSHMQHAYDFYKP..DLSSLYPTVDGKLSIQCYLSALD-
HMCS_YEAST/217-490---------------------------------IVFD.SVRASYMEHAYDFYKP..DFTSEYPYVDGHFSLTCYVKALD-
HMCS1_RAT/187-469---------------------------------VIFDRGLRGTHMQHAYDFYKP..DMLSEYPVVDGKLSIQCYLSALD-
P93773_PINSY/178-452---------------------------------IATESKYRGTHMAHVYDFYKP..NLASEYPVVDGKLSQTCYLMALD-

PF00108

THIL_ZOORA/3-262-----------------------------------------TPSIVIAS-A.RTAVG.SFNGAFANTPAH-ELGATVIS-
THIL_YEAST/2-267-----------------------------------------SQNVYIVS-TARTPIG.SFQGSLSSKTAV-ELGAVALK-
FADA_PSEFR/5-258-----------------------------------------PRDVVIVD-FGRTPMGRSKGGMHRNTRAE-DMSAHLIS-
THIB_CANTR/3-267-----------------------------------------LPPVYIVS-TARTPIG.SFQGSLSSLTYS-DLGAHAVK-
THIL_THIVI/2-264-----------------------------------------SDTIVIVD-AGRTAIG.TFGGALSALQAT-DIGTTVLK-
THLA_CLOAB/1-262-----------------------------------------MKEVVIAS-AVRTAIG.SYGKSLKDVPAV-DLGATAIK-
THIL_CUPNH/1-263-----------------------------------------MTDVVIVS-AARTAVG.KFGGSLAKIPAP-ELGAVVIK-
YKA3_CAEEL/23-298-----------------------------------------MPNIVLVD-AVRTPFV.VSGTVFKDLMAV-DLQKEAIK-
YQEF_ECOLI/1-262-----------------------------------------MKDVVIVG-ALRTPIG.CFRGALAGHSAV-ELGSLVVK-
THIL_PARDE/1-261-----------------------------------------MTKAVIVS-AARTPVG.SFLGSFANLPAH-ELGAIVLK-
THIM_HUMAN/4-266-----------------------------------------LRGVFVVA-AKRTPFG.AYGGLLKDFTAT-DLSEFAAK-
ECHB_RAT/52-325-----------------------------------------LKNIVVVE-GVRIPFL.LSGTSYKDLMPH-DLARAALS-
ATOB_ECOLI/1-263-----------------------------------------MKNCVIVS-AVRTAIG.SFNGSLASTSAI-DLGATVIK-
FADA_ECOLI/1-254-----------------------------------------MEQVVIVD-AIRTPMGRSKGGAFRNVRAE-DLSAHLMR-
ATOB_HAEIN/1-263-----------------------------------------MENVVIVS-AVRTPIG.SFNGALSSVSAV-DLGAIVIQ-
FADA4_MYCLE/1-263-----------------------------------------MTTSVIVT-GARTPIG.KLMGSLKDFSAS-DLGAITIA-
THIKA_RAT/35-291-----------------------------------------ASDVVVVH-GRRTPIGRAGRGGFKDTTPD-ELLSAVLT-
THIK_YARLI/27-284-----------------------------------------PDDVVITA-AYRTAHTKGGKGLFKDTSSS-ELLASLLE-
THIK_YEAST/33-289-----------------------------------------PEDVVIVA-ANRSAIGKGFKGAFKDVNTD-YLLYNFLN-
THIL_HUMAN/39-299-----------------------------------------LKEVVIVS-ATRTPIG.SFLGSLSLLPAT-KLGSIAIQ-
THIKA_CANTR/24-280-----------------------------------------PDDVVIVA-AYRTAIGKGFKGSFRSVRSE-FILTEFLK-
THL_BACSU/1-263-----------------------------------------MRKTVIVS-AARTPFG.KFGGVLKEVKAA-ELGGIVMK-

PF00109

Q18559_CAEEL/5257-5480-----------------------------------------DTRVAVIGWSAEFSGSSN.........IH-EYWENLMD-
Q18559_CAEEL/1-236-----------------------------------------MSA.CLVGSWAKIPNGED.........GH-EMAENIFL-
Q18559_CAEEL/1888-2129-----------------------------------------ENPIGVMAAACRLPGGVS........SPS-ELWELLKI-
Q18559_CAEEL/4241-4474-----------------------------------------KSEIEIVGFDISLPYNQIS.......ENS-ENWQHLKT-
Q18559_CAEEL/824-1057-----------------------------------------TSDINVIACDYQFAGVEG.........EK-ELWDTLLT-
FAS_HUMAN/1-239-----------------------------------------MEEVVIAGMSGKLPESEN.........LQ-EFWDNLIG-
PKSM_BACSU/2319-2554-----------------------------------------SRDVAVIGISGRYPQAET.........AE-DFWNNLKE-
PKSL_BACSU/433-687-----------------------------------------AGDIAIIGLAGRYPKAAN.........IH-EFWNNLKE-
Q92217_COCHE/11-264-----------------------------------------ITPIAVVGMSFRGPGDAT........NVE-KLLNMISE-
PKSR_BACSU/1528-1758-----------------------------------------ADGIAIIGMSGQFPKANS.........VT-EFWDNLVQ-
P91871_CAEEL/37-275-----------------------------------------QDDIVISGVSGRFPRCDN.........VK-MFGDMLLA-
PKSM_BACSU/393-647-----------------------------------------GEDIAIIGMAGRYPKAKN.........IQ-EFWEQLKA-
PKSJ_BACSU/4588-4821-----------------------------------------AEGIAVVGLSCRFPGAET.........LE-SYWSLLSE-
PKSJ_BACSU/3339-3589-----------------------------------------FEPVAIVGISGRFPGAMD.........ID-EFWKNLEE-
PKSL_BACSU/4082-4314-----------------------------------------AEDIAIIGLSCRFPGAET.........LE-EYWDLIRD-
PKSR_BACSU/527-777-----------------------------------------TEDIAIIGVSGRYPMSNS.........LE-ELWGHLIA-
PKSF_BACSU/6-249-----------------------------------------LPEVVVTGVGVTASIGQG.........KE-DFASSLLS-
PKSJ_BACSU/1760-2010-----------------------------------------DDSVAIIGISCEFPGAKN.........HD-EFWENLRD-
PKSL_BACSU/1926-2181-----------------------------------------TEEIAIIGISGRYPQADN.........ID-ELWEKLRD-
PKSL_BACSU/2873-3118-----------------------------------------EDAIAIVGMSGRYPGARN.........VR-EYWDNLVH-
PKSM_BACSU/3529-3768-----------------------------------------DEPIAIIGMSGRFPQADS.........VH-ELWDNLKN-
ERYA2_SACER/1488-1739-----------------------------------------SEPIAIVGIGCRFPGGIG........SPE-QLWRVLAE-
ERYA2_SACER/30-280-----------------------------------------SDPIAIVSMACRLPGGVN........TPQ-RLWELLRE-
ERYA3_SACER/38-277-----------------------------------------GEPIAIVGMACRFPGDVD........SPE-SFWEFVSG-
FABF_VIBHA/3-246-----------------------------------------KRRVVVTGMGMLSPVGNT.........VE-SSWKALLE-
FABF_SHIFL/3-246-----------------------------------------KRRVVVTGLGMLSPVGNT.........VE-STWKALLA-
ERYA3_SACER/1489-1739-----------------------------------------DDPIAIVGMACRFPGGVH........NPG-ELWEFIVG-
Q56164_9ACTO/2-243-----------------------------------------SASVVVTGLGVAAPNGLG.........RE-DFWASTLG-
MCAS_MYCBO/5-255-----------------------------------------VTPVAVIGMGCRLPGGIN........SPD-KLWESLLR-
OXSM_SCHPO/1-253-----------------------------------------MKRVVITGLGAVTPLGNG.........VK-TNWRNLIQ-
Q54281_SACHI/2-251-----------------------------------------TRRVVITGVGVRAPGGLG.........AK-NFWELLTS-
O51827_PSEFL/9-261-----------------------------------------FEPIAIIGSGCRFAKGAS........TPE-AFWELLRA-
PPSA_MYCTU/101-351-----------------------------------------DEPIAVVGMGCRFPGGIS........CPE-ALWDFLCE-
O82520_CAPCH/75-321-----------------------------------------KKRIVITGMGLVSVFGSD.........ID-NFYNKLLE-
O33954_STRFR/42-271-----------------------------------------GGEIAVVGMSCRLPGAAG.........VE-EFWELLRS-
Q48375_KIBAR/3-252-----------------------------------------ERRVVITGIGVIAPGGIG.........AK-SFWSLLSE-
P95029_MYCTU/2548-2808-----------------------------------------AFVVSSEADARAFVEFDPEHTVIRPVPDS-TDWQVIRK-
O54511_YEREN/26-276-----------------------------------------CEPVAVIGYACHFPESPD.........GE-TFWQNLLE-
O51828_PSEFL/39-290-----------------------------------------VEPIAVVGLGCRLPGSAD........TPK-RLWSLLKH-
O67612_AQUAE/2-247-----------------------------------------KRRVVITGIGAVTPLGTG.........VK-KFWENLVK-
MSAS_PENPA/32-282-----------------------------------------SNDVAVVGMACRVAGGNH........NPE-LLWQSLLS-
Q54282_SACHI/2-240-----------------------------------------STW..VTGMGVVAPNGLG.........AD-DHWAATLK-
Q59497_CORAM/2523-2781-----------------------------------------VFTVPTEQEALDIEEADPSFTKLREVDG.-.EWEVTRL-
O30481_STRHY/33-284-----------------------------------------AEPIAIIGMACRFPGGVT........SPE-ALWELVSS-
Q17301_CAEBR/1267-1499-----------------------------------------KSEIEIVGFDITLPYNQ.L......STNN-ENWSFLKT-
Q00290_ASPTE/44-294-----------------------------------------QNEVAVVGMACRLAGGNN........SPE-ELWQSILN-
O54666_AMYMD/631-880-----------------------------------------GEPIAIVGMACRLPGGVA........SPE-DLWRLVAE-
O33904_9GAMM/30-308-----------------------------------------DMPIAIVGMASIFANSRY.........LN-KFWDLISE-
Q9ZGI5_9ACTO/88-338-----------------------------------------AEPVAVVGISCRVPGARD.........PR-EFWELLAA-
Q54299_STRHY/5220-5467-----------------------------------------NEPIAIVAMACRLPGGVS........SPE-GLWHLVES-
O32452_9ACTO/7-245-----------------------------------------DAP.AVTGIGVVAPTGIG.........VE-EHWAATLR-
O13355_NEUCS/1-263-----------------------------------------MRRVVVTGLGAITPLAVG.........IR-PTWRRLLD-
O54142_STRCO/518-803-----------------------------------------AEPIAIVGFGGRFADSPD.........AD-GFWRTMLS-
Q9ZGA4_9ACTO/2782-3028-----------------------------------------DEPLAIVAMACRMPGGVD........TPE-DLWSLVES-
KAS1_STRCM/3-250-----------------------------------------QRRVAITGIEVLAPGGLG.........RK-EFWQLLSE-
Q54174_STRFR/5-246-----------------------------------------AVEVAVTGLGVVAPNGLG.........TD-AYWAATRK-
Q54218_STRGR/11-250-----------------------------------------RTL..ITGMGLATPHGVD.........VE-DFWAATRV-
Q17301_CAEBR/2273-2496-----------------------------------------DNRVAVIGWSAEFSG...A......ENIE-EFWENLLD-
FAB2_MYCTU/10-253-----------------------------------------FPYVVVTGIAMTTALATD.........AE-TTWKLLLD-
O30764_9ACTO/22-251-----------------------------------------SDAIAVIGMSCRFPGAPG.........TA-EFWQLLSS-
Q9Z3T9_PSESX/605-856-----------------------------------------DEPIAIIGMSCRYPGGAN........SPE-ALWTLLMQ-
P70719_AGGAC/1-252-----------------------------------------MKRVVITGIGAVTAFGKT.........WQ-EIKTAFQR-
O54440_PSEAI/3-246-----------------------------------------RRRVVITGMGMLSPLGLD.........VP-SSWEGILA-
Q9ZCH8_RICPR/7-260-----------------------------------------NKRVVITGLGLVTPVGLN.........VS-STWKNIVG-
O33954_STRFR/2575-2826-----------------------------------------DDPVVIVGMACRFPGGAG........TPE-ALWKLVTE-
O54149_STRCO/3-244-----------------------------------------DPSLAVTGLGLVTAAGMG.........VD-ATWEGVLR-
O06586_MYCTU/3-222-----------------------------------------PTGIAIIGLACRFPTVVS.........PG-DLWDLLRD-
P93117_CUPWR/105-350-----------------------------------------QRRVVVTGMGVVTPLGHD.........PD-VFYNNLLD-
O54593_AMYMD/30-279-----------------------------------------DEPLAVVGMACRFPGGVS........SPE-DLWQLVAG-
Q49940_MYCLE/35-285-----------------------------------------SEPVAVVGIGCRFPGNVT........GPD-SFWQLLVD-
Q9ZGI2_9ACTO/34-285-----------------------------------------QEPMAIVGMSCRFAGGIR........SPE-DLWDAVAA-
PKSL1_ASPPA/371-621-----------------------------------------KCKLAIVSMSGRFPE...S......PTTE-SFWDLLYK-
KAS1_STRCN/2-251-----------------------------------------TRRVAVTGIGVVAPGGIG.........VP-AFWDLLSS-
O50436_MYCTU/6-256-----------------------------------------ATSVAVIGMACRLPGGID........SPQ-RLWEALLR-
KAS1_STRRM/7-255-----------------------------------------ARRVVITGIGVVAPGDVG.........TK-PFWEMLTA-
ERYA1_SACER/1979-2226-----------------------------------------DEPIAIVGMACRLPGEVD........SPE-RLWELITS-
O30768_9ACTO/40-290-----------------------------------------REPIAIVGMACRYPGGVS........DPE-ELWQLAAE-
O30766_9ACTO/1459-1713-----------------------------------------GEPIAIIGMACRLPGGVR........SPE-DLWELLSD-
WA_EMENI/376-626-----------------------------------------LSKIAIIGMSGRFPE...A......DSPQ-DFWNLLYK-
PHAS_MYCTU/24-274-----------------------------------------VTPVAVIGMACRLPGGID........SPE-LLWKALLR-
Q9Z4Y3_STRCO/3-242-----------------------------------------EGPAAITGVGLVTPAGTD.........AD-STWEAMCA-
O30480_STRHY/32-282-----------------------------------------AEPVAIVGMACRLPGGVD........SPE-SLWELMAS-
OL56_STRAT/33-288-----------------------------------------REPIAIVGMSCRFPGGGDAT....VNTPE-QFWDLLNS-
P72239_PSESX/4-210-----------------------------------------PVEVWVTGMAWSTALGDD.........LE-VVWQSLLA-
O54666_AMYMD/2194-2444-----------------------------------------EEPIAIVAMACRFPGGVH........SPE-DLWRLVAD-
P78584_ASPPA/12-261-----------------------------------------SHDVAVVGMGCRLPGNNN........TPE-ELWRSILQ-
O33956_STRFR/1555-1806-----------------------------------------GEPIAIVSMACRMPGGVS........TPE-ELWRLLRD-
Q53671_STRAA/2-250-----------------------------------------NRRVVITGIGVVAPGAVG.........VE-AFWEQLTA-
O54593_AMYMD/1701-1950-----------------------------------------GEPIAIVGMACRLPGGVT........DPE-GLWRLVRD-
Q49932_MYCLE/32-282-----------------------------------------AEPIAVVGIGCRFPGDVT........GPD-SFWDLLID-
P95814_STRSQ/5409-5656-----------------------------------------DEPIAIVAMACRLPGGVT........SPE-ELWRLVES-
Q9ZGI5_9ACTO/2603-2854-----------------------------------------DDPIAIVAMSCRYPGDIR........SPE-DLWRMLSE-
O96554_CRYPV/884-1134-----------------------------------------YSDIVVVGMSCSFPGG..S......STPG-EFWSLLQS-
P71718_MYCTU/4-254-----------------------------------------NDPVVIVGLAIEAPGGVE........TAD-DYWTLLSE-
FABF_SYNY3/6-249-----------------------------------------KKRVVVTGLGAITPIGNT.........LQ-DYWQGLME-
O65933_MYCTU/33-281-----------------------------------------SEPVAVVGMGCRYPGGVD........SPE-TLWELVAQ-
NODE_RHIS3/2-238-----------------------------------------DRRVVITGIGGLCGLGTD.........AP-SIWKEMRE-
Q53672_STRAA/5-246-----------------------------------------ASQAVITGIGVAAPNGLS.........VK-AWWDAVLR-
Q49933_MYCLE/34-288-----------------------------------------TEPIAVIGMGCRFPGGVN........NPE-QFWDLLCD-
O51827_PSEFL/1032-1273-----------------------------------------AGSVAVVAMACRFPQ.AD........SPE-ALWKLMLE-
Q54496_STRNO/2-243-----------------------------------------TAAVVVTGLGVVAPTGLG.........VR-EHWSSTVR-
Q44222_NOSS1/9-289-----------------------------------------TAKIAIVGMDAFFGECNG.........LD-AFERSIYD-
KAS2_STRCO/13-255-----------------------------------------SRRAVVTGLGVLSPHGTG.........VE-AHWKAVAD-
Q54995_9ACTO/18-258-----------------------------------------LPP.VFTGIGVAAPNGLG.........TE-EWWAATLR-
O54142_STRCO/38-299-----------------------------------------AEPIAIVGMSALYPGAQG.........VE-DLWRLLLA-
O30482_STRHY/33-284-----------------------------------------REPIAIVSMACRLPGGVD........SPE-SLWDLVAA-
P87001_PENPA/44-294-----------------------------------------HDDIAIIGMACRVPGDVK........SPS-ALWQFLLQ-
O54155_STRCO/797-1033-----------------------------------------DEPVAVIGIGCRFPGAPD.........PD-SYWRLLRD-
P79068_GLOLA/381-631-----------------------------------------KCKLAIVGMAGRFPD...A......ASHE-KLWELLAK-
Q54208_STRGA/5-252-----------------------------------------NRTVVVTGIGATTPLGGD.........AA-STWEGLVA-
O30776_NOSP7/53-334-----------------------------------------HNPIAIVGMASLLPQARN.........LR-EYWQNIVN-
P74017_SYNY3/16-236-----------------------------------------AMGVVVTGLALDTALGDQ..........L-QTWTKLLQ-
Q9ZGD6_STRCY/2-243-----------------------------------------TARVVITGNRIAAPNGFG.........VE-DYWAATRV-
Q9ZGI5_9ACTO/1108-1359-----------------------------------------DEPVAIVGMACRLPGGVA........SPE-DLWRLVAG-
KAS1_STRCO/3-252-----------------------------------------RRRVAVTGIGVVAPGGIG.........TP-QFWRLLSE-
FABF_BACSU/3-245-----------------------------------------KKRVVVTGLGALSPLGND.........VD-TSWNNAIN-
Q9Z3T8_PSESX/38-289-----------------------------------------QEPIAIVAMGCRLPGGLA........SPE-ALWRLVEA-
Q9ZLS2_HELPJ/1-249-----------------------------------------MRRIVVTGMGMINSLGLN.........KE-DSFLAIAK-
O52789_AMYMD/1725-1976-----------------------------------------GEPIAIVGMACRLPGGVM........SPD-DLWRMVAE-
O01677_BOMMO/27-265-----------------------------------------GEEVVISGMSGIFPK...S......DSVL-EFKNNLFN-
FABB_ECOLI/1-245-----------------------------------------MKRAVITGLGIVSSIGNN.........QQ-EVLASLRE-
KAS2_STRCM/1-243-----------------------------------------MTPVAVTGMGIAAPNGLG.........RP-TTGRPPWA-
O86335_MYCTU/106-346-----------------------------------------NEPVAVIGVGCRFPGDID........GPE-RLWDFLTE-
O32451_9ACTO/9-258-----------------------------------------PRRVAITGMGVVAPGGSG.........RK-AFWNLLTD-
KASC1_ARATH/60-306-----------------------------------------KKRVVITGMGLVSVFGND.........VD-AYYEKLLS-
Q54495_STRNO/6-256-----------------------------------------NRRVVITGIGIVAPDATG.........VK-PFWDLLTA-
O84775_CHLTR/3-247-----------------------------------------KKRVVVTGMGIVSCLGNE.........VE-SFYDSLLA-
O96554_CRYPV/3024-3288-----------------------------------------NVG.VIAGLACRFPGGCNTPDTLWKSLIR-GYSINPLS-
KAS2_STRCN/10-254-----------------------------------------TRRTAVTGIGVVAPNGLH.........AD-TYWKSVKE-
FAB1_MYCTU/11-253-----------------------------------------FPSVVVTAVTATTSISPD.........IE-STWKGLLA-
Q9ZGA4_9ACTO/5996-6242-----------------------------------------DEPLAIVGMACRLPGGVA........SPD-DLWRLLES-
Q9ZGI3_9ACTO/34-287-----------------------------------------HEPVAIVGMACRLPGGVA........SPE-DLWQLVAG-
Q9ZGA4_9ACTO/1182-1428-----------------------------------------GEPVAIVGMACRLPGGVT........SPE-GLWRLVAS-
O96554_CRYPV/5251-5514-----------------------------------------EYSVAIIGVSCRLPG...RV....KSFND-LYEIVLLK-
Q9ZGD7_STRCY/2-252-----------------------------------------GRRVVVTGIGVLAPGGIG.........AE-NFWSLLSE-
Q50469_MYCTU/46-293-----------------------------------------TEPVAVVGIGCRFPGGVD........GPD-GLWDVVSA-
O30479_STRHY/974-1225-----------------------------------------GEPIAIVGMACRLPGGVT........SPE-ELWELLSS-
O01678_BOMMO/23-261-----------------------------------------GDEVYVTGVSGYFPD...S......DSVK-HLQENLFN-
Q48376_KIBAR/2-246-----------------------------------------TSQAVVTGLGVVSPNGFG.........VT-DYWNATCG-
O53490_MYCTU/34-281-----------------------------------------SEPIAIVGMSCRFPGGVD........SPE-GLWQMVAD-
KAS1_STRGA/6-255-----------------------------------------EKRVVITGIGVRAPGGAG.........TA-AFWDLLTA-
PPSE_MYCTU/5-262-----------------------------------------ENAIAVVGMAGRFPGAKD.........VS-AFWSNLRR-
NODE_RHILT/2-238-----------------------------------------DRRVVITGIGGLCGLGTN.........AA-SIWKEMRE-
O30764_9ACTO/1006-1257-----------------------------------------GDPIAVIGIGCRFPGGVA........TPD-DLWELVAS-
O33958_STRFR/37-288-----------------------------------------REPIAVVGMACRYPGGVT........GPE-ELWELVAG-
Q54815_STRPE/24-263-----------------------------------------RGRAVVTGLGIVAPNGLG.........VG-AYWDAVLN-
O33955_STRFR/20-275-----------------------------------------REPIAVVAMSCRYPGGVT........TPE-DLWRLLAD-
O53579_MYCTU/116-366-----------------------------------------RVDIAIVGLSTRFPGEMN........TPE-QTWQALLE-
O33878_PSEAI/1-243-----------------------------------------MRRVVITGLGIVSCLGND.........KD-TVSANLRA-
O52545_AMYMD/34-285-----------------------------------------AEPVAIVSMACRYAGGIR........GPE-DFWRVVSE-
Q54814_STRPE/2-251-----------------------------------------NRRIVITGIGVVAPGAVG.........TK-PFWELLLS-
ERYA1_SACER/504-755-----------------------------------------GEPVAVVAMACRLPGGVS........TPE-EFWELLSE-
FABB_HAEIN/1-244-----------------------------------------MRRTVITGFGIISSIGNN.........KE-EVLASLKA-
O30767_9ACTO/43-293-----------------------------------------REPIAIVGMACRLPGGVR........GPE-DLWELLRS-
CEM1_YEAST/2-265-----------------------------------------SRRVVITGLGCVTPLGRS.........LS-ESWGNLLS-
KAS1_STRVN/2-251-----------------------------------------TRRVVITGVGVRAPGGSG.........TK-EFWDLLTA-
Q54217_STRGR/2-251-----------------------------------------ERRAVITGIGVCAPGGTG.........VD-SFWELMCD-
O53901_MYCTU/14-263-----------------------------------------VTPVAVIGMGCRLPGGID........SPD-RLWEALLR-
O52790_AMYMD/35-284-----------------------------------------GEPIAIVGMACRLPGGVT........GPG-DLWRLVAE-
KASA_STRCO/45-294-----------------------------------------KRRVVITGVGVRAPGGNG.........TR-QFWELLTS-
NOE4_RHIML/2-237-----------------------------------------DRRVVITGMGGLCGLGTD.........TT-SIWKWSAR-
O54666_AMYMD/3171-3422-----------------------------------------DEPIAIVGMSTRLPGGAD........SPE-ELWKLVAE-
KAS2_STRVN/6-248-----------------------------------------RRRAVVTGLSVAAPGGLG.........TE-RYWKSLLT-
Q54994_9ACTO/2-251-----------------------------------------NRQVAVTGIGVVAPGGIG.........RK-PYWEQLTS-
KAS2_STRGA/4-246-----------------------------------------PAPVVVTGLGIVAPNGTG.........TE-EYWAATLA-
O05170_STRVR/23-283-----------------------------------------LSPVAVVGIGCRFPGGVN........SPG-EFWDLLTA-
Q54297_STRHY/4880-5122-----------------------------------------DEPLAIVGMACRLPGGVS........SPE-DLWRLLES-

PF07451

B0K9G7_THEP3/7-334---------------------------------GTQTVKFKNPPSIIAGGTIVGPKEGE-------GPLR-DYFDMILV-
A6TVT6_ALKMQ/4-333---------------------------------GRQTWIFDSKPTIVASAAVGGPFEAQ-------GPLR-EDFDILHE-
A4ILB0_GEOTN/9-337---------------------------------GHRTWVFANKPVIVATAAVGGPFEAN-------GRLA-DDFDFLHE-
A6LRM0_CLOB8/7-335---------------------------------GNQTVKLDNPPKIISTHSIVGPKEGE-------GPLS-KYFDEILN-
A5KLQ7_9FIRM/6-345---------------------------------GAQSIMFREAPYLISAASVAGSKEAD-------GPIG-KLFDVTDK-
A7GHV3_CLOBL/6-334---------------------------------GEQTFKLDSKPKIIGTTSIVGPKEGE-------GPLK-DYFDVILK-
Q9KCK2_BACHD/4-332---------------------------------GRQTWEFENRPVILSSAATAGPFEAN-------GPLA-DDFDILFE-
Q5WH23_BACSK/4-331---------------------------------SHRTMTFSNPVYIQSSGTAVGPKEGA-------GPLA-GSFDYRYT-
A5Z9F5_9FIRM/6-334---------------------------------GSSSISFDKPPFIIEGASIVGQKEGD-------GPLG-KLFDVVEQ-
A4IQI0_GEOTN/5-332---------------------------------GKQTWVFDEDIYIRAAATAVGPLEAD-------GPLG-GYFDIWHR-
Q2B8V8_9BACI/4-335---------------------------------GKQSWIFQNRPVILSTGVSGGPFEAK-------GNLA-RDFDILHD-
B8I4W4_CLOCE/7-335---------------------------------GKQTVILKNPPSIKATASFVGPKEGK-------GPLK-DDFDYIIT-
A6TQB0_ALKMQ/8-336---------------------------------GNQTIKLLNPPSIISTASIVGPKEGQ-------GPLA-KYFDQIIQ-
A4J4J1_DESRM/4-332---------------------------------GHQTWVFPSKPTILATGTVVGPFEGK-------GPLA-NDFDLIHG-
Q8ERC5_OCEIH/4-332---------------------------------GHRTWEFINRPSIITTGTVGGPFEAN-------GSIP-EAFDTLHE-
Q2RIQ1_MOOTA/8-336---------------------------------GQHTLQFANPPVIVATASVVGPKEGE-------GPLG-DTFDMVID-
Q67T05_SYMTH/7-337---------------------------------GAQTVRLEQPPVIVGAAAVAGPVEAQ-------GPLG-HEFDLTYP-
Q189X1_CLOD6/7-335---------------------------------GKRTVKLENKPTIISTGTIVGPKEGE-------GPLK-DYFDMIMT-
Q635L3_BACCZ/5-333---------------------------------GKQTWVFQNDIYVNATGTAVGPKEAE-------GPLG-KEFDISYD-
Q631K6_BACCZ/4-332---------------------------------GHRTWVFENKPVIISTGVVGGPFEAK-------GKIP-EDFDILHE-
B8FPM4_DESHD/7-333---------------------------------GNQTVVFSNPSVILSSYSVVGPMEGQ-------GPLG-KTFNKVWQ-
A7VV52_9CLOT/6-334---------------------------------GRYTVVMERKPAILGYAAICGKKESE-------GPLG-AAFDLTYE-
A0PZS9_CLONN/6-338---------------------------------GKQTIKLENKPRIIATTSVVGPKEGE-------GPLK-DYFDIILS-
A7VIX6_9CLOT/21-354---------------------------------GKQSVSFTDPPYILGEASVCGPKEAD-------GPLA-GYFDIVSE-
A7Z687_BACA2/5-332---------------------------------GKQTWVFENPLFVNAAGTAAGPKEKD-------GPIG-SLFDKTYD-
Q0AZ98_SYNWW/8-335---------------------------------GAQTLVFDQPPVITSWASIAGPKEGQ-------GPWG-QDFDWSME-
Q891W9_CLOTE/6-334---------------------------------GKQTLKLETKPKLISTYSIVGPKEGE-------GPLN-MYFDKIIQ-
A5ZW68_9FIRM/8-352---------------------------------GKASISFSRPVYIQSCASVVGPKEGD-------GPLK-NCFDMICD-
A5D2Y8_PELTS/8-335---------------------------------GLQTVWFQSPPVIISAASVVGFREGE-------GPLG-KTFDKVVY-
A8MHP8_ALKOO/7-335---------------------------------GSQTIKLLNPPSIISAGSIVGPKEGD-------GPLA-QYFDKIVQ-
Q0SRD0_CLOPS/9-337---------------------------------GSQTIELKSKPRIIATYSVVGPREGQ-------GPLK-EYFDKILQ-
A6BCY0_9FIRM/4-332---------------------------------GKQSIAFEVSPYLEESASVVGKKEGE-------GPLG-GMFDMVAE-
A5N8K2_CLOK5/4-332---------------------------------GHQSWVFESKPAIIGCSTVGGPFEAK-------GALA-KEFDLLHE-
A6P2X9_9FIRM/7-334---------------------------------GAQTVALASPPAVMGYASVVGKKEGD-------GPLA-AFFDHIEQ-
Q97GR2_CLOAB/6-335---------------------------------GSQTARIDSKPRIVSAVSMVGPKEGR-------GPLK-DYFDIILS-
A4XFR0_CALS8/5-335---------------------------------GKSTFKFENCPIISDCFTIVGKKEGE-------GPLG-LFFDMVVE-
A9KI33_CLOPH/13-353---------------------------------GKQSVQFSNPPAIIGCASVAGQKEGE-------GPLG-AFFDVIEE-
Q9KCM9_BACHD/5-332---------------------------------RKQTLKFDKPVYIESTGTAVGPMEGA-------GPLR-HTFDQAYD-
A6CSV2_9BACI/4-336---------------------------------GTQSWEFQNQPSIISTGVVGGPFEKK-------GRLS-EDFDRFYD-
Q5WGZ4_BACSK/4-332---------------------------------GKQSWIFDSKPVITATGTVGGPFEAN-------GAIP-EAFDLLHD-
A1HRA0_9FIRM/6-333---------------------------------GKQSIIFGAPPIITSTANIVGPMEGE-------GLLA-GYFDQVMA-

PF13723

A0KS20_SHESA/23-240--------------------------------------------------------------------WQ.T.WCK.HS.
Q3KJ71_PSEPF/24-238--------------------------------------------------------------------WQ.A.WSR.QP.
A6WI73_SHEB8/23-240--------------------------------------------------------------------WQ.T.WCK.NS.
Q87V50_PSESM/22-236--------------------------------------------------------------------WR.Q.WSL.NP.
D2C0A5_DICD5/23-240--------------------------------------------------------------------WR.Q.WAT.RP.
Q088U8_SHEFN/23-254--------------------------------------------------------------------WL.Q.WQQ.PN.
Q1IG78_PSEE4/22-237--------------------------------------------------------------------WQ.T.WAA.TG.
D3H094_ECO44/24-239--------------------------------------------------------------------WQ.A.WSR.QP.
A6B2U2_VIBPA/28-240--------------------------------------------------------------------WK.E.WAA.SG.
Q1ZAL5_PHOPR/24-248--------------------------------------------------------------------WQ.E.WAS.NQ.
D0ZDH8_EDWTE/23-238--------------------------------------------------------------------WQ.Q.WSR.QP.
A3XWZ8_9VIBR/21-243--------------------------------------------------------------------WQ.T.WST.HL.
B8KAV3_VIBPA/28-239--------------------------------------------------------------------WQ.Q.WSK.TL.
Q2BXG5_9GAMM/24-240--------------------------------------------------------------------WQ.Q.WAI.TQ.
Q7MMI9_VIBVY/35-248--------------------------------------------------------------------WL.E.WAN.TG.
A8H9F9_SHEPA/23-237--------------------------------------------------------------------WL.N.WPT.TA.
C9Y2G4_CROTZ/23-238--------------------------------------------------------------------WS.D.WAQ.GC.
A4WFQ9_ENT38/23-238--------------------------------------------------------------------WQ.A.WSR.ES.
D4GIX1_PANAM/24-239--------------------------------------------------------------------WL.E.WAR.LS.
A9ICW7_BORPD/22-238--------------------------------------------------------------------WR.E.WAC.SP.
B5FC47_VIBFM/24-237--------------------------------------------------------------------WL.E.WRE.NN.
B1KLW4_SHEWM/23-238--------------------------------------------------------------------WK.H.WLE.SA.
A8FQ17_SHESH/23-236--------------------------------------------------------------------WK.R.WPE.TK.
Q6CYK1_ERWCT/23-238--------------------------------------------------------------------WL.T.WSR.VP.
B4SN15_STRM5/22-244--------------------------------------------------------------------WL.G.WAD.AP.
B6EI52_ALISL/27-240--------------------------------------------------------------------WL.L.WSE.SD.
B0TPT7_SHEHH/23-240--------------------------------------------------------------------WL.N.WPT.IA.
C9PCF7_VIBFU/28-238--------------------------------------------------------------------WK.A.WSQ.TG.
A1JK88_YERE8/23-237--------------------------------------------------------------------WL.D.WAK.NC.
C9QG28_VIBOR/28-240--------------------------------------------------------------------WD.N.WAI.SL.
B2JEK1_BURP8/10-230--------------------------------------------------------------------VA.R.WSS.WP.
D4DWU4_SEROD/23-235--------------------------------------------------------------------WL.Q.WAQ.QP.
C5TMY6_NEIFL/32-254--------------------------------------------------------------------WQ.D.WAQ.GK.
D0W6C1_NEILA/28-248--------------------------------------------------------------------WA.K.WAE.CP.
A0KNN6_AERHH/22-235--------------------------------------------------------------------WQ.A.WAQ.QG.
C4GLR4_9NEIS/27-242--------------------------------------------------------------------WR.E.WAA.GR.
B8CHL8_SHEPW/21-234--------------------------------------------------------------------WQ.A.WPA.AI.
A1SB23_SHEAM/16-223--------------------------------------------------------------------WA.A.WQK.SL.
C6M4A1_NEISI/28-249--------------------------------------------------------------------WR.Q.WAS.GT.
A4SJH0_AERS4/22-237--------------------------------------------------------------------WQ.E.WAQ.WG.
D4DPD2_NEIEG/27-243--------------------------------------------------------------------WA.A.WAS.GR.
A8GA54_SERP5/11-225--------------------------------------------------------------------WR.Q.WAT.GN.
C9PNT3_9PAST/22-236--------------------------------------------------------------------WQ.T.WAN.QE.
C0A904_9BACT/39-285--------------------------------------------------------------------WA.D.WAA.HSG
Q1LF35_RALME/48-283--------------------------------------------------------------------WL.A.WSR.AP.
D4EES3_AGGAC/28-245--------------------------------------------------------------------WK.SGYAH.WQ.
Q0I115_HAES1/28-245--------------------------------------------------------------------WQ.Q.GEQYWM.
C6AQB8_AGGAN/28-245--------------------------------------------------------------------WKLG.YQH.WQ.
C8N8Z6_9GAMM/23-235--------------------------------------------------------------------WQ.R.WAE.HP.
A6W243_MARMS/22-235--------------------------------------------------------------------WK.D.WLY.NQ.
Q3IC51_PSEHT/8-234--------------------------------------------------------------------LA.T.WIQ.PE.
A4TU44_9PROT/10-227--------------------------------------------------------------------WA.A.WDG.QA.
Q1QTW3_CHRSD/12-234--------------------------------------------------------------------WR.A.WQP.GR.

PF00195

CHS3_BROFI/3-229PNICAFMAP.SLDARQDIVVTEVPKLAKEAAVRAIK------EWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPS
2PS_GERHY/7-233PTMCEFMAP.SLNARQDLVVTGVPMLGKEAAVKAID------EWGLPKSKITHLIFCTTAGVDMPGADYQLVKLLGLSPS
O82145_HYDMC/6-232PNMCTFAAP.SIDGRQDIVVKEIPKLAKEAASKAIK------EWGQPKSNITHLVFCTTSGVDMPGCDYQLTRLLGLRPS
O23674_ARATH/11-236PELTTEGSP.TIKQRLEIANEAVVEMALEASLGCIK------EWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRND
CHSD_PETHY/2-228PNICESMAP.SLDARTNIYAVEVPKLGKEAAEKAIE------EWNQPKSRITHLVFCTTTGVSMPGADFQLTKLLGLGSS
O81305_ARATH/4-229PELATEGSP.TIKQRLEIANDAVVQMAYEASLVCIK------EWGRAVEDITHLVYVSSSEFRLPGGDLYLSAQLGLSNE
VPS_HUMLU/4-230PHLCEYNAP.SLNTRQDMLVVEVPKLGKEAAINAIK------EWGQPKSKITHLIFCTGSSIDMPGADYQCAKLLGLRPS
CHSA_IPOPU/8-234PNLCTYNEA.SLNTRQDILVSEVPKLGKDAAMKAIK------EWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSS
O24484_PINRA/9-234PELAVEGSA.TVRQRLEISNVAVTDMAVDACRDCLK------EWGRPVSEITHLVYVSSSEIRLPGGDLYLASRLGLRSD
O23811_ORYSA/9-234PELRTEGTP.TLTPRLDICNAAVLELGATAARAALG------EWGRPAADITHLVYISSSELRLPGGDLFLATRLGLHPN
THS1_VITVI/2-228PNIGAYMAP.SLNIRQEIITAEVPRLGRDAALKALK------EWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETS
CHSF_PETHY/2-228PSICEHKAP.SFDARQDIVVVEVPKLGKEAAQNAIK------EWGQPKSKITHLVFCTTTGVDMHGADYQLTKLLGLSPS
CHS2_HORVU/4-230PKICAHMET.SLDARHAIALVEVPKLGQGAAEKAIK------EWGQPLSKITHLVFCTTSGVDMPGADYQLTKLLGLSPT
CHSB_PETHY/5-231PTLCSHNEP.SLDIRQDILVSEIPKLGKEAALKAIG------EWGQPKSTITHLVFCTRSGVDMPGADCQLVKLLGLSPS
O22122_SCUBA/2-228DNFTAYEAP.SLDARQDIVVVEIPKLGKEAAQKAIK------EWGQPKSKITHVIFCTTSGVDMPGADYQITKLLGLRPS
CHS3_GERHY/8-234PSMCKFMAP.SLDARQDLVVVEVPKLGKEAATKAIK------EWGFPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPS
CHSG_PETHY/2-231PNICEHKAP.SLNARQEIAVAEAPKLGKRAAQKAIE------EWSQSKSKITHLVFCTTTSVELPGADYQLTKLLGLSPS
CHSY_PINSY/7-233PKVCEYMAP.SLDARQDMVVVEVPRLGKEAAAKAIK------EWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPS
BBS_PHASS/2-228PCFSTFMDK.SLNVRQEVAISEIPKLGAKAATKAIE------DWGQPKSRITHLIFCTTSGMDLPGADYQLTQILGLNPN
THS1_ARAHY/2-228PNMCAYKAP.SLDAREDMMIREVPRVGKEAATKAIK------EWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPS
DPS1_PINST/7-234PELCAFLEVPSLDTRQAMLAAEVPRLGKEAAEKAIE------EWGQPKSRITHLIFCTTTTPDLPGADFEVAKLLGLHPS

PF08545

FABH_STRPQ/106-183--------------------------------------------------------------------------------
FABH1_VIBVU/106-183--------------------------------------------------------------------------------
O68915_9ACTO/119-188--------------------------------------------------------------------------------
Q7P488_FUSNV/107-185--------------------------------------------------------------------------------
O65985_THETR/112-190--------------------------------------------------------------------------------
Q63N14_BURPS/119-199--------------------------------------------------------------------------------
Q6MR21_BDEBA/112-191--------------------------------------------------------------------------------
Q7CTU0_AGRT5/109-187--------------------------------------------------------------------------------
FABH1_BACTN/110-188--------------------------------------------------------------------------------
FABH_YERPE/106-183--------------------------------------------------------------------------------
Q8ED66_SHEON/118-189--------------------------------------------------------------------------------
FABH3_STRCO/108-188--------------------------------------------------------------------------------
FABH_GLOVI/106-183--------------------------------------------------------------------------------
FABH2_DEIRA/113-191--------------------------------------------------------------------------------
Q8EDA9_SHEON/104-182--------------------------------------------------------------------------------
FABH_STRLI/115-192--------------------------------------------------------------------------------
Q8P810_XANCP/217-297--------------------------------------------------------------------------------
Q5FUN7_GLUOX/112-191--------------------------------------------------------------------------------
Q8XRP5_RALSO/110-188--------------------------------------------------------------------------------
FABH_THETN/110-188--------------------------------------------------------------------------------
FABH_CHLTE/107-186--------------------------------------------------------------------------------
Q7TTZ7_RHOBA/109-186--------------------------------------------------------------------------------
FABH2_BACAN/108-186--------------------------------------------------------------------------------
Q73Q42_TREDE/107-187--------------------------------------------------------------------------------
FABH_SPIOL/175-254--------------------------------------------------------------------------------
Q9A8B2_CAUCR/171-240--------------------------------------------------------------------------------
FABH_LISMF/106-184--------------------------------------------------------------------------------
Q67RA0_SYMTH/112-193--------------------------------------------------------------------------------
FABH_HELPY/109-188--------------------------------------------------------------------------------
Q72LL0_THET2/104-182--------------------------------------------------------------------------------
PQSD_PSEAE/107-188--------------------------------------------------------------------------------
FABH_CLOTE/108-185--------------------------------------------------------------------------------
FABH_SILPO/108-191--------------------------------------------------------------------------------
FABH_BARQU/107-191--------------------------------------------------------------------------------
FABH_PASMU/106-183--------------------------------------------------------------------------------
Q5WUL0_LEGPL/115-194--------------------------------------------------------------------------------
FABH_SYMTH/109-187--------------------------------------------------------------------------------
Q7NZ26_CHRVO/150-229--------------------------------------------------------------------------------
O04439_ALLPO/173-252--------------------------------------------------------------------------------
FABH_RHOCA/108-191--------------------------------------------------------------------------------
Q64Y53_BACFR/101-177--------------------------------------------------------------------------------
Q7NV97_CHRVO/105-183--------------------------------------------------------------------------------
FABH1_LACPL/108-188--------------------------------------------------------------------------------
Q820X4_COXBU/124-203--------------------------------------------------------------------------------
Q8RL75_PSEFL/107-186--------------------------------------------------------------------------------
FABH1_STRAW/116-193--------------------------------------------------------------------------------
FABH_PROMP/113-191--------------------------------------------------------------------------------
FABH_PSEAE/105-185--------------------------------------------------------------------------------
FABH_AQUAE/105-183--------------------------------------------------------------------------------
FABH_HELHP/110-189--------------------------------------------------------------------------------
FABH_CAUCR/106-189--------------------------------------------------------------------------------
FABH_BLOFL/106-183--------------------------------------------------------------------------------
FABH_RICCN/106-184--------------------------------------------------------------------------------
FABH2_STAES/108-186--------------------------------------------------------------------------------
FABH_METCA/108-185--------------------------------------------------------------------------------
Q577P4_BRUAB/109-185--------------------------------------------------------------------------------
FABH2_VIBPA/107-185--------------------------------------------------------------------------------
Q6A930_PROAC/116-193--------------------------------------------------------------------------------
Q74CS1_GEOSL/106-184--------------------------------------------------------------------------------
Q6FAK4_ACIAD/154-233--------------------------------------------------------------------------------
FABH_BRAJA/109-193--------------------------------------------------------------------------------
Q8DBH1_VIBVU/106-187--------------------------------------------------------------------------------
FABH_SHEON/106-183--------------------------------------------------------------------------------
FABH_CLOAB/106-183--------------------------------------------------------------------------------
Q9K3G9_STRCO/109-186--------------------------------------------------------------------------------
Q73S66_MYCPA/111-193--------------------------------------------------------------------------------
Q81RV7_BACAN/105-186--------------------------------------------------------------------------------
Q5YNV7_NOCFA/117-194--------------------------------------------------------------------------------
Q93H15_STRAW/88-168--------------------------------------------------------------------------------
FABH_NEIG1/108-185--------------------------------------------------------------------------------
FABH_ANAMM/107-189--------------------------------------------------------------------------------
Q6MAF5_PARUW/110-188--------------------------------------------------------------------------------
Q82PP5_STRAW/108-187--------------------------------------------------------------------------------
FABH2_LACPL/107-188--------------------------------------------------------------------------------
FABH_EHRRG/107-186--------------------------------------------------------------------------------
FABH2_STRCO/112-192--------------------------------------------------------------------------------
Q7U427_SYNPX/113-191--------------------------------------------------------------------------------
FABH_PHOLL/106-183--------------------------------------------------------------------------------
Q9KHD3_STRGR/140-219--------------------------------------------------------------------------------
Q8L2P3_PSEFL/107-183--------------------------------------------------------------------------------
Q5X5H2_LEGPA/108-187--------------------------------------------------------------------------------
FABH4_STRCO/108-188--------------------------------------------------------------------------------
FABH_TROWT/107-184--------------------------------------------------------------------------------
FABHL_CAMJE/116-191--------------------------------------------------------------------------------
Q66B09_YERPS/117-195--------------------------------------------------------------------------------
FABH_WOLTR/107-194--------------------------------------------------------------------------------
FABH_NOSS1/108-185--------------------------------------------------------------------------------
FABH_DESVH/108-177--------------------------------------------------------------------------------
FABH_STRT2/106-183--------------------------------------------------------------------------------
Q9I4X1_PSEAE/123-201--------------------------------------------------------------------------------
Q7M7Z5_WOLSU/107-186--------------------------------------------------------------------------------
FABH_PORGI/110-188--------------------------------------------------------------------------------
Q5QWT4_IDILO/106-184--------------------------------------------------------------------------------
Q6MLJ5_BDEBA/110-190--------------------------------------------------------------------------------
Q5NL87_ZYMMO/111-190--------------------------------------------------------------------------------
Q98K75_RHILO/87-167--------------------------------------------------------------------------------
FABH1_DEIRA/107-185--------------------------------------------------------------------------------
FABH_PROMA/113-191--------------------------------------------------------------------------------
Q5WEX8_BACSK/106-184--------------------------------------------------------------------------------
FABH_MYCPA/116-193--------------------------------------------------------------------------------
FABH_NITEU/106-183--------------------------------------------------------------------------------
Q74GF6_GEOSL/107-185--------------------------------------------------------------------------------
FABH_HAEIN/106-183--------------------------------------------------------------------------------
Q62FY9_BURMA/115-194--------------------------------------------------------------------------------
Q8GE37_HELMO/110-188--------------------------------------------------------------------------------
FABH_AGRT5/107-190--------------------------------------------------------------------------------
FABH5_STRCO/105-185--------------------------------------------------------------------------------
Q847B9_NODSP/110-191--------------------------------------------------------------------------------
Q885B9_PSESM/110-188--------------------------------------------------------------------------------
Q63PP7_BURPS/122-199--------------------------------------------------------------------------------
FABH_STRMU/106-183--------------------------------------------------------------------------------
FABH_SYNP6/111-188--------------------------------------------------------------------------------
FABH_LACLA/106-184--------------------------------------------------------------------------------
FABH_STRPN/106-183--------------------------------------------------------------------------------
Q97KV2_CLOAB/114-194--------------------------------------------------------------------------------
Q8F686_LEPIN/117-195--------------------------------------------------------------------------------
FABH_STAEQ/106-184--------------------------------------------------------------------------------
FABH_CHRVO/107-184--------------------------------------------------------------------------------
FABH1_BACCR/106-184--------------------------------------------------------------------------------
O30202_ARCFU/103-177--------------------------------------------------------------------------------
FABH_AROAE/109-186--------------------------------------------------------------------------------
Q64Y55_BACFR/113-190--------------------------------------------------------------------------------
FABH_MYCBO/116-193--------------------------------------------------------------------------------
Q5KSM6_9ACTO/107-185--------------------------------------------------------------------------------
FABH_SYNY3/110-187--------------------------------------------------------------------------------
Q8KE19_CHLTE/7-93--------------------------------------------------------------------------------
FABH2_BACSU/107-185--------------------------------------------------------------------------------
FABH_RALSO/114-191--------------------------------------------------------------------------------
FABH_CLOPE/106-184--------------------------------------------------------------------------------
FABH_PORPU/105-182--------------------------------------------------------------------------------
Q9EV93_CLOST/253-336--------------------------------------------------------------------------------
Q8KND4_MICEC/107-187--------------------------------------------------------------------------------
Q7P5B4_FUSNV/90-168--------------------------------------------------------------------------------
Q7B6G5_STRHY/115-192--------------------------------------------------------------------------------
Q6LQM2_PHOPR/106-184--------------------------------------------------------------------------------
FABH_CAMJE/108-185--------------------------------------------------------------------------------
Q5YPR0_NOCFA/115-192--------------------------------------------------------------------------------
FABH_COXBU/109-186--------------------------------------------------------------------------------
Q63N13_BURPS/108-189--------------------------------------------------------------------------------
Q82KT2_STRAW/108-188--------------------------------------------------------------------------------
Q65LQ9_BACLD/110-188--------------------------------------------------------------------------------
Q982F9_RHILO/108-186--------------------------------------------------------------------------------
Q81JE9_BACAN/109-187--------------------------------------------------------------------------------
Q5NF70_FRATT/108-185--------------------------------------------------------------------------------
FABH_PROMM/113-192--------------------------------------------------------------------------------
Q6AET2_LEIXX/120-197--------------------------------------------------------------------------------
Q7NZW4_CHRVO/106-186--------------------------------------------------------------------------------
Q6AQA3_DESPS/118-189--------------------------------------------------------------------------------
FABH_GRATL/107-186--------------------------------------------------------------------------------
FABH_CHLPN/114-193--------------------------------------------------------------------------------
FABH_DESPS/106-184--------------------------------------------------------------------------------
FABH_XANCP/110-187--------------------------------------------------------------------------------
Q767G6_9ACTO/120-198--------------------------------------------------------------------------------
Q8RC81_THETN/108-187--------------------------------------------------------------------------------
Q5YNJ2_NOCFA/116-193--------------------------------------------------------------------------------
Q67MB7_SYMTH/116-197--------------------------------------------------------------------------------
FABH_CHLMU/106-185--------------------------------------------------------------------------------
Q5QZ39_IDILO/107-184--------------------------------------------------------------------------------
Q884Y8_PSESM/108-185--------------------------------------------------------------------------------
Q9KHD4_STRGR/142-220--------------------------------------------------------------------------------
FABH2_BACHD/109-187--------------------------------------------------------------------------------
Q5X356_LEGPA/131-209--------------------------------------------------------------------------------
Q5X4S4_LEGPA/109-187--------------------------------------------------------------------------------
Q7KWI9_PLAF7/153-231--------------------------------------------------------------------------------
Q65LD5_BACLD/106-184--------------------------------------------------------------------------------
FABH_ENTFA/107-184--------------------------------------------------------------------------------
Q8RC85_THETN/112-193--------------------------------------------------------------------------------
Q93HA0_STRAW/106-185--------------------------------------------------------------------------------
FABH_OCEIH/106-184--------------------------------------------------------------------------------
FABH_THEEB/108-185--------------------------------------------------------------------------------

PF08392

Q9FW59_ORYSJ/25-322IIGGGDARPD..RLAEGMEEMDETFHAVLDELFARSSAAGGGG.VRPA.DVDLLVVNVSMFSPAPSLSARVVRRYNLRED
KCS3_ARATH/23-313FFEGREQ.RP..TLQDGLSEMEEFYIDTIEKVLKRN......K.ISPS.EIDILVVNVSMLNSTPSLSARIINHYKMRED
Q8RXA6_TROMA/89-378VFKIPPR..V..YDAEERAEAEMLMFGAVDGLFEKI......S.VKPN.QIGVLVVNCGLFNPIPSLSSMIVNRYKMRGN
KCS11_ARATH/92-381VLNVPPN..P..CMKEARKEAETVMFGAIDELLAKT......N.VNPK.DIGILIVNCSLFNPTPSLSAMVVNHYKLRGN
KCS16_ARATH/71-366LQTLPLQ..Q..NLAVSRIETEEVIIGAVDNLFRNT......G.ISPS.DIGILVVNSSTFNPTPSLSSILVNKFKLRDN
O23738_BRANA/70-368LLQVPPR..K..TFAAAREETEQVIIGALENLFKNT......N.VNPK.DIGILVVNSSMFNPTPSLSAMVVNTFKLRSN
KCS2_ARATH/74-363IHSIPPR..P..TMAAAREEAEQVIFGALDNLFENT......K.INPR.EIGVLVVNCSLFNPTPSLSAMIVNKYKLRGN
Q84K36_TROMA/115-405VMSTEVN.SS..TMSEGRLEATTVMFDALDELFEKT......K.VRPK.DVGVLVVNCSIFNPTPSLSAMIINHYKMRGN
Q75M74_ORYSJ/23-315VLDGREG.EP..THGDSLGEMEDFFGDSIAELFART......G.FGPR.DVDVLVVNASMFSPDPSLASMIVHRYGMRED
KCS14_ARATH/52-334MLTSPPT..P..SMYEARHESELVIFGALNSLFKKT......G.IEPR.EVGIFIVNCSLFNPNPSLSSMIVNRYKLKTD
Q41301_SIMCH/101-390VTKVPPE..P..SIAAARAEAEEVMYGAIDEVLEKT......G.VKPK.QIGILVVNCSLFNPTPSLSSMIVNHYKLRGN
Q650T5_ORYSJ/56-349LHHIPPA..A..THGEAIREAHMLFFPALDDLFAKT......G.VPPS.SVGAVVVNCSGFCAAPSLSAIIANRYGMPSD
Q7XZE7_MARPO/111-400LHRLPAN..A..NMAEARNEAEEVMFGALDELFEKT......K.VKPK.DIGILVVNCSLFNPTPSLSAMIVNKYHMRGN
Q9FV67_LIMDO/93-382IGTIPAH..P..SMKAARREAELVMFGAIDQLLEKT......K.VNPK.DIGILVVNCSLFSPTPSLSSMIVNHYKLRGN
Q6DUV5_BRANA/114-403ITSNPPK..L..NMSEARAEAEAVMFGALDSLFEKT......G.IKPA.EIGILIVNCSLFSPTPSLSAMIVNRYKMRQD
Q6K3E6_ORYSJ/23-314VLDARED.CP..TLRDALDEMDDFFDDAVAAVLARA......A.VSPR.DVDLLVINVGSFSPSPSLADRVVRRFGLRDD
Q688V9_ORYSJ/93-381MHLIPPE..P..TMANARAEAESVMFGALDKLFKFT......G.VKPK.DVGVLVVNCSLFNPTPSLSAMIVNKYKLRGN
Q5Z6R6_ORYSJ/79-372NLYLPPR..T..GMEEARDEAEIVVFAAVGDLLART......R.IRPE.EIDVLVTNCSVFSPTPSFADMVVNRFKLRGD
Q8H7L2_ORYSJ/167-457VFEPGTN.CA..TMKEGRAEASAAMFAALDELFDKC......R.VRPK.DVGVLVVNCSLFNPTPSLSAMIVNHYKMRGN
KCS7_ARATH/38-328VHEIPPN..A..SISAAREETHEILFAIVQDLFSKH......E.IDPK.SIDILVSNCSLFCPSPSITSMIINKFGMRSD
Q8LQT7_ORYSJ/61-349YHYMPPD..R..SLRASRDESELVIFSAVDDVFARS......A.LTPA.DIDVLIVNCSIFTPTPVFADMVVNRYKLRAE
Q6Z6C7_ORYSJ/95-384VLREPPN..P..SMAEARREAEAVMFGAVDDLLAKT......G.VSAK.EIGVLVVNCSLFNPTPSLSAMVVNHYKLRGN
KCS20_ARATH/42-333LMEIPLK..K..SLSSVKIETMTTIFTSVEDLLRKN......K.LSPR.SIDILITNCSLHSPSPSLSAMVINKFHMRSN
Q84VI8_MARPO/119-408VLRVPPN..P..NMHEARLEAETVMFGALDELFEKT......G.VKPK.EVGILVVNCSLFNPTPSLSAMIVNHYKMRGN
Q9XEP1_SORBI/93-380LTSSPPN..P..CMAEARREAEAVMFGAVDQLLAKT......G.VRAG.DIGIVVVNSGLFSPTPSLSAMIVHHYKLRRD
Q7XZE8_MARPO/116-405ILASPPN..P..CMREAREEAAMVMFGALDELFEQT......G.VKPK.EIGVLVVNCSLFNPTPSMSAMIVNHYHMRGN
Q7XT16_ORYSJ/77-368FRYIPPE..S..GIEASREEAELVIFSAVDKAFAAA......TGLVPADDIGTVILACSFTTPTPSLADVVVRRYGLRAD
Q670P4_LESFE/67-364LLNVPPI..Q..TMAAAREETEQVIFNAIDNLLANT......K.VNTR.DIGIIIVNSSMFNPTPSLSAMVVNKYKLRST
Q6K558_ORYSJ/43-332IFSGEFQ..K..TQAFAVQEAEEGLFATVAHLLAKS......D.VRPR.DVGFVVVACSMFSPAPSLASMIVRRFGMPPG
Q93XD5_LESFE/69-366LHQVPPQ..K..TFAAIKDETEQVIKGALENLFENT......K.VNPR.EIGILVINSSMFNPTPSLSAMVINTFKLRSN
KCS21_ARATH/24-318VLEGRED.SP..TLLDAHSEMDEIMFDTLDKLFHKTK....GS.ISPS.DIDILVVNVSLFAPSPSLTSRVINRYKMRED
Q6F365_ORYSJ/100-389VLNIPPN..P..SMANARKEAEMVMYGALDELLAKT......G.VNPK.DIGILVVNCSLFNPTPSLSAMVVNHYKLRGN
Q6TMJ4_DICDI/114-404ITKKSPD..V..SMESAREEAQLVLSGCLDSLFAKT......G.LKPQ.EIDILIVNCSLFNPTPSLAAMMMNRYKMRSD
Q75M84_ORYSJ/26-319LLDGREE.LA..AQRDSVDEMDACFDGAVPELLART......G.LRAR.DVDVLVVNVNGFFPEPCLASRVVRRYGMRED
Q5Z6S3_ORYSJ/79-368HHYIPTY..KYCTLEAARAEVDLVVFSAVDELFAKT......G.VSPD.DVDILVVNCSLFCPTPSFVDMIVNRYKLRSD
Q7XEM4_ORYSJ/93-383LISLPVD..M..CLRTAREESHAVIFGVVDEVLRKS......G.VAAA.DVGVLIFNSSLLSPTPSFTSLIVNRYGMRPG
O81658_HEMSP/97-387IQARPPK..L..SMAEARLEAETVMFGCLDALFEST......G.INPSRDIGILIVNCSLFNPTPSLSAMIVNHYKMRED

PF01154

HMCS1_RAT/13-186---------------------------------------------------------WPKDVGIVALEIYFPSQYVDQAE
HMCS2_RAT/50-223---------------------------------------------------------WPKDVGILALEVYFPAQYVDQTD
HMCS2_BLAGE/4-176---------------------------------------------------------WPEDVGIIGIEMIFPSLYVDQAE
HMCS_YEAST/45-216---------------------------------------------------------RPQNVGIKGIQIYIPTQCVNQSE

PF02797

THS1_VITVI/238-388---------------------------------LI-SENIEKCLTQAFDPLGIS......DWNSLFWIAHPGGP---AI-
O81305_ARATH/238-383---------------------------------KI-EDNVEEFCKKLVAKAGSGA....LELNDLFWAVHPGGP---AI-
O23811_ORYSA/244-389---------------------------------KI-ENRIEGFCRTLMDRVGIK......EFNDVFWAVHPGGP---AI-
CHSF_PETHY/238-388---------------------------------LV-SQNIEKSLVEVFQPLGIF......DWNSIFWVGHAGGR---EI-
CHSG_PETHY/241-391---------------------------------VI-SQNIERRLVEVFKPLGIS......DWNSIFWVAHPGGP---AI-
CHSA_IPOPU/244-394---------------------------------LI-TQNVEDCLVKAFEPFGIS......DWNSIFWILHPGGN---AI-
CHS3_BROFI/239-389---------------------------------LI-SKNIQKCLLDAFKPLGVH......DWNSIFWIAHPGGP---AI-
O23674_ARATH/245-393---------------------------------KI-EENIEEFCKKLMGKAGDES....MEFNDMFWAVHPGGP---AI-
O22122_SCUBA/238-388---------------------------------LI-SKNIEKSLKEAFAPLGIS......DWNSLFWIVHPGGP---AI-
O24484_PINRA/245-390---------------------------------II-EDHIEGFCRKLMDKAGVD......DYNELFWGVHPGGP---AI-
BBS_PHASS/239-389---------------------------------IV-SKNVGKCLEEAFTPFGIS......DWNSIFWVPHPGGR---AI-
VPS_HUMLU/241-391---------------------------------LI-SQNIEKSLIEAFTPIGIN......DWNNIFWIAHPGGP---AI-
DPS1_PINST/244-394---------------------------------LI-STNIEKCLVEAFSQFNIS......DWNQLFWIAHPGGH---AI-
CHS2_HORVU/240-390---------------------------------LI-SENIEQALEDAFEPLGIH......NWNSIFWIAHPGGP---AI-
CHSB_PETHY/241-391---------------------------------TI-AKNVESCLIKAFEPLGIS......DWNSLFWILHPGGN---AI-
CHS3_GERHY/244-394---------------------------------LI-AKNIEKALIQAFSPLNIN......DWNSIFWIAHPGGP---AI-
CHSD_PETHY/238-388---------------------------------LI-SNNIEKSLVEVFQPLGIS......AWNSIFWVAHPGGP---AI-
O82145_HYDMC/242-398---------------------------------LV-SDNIENTLVEAFTPILMDSIDSIIDWNSIFWIAHPGGP---AI-
2PS_GERHY/243-393---------------------------------MV-AKNIENAAEKALSPLGIT......DWNSVFWMVHPGGR---AI-
CHSY_PINSY/243-393---------------------------------LI-SKNIEKSLVEAFQQFGIS......DWNQLFWIAHPGGP---AI-
THS1_ARAHY/238-388---------------------------------II-SQNINGALSKAFDPLGIS......DYNSIFWIAHLGGR---AI-

PF08541

Q7CTU0_AGRT5/239-328---------------------------------LT-AADI--------------------SR----FVPHQANA---RM-
FABH_PROMM/246-335---------------------------------TA-PESL--------------------DW----LLLHQANQ---RI-
Q73Q42_TREDE/222-311---------------------------------IN-MEDV--------------------DL----VVCHQANK---RI-
FABH_PSEAE/233-322---------------------------------WQ-ASDL--------------------HH----LVPHQANT---RI-
FABH_CHRVO/230-319---------------------------------VE-QASL--------------------DW----LVPHQANL---RI-
Q6RC13_MYCUL/216-307---------------------------------TS-IAEI--------------------DY----FGLIGIGI---PS-
FABH_DESVH/241-330---------------------------------FT-TEDV--------------------DL----VIPHQANL---RI-
FABH_LISMF/221-310---------------------------------LE-KEDL--------------------DL----LIPHQANI---RI-
Q5YPR0_NOCFA/241-333---------------------------------VG-LDEI--------------------EV----FIPHQANL---RI-
FABH2_STRCO/230-319---------------------------------WD-LADV--------------------DA----FVGHQANL---RI-
Q5KSM6_9ACTO/237-326---------------------------------VV-PDDI--------------------DH----FVPHQANG---TM-
Q5WEX8_BACSK/220-309---------------------------------LG-KEDV--------------------DF----LVPHQANI---RI-
FABH_NOSS1/239-328---------------------------------LT-VDQI--------------------DW----LLLHQANQ---RI-
Q67RA0_SYMTH/248-336---------------------------------YR-TQDI--------------------DY----LAILHMKR---SA-
Q5NF70_FRATT/234-323---------------------------------IK-ASDI--------------------DW----LVPHQANY---RI-
Q7M7Z5_WOLSU/238-327---------------------------------LT-SKEI--------------------HH----FIPHQANY---RI-
FABH2_VIBPA/235-324---------------------------------LT-TEQI--------------------DV----VIPHQANI---RI-
Q847B9_NODSP/248-337---------------------------------YL-ITEV--------------------DF----LLTNQVKK---SL-
Q7NZ26_CHRVO/282-372---------------------------------IA-PEGV--------------------RR----FWLHQANL---AM-
FABH_AQUAE/220-309---------------------------------VK-PEEV--------------------SL----VIPHQANV---RI-
FABH1_STRAW/264-354---------------------------------IT-SDDL--------------------DV----FIPHQANE---RI-
FABH_TROWT/231-321---------------------------------VQ-PGDL--------------------NA----FIPHQANI---RI-
Q63N14_BURPS/258-347---------------------------------LR-TDDI--------------------DA----MVFHQPSE---IL-
FABH_HELHP/239-328---------------------------------IN-PQDV--------------------SF----FIPHQANL---RI-
Q8PJG1_XANAC/243-332---------------------------------IA-AAAL--------------------RC----LVPHQASG---GG-
FABH3_STRCO/240-329---------------------------------WR-VADV--------------------DW----LVSHQANH---RI-
FABH_PROMP/245-334---------------------------------FN-SEKI--------------------NW----LLLHQANQ---RI-
Q65LQ9_BACLD/237-326---------------------------------ME-LKDI--------------------DW----FVPHSANL---RM-
FABH_CLOAB/234-323---------------------------------LN-IEDI--------------------DY----IVPHQANI---RI-
FABH_AROAE/232-321---------------------------------VT-VDSV--------------------DW----LIPHQANI---RI-
Q7X5N4_PSEAI/289-378---------------------------------AS-KDEV--------------------DY----FVFHQANR---MI-
FABH_ARATH/314-403---------------------------------LP-ASAI--------------------DW----LLLHQANQ---RI-
FABH_STRPN/233-324---------------------------------IE-VTDL--------------------DY----LLLHQAND---RI-
Q5FUN7_GLUOX/235-324---------------------------------LT-GQDI--------------------QW----MVPHQANL---RI-
Q93KW7_STRVR/244-335---------------------------------IG-MADV--------------------AR----VSFMNYHA---KW-
Q9L1V9_STRCO/246-337---------------------------------LE-PGDV--------------------TR----VCHVFTGQ---ES-
Q8GHC0_9ACTO/249-339---------------------------------VD-ARDI--------------------KT----VVIHSMPR---QA-
Q8DBH1_VIBVU/241-329---------------------------------VT-LRDI--------------------DY----FLPHQASA---HG-
Q67G55_9ACTO/244-335---------------------------------LA-LPEI--------------------DW----VVLPHFGR---LR-
Q63CM4_BACCZ/243-331---------------------------------YT-PKDI--------------------KV----LLPLHTKR---SM-
FABH2_STRAW/225-314---------------------------------LT-PADL--------------------AG----VVLHQANL---RI-
O34266_XANCA/346-435---------------------------------TE-TTAL--------------------RC----LIPHQASG---GG-
Q87XT2_PSESM/282-372---------------------------------IN-ISDV--------------------KR----FWLHQANL---SM-
Q884Y8_PSESM/221-307---------------------------------LT-PDDI--------------------DA----FCIHQGSA---AI-
FABH_STRT1/232-320---------------------------------.E-KGEP--------------------DY----FLLHQANI---RI-
Q93HA0_STRAW/239-330---------------------------------VK-LGDI--------------------DW----YVLPNLGR---TR-
FABH2_LACPL/239-328---------------------------------LE-SSDI--------------------KA----FVLHQANA---RI-
FABH2_BACSU/234-323---------------------------------LS-SDDL--------------------DW----FVPHSANL---RM-
Q767G6_9ACTO/250-339---------------------------------LS-PDDI--------------------DH----VIPHQANG---RM-
FABH_SILPO/234-323---------------------------------LS-SADV--------------------DW----IVPHQANI---RI-
FABH_HAEDU/227-316---------------------------------LQ-KADL--------------------DW----LVPHQANI---RI-
Q7TTZ7_RHOBA/241-330---------------------------------LS-DDEI--------------------GH----YLFHQATW---KM-
Q64Y53_BACFR/237-323---------------------------------SS-LEDI--------------------DY----LVFHQSNK---FM-
FABH_RHOBA/256-345---------------------------------VS-SDQL--------------------SL----VVLHQANQ---RI-
Q7NV97_CHRVO/234-323---------------------------------GG-LNSI--------------------DC----VVPHQASH---LG-
Q5ZV11_LEGPH/238-327---------------------------------IT-LNDV--------------------DW----VVPHQASL---LA-
Q97KV2_CLOAB/245-334---------------------------------LK-KSDI--------------------KK----YFLSQFAV---QS-
Q8XTB9_RALSO/282-372---------------------------------HA-PADV--------------------RR----FWLHQANL---GM-
Q6A930_PROAC/241-331---------------------------------IT-PADL--------------------DV----FIPHQAND---RI-
FABH_STRLI/241-331---------------------------------LT-VGDL--------------------VA----FVPHQANL---RI-
FABH_SYNP6/242-331---------------------------------ID-RQEV--------------------DW----LLLHQANQ---RI-
Q8ED66_SHEON/250-340---------------------------------LT-PQSF--------------------KR----LWLHQANI---NM-
Q5SL76_THET8/230-319---------------------------------LT-PEDI--------------------RL----FVPHQANL---RI-
Q7P488_FUSNV/237-326---------------------------------LN-INDL--------------------SM----VFPHQANS---RI-
Q9KHD3_STRGR/256-345---------------------------------TK-MDEI--------------------DW----VVPHPGTG---QL-
Q7N8H1_PHOLL/221-311---------------------------------IT-MDDI--------------------SY----IIPHNVNI---LI-
Q6MLJ5_BDEBA/242-331---------------------------------VA-PEQV--------------------DW----IVPHQANK---RI-
FABH2_VIBVY/235-324---------------------------------MS-KDDI--------------------NV----VIPHQANI---RI-
Q82PP5_STRAW/243-333---------------------------------VG-VEDI--------------------SR----VVMPLIHR---GV-
FABH_PORPU/236-325---------------------------------IS-IDEV--------------------DW----FILHQANI---RI-
FABH_PROMA/245-334---------------------------------IV-PESL--------------------DW----LLLHQANQ---RI-
O68915_9ACTO/245-335---------------------------------IE-PEAL--------------------DA----FVPHQANL---RM-
FABH_BLOFL/229-318---------------------------------LQ-QDEL--------------------DW----LVPHQANL---RI-
Q8RHZ0_FUSNN/221-309---------------------------------MK-ISDI--------------------DM----VIPHQAS.---VA-
Q7X8V9_ORYSJ/337-426---------------------------------LP-ASSI--------------------DW----LLLHQANQ---RI-
Q93H15_STRAW/220-309---------------------------------WK-TDDV--------------------DH----FVPHQANL---RI-
FABH_CHLCV/243-332---------------------------------LA-EGDI--------------------DW----LVPHQANE---RI-
FABH_CLOTE/244-333---------------------------------LE-LKDI--------------------NY----IIPHQANL---RI-
Q88ES4_PSEPK/221-308---------------------------------LK-SSDI--------------------DA----FCIHQGSA---AI-
Q88EC1_PSEPK/299-389---------------------------------LQ-PGDV--------------------KR----FWLHQANL---SM-
FABH_THETN/240-329---------------------------------LT-PEDI--------------------DM----LIPHQANT---RI-
FABH_STRMU/234-325---------------------------------MP-VEAI--------------------DY----FLLHQANI---RI-
FABH1_BACAN/219-308---------------------------------LT-KEDV--------------------DF----LVPHQANI---RI-
FABH_STRP1/233-324---------------------------------IT-KDDI--------------------DY----CLLHQANR---RI-
FABH_SYNY3/241-330---------------------------------LT-TSDL--------------------DW----VILHQANQ---RI-
Q64RC8_BACFR/240-327---------------------------------LT-KDEI--------------------DW----VVPHQANQ---RI-
FABH_LACLA/234-325---------------------------------LS-AEEV--------------------DY----YLLHQANS---RI-
Q64NV1_BACFR/240-327---------------------------------LT-KDNI--------------------DW----IVPHQANM---RI-
FABH5_STRCO/237-326---------------------------------WS-PASV--------------------DR----FVGHQANA---RI-
Q5YN70_NOCFA/251-341---------------------------------IA-GRDV--------------------DA----FVTNQPNR---LF-
FABH_BRUME/234-323---------------------------------LT-AEDI--------------------DW----FVPHQANK---RI-
FABH2_BACHD/236-325---------------------------------MK-RNEI--------------------DW----FVPHSANL---RM-
Q5YNJ2_NOCFA/253-343---------------------------------VS-KEDI--------------------EV----FVPHQANA---RI-
FABH_CHLPN/245-334---------------------------------IQ-EEDI--------------------DW----FVPHQANE---RI-
Q885B9_PSESM/249-338---------------------------------VG-VSDV--------------------DL----FVFHQANH---FM-
Q82HI7_STRAW/252-343---------------------------------LR-PSDI--------------------TR----VTHVLSGG---PE-
Q6FAK4_ACIAD/280-370---------------------------------VN-PQDI--------------------KR----FWLHQANL---NM-
Q8VWB0_9ACTO/262-353---------------------------------AE-LADI--------------------DR----FVLPHMGR---KR-
Q6DAZ3_ERWCT/249-337---------------------------------FT-LEQM--------------------AA----VVPHQASH---LS-
FABH_SYMTH/239-328---------------------------------LT-VGDI--------------------DL----LVPHQANV---RI-
Q8CV20_OCEIH/48-137---------------------------------LN-IKDV--------------------DA----FCFSQFAL---TN-
Q9HYV7_PSEAE/259-349---------------------------------IQ-VAEV--------------------KR----FWLHQANL---NM-
Q5HTA7_CAMJR/252-338---------------------------------VD-EKDI--------------------AF----HLFHQSNA---YL-
FABH_GEOKA/219-308---------------------------------LT-KDDV--------------------DF----LIPHQANI---RI-
FABH2_VIBCH/235-324---------------------------------LS-TEEI--------------------DV----VIPHQANI---RI-
Q6AQA3_DESPS/255-342---------------------------------WR-NEEV--------------------DA----YCCHQVGV---AH-
FABH1_LACPL/238-323---------------------------------LT-PSDL--------------------QY----VICHQANL---RI-
Q9KHD4_STRGR/257-346---------------------------------LT-VDDI--------------------DW----FVPHQGNL---NM-
FABH_CHLMU/237-326---------------------------------LQ-EEDI--------------------DW----LVPHQANE---RI-
Q64Y55_BACFR/251-340---------------------------------IP-QEDI--------------------DC----FVFHQANR---FL-
Q8EDA9_SHEON/231-320---------------------------------VD-KDEV--------------------DL----VIPHQANE---RI-
Q6LQM2_PHOPR/234-323---------------------------------LD-SNDI--------------------DI----VIPHQANK---RI-
Q63PP7_BURPS/254-343---------------------------------TS-VDQY--------------------DA----FLFHQANL---FM-
FABH_COXBU/230-319---------------------------------LK-QSDI--------------------DW----LIPHQANL---RI-
Q8KND4_MICEC/245-336---------------------------------IG-TGDL--------------------AK----VSFMNYSR---EV-
FABH_ANAMM/233-322---------------------------------LD-VDSI--------------------DW----FIPHQANV---RI-
FABH2_BACAN/235-324---------------------------------MK-MDDI--------------------DW----FIPHSANL---RM-
Q5NL87_ZYMMO/234-323---------------------------------FS-ASQV--------------------DW----VVPHQANA---RI-
FABH_RHOCA/235-324---------------------------------LT-PEDV--------------------SW----IVPHQANL---RI-
FABH_THEEB/239-328---------------------------------CT-VEEI--------------------DW----LVLHQANQ---RI-
Q5LUY4_SILPO/282-372---------------------------------VA-NTHL--------------------KR----LWLHQANK---TM-
FABH1_STAES/222-311---------------------------------LS-SEDI--------------------DL----FVPHQANI---RI-
Q98AW4_RHILO/238-327---------------------------------MR-PQDI--------------------DR----FVPHQANA---RI-
Q8FHY5_ECOL6/258-346---------------------------------LQ-LDDI--------------------GT----VVPHQASH---LS-
Q6AET2_LEIXX/245-335---------------------------------VA-PEHL--------------------AA----FIPHQANM---RI-
Q81JE9_BACAN/240-329---------------------------------YS-LADI--------------------DL----IVPHQASG---PA-
Q6MR21_BDEBA/243-332---------------------------------KK-PSDI--------------------KH----FFITQFNV---QS-
FABH_STRA5/232-323---------------------------------LE-KEDI--------------------DY----LFLHQANR---RI-
Q5QZ39_IDILO/231-320---------------------------------LQ-AHDL--------------------DW----LIPHQANL---RI-
FABH_BORPE/239-328---------------------------------VE-VDDI--------------------DW----LIPHQANV---RI-
Q74CS1_GEOSL/236-325---------------------------------LT-PADI--------------------SL----FIPHQANR---RI-
FABH_NITEU/229-318---------------------------------LQ-PSDI--------------------DW----LIPHQANI---RI-
FABH_WOLTR/237-326---------------------------------LK-ITDI--------------------DW----LVPHQANI---RI-
Q98K75_RHILO/223-313---------------------------------LT-PQAI--------------------RR----FWLHQANA---RM-
Q9K3G9_STRCO/229-319---------------------------------LT-WDDI--------------------GA----FVPHQCNG---RL-
FABH_GLOVI/237-326---------------------------------VA-PEQV--------------------KA----YLLHQANQ---RI-
Q5WUL5_LEGPL/257-346---------------------------------KE-KNEI--------------------TW----IIPHQVNR---KL-
Q8EG66_SHEON/260-347---------------------------------WL-VEQV--------------------DK----VICHQVGA---SN-
Q63PP9_BURPS/255-344---------------------------------EP-RENI--------------------DC----FVLHQANR---FM-
Q7NZW4_CHRVO/228-317---------------------------------RS-LAEV--------------------RY----LLINHGDE---DM-
Q8RC85_THETN/250-338---------------------------------YT-PSDI--------------------GY----LAILHMKR---SA-
Q6MAF5_PARUW/240-329---------------------------------LQ-ESDV--------------------SW----LIPHQANK---RI-
FABH_EHRRG/230-319---------------------------------LS-IDEV--------------------NW----FVLHQANI---RI-
Q5QWT4_IDILO/232-321---------------------------------MT-TDDI--------------------DA----LIPHQANK---RL-
Q67MB7_SYMTH/254-342---------------------------------FR-PEEI--------------------RF----VGMLHTKR---SL-
Q8CL25_YERPE/90-178---------------------------------LT-LADI--------------------AT----VIPHQASH---LS-
FABH1_DEIRA/233-322---------------------------------LS-NADV--------------------DW----LIPHQANI---RI-
Q9I4X1_PSEAE/253-342---------------------------------LG-SDDI--------------------DY----FVFHQPAP---FL-
Q7B6G5_STRHY/240-330---------------------------------LD-VADL--------------------AA----FIPHQANA---RI-
FABH_GRATL/239-328---------------------------------LS-IQDV--------------------NW----LLLHQANK---RI-
FABH1_VIBCH/227-316---------------------------------MH-KSEL--------------------DW----LVPHQANY---RI-
O77078_PLAFA/282-371---------------------------------IN-IEDI--------------------NY----FIFHQANI---RI-
Q73S66_MYCPA/245-335---------------------------------LP-AKDI--------------------DL----LVTNQPNR---AF-
FABH_HELPJ/239-328---------------------------------LK-PEDV--------------------RL----FIPHQANF---RI-
FABH_NEIG1/231-320---------------------------------YT-AEQI--------------------DW----IVPHQANR---RI-
Q63N13_BURPS/243-332---------------------------------LA-LGDI--------------------GL----VVPHQPNL---RI-
FABH2_STAES/235-324---------------------------------YS-IEDL--------------------NW----FVPHSANA---RM-
FABH_ERWCT/228-317---------------------------------LD-KSEL--------------------DW----LVPHQANL---RI-
Q8FWG7_BRUSU/237-326---------------------------------ML-PQAI--------------------DR----FFPHQANI---RI-
FABH_CLOPE/235-324---------------------------------IK-IEDI--------------------AA----IIPHQANL---RI-
Q820X4_COXBU/239-326---------------------------------VN-LNEI--------------------.Y----FIGHQANL---MM-
FABH_PORGI/240-327---------------------------------LS-HDDI--------------------TW----VVPHQANL---RI-
Q72KF2_THET2/241-329---------------------------------YT-EADL--------------------DY----LALLHMKR---SA-
FABH_BARQU/235-324---------------------------------IN-SSQL--------------------DW----FVPHQANK---RI-
FABH_CAMJR/230-319---------------------------------IL-AQEI--------------------DL----FIPHQANL---RI-
Q82NC9_STRAW/244-334---------------------------------VA-TADI--------------------DV----LITNQPNR---TF-
FABH_RHIME/234-323---------------------------------TT-ADDI--------------------DW----LVPHQANR---RI-
FABH_RALSO/237-326---------------------------------VE-SSQI--------------------DW----LIPHQANI---RI-
Q5ZTD0_LEGPH/246-335---------------------------------LT-ISDI--------------------QW----LVPHQGNK---NL-
Q82KT2_STRAW/240-329---------------------------------WR-IDDV--------------------DR----FAAHQANA---RI-
Q8GE37_HELMO/240-329---------------------------------WE-KEDI--------------------DF----FIPHQANM---RI-
Q8F686_LEPIN/233-322---------------------------------LT-IDDV--------------------DW----VVPHPGTD---VV-
FABH_RICTY/228-317---------------------------------FS-VSDI--------------------DY----FIPHQANI---RI-
Q54816_STRPE/249-340---------------------------------AG-LDDI--------------------SR----VVLPHMGW---RR-
FABH_OCEIH/221-310---------------------------------LS-RDDV--------------------DY----LVPHQANI---RI-
FABH_SHEON/230-319---------------------------------ID-KSEI--------------------DW----LVPHQANF---RI-
FABH_DESPS/235-324---------------------------------VS-PHEI--------------------KL----LIPHQANI---RI-
FABH_XANCP/236-325---------------------------------LD-THDL--------------------DW----LIPHQANL---RI-
FABH_CHLTE/239-328---------------------------------LT-AETI--------------------DW----LVPHQANQ---RI-
Q5ZVP7_LEGPH/228-317---------------------------------LK-KSDI--------------------DW----LIPHQANI---RI-
FABH_BURPS/240-329---------------------------------LA-SEQV--------------------DW----LIPHQANI---RI-
FABH_MYCBO/242-332---------------------------------VR-PDQI--------------------DV----FVPHQANS---RI-
Q8RC81_THETN/237-325---------------------------------YK-VKDI--------------------DH----IFFTQINK---SV-
Q5YNV7_NOCFA/248-338---------------------------------LS-TDDL--------------------RA----MIPHQANG---RI-
FABH_METCA/232-321---------------------------------LQ-KSDV--------------------DW----LVPHQANI---RI-
FABH2_DEIRA/239-328---------------------------------KT-TADI--------------------DW----LVPHQANI---RI-
PQSD_PSEAE/242-329---------------------------------LT-LDDI--------------------DH----VICHQPNL---RI-

PF02803

FADA_PSEFR/265-390---------------------------------LN.MADI--------------------DF----IELNEAFA---AQ-
THIL_ZOORA/269-391---------------------------------WK.IGDL--------------------DL----VEANEAFA---AQ-
THIL_YEAST/274-397---------------------------------IEDINSV--------------------DY----FEFNEAFS---VV-
THIB_CANTR/274-396---------------------------------LT.VDRV--------------------DF----FELNEAFS---VV-
FADA_ECOLI/261-386---------------------------------LS.ASDI--------------------GV----FEMNEAFA---AQ-
YKA3_CAEEL/305-445---------------------------------LT.LKDV--------------------DV----FEIHEAFA---GQ-
THIL_HUMAN/306-426---------------------------------LK.KEDI--------------------AM----WEVNEAFS---LV-
THLA_CLOAB/269-391---------------------------------WT.VDEL--------------------DL----IESNEAFA---AQ-
ATOB_ECOLI/270-392---------------------------------LQ.LADI--------------------DL----IEANEAFA---AQ-
THL_BACSU/270-392---------------------------------LT.VQDI--------------------DL----FEVNEAFA---SV-
THIL_CUPNH/270-392---------------------------------WT.PQDL--------------------DL----MEINEAFA---AQ-
THIM_HUMAN/273-395---------------------------------LS.LKDM--------------------DL----VEVNEAFA---PQ-
THIKA_RAT/298-421---------------------------------LT.VNDI--------------------DI----FEINEAFA---SQ-
YQEF_ECOLI/269-391---------------------------------WQ.LAEV--------------------DL----IEANEAFA---AQ-
THIK_YEAST/296-416---------------------------------LQ.VQDI--------------------DI----FEINEAFA---AQ-
THIKA_CANTR/287-407---------------------------------LT.VDDI--------------------DV----FEINEAFA---AQ-
FADA4_MYCLE/270-392---------------------------------IS.VEQL--------------------DV----VEINEAFA---AV-
THIL_PARDE/268-390---------------------------------WS.VGDL--------------------DL----VEANEAFA---AQ-
THIL_THIVI/271-393---------------------------------WA.PADL--------------------DL----VEANEAFA---AQ-
THIK_YARLI/291-413---------------------------------LT.VNDV--------------------DV----FEINEAFA---SQ-
ECHB_RAT/332-472---------------------------------LT.MNDI--------------------DA----FEFHEAFS---GQ-
ATOB_HAEIN/270-392---------------------------------IN.LDDI--------------------DL----IEANEAFA---SQ-

PF02801

PKSJ_BACSU/4829-4945---------------------------------ASVNNDG--------------------.RTAGPATPNLEAQ..KEV.
PKSL_BACSU/4322-4438---------------------------------AAINNDG--------------------.RTAGPSSPNLEAQ..KDV.
Q44222_NOSS1/297-409---------------------------------ISIGQSH--------------------TKVDGESVNQACQQ......
Q18559_CAEEL/5488-5604---------------------------------FAINNDG--------------------HSRASFMAPNPAGQ..LKC.
Q17301_CAEBR/2504-2620---------------------------------FAISNDG--------------------ISRASFMAPNPAGQ..QKC.
O33906_9GAMM/317-434---------------------------------VGLSNDG--------------------.KGQFVLSPNPKGQ..VKA.
Q18559_CAEEL/244-354---------------------------------SAFNSDG--------------------.KTPSLTAPNPISQ..YEV.
Q17301_CAEBR/1503-1611---------------------------------WAVGHNG--------------------NS.SSLFTPNGISQ......
P95029_MYCTU/2816-2942---------------------------------AQSFG.D--------------------GVHTSIPAPGLGALGAGRGG
Q59497_CORAM/2789-2913---------------------------------EASY...--------------------GAHTSIPAPGLGALGAGRGR
PKSF_BACSU/257-367---------------------------------WSIKLDG--------------------...NRNPDPSLEGE..IHV.
P74017_SYNY3/244-356---------------------------------WGFSCDA--------------------LHRSTPAFDNHSAQ...QA.
FABF_SHIFL/255-370---------------------------------FGMSS.D--------------------AYHMTSPPENGAGA..ALA.
FABF_VIBHA/255-371---------------------------------FGMSG.D--------------------AYHMTSPSEDGSGG..ALA.
O54440_PSEAI/255-370---------------------------------FGMSG.D--------------------AFHMTAPPEDGAGA..ARC.
O67612_AQUAE/256-371---------------------------------YGATD.D--------------------AYHITSPHECGEGA..YEC.
FABF_BACSU/254-369---------------------------------YGSTG.D--------------------AYHITAPAQDGEGG..ARA.
FABF_SYNY3/258-373---------------------------------YAMTC.D--------------------AYHITAPVPDGRGA..TRA.
Q9ZCH8_RICPR/269-384---------------------------------YGSTG.D--------------------AYHMTAPHPKGRGA..YRA.
O13355_NEUCS/272-392---------------------------------YGCSG.D--------------------AHHMTAPRDDGSGA..FLS.
CEM1_YEAST/273-391---------------------------------YGLSS.D--------------------ACHITSPPADGNGA..KRA.
OXSM_SCHPO/262-380---------------------------------YGLAS.D--------------------SYHITAPNPNGDAA..YYA.
Q9ZLS2_HELPJ/258-370---------------------------------YGESG.D--------------------ANHITAPAPEGEGA..FRA.
Q54208_STRGA/261-376---------------------------------QGISA.D--------------------SHDIVQPEPEGRGI..AHA.
O33878_PSEAI/252-360---------------------------------YGATS.D--------------------GYDMVAP..SGEGA..IPC.
FABB_HAEIN/253-361---------------------------------YGATS.D--------------------GYDMVAP..SGEGA..ERC.
FABB_ECOLI/254-362---------------------------------YGATS.D--------------------GADMVAP..SGEGA..VRC.
O84775_CHLTR/256-371---------------------------------TYTTC.D--------------------AFHITAPRDDGEGI..TAC.
O82520_CAPCH/330-444---------------------------------GAITC.D--------------------AHHITDPRADGLGV..SSC.
KASC1_ARATH/315-429---------------------------------GAVNC.D--------------------AHHMTDPRADGLGV..SSC.
O54149_STRCO/253-365---------------------------------HGASA.D--------------------AHHVTAPDPEGAGA..LRA.
Q9Z4Y3_STRCO/251-363---------------------------------HADTS.D--------------------AHHPTAPRPDGAGA..AAA.
FAB1_MYCTU/262-374---------------------------------AGITS.D--------------------AFHMVAPAADGVRA..GRA.
FAB2_MYCTU/262-375---------------------------------ASITS.D--------------------GFHMVAPDPNGERA..GHA.
Q93458_CAEEL/101-214---------------------------------YGISS.D--------------------CYHISTPDPSAIGA..VLS.
P70719_AGGAC/260-369---------------------------------YGANSDG--------------------.AHVTRPQKD.TMQ...RC.
Q48375_KIBAR/261-376---------------------------------YASRC.N--------------------AFHMTGLRPDGKEM..AEA.
Q9ZGD7_STRCY/261-376---------------------------------YASRC.N--------------------AFHMTGLRPDGREM..GEA.
KAS1_STRCM/259-373---------------------------------YATRS.N--------------------AYHMTGLR.DGAEM..AEA.
KAS1_STRVN/260-375---------------------------------YATRS.Q--------------------AYHMTGLKKDGREM..AES.
Q53671_STRAA/259-374---------------------------------FASRC.N--------------------AYHMTGLRPDGIEM..AEA.
KAS1_STRRM/264-379---------------------------------YAGRC.N--------------------AYSMTGLRSDGREL..AEA.
KASA_STRCO/303-418---------------------------------YATRC.N--------------------AYHMTGLKADGREM..AET.
Q54217_STRGR/260-375---------------------------------YASRG.N--------------------AFHMTGLRSDGAEL..AAA.
KAS1_STRCO/261-376---------------------------------YATFG.N--------------------AYHMTGLTKEGLEM..ARA.
KAS1_STRCN/260-375---------------------------------YATFG.N--------------------AYHMTGLTSEGLEM..ARA.
O32451_9ACTO/267-382---------------------------------YATRG.N--------------------AYHMTGLKPDGREM..AEA.
KAS1_STRGA/264-379---------------------------------FATRS.N--------------------AFHMTGLKPDGREM..AEA.
Q54495_STRNO/265-380---------------------------------FATRC.N--------------------AFHMTGLRPDGREM..AEA.
Q54994_9ACTO/260-375---------------------------------YATRC.N--------------------AYHMTGLTPHGREM..AEA.
NOE4_RHIML/246-359---------------------------------VGLSA.D--------------------AFHITAPAVHGPES....A.
NODE_RHIS3/247-360---------------------------------IGLSA.D--------------------AFNLVSPAVEGPEA....A.
NODE_RHILT/247-360---------------------------------IGLSG.D--------------------AYDIVMPSIEGPEA....A.
Q53672_STRAA/255-365---------------------------------YAATF.D--------------------PPPGRGGT...PQL..ARA.
Q54496_STRNO/253-363---------------------------------YAATF.D--------------------PPPGSGRP...PNL..LRA.
Q54995_9ACTO/268-378---------------------------------YAATF.D--------------------PPAGSGRP...PGL..ERA.
KAS2_STRVN/258-365---------------------------------R...R.D--------------------PAPGSGRP...PAL..GRA.
O32452_9ACTO/253-363---------------------------------YAATF.D--------------------PPPGSGRP...PTL..ERA.
Q54815_STRPE/272-382---------------------------------YGASF.D--------------------PPPGSGRP...SAL..ARA.
KAS2_STRGA/256-366---------------------------------HASTF.D--------------------ARPGTGRP...TGP..ARA.
KASB_STRCO/251-361---------------------------------CASTF.D--------------------PAPGSGRP...AGL..ERA.
Q54174_STRFR/256-366---------------------------------YGSTL.D--------------------PRPGSGRP...AGL..RKA.
Q56164_9ACTO/252-362---------------------------------YGSTF.D--------------------PRPGSGRE...PGL..RKA.
Q48376_KIBAR/256-366---------------------------------YGATF.D--------------------PRPASGRE...PTL..RKA.
Q9ZGD6_STRCY/253-363---------------------------------YGSTF.D--------------------PRPGSGRE...PRL..RRA.
Q54282_SACHI/249-359---------------------------------YAATF.D--------------------PAPGSERP...PAL..RRA.
Q54218_STRGR/260-370---------------------------------YSATL.D--------------------PRPGSGRE...PGL..RRA.
KAS2_STRCM/252-360---------------------------------LAR...L--------------------PAPHSGRG...STR..AHA.
KAS2_STRCO/264-377---------------------------------HAATFTG--------------------AGRWAESR...EGL..ARA.
KAS2_STRCN/263-375---------------------------------HAATFTG--------------------ASHWDQSR...EGL..AHA.
FAS_HUMAN/243-360---------------------------------AGTNTDG--------------------FKEQGVTFPSGDIQ..EQL.
FAS_CHICK/243-360---------------------------------AGSNTDG--------------------FKEQGVTFPSGEMQ..QQL.
P91871_CAEEL/279-396---------------------------------AKSNTDG--------------------HKEHGITFPSGERQ..AQL.
O01678_BOMMO/265-382---------------------------------AKTNCDG--------------------YKEQGITYPAGHIQ..KLL.
O01677_BOMMO/269-386---------------------------------AKTNYGT--------------------NVNADEFLPIREPKEIQEF.
WA_EMENI/634-754---------------------------------AYTNHSA--------------------EA.VSITRPHVGAQ..AFI.
PKSL1_ASPPA/629-750---------------------------------AKTNHSA--------------------MS.ESMTRPHVGAQ..IDN.
P79068_GLOLA/639-760---------------------------------TATNHSA--------------------DA.ISITHPHGPTQ..SIL.
O54142_STRCO/811-926---------------------------------VGASN..--------------------.DAKSLIAPDADGQ..ARA.
P71718_MYCTU/262-379---------------------------------SCLNSDG--------------------.LSDGLTAPSGDAQ..TRL.
O33954_STRFR/2834-2952---------------------------------SAVNQDG--------------------.ASNGLTAPSGPSQ..ERV.
O30480_STRHY/290-406---------------------------------TAVNQDG--------------------.ASNGLTAPTGPSQ..QRV.
O30482_STRHY/292-408---------------------------------TAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O30479_STRHY/1233-1349---------------------------------TAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O30481_STRHY/292-408---------------------------------TAVNQDG--------------------.ASNGLTAPNGPAQ..QRV.
Q9ZGI5_9ACTO/1367-1485---------------------------------SALNQDG--------------------.ASNGLTAPNGPSQ..QRV.
Q9ZGI2_9ACTO/293-411---------------------------------SAINQDG--------------------.ASNGLTAPHGPSQ..QHL.
Q9ZGI3_9ACTO/295-413---------------------------------SAVNQDG--------------------.ASNGLTAPHGPSQ..QRV.
O65933_MYCTU/289-405---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
P95814_STRSQ/5664-5780---------------------------------SAVTSDG--------------------.ASNGLTAPNGLAQ..QRV.
Q54299_STRHY/5475-5591---------------------------------SAVNSDG--------------------.ASNGLTAPNGTSQ..QRV.
OL56_STRAT/296-414---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O52789_AMYMD/1984-2100---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O54593_AMYMD/1958-2076---------------------------------SAVNSDG--------------------.ASNGLTAPNGPSQ..QRV.
O54593_AMYMD/287-403---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O52790_AMYMD/292-408---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O54666_AMYMD/888-1004---------------------------------SAVNQDG--------------------.ASNGLTAPNGLSQ..QRV.
O52545_AMYMD/293-411---------------------------------SAVNQDG--------------------.ASNGLTAPNGPAQ..QRV.
O54666_AMYMD/3430-3546---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
Q50469_MYCTU/301-419---------------------------------SAVNQDG--------------------.ASNGLTAPNGLAQ..QRV.
O53490_MYCTU/289-408---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
Q54297_STRHY/5130-5246---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O54666_AMYMD/2452-2568---------------------------------SAVNSDG--------------------.ASNGLTAPNGPSQ..QRV.
O33956_STRFR/1814-1932---------------------------------SAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
O33955_STRFR/283-401---------------------------------SAVNQDG--------------------.ASNGLTAPNGRAQ..RQV.
O30767_9ACTO/301-418---------------------------------TAVNQDG--------------------.ASNGLTAPSGPAQ..QKV.
O30764_9ACTO/1265-1382---------------------------------TAVNQDG--------------------.ASNGLTAPSGPAQ..QQV.
O30768_9ACTO/298-415---------------------------------TAVNQDG--------------------.ASNGLTAPSGPAQ..QKV.
O30766_9ACTO/1721-1838---------------------------------TAVNQDG--------------------.ASNGLTAPSGPAQ..QNV.
O33958_STRFR/296-414---------------------------------TAVNQDG--------------------.ASNGLTAPNGPAQ..QRV.
ERYA2_SACER/288-406---------------------------------SALNQDG--------------------.ASNGLSAPSGPAQ..RRV.
ERYA3_SACER/285-403---------------------------------SAVNQDG--------------------.ASNGLTAPSGPAQ..QRV.
Q9Z3T8_PSESX/297-415---------------------------------TAINQDG--------------------.ASNGLTAPSGPAQ..EQV.
ERYA2_SACER/1747-1863---------------------------------SAVNQDG--------------------.ASNGLAAPNGPSQ..ERV.
Q9ZGA4_9ACTO/3036-3152---------------------------------SAVNSDG--------------------.ASNGLSAPNGPAQ..QRV.
ERYA1_SACER/763-879---------------------------------TAVNSDG--------------------.ASNGLSAPNGRAQ..VRV.
Q9ZGI5_9ACTO/2862-2980---------------------------------TAVNQDG--------------------.ASNGLTAPNGPSQ..QRV.
Q9ZGA4_9ACTO/1436-1552---------------------------------SAVNQDG--------------------.ASNGLSAPNGVAQ..QRV.
Q9Z3T9_PSESX/864-981---------------------------------SAVNQDG--------------------.ASNGLTAPNGTAQ..QQV.
Q9ZGA4_9ACTO/6250-6366---------------------------------SAVNQDG--------------------.ASNGLSAPNGPSQ..ERV.
ERYA3_SACER/1748-1866---------------------------------SAINQDG--------------------.ATNGLAAPSGVAQ..QRV.
ERYA1_SACER/2234-2352---------------------------------SAVNQDG--------------------.ASNGLSAPSGVAQ..QRV.
MCAS_MYCBO/263-377---------------------------------TATNQDG--------------------.RTETLTMPSEDAQ..VAV.
O53901_MYCTU/271-385---------------------------------TAANQDG--------------------.HTVNIATPSRSAQ..VAA.
PHAS_MYCTU/282-396---------------------------------TSANQDG--------------------.HTVNIATPSQPAQ..VAA.
O50436_MYCTU/264-378---------------------------------TAANQDG--------------------.RTVNIAAPSAQAQ..IAV.
O05170_STRVR/291-409---------------------------------SAFNQDG--------------------.RTNGIMAPCGQAQ..EHV.
Q49932_MYCLE/290-405---------------------------------SAVNQDG--------------------.RSNGVTAPNTAAQ..CDV.
Q49940_MYCLE/293-408---------------------------------SATNQDG--------------------.RSNGMTAPNALAQ..RDV.
Q49933_MYCLE/296-416---------------------------------SAVNQDG--------------------.ASSGVTVPNGPAQ..QEL.
Q92217_COCHE/272-388---------------------------------TGCNQDG--------------------.KTPGITMPNSVSQ..EAL.
O86335_MYCTU/354-472---------------------------------SAVNQDG--------------------.KSNGIMAPNPSAQ..IGV.
P78584_ASPPA/269-387---------------------------------TAVAQDG--------------------.RTNGIMAPNQKAQ..ELV.
Q00290_ASPTE/302-420---------------------------------SAVAQDG--------------------.KTNGIMAPNAKAQ..ELV.
MSAS_PENPA/290-408---------------------------------SAVCQDG--------------------.KTNGIMAPNSVAQ..QLA.
P87001_PENPA/302-422---------------------------------SAVASDG--------------------.KTLGIMAPNAQAQ..ILV.
Q9ZGI5_9ACTO/346-464---------------------------------SAVNNGG--------------------.AAQGMTTPDAQAQ..EAV.
O30764_9ACTO/259-377---------------------------------VATGNDG--------------------.GGPGLTVPDRAGQ..EAV.
O33954_STRFR/279-399---------------------------------GAVNNDG--------------------.GGASLTTPDREAQ..EAV.
O54155_STRCO/1041-1159---------------------------------SALGHGG--------------------.RANGLTAPRSTAQ..RAV.
PPSA_MYCTU/359-477---------------------------------SAVNQDG--------------------.RSNGLMAPNPAAQ..MAV.
O53579_MYCTU/374-492---------------------------------SAVNHDG--------------------.RSNGLIAPNQDAQ..ADV.
O51828_PSEFL/298-416---------------------------------SAVNNDG--------------------.ASSGITVPNIHAQ..EEV.
O51827_PSEFL/1281-1399---------------------------------SAVNHDG--------------------.ACAGLTVPNGPAQ..EAL.
O51827_PSEFL/269-384---------------------------------SAINQDG--------------------.ASAGQTVPNANAQ..AAV.
Q18559_CAEEL/2133-2242---------------------------------VNVNHGG--------------------.RSVSLTAPNGVAH..KML.
O96554_CRYPV/3296-3416---------------------------------WGCNHVG--------------------.RSASLTAPNGPAQ..TCV.
O96554_CRYPV/5522-5642---------------------------------SATNHNG--------------------.RSASLTAPNGPSQ..TEV.
O96554_CRYPV/1142-1260---------------------------------SSVNHNG--------------------.RSASLTAPNGISQ..QNV.
O06586_MYCTU/230-347---------------------------------SAVGNAG--------------------HSATGLTVPSVAGQ..VDV.
O54511_YEREN/284-402---------------------------------SAVNNDG--------------------NRKVGYTAPSVAGQ..QAV.
PPSE_MYCTU/270-390---------------------------------SAINNDG--------------------SAKMGYAAPNPAAQ..ADV.
PKSR_BACSU/1766-1891---------------------------------SGVSHGG--------------------.RGMSLHAPNPAGM..KDA.
PKSM_BACSU/3776-3894---------------------------------SGVNYDG--------------------.KTNGITAPNPFSQ..AEL.
PKSL_BACSU/3126-3244---------------------------------SGINQDG--------------------.KTNGITAPSAKSQ..MDL.
PKSJ_BACSU/2018-2137---------------------------------IGVNNDG--------------------ADKVGFYAPSVKGQ..ADV.
PKSL_BACSU/2189-2307---------------------------------TAINHGG--------------------.KTNGYSVPNPNAQ..ADV.
PKSM_BACSU/2562-2680---------------------------------SAINSGG--------------------.KTNGYTVPNPHAQ..AQV.
PKSR_BACSU/785-903---------------------------------SFANHSG--------------------.GRQMYTAPDPKQQ..AKL.
PKSM_BACSU/655-773---------------------------------SAINHVG--------------------.KVSGITVPSPVAQ..ADV.
PKSL_BACSU/695-813---------------------------------SAVNHVG--------------------.TVSGISVPSPVSQ..ADL.
PKSJ_BACSU/3597-3724---------------------------------TAENHGG--------------------.RANTLTSPNPKAQ..ADL.
O30776_NOSP7/342-460---------------------------------IGTSSDG--------------------.RYKSIYASRKEGQ..VKA.
O33904_9GAMM/316-434---------------------------------VGASSDG--------------------.KFKSIYAPRPSGQ..AKA.
O54142_STRCO/307-424---------------------------------CALRHEA--------------------RPGIFRYSLSAAHR..RAA.

PF08540

HMCS_SCHPO/176-446---------------------------------GAYANYNVRD....VAKN..GKSQGLGLDRFDYCIFHAPTC---KQ-
Q5A3Z7_CANAL/178-450---------------------------------NCYKNYSKK.....ITGD..ANKTVGVYDHFDFSAFHVPTC---KL-
HMCS_ARATH/175-451---------------------------------SCYKHLCNK..FEKIE......GKEFSINDADYIVFHSPYN---KL-
HMCS2_BLAGE/177-455---------------------------------HCYPRFCSK..TEKYLKRCGKENTKIDLDYFDAFVFHSPYC---KL-
HMCS2_HUMAN/224-506---------------------------------RCYTSYRKK..IQNQWKQAGS.DRPFTLDDLQYMIFHTPFC---KM-
HMCS_CAEEL/183-448---------------------------------MTYTYFISK..VNRHT......TGIDGLNSFDGVFLHSPFT---KM-
HMCS1_BLAGE/174-451---------------------------------HCYQLYCSK..IQKQL......GEKFDIERLDAVLFHAPYC---KL-
HMCS_YEAST/217-490---------------------------------QVYKSYSKKAISKGLVSDPAGSDALNVLKYFDYNVFHVPTC---KL-
HMCS1_RAT/187-469---------------------------------RCYSVYRKK..IRAQWQKEGK.DKDFTLNDFGFMIFHSPYC---KL-
P93773_PINSY/178-452---------------------------------SCYKRFCNK..FEKEE......GRQFSLLDTDYIAFHSPYN---KL-

PF00108

THIL_ZOORA/3-262AVLERA-------G..VAAG.-.EVNEVILGQVLPAGE.GQNPARQAAMKA--GVPQEATAWGMNQLCGSGLRAVALGMQ
THIL_YEAST/2-267GALAKV-------P.ELDASK-.DFDEIIFGNVLSANL.GQAPARQVALAA--GLSNHIVASTVNKVCASAMKAIILGAQ
FADA_PSEFR/5-258KVLERN-------S.KVDPG.-.EVEDVIWGCVNQTLEQGWNIARMASLMT--QIPHTSAAQTVSRLCGSSMSALHTAAQ
THIB_CANTR/3-267AALAKV-------P.QIKPQ.-.DVDEIVFGGVLQANV.GQAPARQVALKA--GLPDSIIASTINKVCASGMKAVIIGAQ
THIL_THIVI/2-264ALIERT-------G..IAPE.-.QVSEVILGQVLTAGC.GQNPARQTTLMA--GLPHTVPAMTINKVCGSGLKAVHLAMQ
THLA_CLOAB/1-262EAVKKA-------G..IKPE.-.DVNEVILGNVLQAGL.GQNPARQASFKA--GLPVEIPAMTINKVCGSGLRTVSLAAQ
THIL_CUPNH/1-263AALERA-------G..VKPE.-.QVSEVIMGQVLTAGS.GQNPARQAAIKA--GLPAMVPAMTINKVCGSGLKAVMLAAN
YKA3_CAEEL/23-298ALVEKT-------K..LPYE.-.QLDHIICGTVIQECK.TSNIAREAALLA--GVPDKIPAHTVTLACISSNVAMTTGMG
YQEF_ECOLI/1-262ALIERT-------G..VPAY.-.AVDEVILGQVLTAGA.GQNPARQSAIKG--GLPNSVSAITINDVCGSGLKALHLATQ
THIL_PARDE/1-261AVVERA-------G..IDPS.-.EVSETILGQVLTAAQ.GQNPARQAHIKV--GLPRESAAWVINQVCGSGLRTVALAAQ
THIM_HUMAN/4-266AALSAG-------K..VSPE.-.TVDSVIMGNVLQSSSDAIYLARHVGLRV--GIPKETPALTINRLCGSGFQSIVNGCQ
ECHB_RAT/52-325GLLYRT-------N..IPKD.-.VVDYIIFGTVIQEVK.TSNVAREAALGA--GFSDKTPAHTVTMACISSNQAMTTAVG
ATOB_ECOLI/1-263AAIERA-------K..IDSQ.-.HVDEVIMGNVLQAGL.GQNPARQALLKS--GLAETVCGFTVNKVCGSGLKSVALAAQ
FADA_ECOLI/1-254SLLARN-------P.ALEAA.-.ALDDIYWGCVQQTLEQGFNIARNAALLA--EVPHSVPAVTVNRLCGSSMQALHDAAR
ATOB_HAEIN/1-263EAIKRA-------N..IESA.-.LVNEVIMGNVLQAGL.GQNPARQAALKA--GIEKEIPSLTINKVCGSGLKSVALGAQ
FADA4_MYCLE/1-263AALKKA-------N..VAPS.-.IVQYVIIGQVLTAGA.GQMPARQAAVAA--GIGWDVPALTINKMCLSGLDAIALADQ
THIKA_RAT/35-291AVLQDV-------K..LKPE.-.CLGDISVGNVLEPGA.GAVMARIAQFLS--GIPETVPLSAVNRQCSSGLQAVANIAG
THIK_YARLI/27-284GLVKES-------....KIDP-KLIGDVVCGNVLA.AGAGATEHRAACLVA--GIPETVPFVALNRQCSSGLMAVNDVAN
THIK_YEAST/33-289EFIGRF-------PEPLRADL-NLIEEVACGNVLN.VGAGATEHRAACLAS--GIPYSTPFVALNRQCSSGLTAVNDIAN
THIL_HUMAN/39-299GAIEKA-------G..IPKE.-.EVKEAYMGNVLQGGE.GQAPTRQAVLGA--GLPISTPCTTINKVCASGMKAIMMASQ
THIKA_CANTR/24-280EFIKKT-------....NIDP-SLIEDVAIGNVLN.QAAGATEHRGACLAA--GIPYTAAFIAVNRFCSSGLMAISDIAN
THL_BACSU/1-263EALQQA-------G..VSGD.-.DVEGNVMGMVVQAGS.GQIPSRQAARLA--GMPWSVPSETLNKVCASGLRAVTLCDQ

PF00109

Q18559_CAEEL/5257-5480GICSTG..................NNKY..........LLKNPF..............GFDNKFFNLTDEDARVLDPQVR
Q18559_CAEEL/1-236NRNNIA.........LLP......VEKNY.....LSDFREKHPEVKAALVD....GIEYFDDQYFGTGESEAICMDPQQR
Q18559_CAEEL/1888-2129GKNASS.........RIPATR.VPTRNTL...ISGSKYGNPVEG..GNFITQ...DVTQFDPSFFKISKSEAELIDPQQR
Q18559_CAEEL/4241-4474N..............TVKQKL.HNRSLKQ...DHARVALLDSDA.............RYWDPEYFGIRPSEAKFIDPQQR
Q18559_CAEEL/824-1057SRLTTG.........KIS........DIR.....KKQCEGDAGLEVGLLKQ....DISMFDNSFFAIAKDEAEFLDPQHR
FAS_HUMAN/1-239GVDMVT...........DDDR.RWKAGLY...GLPRRSGKLKDL.............SRFDASFFGVHPKQAHTMDPQLR
PKSM_BACSU/2319-2554GRNCIE.........EIPKDR.WDWKAYY...DKEKGKEGSIYTKWGGFIK....DMDKFDPLFFQISPLEAERMDPQER
PKSL_BACSU/433-687GKDCVS.........EIPESR.WDWQRLE...GITSPSGKDISK.WGGFID....DPDCFDPQFFRITPREAETMDPQER
Q92217_COCHE/11-264GRESRA.........EVQAKK.WDPEGFY...HPDSSRHGTHNVEYGHWFQQ...DVYNFDAPFFNVSPAEAAALDPQQR
PKSR_BACSU/1528-1758GKNCVS.........EVPKER.WDWRKY.....AAADKEGQSSLQWGGFIE....GIGEFDPLFFGISPKEAANMDPQEF
P91871_CAEEL/37-275GEDLVT.........EDS.LR.WTPGFCD.....LPKRHGKLKV............LNKFDAGFFQVTPKQANFMDPQVR
PKSM_BACSU/393-647GTDCIT.........EIPNSR.WEWKESD...GLDSPAGKPLSK.WGGFIE....EADCFDPQFFRISPREAEMMDPQER
PKSJ_BACSU/4588-4821GRSSIG.........PIPAER.WGCKTPY........YAGVIDG............VSYFDPDFFLLHEEDVRAMDPQAL
PKSJ_BACSU/3339-3589GKDSIT.........EVPKDR.WDWREHY...GNPDTDVNKTDIKWGGFID....GVAEFDPLFFGISPREADYVDPQQR
PKSL_BACSU/4082-4314GRSAIA.........PVP......PERF...........GNSSSNYAGLID....EMNRFDHDFFMMSESDVRAMDPQAL
PKSR_BACSU/527-777GDNCIT.........EAPESR.WRTSLLK..TLSKDPKKPANKKRYGGFLQ....DIEAFDHQLFEVEQNRVMEMTPELR
PKSF_BACSU/6-249GRHAFD.........VMK......RSGRQ...KDSRFIGAEIAS.............LSYPDRLSKKMLR...KASFSSR
PKSJ_BACSU/1760-2010GKESIA.........FFN..K.EELQRFG...ISKEIAENADYVPAKASID....GKDRFDPSFFQISPKDAEFMDPQLR
PKSL_BACSU/1926-2181GRDCIT.........EIPADR.WDHSLYY...DEDKDKPGKTYSKWGGFMK....DVDKFDPQFFHISPREAKLMDPQER
PKSL_BACSU/2873-3118ARNAIR.........DIPTSR.WDVDKYY...DPVLNKKGKVYCKSMGMLD....DIEHFDPLFFNIPPSEAELMDPQHR
PKSM_BACSU/3529-3768GKSCIS.........DIPGER.RDWGRA.......NRDPEKAVPRWGAFLK....DIDRFDPLFFQISPKEAESMDPRQR
ERYA2_SACER/1488-1739GANLTT.........GFPADRGWDIGRLY...HPDPDNPGTSYVDKGGFLT....DAADFDPGFFGITPREALAMDPQQR
ERYA2_SACER/30-280GGETLS.........GFPTDRGWDLARLH...HPDPDNPGTSYVDKGGFLD....DAAGFDAEFFGVSPREAAAMDPQQR
ERYA3_SACER/38-277GGDAIA.........EAPADRGWEPD.......PDARLGGMLAA............AGDFDAGFFGISPREALAMDPQQR
FABF_VIBHA/3-246GQSGIVN......IEHFD......ATNF......STRFAGLVKD.............FDCTEYMSKKDAR...KMDLFIQ
FABF_SHIFL/3-246GQSGISL......IDHFD......TSAY......ATKFAGLVKD.............FNCEDIISRKEQR...KMDAFIQ
ERYA3_SACER/1489-1739GGDAVT.........EMPTDRGWDLDALF...DPDPQRHGTSYSRHGAFLD....GAADFDAAFFGISPREALAMDPQQR
Q56164_9ACTO/2-243GKSGIGP......LTRFD......PTGY......PARLAGEVPG.............FAAEEHLPSRLLP...QTDRMTR
MCAS_MYCBO/5-255GDDLVT.........EIPPDR.WDADDYY...DPEPGVPGRSVSRWGGFLD....DVAGFDAEFFGISEREATSIDPQQR
OXSM_SCHPO/1-253GKSGIVS......LKGFP.......EYEQ....IPSKVAGVIP...RGK..E..KEEWNVLDYVDQGKLR...EVATFTQ
Q54281_SACHI/2-251GRTATRR......ISFFD......PTPN......RSQIAAECDFDPE.............HEGLSPREIR...RMDRAAQ
O51827_PSEFL/9-261GTDFVG.........PVPAERWDTAA.IY...DESAAETGTTYSKVGAFLE....HIDRFDAHYFGISASEAKEMDPQQR
PPSA_MYCTU/101-351RRSSIS.........QVPPQR.WQPFEGG...PPEVAAALARTTRWGSFLP....DIDAFDAEFFEISPSEADKMDPQQR
O82520_CAPCH/75-321GQSGISL......IDRFD......ASSY......TVRFAGQIRD.............FSSEGYIDGKNDR...RLDDCWR
O33954_STRFR/42-271GRGMPT.............................RQDDGT....WRAALE....DHAGFDAGFFGMNARQAAATDPQHR
Q48375_KIBAR/3-252GRTSTRG......ITFFD......PSAF......RSRVAAEADFDPY.............EHGLGPQEIR...RMDRAAQ
P95029_MYCTU/2548-2808AGTEIR..........VPR.....KTKLS......RVVGGQIPTG..............FDPTVWGISADMAGSIDRLAV
O54511_YEREN/26-276GRECSR.........RFTREE.LLAVGLD.....AAIIDDPHYVNIGTVLD....NADCFDATLFGYSRQEAESMDPQQR
O51828_PSEFL/39-290ATDAVG.........DMPSDRLYGTD.YY...HPDPQAPGKAYVMRGGFIE....GVDQFDPGFFGISPKEAEGMDPQQR
O67612_AQUAE/2-247GVSGVDY......IKSFN......PDEYG....IPVKIAAEVKD.............FNPEDFMDKKEAR...KASRFVQ
MSAS_PENPA/32-282QKSAMG.........EIPPMR.WEPYYRR...DARNEKFLKNTTSRGYFLD....RLEDFDCQFFGISPKEAEQMDPQQR
Q54282_SACHI/2-240GRHGISR......LSRFD......PTGY......PAELAGQVLD.............FDATEHLPKRLLP...QTDVSTR
Q59497_CORAM/2523-2781KGATAR..........VPR.....KATLT......RTVAGQMPDH..............FDAAKWGIPDHMLDALDRMAV
O30481_STRHY/33-284GTDAIS.........GFPDDRGWDMEGFF...DSDPAQEGTSYMREGGFLT....NATGFDPAFFGISPREAVAMDPQQR
Q17301_CAEBR/1267-1499N..RVK.........QPLQ....TRNAKT...EER.VALLDADLRY.............WDPEYFGIRPSEAGYLDSQQR
Q00290_ASPTE/44-294RKDASG.........EIPSMR.WEPYYRR...DIRNPKILDQTTKRGYFLD....HVENFDAAFFGVSPKEAEQMDPQQR
O54666_AMYMD/631-880RVDAVS.........EFPGDRGWDLDSLI...DPDRERAGTSYVGQGGFLH....DAGEFDAGFFGISPREAVAMDPQQR
O33904_9GAMM/30-308KIDAIT.........ELPSTH.WQPEEYY..DAD.KTAADKSYCKRGGFLP.....DVDFNPMEFGLPPNILELTDSSQL
Q9ZGI5_9ACTO/88-338GGQAVT.........DVPADR.WNAGDFY...DPDRSAPGRSNSRWGGFIE....DVDRFDAAFFGISPREAAEMDPQQR
Q54299_STRHY/5220-5467GTDAIS.........GFPTDRGWDVEGLF...DPDPDAAGKSYCVQGGFLD....TAADFDAPFFGISPREALGMDPQQR
O32452_9ACTO/7-245GVPVIGP......LTRFD......ASRY......PSPFGGEVPG.............FDAAERVPGRLIP...QTDHWTH
O13355_NEUCS/1-263SHSGIVS......VADLEP....QDKWKE....LTSTVGGLVPTPARNKQNVDEQHTWKAADWLEPSDQX...RMSLFAQ
O54142_STRCO/518-803GRDRIG.........PLPAEL.FDRDLYH...APGALALGRSYTDLGAPVP.....VPTQPPPGLRIPPHRYAATDAAQR
Q9ZGA4_9ACTO/2782-3028GGDAIT.........EFPTDRGWDLAALY...DPDPDAIGKVSVRHGGFLS....GAADFDAEFFGISPREALAMDPQQR
KAS1_STRCM/3-250GRTATRG......ITFFD......PAPF......RSKVAAEADFCGL.............ENGLSPQEVR...RMDRAAQ
Q54174_STRFR/5-246GTSGIAR......ISRFD......PSRY......PVQLAGEIEG.............FDAKGHLPGRLLP...QTDRMTQ
Q54218_STRGR/11-250GKNAIGP......VTRFD......ASGY......PARLAGEIRG.............FSAADHLPGRLVA...QTDRVTQ
Q17301_CAEBR/2273-2496G..VVS.........TGKE....NSLLKS...PFG......FDN..................KFFNITDEDAKMLDPQVR
FAB2_MYCTU/10-253RQSGIRT......LDDPF......VEEFD....LPVRIGGHLLE..............EFDHQLTRIELR...RMGYLQR
O30764_9ACTO/22-251GADAVV.............................TAADGR....RRGTID....APADFDAAFFGMSPREAAATDPQQR
Q9Z3T9_PSESX/605-856ERDAIS.........EYPTDRGWDTTKLY...DSEPGRFGKISTRTSGFLH....DASAFDPAFFGISPREALTLEPQQR
P70719_AGGAC/1-252KQNAVQ........AKAD.....WAERYP...ELEARLGAEIHG.............YQPPSHWNRKQLR...SLGRVSQ
O54440_PSEAI/3-246GRSGIAP......IEHMD......LSAY......STRFGGSVKG.............FNVEEYLSAKEAR...KLDLFIQ
Q9ZCH8_RICPR/7-260GVSGIKT......ITEFD......TSKL......ACKIAGVIDNS......E..QNGFKLENFTQADDINRLSKMDKFIH
O33954_STRFR/2575-2826ERDVIG.........AAPTDRGWDLDSVY...DPEPGVAGKTYVREGGFLH....DAAEFDAEFFGISPREAVAMDPQQR
O54149_STRCO/3-244GRSAGAR.......DERLA....GLPVD.....IACAVPGLQPAR................HVDRRSVLI....HDRFVQ
O06586_MYCTU/3-222GREAAG..........................................SID....NVADFDADFFNLSPREASAMDPRQR
P93117_CUPWR/105-350GVSGISE......IETFD......CTQF......PTRIAGEIKS.............FSTDGWVAPKLSK...RMDKFML
O54593_AMYMD/30-279GVDALS.........DFPDDRGWELDGLF...DPDPDHPGTSYTSQGGFLR....GAGLFDAGLFGISPREALVMDPQQR
Q49940_MYCLE/35-285GGDAIS.........EVPPDR.WDADAFY...DPDPSASGRMTTKWGGFVP....DVDAFDAEFFGITPREAVAMDPQHR
Q9ZGI2_9ACTO/34-285GKDLVS.........EVPEERGWDIDSLY...DPVPGRKGTTYVRNAAFLD....DAAGFDAAFFGISPREALAMDPQQR
PKSL1_ASPPA/371-621GLDVCK.........EVPRRR.WDINTHV...DPSGKARNKGATKWGCWLD....FSGDFDPRFFGISPKEAPQMDPAQR
KAS1_STRCN/2-251GRTATRG......ITLFD......PEGL......RSRIAAECDFDPL.............AHGLDPELVE...RADRYIQ
O50436_MYCTU/6-256GDDLVG.........EIPADR.WDANVYY...DPEPGVPGRSVSRWGAFLD....DVGGFDCDFFGLTEREATAIDPQHR
KAS1_STRRM/7-255GRTATRP......ISSFD......ASPF......RSQVAAECDFDPA.............AEGLSQRQVR...AWDRTMQ
ERYA1_SACER/1979-2226GRDSAA.........EVPDDRGWVPDELM...ASD....AAGTRAHGNFMA....GAGDFDAAFFGISPREALAMDPQQR
O30768_9ACTO/40-290GVDAIT.........RFPTDRGWDEAAVY...SPEHR.PGTTYCREGGFLA....GAGDFDAAFFGISPNEALVMDPQQR
O30766_9ACTO/1459-1713GADAIT.........AFPTDRGWDNDALY...DPDPAASRRTYARAGGFLH....DAAEFDPGFFGISPREALAMDPQQR
WA_EMENI/376-626GLDVHR.........KVPEDR.WDADAHV...DLTGTATNTSKVPYGCWIR....EPGLFDPRFFNMSPREALQADPAQR
PHAS_MYCTU/24-274GDDLIT.........EVPPDR.WDCDEFY...DPQPGVPGRTVCKWGGFLD....NPADFDCEFFGIGEREAIAIDPQQR
Q9Z4Y3_STRCO/3-242ARSLEGG......DPEPLA....GTGAW.....HSLRVPALRPG.................QLTGRGTAR....TDPFIR
O30480_STRHY/32-282GGDAVS.........PFPTDRGWDLDGLY...DPDPDHLGTAYVREGGFLD....RAGAFDPDPFGISPREALAMDPQQR
OL56_STRAT/33-288GGDGIA.........GLPEDRGWDLGRLY...DPDPDRAGTSYVREGGFLY....DSGEFDAAFFGISPREALAMDPQQR
P72239_PSESX/4-210GRSGIR............................SVDFPVALRS..............PLASPLPDLDPALP..LPERQH
O54666_AMYMD/2194-2444GADAVT.........EFPADRGWDTDRLY...HEDPDHEGTTYVRHGAFLD....DAAGFDAAFFGISPNEALAMDPQQR
P78584_ASPPA/12-261KVDASS.........EIPRTR.WEP.YQQ...NAHNARSIGKVPRRGYFVK....NIENFDASFFNISPKEAEQMDPQQR
O33956_STRFR/1555-1806GKDAIG.........PFPANRGWDLENLY...DPDPDADGRTYVREGGFLH....EAPDFDPSFFGISPREALAMDPQQR
Q53671_STRAA/2-250GRTATRT......ISLFD......ASAF......RSRIAAEVDFDAA.............RHGFGPAEAE...RLDRATQ
O54593_AMYMD/1701-1950GLEGLS.........PFPEDRGWDLENLF...DDDPDRSGTTYTSRGGFLD....GAGLFDAGFFGISPREALAMDPQQR
Q49932_MYCLE/32-282GRNAIS.........RVPADR.WDADAFY...DPDPLTPGRMTTKWGGFVS....DIAGFDAAFFGITPREAAAMDPQQR
P95814_STRSQ/5409-5656GTDAIT.........TAPGDRGWDLDALY...DPDPDAVGKAYSLRGGFLE....GAAEFDAAFFDISPRESLGMDPQQR
Q9ZGI5_9ACTO/2603-2854GGEGIT.........PFPTDRGWDLDGLY...DADPDALGRAYVREGGFLH....DAAEFDAEFFGVSPREALAMDPQQR
O96554_CRYPV/884-1134GVD...A......IGEIPKSR.WNIDEYY...STDLDLENKMYTKEGGFIE....NIDQFGASFFKISHAEARSMDPQQR
P71718_MYCTU/4-254QREGLG.........PFPTDRGWALRELF..DGSRRNGFKPIHN.LGGFLS....SATTFDPEFFRISPREATAMDPQQR
FABF_SYNY3/6-249GRNGIGP......ITRFD......ASDQ......ACRFGGEVKD.............FDATQFLDRKEAK...RMDRFCH
O65933_MYCTU/33-281GRDAVS.........DFPADRGWDVDGLF...DPDPDACGKMYTRRGTFLE....HAGDFDAGFFGIGPSEALAMDPQQR
NODE_RHIS3/2-238GRSAIGP......IVTSE......LHGL......TGTIGAEIKTLP..............EHDIDRKQLV...TMDRFSL
Q53672_STRAA/5-246GESGIRR......LSRFD......PGRY......PARLAGEIRD.............FVDADHVPGRLLP...QTDRVTR
Q49933_MYCLE/34-288GRSGIV.........RVPSDR.WDADAYY...TDDHTVPGTICSTEGGFLTG..WQPDEFDAEFFSISPREASAMDPQQR
O51827_PSEFL/1032-1273QTDTVG.........PVPPSR............LAGAKPEETFPRFASLIQ....RPEGFDEAFFRISPKEARSMDPQQR
Q54496_STRNO/2-243GASAIGP......VTRFD......AGRY......PSKLAGEVPG.............FVPEDHLPSRLMP...QTDHMTR
Q44222_NOSS1/9-289GKQHFI........T.LPPKRWYGIDEQK..DLLQEYGLTDAKAPVGAYIK.....DFDLDTLAYKIPPNEVEKLNPQQL
KAS2_STRCO/13-255GTSSLGP......VTREG......CAHL......PLRVAGEVHG.............FDAAETVEDRFLV...QTDRFTH
Q54995_9ACTO/18-258GEHGLRP......VTEYD......ASGH......PGGLVGRVPD.............FDAARHLPGRLLP...QTDRVTR
O54142_STRCO/38-299DGPAPASG.....TGPAPGGLGDIEVDVARFGIPPAQAASMARLQLLMVEA....ARQCLDDATGSGADRGRTDVVVGTC
O30482_STRHY/33-284GRDGVS.........AFPIDRGWDLEGIY...DPDPDHPGTTYARDGGFLD....DAAGFDPAFFGISPREALAMDPQQR
P87001_PENPA/44-294KGDASG.........DMPSWR.WDPYRQR...HPRNAAALAKTTAKGYFVN....DIDHFDAAFFAISPREAEQMDPQQR
O54155_STRCO/797-1033GRDAVG..........................EAPADRHGDTGGRPGGFLE....HVYDFDARFFGVSARETERMDPQQR
P79068_GLOLA/381-631GLDVHR.........VVPADR.FPVATHY...DITGKAVNTSHSQYGCWIE....NPGYFDPRFFNMSPREAFQTDPMQR
Q54208_STRGA/5-252GRSGVKP......LEQDW......AA..D....QAVRIAAPVAV..............EPTEVLPRPQAR...KLDRSAQ
O30776_NOSP7/53-334KIDCIT.........DVPSTH.WSVEDYY..DPNPRTTEDKTYCKRGGFLP.....EVDFNPMEFGIPPSILEVTDVSQL
P74017_SYNY3/16-236GKTAIK............................PKQPFINLPS...............FPLALQGNYPRSLGQLVPPLV
Q9ZGD6_STRCY/2-243GKSAIGR......ITRFD......PTQY......PARLAGEIRG.............FDARDHLPGRLIP...QTDRMTQ
Q9ZGI5_9ACTO/1108-1359GGDAIS.........EFPQDRGWDVEGLY...HPDPEHPGTSYVRQGGFIE....NVAGFDAAFFGISPREALAMDPQQR
KAS1_STRCO/3-252GRTATRR......ISLFD......PSGL......RSQIAAECDFEPS.............DHGLGLATAQ...RCDRYVQ
FABF_BACSU/3-245GVSGIGP......ITRVD......AEEY......PAKVAAELKD.............FNVEDYMDKKEAR...KMDRFTQ
Q9Z3T8_PSESX/38-289G.EALS........SALPSDRGWQLDSLF...PADSPLRERVAGWRGGFLD....EVAGFDAAFFRISDREALAMDPQQR
Q9ZLS2_HELPJ/1-249GECGIKN......IESFD......ANAF......PVRIAGEITD.............FDPTEVMNPKDVK...KAGRFIQ
O52789_AMYMD/1725-1976GRDGMS.........PFPGDRGWDLDGLF...DSDPERPGTAYIRQGGFLH....EAALFDPGFFGISPREALAMDPQQR
O01677_BOMMO/27-265KVDMVT.........QEGS.R.WVFNHPE...IPKHLGKVKGMSK..............FDAQFFRVHYKQACTMEPMSR
FABB_ECOLI/1-245GRSGITF......SQELK........DSG....MRSHVWGNVK..............LDTTGLIDRKVVR...FMSDASI
KAS2_STRCM/1-243PRAASAA......STRFD......PSGY......PAQLAGEIPG.............FRAAEHLPGRLVP...QTDRVTR
O86335_MYCTU/106-346KKCAIT.........AYPD....RGFTN........AGTFAES...GGFLK....DVAGFDNRFFDIPPDEALRMDPQQR
O32451_9ACTO/9-258GRTATRK......ISLFD......PAGF......RSRIAAECDFDPA.............AEGLTPREVR...RMDRAAQ
KASC1_ARATH/60-306GESGISL......IDRFD......ASKF......PTRFGGQIRG.............FSSEGYIDGKNER...RLDDCLK
Q54495_STRNO/6-256GRTATRT......ITAFD......PSPF......RSRIAAECDFDPL.............AEGLTPQQIR...RMDRATQ
O84775_CHLTR/3-247GISGVRT......ITSFP......CDDY......ATRFAGWIEE.............FNSEPYLDKKQAR...RVDPFIT
O96554_CRYPV/3024-3288GKMFNSVGGAFCASREIPIQR.WNHNLVY...NADPDKTGKCYSYKACFID....SIDMFDNSKFGITNIEAKHMDPQQR
KAS2_STRCN/10-254GASVLDR......ITREG......CEHL......PLRVAGEVRG.............FDPSALIEETFLV...QTDLFTH
FAB1_MYCTU/11-253GESGIHA......LEDEF......VTKWD....LAVKIGGHLKD..............PVDSHMGRLDMR...RMSYVQR
Q9ZGA4_9ACTO/5996-6242GGDGIT.........AFPADRGWDVDALY...DPDPEHSGTSTVRHGGFLT....GAGDFDAGFFGISPREALAMDPQQR
Q9ZGI3_9ACTO/34-287DGDAIS.........EFPQDRGWDVEGLY...DPDPDASGRTYCRSGGFLH....DAGEFDADFFGISPREALAMDPQQR
Q9ZGA4_9ACTO/1182-1428GTDAIT.........EFPVDRGWDVDELV...DPDPDAVGRSTTRHGGFLT....EATGFDAAFFGISPNEALAMDPQQR
O96554_CRYPV/5251-5514SKD...C......ITEIPLDR.WPFDLYY...DPDPDNRSKSYVNQGAFIT....DIDLFDNTFFGLSSTEATNVDPQQK
Q9ZGD7_STRCY/2-252GRTATRG......ITFFD......PSSF......RSQIAAEADFDAE.............RSGLSPQEIR...RMDRAAQ
Q50469_MYCTU/46-293GRDVVS.........EFPTDRGWDVEGLY...DPDPDAEGKTYTRWGAFLD....DATGFDAGFFGIAPSEVLAMDPQQR
O30479_STRHY/974-1225GGDGIS.........GFPTDRGWDLEHLY...HPDPDHPGTSYVREGGFLH....DAGDFDAALFGISPREALAMDPQQR
O01678_BOMMO/23-261KVDLIS.........SDDR.R.WKLAHPE...IPQRTGKINNVNK..............FDASFFGVHYKQAHTMDPMCR
Q48376_KIBAR/2-246GKSGIGR......ITRFD......ARRY......PAKLAGEVAG.............FNASDHLPSRLIP...QTDRMTQ
O53490_MYCTU/34-281ARDVMS.........EFPTDRGWDLAGLF...DPDPDVRHKSYARTGGFVD....GVADFDPAFFGISPSEALAMDPQHR
KAS1_STRGA/6-255GRTATRT......ISLFD......AAPY......RSRIAGEIDFDPI.............GEGLSPRQAS...TYDRATQ
PPSE_MYCTU/5-262GKESIV.........TLSEQE.LRDAGVS.....DKTLADPAYVRRAPLLD....GIDEFDAGFFGFPPLAAQVLDPQHR
NODE_RHILT/2-238GPSAISP......IITTD......LYDL......EGTVGLEIKAIP..............EHDIPRKQLV...SMDRFSL
O30764_9ACTO/1006-1257GTDAIS.........TFPTDRGWDLDGLY...DPDPSTPGKSYVRHGGFLH....DAAQFDAEFFGISPREATAMDPQQR
O33958_STRFR/37-288GRDAIG.........PFPVDRGWDVASVY...DPDPESKGTTYCREGGFLE....GAGDFDAAFFGISPREALVMDPQQR
Q54815_STRPE/24-263GRNGIGP......LRRFT......GDGR......LGRLAGEVSD.............FVPEDHLPKRLLA...QTDPMTQ
O33955_STRFR/20-275ERDAVS.........GLPRDRGWDLDALY...DPD.GGPGTSYAREGGFLS....HCAGFDAEFFGISPREALAMDPQQR
O53579_MYCTU/116-366GRDGIT.........DLPDGR.WSEFLE....EPRLAARVAGARTRGGYLK....DIKGFDSEFFAVAKTEADNIDPQQR
O33878_PSEAI/1-243GRPGIRF......NPSYA........EMG....LRSHVSGSVD..............LNLEELIDRKVFR...FMGDAAA
O52545_AMYMD/34-285GADVYT.........GFPEDRGWDVEGLY...HPDPDNPGTTYVREGAFLQ....DAAQFDAGFFGISPREALAMDPQQR
Q54814_STRPE/2-251GTTATRA......ISTFD......ATPF......RSRIAAECDFDPV.............AAGLSAEQAR...RLDRAGQ
ERYA1_SACER/504-755GRDAVA.........GLPTDRGWDLDSLF...HPDPTRSGTAHQRGGGFLT....EATAFDPAFFGMSPREALAVDPQQR
FABB_HAEIN/1-244GKSGIEV......VPEFV........EMN....MRSHVAGTIK..............LNPSEHIDRKVFR...FMGDAAA
O30767_9ACTO/43-293ETDAVS.........PAPSDRGWDVTAMY...SPDPDRPGTTYCREGGFVR....GVDRFDPGLFGISPNEALAMDPQQR
CEM1_YEAST/2-265SKNGLTP......ITSLPNYN..EDYKLREKSIPSTITVGKIPENFQNE.......NSAINKLLFTSQDER..RTSSFIK
KAS1_STRVN/2-251GRTATRP......ISFFD......ASPF......RSRIAGEIDFDAV.............AEGFSPREVR...RMDRATQ
Q54217_STRGR/2-251GRTATRG......ITLFD......PSPY......RSRVAAEIDFDPR.............AHGLTPQEIR...RMDRAAQ
O53901_MYCTU/14-263GDDLVT.........EIPADR.WDIDEYY...DPEPGVPGRTDCKWGAYLD....NVGDFDPEFFGIGEKEAIAIDPQHR
O52790_AMYMD/35-284GGDAVS.........GFPTDRCWDLDTLF...DPDPDHAGTSYTDQGGFLH....DAALFDPGFFGISPREALAMDPQQR
KASA_STRCO/45-294GRTATRR......ISFFD......PSPY......RSQVAAE................ADFDPVAEGFGPRELDRMDRASQ
NOE4_RHIML/2-237RRSAIGP......VLNTE......LHGL......KGIVGAEIKALP..............DHNIDRKQLV...SMDRISV
O54666_AMYMD/3171-3422GRDAVS.........GFPVDRGWDLDGLY...HPDPAHAGTSYTRSGGFLH....DAAQFDAGLFGISPREALAMDPQQR
KAS2_STRVN/6-248GENGIAE......LSRFD......ASRY......PSRLAGQIDD.............FEASEHLPSRLLP...QTDVSTR
Q54994_9ACTO/2-251GRTATRA......ISFFD......ASPF......RSRIAAEVDFDPA.............AAGLSPREVR...RMDRAAQ
KAS2_STRGA/4-246GKSGIDV......IQRFD......PHGY......PVRVGGEVLA.............FDAAAHLPGRLLP...QTDRMTQ
O05170_STRVR/23-283GRNTVG.........EMPPDR.WEEYRDF...GPRFDAALRTAIRSGSFLDD...DIAGFDAEFFGISPREAELMDPQQR
Q54297_STRHY/4880-5122GTDAVS.........GFPTDRGWDVENLY...D....MAGKSHRAEGGFLD....AAAGFDAGFFGISPREALAMDPQQR

PF07451

B0K9G7_THEP3/7-334D--------------DTYGEKSWEKAESKMFQDAVNLVLKKANLKIS..DIDYLLGGDLLNQIISANFAARQLNVPHFGL
A6TVT6_ALKMQ/4-333D--------------IWLGQDSFEKAERKLLEQACEIAIDKAGMKKE..DIHFFLSGDLMNQITSSSFAARTLGMPYLGV
A4ILB0_GEOTN/9-337D--------------LWLGEDSYEKAHRVLFEEAAFQAMEKAGLEKE..KVQFLIAGDLINQMTPTSFAARTLGAPYLGV
A6LRM0_CLOB8/7-335D--------------DMLGKESFEKAESEMMFTAISQALKKGNLKET..DIDYLFSGDLLNQIISSSFAAREFSIPFFGL
A5KLQ7_9FIRM/6-345D--------------DLFGAQTWEEAESNMQKEACVLAAGKAHVDLK..KIRYLFGGDLLRQGIATSMGVEALQIPMFGL
A7GHV3_CLOBL/6-334D--------------DLFNQESFEKAESAMLSTAISDVIKKCNLKDK..DIDMLCAGDLLNQTISSSFAARNLDIPFIGL
Q9KCK2_BACHD/4-332D--------------MWLGEDSFEKAQKVLIEEAAKTAIEKAGIQND..DIQFVFAGDLLNQMTSTSFACRSLCIPYFGL
Q5WH23_BACSK/4-331D--------------IYCDEKSWEMAERALMKQAIKQCLTKNHLSID..SVDLFVAGDLSNQTTASSFVARDLQLPYIGT
A5Z9F5_9FIRM/6-334D--------------PMLGQETWEEAESLLQKEAIQKLLFKAGMSKE..EIRYIFGGDLLGQLIATTFGILEFEVPFFGL
A4IQI0_GEOTN/5-332D--------------LYCGEETWELAERRLMSEAVARCLQKAGVSAH..DVDLFLAGDLLNQNATSNYVARELPIPFLCL
Q2B8V8_9BACI/4-335D--------------LWMGEDSYEKAHRVLMEEAAKTAMQKGSVEKD..DVQFFIAGDLINQITPSSLAARTIQLPYFGV
B8I4W4_CLOCE/7-335D--------------ELWGEDSWEKAESKLVRETFAKVLQKAKLSND..QIDYVLAGDLLNQCIAANYGLRETEVPFLGL
A6TQB0_ALKMQ/8-336D--------------DLFGEKSWERAESKLIKETVKLALKKAGLHLN..DIDYMFGGDLLNQLMSTSFAARDLGIPFFGL
A4J4J1_DESRM/4-332D--------------LWLGQDSYEKAEKKMLEEACEVAVNKSGLQKQ..DIQFFLGGDLLNQIISSSFAARTMAVPYLGL
Q8ERC5_OCEIH/4-332D--------------MWIKQDSFEKAQQKMLEEACQIAIKKSPIEKE..NVEFFIAGDLINQITPTSFAAKTVGTPYLGV
Q2RIQ1_MOOTA/8-336D--------------SYFGEETWEKAERKMLEEAVKMVIAKAQLKPQ..DIDFLLAGDLLNQTISANYAARSLGIPFLGL
Q67T05_SYMTH/7-337D--------------LTVGQDSFEKAERQMMIDACNLALRRAGIQQKPPAVDYFLAGDLLNQLITTAFSGLELGVPLYGL
Q189X1_CLOD6/7-335D--------------DLYGEKTWELAESKMVETASQQAIQKAGKKLS..DVNYMLGGDLINQIVPASFAARELAIPFLGI
Q635L3_BACCZ/5-333D--------------LHCGEENWELAERRLMSDSIQQVMQKGNVETS..QIDFFLAGDLLNQTVTANYVARKWGIPFLGM
Q631K6_BACCZ/4-332D--------------LWLGQDSYEKAHKILFEEACSRATEKAKLRKD..DIQFVLAGDLINQITPTSFACRTLGTPYLGL
B8FPM4_DESHD/7-333D--------------NINGNTSWEVAETKMLEEAMEGAVKQSQIKKD..EIDYLLAGDLLNQIISANFAARTMGIPFIGL
A7VV52_9CLOT/6-334D--------------TTLGEKSWEKAESRLQKEAVNCAMKKAGVTAG..AVDYIFAGDLLNQCISSTFGLRSLGIPFLGQ
A0PZS9_CLONN/6-338D--------------DLNGKDSFEKAESSIMYRAVQETLKKSNLEEK..DIHYLVAGDLLNQTAASNFAARDVDIPFLGL
A7VIX6_9CLOT/21-354D--------------PTFGKDSWEEGESEMVKQAVELAIKKAGKEKS..DIRYLFAGDLLGQLIATTFGVKDMDIPIFGL
A7Z687_BACA2/5-332E--------------MHCNQKNWEMAERQLMEDAINSALQKQNLKKS..DIDLLLAGDLLNQNVTANYVARHLKIPFLCL
Q0AZ98_SYNWW/8-335D--------------YLFGEESWEKAENKMLRETVKKALNKRNFDEA..DTEILMAGDLLNQLVSSNYAARELGIPFLGL
Q891W9_CLOTE/6-334D--------------DLAGKDSFEKAESNFLYTAVTESIKNANLQED..DIDILFAGDLLNQLSSSSFAARDMNIPFIGL
A5ZW68_9FIRM/8-352D--------------PMFGEKKWEAAESAMQKEAAVLAIGKAGLTPD..DIRFVFAGDLLAQTIASSFGIAEMGIPFFGL
A5D2Y8_PELTS/8-335D--------------SYYGEKTWEKAEQRMMLDAMKKALQKAGLQEK..DVDFILAGDLLNQIISANFTASSMSVPFLGL
A8MHP8_ALKOO/7-335D--------------DLLGEDSWEMAESALVKEAANIALGKVNLTLD..DMEYMFGGDLLNQIMSTSFAARDMKVPFFGL
Q0SRD0_CLOPS/9-337D--------------DCNGCESFEKAESSLMITAIEGVIKKGNVKEE..DVDYLFSGDLLNQLTSTNFVAREFKIPFFGV
A6BCY0_9FIRM/4-332K--------------DLFGENTWEEAESTMQKEACLLALGKAHLAPE..SIRYLFGGDLLRQGVATSMGVETLQIPMFGL
A5N8K2_CLOK5/4-332D--------------IWIGQDSFEKAEKKLLEEACDLAVKNSKLKNE..NINFFVSGDLMNQIITSSFAARTLKIPYLGV
A6P2X9_9FIRM/7-334D--------------DSFGEKTWEKAETAMQRLALSMALNKAGLAAC..NLDYIFAGDLLNQCIGTGFALRGQDIPFYGL
Q97GR2_CLOAB/6-335D--------------DMNGEESFEKAESNMLYTVITEVIKKSNLTEN..DIDYLFAGDLLNQITSSSFAARDAKIPFYGL
A4XFR0_CALS8/5-335D--------------EYAGQKSWELAEGKLLNIAISKLIQKSGFTPD..EVDLILSGDLLNQLTSSHFAARDLNIPFIGL
A9KI33_CLOPH/13-353D--------------PMFGQKTWEEAESKMLGMAVDVAIHNAGLKKS..DIRYLVGGDLLGQLIATSFGIENFEIPLIGV
Q9KCM9_BACHD/5-332N--------------LYCGEDSWELAERRLMQDAIEHCLKKVHVETE..RVSFMIAGDLLNQNITANYVARALGIPFLGT
A6CSV2_9BACI/4-336D--------------LWMGEDTYEKANRLMIEDAVKLAIEKGGLQEE..QIQFFLSGDLINQITPSSFAARTNAIPYLGL
Q5WGZ4_BACSK/4-332D--------------LWIGEDSYEKAQTVLIEGAVTETLKKASLKKE..DVNFMLAGDLVNQLTPSSFAGRTIGIPYLGM
A1HRA0_9FIRM/6-333D--------------NLNNQDSWEKCESYMLEWAIRKAVAKENSTIA..TVDYVLAGDLLNQLMATHFALRSLGRPFLGL

PF13723

A0KS20_SHESA/23-240ADT..S-------------------------------------------KD...DLE.GISPTLPQVPAMQRRRFSRLTK
Q3KJ71_PSEPF/24-238VVL..E-------------------------------------------S......S.DAAPDVSFLPAMQRRRLSRLAR
A6WI73_SHEB8/23-240AEL..N-------------------------------------------LDT.PQSD.TTAPALKHVPAMQRRRFSRLTK
Q87V50_PSESM/22-236TLL..E-------------------------------------------T......S.DAAPDVSFLPAMQRRRLGRMAR
D2C0A5_DICD5/23-240ALI..D-------------------------------------------A......T.QPLAKCDQLPMMTARRLNSGSR
Q088U8_SHEFN/23-254GNL..A-------------------------------------------P......K.PDSPPLAHIPAMQRRRFSRLTK
Q1IG78_PSEE4/22-237ECP..S-------------------------------------------A......E.AQVPDVSFLPAMQRRRLSQLAR
D3H094_ECO44/24-239WAI..D-------------------------------------------P......A.APLAKLSELPMMTARRLSSGSK
A6B2U2_VIBPA/28-240NWP..Q-------------------------------------------D......G...KVNVADIPAMMRRRMSPLSK
Q1ZAL5_PHOPR/24-248KLW..P-------------------------------------------E......P.LTPVPHHLIPPMMRRRMSALSK
D0ZDH8_EDWTE/23-238FAI..D-------------------------------------------P......R.ATQAKLTELPMMTARRLNSGSK
A3XWZ8_9VIBR/21-243DWP..Q-------------------------------------------N......G...STEFKAIPPMMRRRMSLQSK
B8KAV3_VIBPA/28-239AWP..V-------------------------------------------D......G...KAPVNAIPPMMRRRMSSLSK
Q2BXG5_9GAMM/24-240KWP..Q-------------------------------------------A......P.E.PIVFDKIPPMMRRRMSNLTK
Q7MMI9_VIBVY/35-248SYP..E-------------------------------------------S......F...DITASNIPAMMRRRMSSLSK
A8H9F9_SHEPA/23-237LDQ.GA-------------------------------------------E......P.SAVPKLAHVPAMQRRRLSKLTK
C9Y2G4_CROTZ/23-238QAI..D-------------------------------------------P......T.APQAKLTALPMMTARRLASGSR
A4WFQ9_ENT38/23-238LAI..D-------------------------------------------P......A.APQAKLTALPMMTARRLNSGSK
D4GIX1_PANAM/24-239HAI..D-------------------------------------------P......A.APQAKLTELPMMTARRLSAGSK
A9ICW7_BORPD/22-238YCPYPA-------------------------------------------E......T.EELPSTHFLPAMQRRRLSPLAR
B5FC47_VIBFM/24-237FTW..P-------------------------------------------E......N.E.KAPVDKIPAMARRRMSSLSK
B1KLW4_SHEWM/23-238PIQ..E-------------------------------------------E......L.PHSPKLAQVPAMQRRRYSKLTK
A8FQ17_SHESH/23-236LAH..D-------------------------------------------S......DLPRAPKLAQVPAMQRRRYSALTK
Q6CYK1_ERWCT/23-238AAI..N-------------------------------------------A......E.QPLDKCRHLPMMMARRLNQGSR
B4SN15_STRM5/22-244YLP..H-------------------------------------------G......A..DTPALAEVPAMQRRRIERLGR
B6EI52_ALISL/27-240FTW..P-------------------------------------------E......D..GKIPVDKIPAMARRRMSSLSK
B0TPT7_SHEHH/23-240SDD.SA-------------------------------------------Q......Q.SAVPKLTHVPAMQRRRLSKLTK
C9PCF7_VIBFU/28-238VWP..Q-------------------------------------------G......A....IEAGLIPAMMRRRMSPLSK
A1JK88_YERE8/23-237ANH..T-------------------------------------------V.....WQ.GDLPKSAHIPMMSARRMSTGSR
C9QG28_VIBOR/28-240QWP..E-------------------------------------------E......T...KLITSAIPPMMRRRMSNLSK
B2JEK1_BURP8/10-230AVA..A-------------------------------------------..........VAPDVGFIEPMVRRRLSTLSR
D4DWU4_SEROD/23-235ISE..L-------------------------------------------S......Q.DLPPPCAHIPMMSLRRMSVGTR
C5TMY6_NEIFL/32-254LDT..A-------------------------------------------S.....LP.ECKPALSFLPPMQRRRLGKAAR
D0W6C1_NEILA/28-248DFA..D-------------------------------------------G.....LP.DVKPELPFLPAMQRRRLSKAAR
A0KNN6_AERHH/22-235RW...P-------------------------------------------V......D.PPFPATPLLPMMMARRLSQGAR
C4GLR4_9NEIS/27-242LNA..Q-------------------------------------------T.....LP.EHKPALAFLPAMQRRRLGAAAR
B8CHL8_SHEPW/21-234SDI.GA-------------------------------------------T......A.TAAPKLPQVPAMQRRRLSKLTK
A1SB23_SHEAM/16-223SEP..S-------------------------------------------S......T..VAPALPQVPAMQRRRFSRLSR
C6M4A1_NEISI/28-249LDT..A-------------------------------------------G.....LP.DHKPALAFLPALQRRRLGKAAR
A4SJH0_AERS4/22-237QWP..A-------------------------------------------A........VPFPATPLLPMMMARRLSQGSR
D4DPD2_NEIEG/27-243LNA.VD-------------------------------------------L......P.DTPPKVDFLPAMQRRRLGLSAR
A8GA54_SERP5/11-225AIT..A-------------------------------------------K.....YP.GVLPGCSHIPMMSLRRMSIGTR
C9PNT3_9PAST/22-236FRP..L-------------------------------------------E......A.GIKFPTPLIPMMQARRMGLADK
C0A904_9BACT/39-285AST..D-------------------------------------------APAAPATG.GTLPKTPHIPMMTARRMSAGSR
Q1LF35_RALME/48-283WLP..E-------------------------------------------G........ADLPALAAMAPMLRRRVNATGR
D4EES3_AGGAC/28-245QNQ..A-------------------------------------------N.....FA.DFAPKLAFLPPLKRRRLSDPAR
Q0I115_HAES1/28-245ESV..A-------------------------------------------K.....RE.TVAPKLAFLPPLKRRRLSESAR
C6AQB8_AGGAN/28-245QNC..T-------------------------------------------N.....FA.DFAPKLEFLPPLKRRRLSDSAR
C8N8Z6_9GAMM/23-235EIL..T-------------------------------------------T.....LP.ERAPDLAHVPALQRRRLSPAAR
A6W243_MARMS/22-235NEL..P-------------------------------------------T......D.SAKPGLKNIPVMLRRRFTAIGK
Q3IC51_PSEHT/8-234QRQ.IE-------------------------------------------SDH..WYD.NSPITLDWVAPMQRRRMTRFSK
A4TU44_9PROT/10-227DVL..A-------------------------------------------V.....GG.MVPPARPALPSLLRRRVSAIGR
Q1QTW3_CHRSD/12-234RDT..A-------------------------------------------HSR..LSV.EEKPAGAQVPAMLRRRLTSIGR

PF00195

CHS3_BROFI/3-229VNRFMLYQQG---C----------FAGG----------------------------------------------------
2PS_GERHY/7-233VKRYMLYQQG---C----------AAGG----------------------------------------------------
O82145_HYDMC/6-232IKRLMMYQQG---C----------HAGG----------------------------------------------------
O23674_ARATH/11-236VNRVMLYFLG---C----------YGGV----------------------------------------------------
CHSD_PETHY/2-228VKRFMMNQLG---C----------FAGG----------------------------------------------------
O81305_ARATH/4-229VQRVMLYFLG---C----------YGGL----------------------------------------------------
VPS_HUMLU/4-230VKRVMLYQLG---C----------YAGG----------------------------------------------------
CHSA_IPOPU/8-234VKRLMMYQQG---C----------NAGA----------------------------------------------------
O24484_PINRA/9-234VSRVMLYFLG---C----------YGGV----------------------------------------------------
O23811_ORYSA/9-234TVRTSLLFLG---C----------SGGA----------------------------------------------------
THS1_VITVI/2-228VRRVMLYHQG---C----------YAGG----------------------------------------------------
CHSF_PETHY/2-228VKRLMMYQLG---C----------YGGG----------------------------------------------------
CHS2_HORVU/4-230VKRLMMYQQG---C----------FGGA----------------------------------------------------
CHSB_PETHY/5-231VQRLMMYQQG---C----------FAGG----------------------------------------------------
O22122_SCUBA/2-228VKRFMMYQQG---C----------FAGG----------------------------------------------------
CHS3_GERHY/8-234VKRLMMYQQG---C----------FAGG----------------------------------------------------
CHSG_PETHY/2-231VKRSMMYQQG---C----------YGGG----------------------------------------------------
CHSY_PINSY/7-233VKRVMMYQQG---C----------FAGG----------------------------------------------------
BBS_PHASS/2-228VERVMLYQQG---C----------FAGG----------------------------------------------------
THS1_ARAHY/2-228VKRYMMYHQG---C----------FAGG----------------------------------------------------
DPS1_PINST/7-234VKRVGVFQHG---C----------FAGG----------------------------------------------------

PF08545

FABH_STRPQ/106-183---FDMTA.A...C----------SGFV----------------------------------------------------
FABH1_VIBVU/106-183---FARAA.A...C----------SGFV----------------------------------------------------
O68915_9ACTO/119-188---LDVSG.A...C----------AGFC----------------------------------------------------
Q7P488_FUSNV/107-185---FDLNA.A...C----------TGFI----------------------------------------------------
O65985_THETR/112-190---FDIEV.G...C----------SGFI----------------------------------------------------
Q63N14_BURPS/119-199---ADVEM.E...C----------ASFV----------------------------------------------------
Q6MR21_BDEBA/112-191---YDINT.A...C----------AGFV----------------------------------------------------
Q7CTU0_AGRT5/109-187---IDLAG.A...C----------SGFL----------------------------------------------------
FABH1_BACTN/110-188---FDMQA.V...C----------SGFL----------------------------------------------------
FABH_YERPE/106-183---FDLAA.A...C----------AGFT----------------------------------------------------
Q8ED66_SHEON/118-189---YDMQV.A...C----------SSAT----------------------------------------------------
FABH3_STRCO/108-188---FDVSA.V...C----------SGFL----------------------------------------------------
FABH_GLOVI/106-183---FDLTA.A...C----------SGFV----------------------------------------------------
FABH2_DEIRA/113-191---FDVSV.A...C----------SGFL----------------------------------------------------
Q8EDA9_SHEON/104-182---FDINA.A...C----------SGFL----------------------------------------------------
FABH_STRLI/115-192---FDLSA.A...C----------AGFC----------------------------------------------------
Q8P810_XANCP/217-297---FDVNA.T...C----------LSFL----------------------------------------------------
Q5FUN7_GLUOX/112-191---FDISA.A...C----------SGFV----------------------------------------------------
Q8XRP5_RALSO/110-188---GVFSS.E...C----------GNMV----------------------------------------------------
FABH_THETN/110-188---FDISV.G...C----------SGFI----------------------------------------------------
FABH_CHLTE/107-186---FDLSA.A...C----------SGFV----------------------------------------------------
Q7TTZ7_RHOBA/109-186---IDFNL.G...C----------SGFV----------------------------------------------------
FABH2_BACAN/108-186---FDLNA.T...C----------AGFT----------------------------------------------------
Q73Q42_TREDE/107-187---FDLSA.A...C----------SGFL----------------------------------------------------
FABH_SPIOL/175-254---YDITA.A...C----------SGFM----------------------------------------------------
Q9A8B2_CAUCR/171-240---FDMNV.A...C----------SSAT----------------------------------------------------
FABH_LISMF/106-184---MDVEA.A...C----------AGFT----------------------------------------------------
Q67RA0_SYMTH/112-193---FDAQL.R...C----------GTWV----------------------------------------------------
FABH_HELPY/109-188---FDISA.A...C----------TGFI----------------------------------------------------
Q72LL0_THET2/104-182---YDLLA.G...C----------PGWI----------------------------------------------------
PQSD_PSEAE/107-188---LDIRA.Q...C----------SGLL----------------------------------------------------
FABH_CLOTE/108-185---FDISA.A...C----------SGFT----------------------------------------------------
FABH_SILPO/108-191---FDVQA.V...C----------AGFV----------------------------------------------------
FABH_BARQU/107-191---FDIQA.V...C----------SGFI----------------------------------------------------
FABH_PASMU/106-183---FDVAA.A...C----------SGFV----------------------------------------------------
Q5WUL0_LEGPL/115-194---FDIGA.A...C----------AGFV----------------------------------------------------
FABH_SYMTH/109-187---FDLSA.A...C----------PGWI----------------------------------------------------
Q7NZ26_CHRVO/150-229---FDMNV.A...C----------SSAT----------------------------------------------------
O04439_ALLPO/173-252---FDITA.A...C----------SGFV----------------------------------------------------
FABH_RHOCA/108-191---FDVQA.V...C----------AGFV----------------------------------------------------
Q64Y53_BACFR/101-177---LDLTL.G...C----------SGYV----------------------------------------------------
Q7NV97_CHRVO/105-183---FDVNT.S...C----------LSFL----------------------------------------------------
FABH1_LACPL/108-188---FDLSA.A...C----------AGFT----------------------------------------------------
Q820X4_COXBU/124-203---IDINT.A...C----------SSFA----------------------------------------------------
Q8RL75_PSEFL/107-186---FPLGV.TWGDC----------TMLL----------------------------------------------------
FABH1_STRAW/116-193---FDISA.G...C----------AGFG----------------------------------------------------
FABH_PROMP/113-191---FDLTA.A...C----------SGFL----------------------------------------------------
FABH_PSEAE/105-185---FDLSA.A...C----------TGFV----------------------------------------------------
FABH_AQUAE/105-183---FDISA.A...C----------SGFI----------------------------------------------------
FABH_HELHP/110-189---FDISA.A...C----------SGFV----------------------------------------------------
FABH_CAUCR/106-189---FDVQA.V...C----------SGFV----------------------------------------------------
FABH_BLOFL/106-183---FDLSA.A...C----------SGFV----------------------------------------------------
FABH_RICCN/106-184---FDLQA.V...C----------AGFV----------------------------------------------------
FABH2_STAES/108-186---IDINA.A...C----------AGFT----------------------------------------------------
FABH_METCA/108-185---FDVQA.A...C----------SGFI----------------------------------------------------
Q577P4_BRUAB/109-185---ADLAG.A...C----------TGFL----------------------------------------------------
FABH2_VIBPA/107-185---FDLNA.A...C----------TGFV----------------------------------------------------
Q6A930_PROAC/116-193---FDLNG.A...C----------AGFC----------------------------------------------------
Q74CS1_GEOSL/106-184---YDISA.A...C----------SGFI----------------------------------------------------
Q6FAK4_ACIAD/154-233---YDMNV.A...C----------SAAT----------------------------------------------------
FABH_BRAJA/109-193---FDLQA.V...C----------SGFV----------------------------------------------------
Q8DBH1_VIBVU/106-187---FDLNS.T...C----------LSFL----------------------------------------------------
FABH_SHEON/106-183---FDIAA.A...C----------SGFV----------------------------------------------------
FABH_CLOAB/106-183---FDLNA.A...C----------TGFI----------------------------------------------------
Q9K3G9_STRCO/109-186---FDLNG.G...C----------AGFG----------------------------------------------------
Q73S66_MYCPA/111-193---LDLNNGG...C----------AAFV----------------------------------------------------
Q81RV7_BACAN/105-186---FEIMN.V...S----------SCFP----------------------------------------------------
Q5YNV7_NOCFA/117-194---FDISA.G...C----------AGFC----------------------------------------------------
Q93H15_STRAW/88-168---FDISA.V...C----------TGFV----------------------------------------------------
FABH_NEIG1/108-185---FDVQA.V...C----------AGFM----------------------------------------------------
FABH_ANAMM/107-189---FDINA.A...C----------SGFL----------------------------------------------------
Q6MAF5_PARUW/110-188---MDIQA.A...C----------TGFL----------------------------------------------------
Q82PP5_STRAW/108-187---FDLQQ.R...C----------NAGL----------------------------------------------------
FABH2_LACPL/107-188---FDINV.A...C----------AGFV----------------------------------------------------
FABH_EHRRG/107-186---FDIQA.V...C----------SGFI----------------------------------------------------
FABH2_STRCO/112-192---FDLSA.V...C----------SGFV----------------------------------------------------
Q7U427_SYNPX/113-191---FDLTA.A...C----------SGFL----------------------------------------------------
FABH_PHOLL/106-183---FDISA.A...C----------SGFV----------------------------------------------------
Q9KHD3_STRGR/140-219---FDVCG.A...C----------TGFV----------------------------------------------------
Q8L2P3_PSEFL/107-183---ADVQF.A...G----------KSGT----------------------------------------------------
Q5X5H2_LEGPA/108-187---FDIGA.A...C----------SGFV----------------------------------------------------
FABH4_STRCO/108-188---LDLNV.V...C----------AGFT----------------------------------------------------
FABH_TROWT/107-184---LDINA.A...C----------AGFS----------------------------------------------------
FABHL_CAMJE/116-191---FDLGQ.A...C----------AGYL----------------------------------------------------
Q66B09_YERPS/117-195---FDINS.S...C----------VSFI----------------------------------------------------
FABH_WOLTR/107-194---FDVQA.A...C----------SGFI----------------------------------------------------
FABH_NOSS1/108-185---FDLTA.A...C----------SGFV----------------------------------------------------
FABH_DESVH/108-177---LDCNA.A...C----------SGFL----------------------------------------------------
FABH_STRT2/106-183---FDITA.A...C----------SGFV----------------------------------------------------
Q9I4X1_PSEAE/123-201---LDSQM.E...C----------ASFL----------------------------------------------------
Q7M7Z5_WOLSU/107-186---FDISA.A...C----------SGFI----------------------------------------------------
FABH_PORGI/110-188---FDMQA.A...C----------PTFI----------------------------------------------------
Q5QWT4_IDILO/106-184---FDLNA.A...C----------SSFL----------------------------------------------------
Q6MLJ5_BDEBA/110-190---VDLNA.A...C----------SGFL----------------------------------------------------
Q5NL87_ZYMMO/111-190---FDVQA.V...C----------SGFL----------------------------------------------------
Q98K75_RHILO/87-167---FDMGL.G...C----------SSAA----------------------------------------------------
FABH1_DEIRA/107-185---YDLST.A...C----------SGFV----------------------------------------------------
FABH_PROMA/113-191---FDLTA.A...C----------SGFL----------------------------------------------------
Q5WEX8_BACSK/106-184---MDISA.A...C----------AGFI----------------------------------------------------
FABH_MYCPA/116-193---FDISA.G...C----------AGFG----------------------------------------------------
FABH_NITEU/106-183---FDVQA.V...C----------SGFI----------------------------------------------------
Q74GF6_GEOSL/107-185---FDMNA.V...C----------SGFV----------------------------------------------------
FABH_HAEIN/106-183---FDLAA.A...C----------TGFV----------------------------------------------------
Q62FY9_BURMA/115-194---LDVNL.G...C----------SGYV----------------------------------------------------
Q8GE37_HELMO/110-188---FDLET.A...C----------TSFI----------------------------------------------------
FABH_AGRT5/107-190---FDMQA.V...C----------SGFV----------------------------------------------------
FABH5_STRCO/105-185---YDIAA.V...C----------SGFI----------------------------------------------------
Q847B9_NODSP/110-191---FEVKN.F...C----------NSGN----------------------------------------------------
Q885B9_PSESM/110-188---FDFNQ.G...C----------SGFI----------------------------------------------------
Q63PP7_BURPS/122-199---LDVNL.G...C----------SGYP----------------------------------------------------
FABH_STRMU/106-183---FDLTA.A...C----------SGFI----------------------------------------------------
FABH_SYNP6/111-188---FDLTA.A...C----------SGFL----------------------------------------------------
FABH_LACLA/106-184---YDLTA.A...C----------SGFV----------------------------------------------------
FABH_STRPN/106-183---FDLTA.A...C----------SGFV----------------------------------------------------
Q97KV2_CLOAB/114-194---YDLNA.N...C----------AGML----------------------------------------------------
Q8F686_LEPIN/117-195---FDVST.A...C----------TGFV----------------------------------------------------
FABH_STAEQ/106-184---MDQLA.A...C----------SGFM----------------------------------------------------
FABH_CHRVO/107-184---FDVQA.V...C----------AGFV----------------------------------------------------
FABH1_BACCR/106-184---MDLSA.A...C----------AGFM----------------------------------------------------
O30202_ARCFU/103-177---MDITD.T...M----------RAAT----------------------------------------------------
FABH_AROAE/109-186---FDVQA.V...C----------SGFV----------------------------------------------------
Q64Y55_BACFR/113-190---LDISL.G...C----------SGWV----------------------------------------------------
FABH_MYCBO/116-193---FDLSA.G...C----------AGFG----------------------------------------------------
Q5KSM6_9ACTO/107-185---FDVNA.V...C----------SGMV----------------------------------------------------
FABH_SYNY3/110-187---FDITA.A...C----------SGFV----------------------------------------------------
Q8KE19_CHLTE/7-93---FDVTN.A...C----------NSFL----------------------------------------------------
FABH2_BACSU/107-185---LDINA.T...C----------AGLT----------------------------------------------------
FABH_RALSO/114-191---FDLQA.V...C----------SGFV----------------------------------------------------
FABH_CLOPE/106-184---FDINA.A...C----------TGFI----------------------------------------------------
FABH_PORPU/105-182---FDITA.A...C----------SGFI----------------------------------------------------
Q9EV93_CLOST/253-336---SDTRG.F...C----------AGPT----------------------------------------------------
Q8KND4_MICEC/107-187---TEIRQ.G...C----------NGMF----------------------------------------------------
Q7P5B4_FUSNV/90-168---LDINT.T...C----------TSFI----------------------------------------------------
Q7B6G5_STRHY/115-192---MDVGA.A...C----------SGFS----------------------------------------------------
Q6LQM2_PHOPR/106-184---FDMNA.A...C----------TGFL----------------------------------------------------
FABH_CAMJE/108-185---FDISA.A...C----------SGFI----------------------------------------------------
Q5YPR0_NOCFA/115-192---FDISA.G...C----------SGLA----------------------------------------------------
FABH_COXBU/109-186---FDINA.A...C----------AGFV----------------------------------------------------
Q63N13_BURPS/108-189---FDIRA.Q...C----------SGGL----------------------------------------------------
Q82KT2_STRAW/108-188---FDVAA.V...C----------SGFL----------------------------------------------------
Q65LQ9_BACLD/110-188---VDVNA.T...C----------AGLA----------------------------------------------------
Q982F9_RHILO/108-186---VDLTA.A...C----------AGFI----------------------------------------------------
Q81JE9_BACAN/109-187---FDINS.T...C----------LSFI----------------------------------------------------
Q5NF70_FRATT/108-185---FDISA.A...C----------SGFV----------------------------------------------------
FABH_PROMM/113-192---FDLTA.A...C----------SGFL----------------------------------------------------
Q6AET2_LEIXX/120-197---YDMNA.A...C----------AGYA----------------------------------------------------
Q7NZW4_CHRVO/106-186---FEVTN.F...C----------NAAW----------------------------------------------------
Q6AQA3_DESPS/118-189---FDISN.A...C----------LGFL----------------------------------------------------
FABH_GRATL/107-186---FDLTA.A...C----------SGFV----------------------------------------------------
FABH_CHLPN/114-193---FDCQA.A...C----------TGYL----------------------------------------------------
FABH_DESPS/106-184---FDVNA.A...C----------SGFL----------------------------------------------------
FABH_XANCP/110-187---FDVNA.A...C----------SGFV----------------------------------------------------
Q767G6_9ACTO/120-198---FDINA.V...C----------SGFV----------------------------------------------------
Q8RC81_THETN/108-187---FDINA.S...C----------AGFA----------------------------------------------------
Q5YNJ2_NOCFA/116-193---FDLTS.G...C----------GGFG----------------------------------------------------
Q67MB7_SYMTH/116-197---FEVAA.V...S----------AGCP----------------------------------------------------
FABH_CHLMU/106-185---FDCLV.A...C----------TGFL----------------------------------------------------
Q5QZ39_IDILO/107-184---FDVGA.A...C----------SGFI----------------------------------------------------
Q884Y8_PSESM/108-185---FDISL.G...C----------SGYV----------------------------------------------------
Q9KHD4_STRGR/142-220---FDVTSVA...C----------AGFM----------------------------------------------------
FABH2_BACHD/109-187---IDLNA.A...C----------AGFT----------------------------------------------------
Q5X356_LEGPA/131-209---YDLKT.G...C----------STSL----------------------------------------------------
Q5X4S4_LEGPA/109-187---FDINS.T...C----------LSFL----------------------------------------------------
Q7KWI9_PLAF7/153-231---MDLTA.A...C----------TGFI----------------------------------------------------
Q65LD5_BACLD/106-184---MDISA.A...C----------AGFM----------------------------------------------------
FABH_ENTFA/107-184---FDISA.A...C----------SGFV----------------------------------------------------
Q8RC85_THETN/112-193---FDMAL.R...C----------GTAV----------------------------------------------------
Q93HA0_STRAW/106-185---VEVRQ.M...S----------NGGM----------------------------------------------------
FABH_OCEIH/106-184---MDVSA.A...C----------AGFM----------------------------------------------------
FABH_THEEB/108-185---FDLTA.A...C----------SGFL----------------------------------------------------

PF08392

Q9FW59_ORYSJ/25-322VKVYNLTGMG---C----------SATL----------------------------------------------------
KCS3_ARATH/23-313IKVFNLTAMG---C----------SASV----------------------------------------------------
Q8RXA6_TROMA/89-378VFSYNLGGMG---C----------SAGV----------------------------------------------------
KCS11_ARATH/92-381ILSYNLGGMG---C----------SAGL----------------------------------------------------
KCS16_ARATH/71-366IKSLNLGGMG---C----------SAGV----------------------------------------------------
O23738_BRANA/70-368VRSFNLGGMG---C----------SAGV----------------------------------------------------
KCS2_ARATH/74-363IKSFNLGGMG---C----------SAGV----------------------------------------------------
Q84K36_TROMA/115-405ILSYNLGGMG---C----------SAGI----------------------------------------------------
Q75M74_ORYSJ/23-315VAAYSLAGMG---C----------SAGL----------------------------------------------------
KCS14_ARATH/52-334VKTYNLSG..---.----------....----------------------------------------------------
Q41301_SIMCH/101-390ILSYNLGGMG---C----------SAGL----------------------------------------------------
Q650T5_ORYSJ/56-349VRTCNLSGMG---C----------AAGA----------------------------------------------------
Q7XZE7_MARPO/111-400IRTYNLGGMG---C----------SAGV----------------------------------------------------
Q9FV67_LIMDO/93-382IISYNLGGMG---C----------SAGL----------------------------------------------------
Q6DUV5_BRANA/114-403IKSYNLGGMG---C----------SAGL----------------------------------------------------
Q6K3E6_ORYSJ/23-314VMAYNLSGMG---C----------SAGL----------------------------------------------------
Q688V9_ORYSJ/93-381IKSFNLGGMG---C----------SAGV----------------------------------------------------
Q5Z6R6_ORYSJ/79-372VRAVHLSGMG---C----------SAGL----------------------------------------------------
Q8H7L2_ORYSJ/167-457ILSYNLGGMG---C----------SAGV----------------------------------------------------
KCS7_ARATH/38-328IKSFSLSGMG---C----------SAGI----------------------------------------------------
Q8LQT7_ORYSJ/61-349VQNVNLSGMG---C----------SAGL----------------------------------------------------
Q6Z6C7_ORYSJ/95-384IVSYNLGGMG---C----------SAGL----------------------------------------------------
KCS20_ARATH/42-333IKSFNLSGMG---C----------AAGI----------------------------------------------------
Q84VI8_MARPO/119-408IKSLNLGGMG---C----------SAGV----------------------------------------------------
Q9XEP1_SORBI/93-380VSSYNLAGMG---C----------SASL----------------------------------------------------
Q7XZE8_MARPO/116-405IKSLNLGGMG---C----------SAGL----------------------------------------------------
Q7XT16_ORYSJ/77-368VRSVNLSGMG---C----------SGAL----------------------------------------------------
Q670P4_LESFE/67-364IKSFNIGGMG---C----------SAGI----------------------------------------------------
Q6K558_ORYSJ/43-332TRTYSLAGMG---C----------SAGT----------------------------------------------------
Q93XD5_LESFE/69-366IKSFNLGGMG---C----------SAGV----------------------------------------------------
KCS21_ARATH/24-318IKSYNLSGLG---C----------SASV----------------------------------------------------
Q6F365_ORYSJ/100-389VVSYNLGGMG---C----------SAGL----------------------------------------------------
Q6TMJ4_DICDI/114-404VLSYNLSGMG---C----------SAGA----------------------------------------------------
Q75M84_ORYSJ/26-319VAAYNLSGMG---C----------SATL----------------------------------------------------
Q5Z6S3_ORYSJ/79-368IRSMHLSGMG---C----------SASL----------------------------------------------------
Q7XEM4_ORYSJ/93-383VVSHNLSGMG---C----------SAGI----------------------------------------------------
O81658_HEMSP/97-387VKSFNLGGMG---C----------SAGL----------------------------------------------------

PF01154

HMCS1_RAT/13-186LEKYDGVD-----A----------GKYT----------------------------------------------------
HMCS2_RAT/50-223LEKFNNVE-----A----------GKYT----------------------------------------------------
HMCS2_BLAGE/4-176LETYDEVS-----P----------GKYT----------------------------------------------------
HMCS_YEAST/45-216LEKFDGVS-----Q----------GKYT----------------------------------------------------

PF02797

THS1_VITVI/238-388-----LDA-V---E------AK--LNLE-K-----------------KKL---------------------------E--
O81305_ARATH/238-383-----LSG-L---E------TK--LKLK-P-----------------EKL---------------------------E--
O23811_ORYSA/244-389-----LNR-L---E------VC--LELQ-P-----------------EKL---------------------------K--
CHSF_PETHY/238-388-----LDQ-V---E------LK--LGLK-P-----------------EKL---------------------------N--
CHSG_PETHY/241-391-----LNQ-I---E------LK--LGLK-P-----------------EKL---------------------------R--
CHSA_IPOPU/244-394-----LDG-V---E------EK--LGLE-P-----------------EKL---------------------------R--
CHS3_BROFI/239-389-----LDQ-V---E------IK--LGLK-A-----------------EKL---------------------------A--
O23674_ARATH/245-393-----LNR-L---E------TK--LKLE-K-----------------EKL---------------------------E--
O22122_SCUBA/238-388-----LDQ-V---E------EK--LGLK-P-----------------EIM---------------------------V--
O24484_PINRA/245-390-----LNR-L---E------KK--LSLG-P-----------------EKL---------------------------Y--
BBS_PHASS/239-389-----LDQ-V---E------ER--VGLK-P-----------------EKL---------------------------S--
VPS_HUMLU/241-391-----LDE-I---E------AK--LELK-K-----------------EKM---------------------------K--
DPS1_PINST/244-394-----LDQ-V---E------AS--LNLD-P-----------------TKL---------------------------R--
CHS2_HORVU/240-390-----LDR-V---E------DR--VGLD-K-----------------KRM---------------------------R--
CHSB_PETHY/241-391-----VDQ-V---E------ST--LGLG-P-----------------EKL---------------------------R--
CHS3_GERHY/244-394-----LDQ-V---E------FK--LGLR-E-----------------EKL---------------------------R--
CHSD_PETHY/238-388-----LNQ-V---E------LK--LGLN-P-----------------EKL---------------------------G--
O82145_HYDMC/242-398-----LNQ-V---Q------AK--VGLK-E-----------------EKL---------------------------R--
2PS_GERHY/243-393-----LDQ-V---E------RK--LNLK-E-----------------DKL---------------------------R--
CHSY_PINSY/243-393-----LDQ-V---E------AK--LNLD-P-----------------KKL---------------------------S--
THS1_ARAHY/238-388-----LDQ-V---E------QK--VNLK-P-----------------EKM---------------------------K--

PF08541

Q7CTU0_AGRT5/239-328-----SDA.V---C------GN--LGIE.R-----------------E..---------------------------K--
FABH_PROMM/246-335-----LDA.V---A------NR--FAIP.Q-----------------A..---------------------------K--
Q73Q42_TREDE/222-311-----LEA.A---A------KR--LNTD.M-----------------S..---------------------------K--
FABH_PSEAE/233-322-----LAA.V---A------DQ--LDLP.V-----------------E..---------------------------R--
FABH_CHRVO/230-319-----IES.T---A------KH--LGLP.M-----------------D..---------------------------K--
Q6RC13_MYCUL/216-307-----LTATI---L------EP--NGIP.V-----------------N..---------------------------K--
FABH_DESVH/241-330-----IEA.V---G------DR--LGFA.S-----------------E..---------------------------K--
FABH_LISMF/221-310-----MEA.S---R------ER--LNLP.E-----------------E..---------------------------K--
Q5YPR0_NOCFA/241-333-----IDG.V---V------RK--LGWR.D-----------------DSV---------------------------V--
FABH2_STRCO/230-319-----LTS.V---A------KR--LRLP.P-----------------E..---------------------------R--
Q5KSM6_9ACTO/237-326-----LDS.L---F------AD--LELP.R-----------------A..---------------------------T--
Q5WEX8_BACSK/220-309-----MEA.S---R------ER--LELP.R-----------------E..---------------------------K--
FABH_NOSS1/239-328-----LDT.V---A------QR--LNIP.A-----------------H..---------------------------K--
Q67RA0_SYMTH/248-336-----HQA.L---I------EQ--LGIP.V-----------------D..---------------------------R--
Q5NF70_FRATT/234-323-----LNS.T---A------KK--IDMP.M-----------------P..---------------------------K--
Q7M7Z5_WOLSU/238-327-----IKA.V---G------DL--LDFT.P-----------------E..---------------------------Q--
FABH2_VIBPA/235-324-----IQT.L---C------DL--SGIP.Q-----------------D..---------------------------K--
Q847B9_NODSP/248-337-----SKA.I---L------AS--LNLK.D-----------------E..---------------------------Q--
Q7NZ26_CHRVO/282-372-----NQLIA---R------RV--LGRE.A-----------------DTV---------------------------E--
FABH_AQUAE/220-309-----INA.L---A------EK--LNIP.K-----------------E..---------------------------K--
FABH1_STRAW/264-354-----IDS.M---V------KT--LKLP.E-----------------H.V---------------------------T--
FABH_TROWT/231-321-----IDE.L---A------KQ--IGLE.E-----------------N.V---------------------------L--
Q63N14_BURPS/258-347-----VRA.W---A------QR--LGLA.P-----------------D..---------------------------Q--
FABH_HELHP/239-328-----INA.V---G------EN--LNFT.P-----------------E..---------------------------Q--
Q8PJG1_XANAC/243-332-----LDH.V---V------QT--LGLR.P-----------------D..---------------------------Q--
FABH3_STRCO/240-329-----TAR.L---A------DE--IGIP.R-----------------E..---------------------------R--
FABH_PROMP/245-334-----LDS.V---G------ER--LNVS.T-----------------E..---------------------------K--
Q65LQ9_BACLD/237-326-----IES.I---C------EK--TEIP.A-----------------E..---------------------------K--
FABH_CLOAB/234-323-----IEF.A---A------KK--LGLS.M-----------------D..---------------------------K--
FABH_AROAE/232-321-----LQA.T---A------RR--LGVS.M-----------------D..---------------------------K--
Q7X5N4_PSEAI/289-378-----NET.I---R------KK--LGLP.V-----------------E..---------------------------K--
FABH_ARATH/314-403-----IDS.V---A------TR--LHFP.P-----------------E..---------------------------R--
FABH_STRPN/233-324-----LDK.M---A------RK--IGVD.R-----------------A..---------------------------K--
Q5FUN7_GLUOX/235-324-----IEG.M---A------KK--LALP.A-----------------D..---------------------------R--
Q93KW7_STRVR/244-335-----SSSAE---W------RP--GGCR.C-----------------P..---------------------------G--
Q9L1V9_STRCO/246-337-----YLKVI---L------DP--MGLS.P-----------------D..---------------------------Q--
Q8GHC0_9ACTO/249-339-----AAS.Y---L------KI--LGFS.L-----------------E..---------------------------S--
Q8DBH1_VIBVU/241-329-----LKK.L---P------SL--VGLP.K-----------------E..---------------------------K--
Q67G55_9ACTO/244-335-----LESLY---Y------ER--FGID.P-----------------A..---------------------------R--
Q63CM4_BACCZ/243-331-----LIE.L---I------QG--LGLT..-----------------E..---------------------------E--
FABH2_STRAW/225-314-----IEP.L---A------AK--IGAV.N-----------------A..---------------------------V--
O34266_XANCA/346-435-----LDH.V---V------QA--LGLR.P-----------------E..---------------------------Q--
Q87XT2_PSESM/282-372-----NHLIT---R------KL--LGRD.A-----------------TVE---------------------------E--
Q884Y8_PSESM/221-307-----VDA.V---A------RR--FEDK.P-----------------E..---------------------------K--
FABH_STRT1/232-320-----LDT.M---A------KK--IDVS.R-----------------D..---------------------------K--
Q93HA0_STRAW/239-330-----MRAQY---F------DP--FGID.P-----------------Q..---------------------------R--
FABH2_LACPL/239-328-----VKS.V---G------QK--LNLA.T-----------------E..---------------------------Q--
FABH2_BACSU/234-323-----IES.I---C------EK--TPFP.I-----------------E..---------------------------K--
Q767G6_9ACTO/250-339-----LDS.L---L------PH--LDLP.R-----------------A..---------------------------V--
FABH_SILPO/234-323-----IQG.T---A------KK--MGLP.M-----------------D..---------------------------K--
FABH_HAEDU/227-316-----IAA.T---A------KK--LEME.M-----------------S..---------------------------Q--
Q7TTZ7_RHOBA/241-330-----LDQ.L---R------KR--MEIS.P-----------------E..---------------------------R--
Q64Y53_BACFR/237-323-----TDF.F---V------KR--LKFD.E-----------------T..---------------------------K--
FABH_RHOBA/256-345-----IDS.A---V------SD--LNVP.P-----------------E..---------------------------K--
Q7NV97_CHRVO/234-323-----MQH.M---A------KR--LGIA.A-----------------G..---------------------------R--
Q5ZV11_LEGPH/238-327-----MHH.I---R------KK--LGIP.G-----------------E..---------------------------K--
Q97KV2_CLOAB/245-334-----IQY.I---C------AQ--LNED.E-----------------N..---------------------------K--
Q8XTB9_RALSO/282-372-----NQLIG---K------RL--LGRD.A-----------------TAD---------------------------D--
Q6A930_PROAC/241-331-----TDV.V---S------RH--LKLP.E-----------------S.V---------------------------T--
FABH_STRLI/241-331-----IDV.L---V------DR--LGVP.E-----------------H.V---------------------------V--
FABH_SYNP6/242-331-----LDA.V---A------DR--LDIS.R-----------------D..---------------------------R--
Q8ED66_SHEON/250-340-----NLFVV---K------KL--LGDE.V-----------------APE---------------------------Q--
Q5SL76_THET8/230-319-----IDA.A---R------ER--LGLP.W-----------------E..---------------------------R--
Q7P488_FUSNV/237-326-----IEA.A---A------KR--MKFP.I-----------------E..---------------------------R--
Q9KHD3_STRGR/256-345-----HTA.V---R------ER--LGIP.E-----------------E..---------------------------R--
Q7N8H1_PHOLL/221-311-----WRQ.A---A------KF--MNIP.I-----------------E..---------------------------K--
Q6MLJ5_BDEBA/242-331-----IEA.V---A------DQ--FKFP.M-----------------E..---------------------------R--
FABH2_VIBVY/235-324-----IQT.L---C------DL--SGID.Q-----------------S..---------------------------K--
Q82PP5_STRAW/243-333-----SPE.N---Y------EL--LGFT.E-----------------K..---------------------------Q--
FABH_PORPU/236-325-----LEA.I---A------TR--LSIP.L-----------------S..---------------------------K--
FABH_PROMA/245-334-----LNA.V---A------DR--FSIP.H-----------------H..---------------------------K--
O68915_9ACTO/245-335-----IEL.M---A------ER--LGLP.E-----------------R.T---------------------------A--
FABH_BLOFL/229-318-----ISK.A---A------KR--LNID.M-----------------E..---------------------------K--
Q8RHZ0_FUSNN/221-309-----MPL.I---M------EK--LGVP.E-----------------G..---------------------------K--
Q7X8V9_ORYSJ/337-426-----IDA.A---A------SR--LDIP.S-----------------D..---------------------------K--
Q93H15_STRAW/220-309-----LHS.V---A------DD--LGLP.R-----------------E..---------------------------R--
FABH_CHLCV/243-332-----IDA.I---A------KR--FEID.E-----------------S..---------------------------K--
FABH_CLOTE/244-333-----IEH.V---A------KK--LGID.E-----------------N..---------------------------K--
Q88ES4_PSEPK/221-308-----VDA.V---A------RR--FEEQHP-----------------E..---------------------------K--
Q88EC1_PSEPK/299-389-----NQLIV---K------KL--LGRE.V-----------------AEE---------------------------E--
FABH_THETN/240-329-----IEA.A---R------KR--LKLT.N-----------------D..---------------------------K--
FABH_STRMU/234-325-----LDK.M---A------KK--IGAD.R-----------------E..---------------------------K--
FABH1_BACAN/219-308-----MES.A---R------ER--LNLP.Q-----------------E..---------------------------K--
FABH_STRP1/233-324-----LDK.I---A------RK--IDVP.R-----------------E..---------------------------K--
FABH_SYNY3/241-330-----MDA.V---G------DR--LGIP.S-----------------E..---------------------------K--
Q64RC8_BACFR/240-327-----ISA.V---A------QR--LDVP.L-----------------E..---------------------------K--
FABH_LACLA/234-325-----LDK.M---A------KK--LGVT.R-----------------Q..---------------------------K--
Q64NV1_BACFR/240-327-----IEA.V---A------HR--MEVP.M-----------------E..---------------------------K--
FABH5_STRCO/237-326-----LHA.V---A------DQ--LRID.G-----------------A..---------------------------R--
Q5YN70_NOCFA/251-341-----LRN.W---R------EA--LELP.P-----------------E..---------------------------R--
FABH_BRUME/234-323-----IDA.S---A------KK--LHIA.E-----------------E..---------------------------K--
FABH2_BACHD/236-325-----IES.I---C------DK--SGIP.L-----------------E..---------------------------Q--
Q5YNJ2_NOCFA/253-343-----NEL.M---K------KN--LGLA.D-----------------D.I---------------------------P--
FABH_CHLPN/245-334-----IDA.L---A------KR--FEID.E-----------------S..---------------------------R--
Q885B9_PSESM/249-338-----LDA.L---R------RR--LKLP.A-----------------E..---------------------------K--
Q82HI7_STRAW/252-343-----YIRAV---L------EP--LGID.P-----------------A..---------------------------R--
Q6FAK4_ACIAD/280-370-----NQLIA---K------LV--LGKE.A-----------------EAE---------------------------R--
Q8VWB0_9ACTO/262-353-----LRAGF---L------NR--LGIG.E-----------------D..---------------------------R--
Q6DAZ3_ERWCT/249-337-----LEH.M---R------KR--LAIP.T-----------------E..---------------------------R--
FABH_SYMTH/239-328-----IDS.A---V------KR--LGLA.P-----------------E..---------------------------K--
Q8CV20_OCEIH/48-137-----ILK.I---Q------DH--FNIQ.E-----------------E..---------------------------K--
Q9HYV7_PSEAE/259-349-----NLLIT---R------KL--LGRD.A-----------------EAH---------------------------E--
Q5HTA7_CAMJR/252-338-----VDC.I---K------EE--LKLN.D-----------------D..---------------------------K--
FABH_GEOKA/219-308-----VEA.A---R------QR--LELP.E-----------------E..---------------------------K--
FABH2_VIBCH/235-324-----IQT.L---C------DL--AGIA.Q-----------------D..---------------------------K--
Q6AQA3_DESPS/255-342-----FRM.L---F------DR--LGLS.E-----------------E..---------------------------K--
FABH1_LACPL/238-323-----IEK.I---A------AN--LALP.M-----------------T..---------------------------K--
Q9KHD4_STRGR/257-346-----INQ.V---C------RT--LEIP.R-----------------E..---------------------------K--
FABH_CHLMU/237-326-----IDA.I---A------KR--FAVE.D-----------------S..---------------------------R--
Q64Y55_BACFR/251-340-----NEK.I---R------KK--LKID.A-----------------S..---------------------------K--
Q8EDA9_SHEON/231-320-----IDT.L---V------SR--MKIP.K-----------------E..---------------------------K--
Q6LQM2_PHOPR/234-323-----IEA.L---C------DH--AKIP.L-----------------D..---------------------------K--
Q63PP7_BURPS/254-343-----LKH.L---A------KK--AGLP.A-----------------E..---------------------------R--
FABH_COXBU/230-319-----IEA.T---A------KR--LGLP.R-----------------E..---------------------------R--
Q8KND4_MICEC/245-336-----VEQRC---M------AP--LGLG.M-----------------E..---------------------------K--
FABH_ANAMM/233-322-----IDL.V---I------NR--LGLS.R-----------------D..---------------------------K--
FABH2_BACAN/235-324-----IES.I---C------EK--SQIP.I-----------------H..---------------------------K--
Q5NL87_ZYMMO/234-323-----LSA.T---A------QK--LGVP.S-----------------E..---------------------------Q--
FABH_RHOCA/235-324-----ITA.T---A------ER--MGVP.M-----------------E..---------------------------R--
FABH_THEEB/239-328-----LDA.V---A------ER--LGIP.Q-----------------E..---------------------------K--
Q5LUY4_SILPO/282-372-----NDFIG---K------KV--LGRE.P-----------------EPG---------------------------E--
FABH1_STAES/222-311-----MES.A---R------ER--LGIE.R-----------------E..---------------------------K--
Q98AW4_RHILO/238-327-----FDA.V---G------RN--LGIA.D-----------------E..---------------------------A--
Q8FHY5_ECOL6/258-346-----LEH.M---R------KR--LRVP.E-----------------S..---------------------------A--
Q6AET2_LEIXX/245-335-----VDE.F---A------KQ--LKLP.E-----------------T.V---------------------------A--
Q81JE9_BACAN/240-329-----MRL.I---R------KK--LGVD.E-----------------E..---------------------------R--
Q6MR21_BDEBA/243-332-----IYE.T---L------DK--LELP.R-----------------D..---------------------------R--
FABH_STRA5/232-323-----LDK.M---S------RK--IDIA.R-----------------D..---------------------------K--
Q5QZ39_IDILO/231-320-----INA.T---A------KK--LQIP.M-----------------E..---------------------------R--
FABH_BORPE/239-328-----LNF.L---A------RK--LRVP.T-----------------E..---------------------------R--
Q74CS1_GEOSL/236-325-----IDA.I---G------KR--LGLP.G-----------------E..---------------------------K--
FABH_NITEU/229-318-----ITS.T---A------KK--LGIP.E-----------------E..---------------------------K--
FABH_WOLTR/237-326-----IEA.V---V------KK--LNFL.M-----------------E..---------------------------K--
Q98K75_RHILO/223-313-----NAMIL---K------LS--FGHD.V-----------------DHD---------------------------R--
Q9K3G9_STRCO/229-319-----IDA.M---V------RR--LRPP.E-----------------H.V---------------------------A--
FABH_GLOVI/237-326-----LDS.V---A------SR--LHVA.P-----------------E..---------------------------R--
Q5WUL5_LEGPL/257-346-----IDQ.V---L------HE--NHLN.N-----------------K..---------------------------I--
Q8EG66_SHEON/260-347-----RKQ.V---L------SA--LNIP.P-----------------E..---------------------------K--
Q63PP9_BURPS/255-344-----LDA.L---R------KK--MKIP.E-----------------H..---------------------------K--
Q7NZW4_CHRVO/228-317-----HRS.L---L------AR--LDLS.E-----------------E..---------------------------R--
Q8RC85_THETN/250-338-----HEF.I---L------NE--LGLS.P-----------------D..---------------------------K--
Q6MAF5_PARUW/240-329-----IDA.I---A------KN--FNFP.D-----------------E..---------------------------K--
FABH_EHRRG/230-319-----IEL.V---A------RR--LKIP.S-----------------E..---------------------------K--
Q5QWT4_IDILO/232-321-----IDF.L---G------KM--CKVP.S-----------------E..---------------------------K--
Q67MB7_SYMTH/254-342-----FDQ.V---M------AA--LGIP.P-----------------E..---------------------------R--
Q8CL25_YERPE/90-178-----LAH.M---R------KR--LHVP.T-----------------D..---------------------------V--
FABH1_DEIRA/233-322-----IEA.A---T------QR--FGIP.M-----------------E..---------------------------K--
Q9I4X1_PSEAE/253-342-----VKA.W---A------EG--IGAR.P-----------------E..---------------------------Q--
Q7B6G5_STRHY/240-330-----VDS.V---A------RS--LGLA.P-----------------H.T---------------------------A--
FABH_GRATL/239-328-----LQA.V---A------NR--LSVD.N-----------------Y..---------------------------K--
FABH1_VIBCH/227-316-----ISA.T---A------KK--LSMS.L-----------------D..---------------------------Q--
O77078_PLAFA/282-371-----IET.V---A------KN--LNIP.M-----------------S..---------------------------K--
Q73S66_MYCPA/245-335-----LRN.W---R------DA--LELP.P-----------------A..---------------------------R--
FABH_HELPJ/239-328-----IQA.V---R------EH--LDFK.D-----------------E..---------------------------Q--
FABH_NEIG1/231-320-----IES.T---A------KH--LGLS.M-----------------D..---------------------------K--
Q63N13_BURPS/243-332-----IDA.V---I------EQ--LGLP.R-----------------E..---------------------------R--
FABH2_STAES/235-324-----IES.I---C------EK--ANIE.T-----------------D..---------------------------K--
FABH_ERWCT/228-317-----ISA.T---A------KK--LGMG.M-----------------D..---------------------------K--
Q8FWG7_BRUSU/237-326-----VDK.V---C------ET--IGVP.R-----------------A..---------------------------K--
FABH_CLOPE/235-324-----IDY.V---V------KR--LGIP.R-----------------E..---------------------------K--
Q820X4_COXBU/239-326-----LQS.A---A------SR--AGIA.P-----------------E..---------------------------K--
FABH_PORGI/240-327-----IDA.V---A------RR--MGVP.Y-----------------E..---------------------------K--
Q72KF2_THET2/241-329-----HRA.V---L------AG--LGLS.E-----------------E..---------------------------R--
FABH_BARQU/235-324-----IEA.S---A------KK--LGIS.M-----------------D..---------------------------K--
FABH_CAMJR/230-319-----IKA.V---Q------EK--LNLS.D-----------------E..---------------------------K--
Q82NC9_STRAW/244-334-----LRN.W---R------EA--LQLP.P-----------------E..---------------------------R--
FABH_RHIME/234-323-----IDG.S---A------KK--LGIP.L-----------------E..---------------------------K--
FABH_RALSO/237-326-----MQG.T---A------KK--LGLP.G-----------------E..---------------------------R--
Q5ZTD0_LEGPH/246-335-----VLS.V---A------KQ--LGFP.E-----------------E..---------------------------K--
Q82KT2_STRAW/240-329-----LDS.V---A------ER--LGVP.A-----------------E..---------------------------R--
Q8GE37_HELMO/240-329-----IDS.A---A------KK--LGIG.M-----------------E..---------------------------R--
Q8F686_LEPIN/233-322-----VQD.V---L------KR--TRFP.K-----------------E..---------------------------K--
FABH_RICTY/228-317-----INK.L---A------EL--LNIE.E-----------------H..---------------------------K--
Q54816_STRPE/249-340-----LSAAY---F------NK--WHIQ.P-----------------E..---------------------------R--
FABH_OCEIH/221-310-----MEA.A---R------ER--LGIS.E-----------------D..---------------------------K--
FABH_SHEON/230-319-----INA.T---A------KK--LDMS.L-----------------D..---------------------------K--
FABH_DESPS/235-324-----IKN.L---G------ER--LGLS.S-----------------E..---------------------------Q--
FABH_XANCP/236-325-----IEA.T---A------KR--LDLP.M-----------------E..---------------------------Q--
FABH_CHLTE/239-328-----IHA.T---A------ER--MGIT.E-----------------E..---------------------------K--
Q5ZVP7_LEGPH/228-317-----IQA.I---A------KK--LSLP.M-----------------S..---------------------------H--
FABH_BURPS/240-329-----MTS.T---C------RK--LGLP.Q-----------------E..---------------------------R--
FABH_MYCBO/242-332-----NEL.L---V------KN--LQLR.P-----------------D.A---------------------------V--
Q8RC81_THETN/237-325-----ILE.V---M------DT--LGLD.R-----------------S..---------------------------K--
Q5YNV7_NOCFA/248-338-----IEI.M---A------RV--LKLP.E-----------------D.C---------------------------A--
FABH_METCA/232-321-----IAA.T---A------KK--LQLP.M-----------------E..---------------------------R--
FABH2_DEIRA/239-328-----IEA.A---C------ER--FGLP.I-----------------E..---------------------------R--
PQSD_PSEAE/242-329-----LDA.V---Q------EQ--LGIP.Q-----------------H..---------------------------K--

PF02803

FADA_PSEFR/265-390-----ALP-V---L------KD--LKVL-DKMN..............E-----------------------------K--
THIL_ZOORA/269-391-----ACA-V---N------KD--LGWD-P.................S-----------------------------I--
THIL_YEAST/274-397-----GLV-N---T------KI--LKLD-P.................S-----------------------------K--
THIB_CANTR/274-396-----GLA-N---A------EL--VKIP-L.................E-----------------------------K--
FADA_ECOLI/261-386-----ILP-C---I------KD--LGLI-EQID..............E-----------------------------K--
YKA3_CAEEL/305-445-----VLA-N---L------NA--MDSD-YFCKEQMKRSGKFGRVPMD-----------------------------K--
THIL_HUMAN/306-426-----VLA-N---I------KM--LEID-P.................Q-----------------------------K--
THLA_CLOAB/269-391-----SLA-V---A------KD--LKFD-M.................N-----------------------------K--
ATOB_ECOLI/270-392-----FLA-V---G------KN--LGFD-S.................E-----------------------------K--
THL_BACSU/270-392-----VLT-C---E------KI--VGFD-L.................E-----------------------------K--
THIL_CUPNH/270-392-----ALA-V---H------QQ--MGWD-T.................S-----------------------------K--
THIM_HUMAN/273-395-----YLA-V---E------RS--LDLD-I.................S-----------------------------K--
THIKA_RAT/298-421-----ALY-C---V------EK--LGIP-A.................E-----------------------------K--
YQEF_ECOLI/269-391-----ALS-V---G------KM--LEWD-E.................R-----------------------------R--
THIK_YEAST/296-416-----ALY-C---I------HK--LGID-L.................N-----------------------------K--
THIKA_CANTR/287-407-----CLY-S---A------EQ--VNVP-E.................E-----------------------------K--
FADA4_MYCLE/270-392-----ALA-S---A------RE--LGIA-P.................E-----------------------------L--
THIL_PARDE/268-390-----AIA-V---N------RD--MGWD-P.................S-----------------------------I--
THIL_THIVI/271-393-----AMS-V---N------QE--MGWD-L.................S-----------------------------K--
THIK_YARLI/291-413-----ALF-S---I------QH--CGID-E.................S-----------------------------K--
ECHB_RAT/332-472-----ILA-N---F------KA--MDSD-WFAQNYMGRKTKVGAPPLE-----------------------------K--
ATOB_HAEIN/270-392-----FLG-V---G------KD--LNLD-M.................N-----------------------------K--

PF02801

PKSJ_BACSU/4829-4945.-...MKD-A---L------FK--SGKK.P-----------------E--------------------------------
PKSL_BACSU/4322-4438.-...MLS-A---L------EK--SGKK.T-----------------E--------------------------------
Q44222_NOSS1/297-409.-......-A---L------KM--AVYH.L-----------------E--------------------------------
Q18559_CAEEL/5488-5604.-...MTD-V---L------AR--FTNKEK-----------------E--------------------------------
Q17301_CAEBR/2504-2620.-...MTE-V---L------EK--LTQEEM-----------------N--------------------------------
O33906_9GAMM/317-434.-...FER-A---Y------AA--SDIE.P-----------------K--------------------------------
Q18559_CAEEL/244-354.-...QLE-A---L------KN--IDKD..-----------------.--------------------------------
Q17301_CAEBR/1503-1611.-....LE-I---M------KK--ATSN.T-----------------R--------------------------------
P95029_MYCTU/2816-2942K-DSPLAR-A---L------AK--LGVA.A-----------------D--------------------------------
Q59497_CORAM/2789-2913K-NSRLAK-G---L------AG--LGLT.P-----------------N--------------------------------
PKSF_BACSU/257-367.-...IQK-A---L------ER--ARLL.P-----------------E--------------------------------
P74017_SYNY3/244-356.-...VKH-C---L------TR--SGLT.P-----------------E--------------------------------
FABF_SHIFL/255-370.-...MAN-A---L------RD--AGIE.A-----------------S--------------------------------
FABF_VIBHA/255-371.-...MEA-A---M------RD--ANIT.G-----------------T--------------------------------
O54440_PSEAI/255-370.-...MKN-A---L------RD--AGLD.P-----------------R--------------------------------
O67612_AQUAE/256-371.-...MRL-A---L------ED--AGIK.P-----------------E--------------------------------
FABF_BACSU/254-369.-...MQE-A---I------KD--AGIA.P-----------------E--------------------------------
FABF_SYNY3/258-373.-...IAW-A---L------KD--SGLK.P-----------------E--------------------------------
Q9ZCH8_RICPR/269-384.-...MSE-A---L------QD--ADIT.P-----------------S--------------------------------
O13355_NEUCS/272-392.-...MNX-A---L------KN--AGCQ.P-----------------G--------------------------------
CEM1_YEAST/273-391.-...IEM-A---L------KM--ARLE.P-----------------T--------------------------------
OXSM_SCHPO/262-380.-...MKR-S---L------KQ--AGLS.A-----------------S--------------------------------
Q9ZLS2_HELPJ/258-370.-...MKM-A---L------EM--AKV...-----------------.--------------------------------
Q54208_STRGA/261-376.-...LQN-L---L------ER--TDLE.P-----------------A--------------------------------
O33878_PSEAI/252-360.-...MQQ-A---L------AT--VDAP..-----------------.--------------------------------
FABB_HAEIN/253-361.-...MKQ-A---M------AT--VDTP..-----------------.--------------------------------
FABB_ECOLI/254-362.-...MKM-A---M------HG--VDTP..-----------------.--------------------------------
O84775_CHLTR/256-371.-...ILG-A---L------NK--AGIP.K-----------------E--------------------------------
O82520_CAPCH/330-444.-...IVM-S---L------VD--AGVS.P-----------------E--------------------------------
KASC1_ARATH/315-429.-...IER-C---L------ED--AGVS.P-----------------E--------------------------------
O54149_STRCO/253-365.-...MEA-A---L------AQ--AGVT.G-----------------R--------------------------------
Q9Z4Y3_STRCO/251-363.-...VER-A---L------AA--ARMS.V-----------------R--------------------------------
FAB1_MYCTU/262-374.-...MTR-S---L------EL--AGLS.P-----------------A--------------------------------
FAB2_MYCTU/262-375.-...ITR-A---I------QL--AGLA.P-----------------G--------------------------------
Q93458_CAEEL/101-214.-...MNR-A---I------GN--AHLE.P-----------------K--------------------------------
P70719_AGGAC/260-369.-...MEL-A---L------KD--AHLS.A-----------------Q--------------------------------
Q48375_KIBAR/261-376.-...IRA-A---L------DG--AKMG.P-----------------Q--------------------------------
Q9ZGD7_STRCY/261-376.-...IRV-A---L------DE--ARIN.P-----------------E--------------------------------
KAS1_STRCM/259-373.-...IRL-A---L------DE--ARLN.P-----------------E--------------------------------
KAS1_STRVN/260-375.-...IRA-A---L------DE--ARLD.R-----------------T--------------------------------
Q53671_STRAA/259-374.-...IRT-A---L------DE--ARLD.P-----------------T--------------------------------
KAS1_STRRM/264-379.-...VSR-A---L------DI--ARVD.P-----------------S--------------------------------
KASA_STRCO/303-418.-...IRV-A---L------DE--SRTD.A-----------------T--------------------------------
Q54217_STRGR/260-375.-...IRA-A---L------DE--ARLD.A-----------------S--------------------------------
KAS1_STRCO/261-376.-...IDT-A---L------DM--AELD.G-----------------S--------------------------------
KAS1_STRCN/260-375.-...IDV-A---L------DH--ARVD.P-----------------T--------------------------------
O32451_9ACTO/267-382.-...IRV-A---M------DA--ARVA.P-----------------A--------------------------------
KAS1_STRGA/264-379.-...ITA-A---L------DQ--ARRT.G-----------------D--------------------------------
Q54495_STRNO/265-380.-...IGV-A---L------AQ--AGKA.P-----------------A--------------------------------
Q54994_9ACTO/260-375.-...IRH-A---L------AE--SGTD.P-----------------A--------------------------------
NOE4_RHIML/246-359.-...MRA-C---L------AD--AGLN.A-----------------E--------------------------------
NODE_RHIS3/247-360.-...MRA-C---L------AD--AGLN.V-----------------Q--------------------------------
NODE_RHILT/247-360.-...MRS-C---L------AD--AELN.P-----------------D--------------------------------
Q53672_STRAA/255-365.-...AEL-A---L------VD--AGMT.P-----------------D--------------------------------
Q54496_STRNO/253-363.-...AQA-A---L------DD--AEVG.P-----------------E--------------------------------
Q54995_9ACTO/268-378.-...ARL-A---L------AD--AGLA.P-----------------G--------------------------------
KAS2_STRVN/258-365.-...AEL-A---L------AE--AGLT.P-----------------A--------------------------------
O32452_9ACTO/253-363.-...VRA-A---L------DD--ARLT.P-----------------A--------------------------------
Q54815_STRPE/272-382.-...VET-A---L------AD--AGLD.G-----------------S--------------------------------
KAS2_STRGA/256-366.-...IRL-A---L------EE--ARVA.P-----------------E--------------------------------
KASB_STRCO/251-361.-...IRL-A---L------ND--AGTG.P-----------------E--------------------------------
Q54174_STRFR/256-366.-...IEL-A---L------AD--AGAA.P-----------------E--------------------------------
Q56164_9ACTO/252-362.-...IEL-A---L------AD--AGAA.P-----------------G--------------------------------
Q48376_KIBAR/256-366.-...IEI-A---L------DN--AGML.P-----------------E--------------------------------
Q9ZGD6_STRCY/253-363.-...IEL-A---L------AD--ADAE.P-----------------S--------------------------------
Q54282_SACHI/249-359.-...IEL-A---L------AD--AELR.P-----------------E--------------------------------
Q54218_STRGR/260-370.-...IEL-A---L------AD--AGVA.P-----------------A--------------------------------
KAS2_STRCM/252-360.-...IRT-A---L------DD--AGTA.P-----------------G--------------------------------
KAS2_STRCO/264-377.-...IQG-A---L------AE--AGCR.P-----------------E--------------------------------
KAS2_STRCN/263-375.-...IHG-A---L------DE--AGCA.P-----------------E--------------------------------
FAS_HUMAN/243-360.-...IRS-L---Y------QS--AGVA.P-----------------E--------------------------------
FAS_CHICK/243-360.-...VGS-L---Y------RE--CGIK.P-----------------G--------------------------------
P91871_CAEEL/279-396.-...LQE-V---Y------SE--AGID.P-----------------N--------------------------------
O01678_BOMMO/265-382.-...LRE-F---Y------EE--CSIP.P-----------------S--------------------------------
O01677_BOMMO/269-386.-...LEA-F---Y------SE--IDVC.P-----------------K--------------------------------
WA_EMENI/634-754.-...FKK-L---L------NE--ANVD.P-----------------K--------------------------------
PKSL1_ASPPA/629-750.-...MTA-A---L------NT--TGLH.P-----------------N--------------------------------
P79068_GLOLA/639-760.-...SRA-I---L------DD--AGVD.P-----------------L--------------------------------
O54142_STRCO/811-926.-...VRQ-A---F------AQ--VDFG.P-----------------D--------------------------------
P71718_MYCTU/262-379.-...LRR-A---I------AQ--AAVV.P-----------------A--------------------------------
O33954_STRFR/2834-2952.-...IRQ-A---L------AN--ARLT.V-----------------A--------------------------------
O30480_STRHY/290-406.-...IRD-A---L------TD--ARLT.V-----------------A--------------------------------
O30482_STRHY/292-408.-...IRD-A---L------TN--AQLT.A-----------------T--------------------------------
O30479_STRHY/1233-1349.-...IRD-A---L------TN--AQLT.A-----------------T--------------------------------
O30481_STRHY/292-408.-...IKA-A---L------AD--ARLT.A-----------------A--------------------------------
Q9ZGI5_9ACTO/1367-1485.-...IRR-A---L------AD--ARLT.T-----------------S--------------------------------
Q9ZGI2_9ACTO/293-411.-...IRQ-A---L------AD--ARLT.S-----------------S--------------------------------
Q9ZGI3_9ACTO/295-413.-...IRR-A---L------AD--ARLA.P-----------------G--------------------------------
O65933_MYCTU/289-405.-...IRA-A---L------AS--ARLR.A-----------------V--------------------------------
P95814_STRSQ/5664-5780.-...IRK-A---L------AA--AGLT.A-----------------A--------------------------------
Q54299_STRHY/5475-5591.-...IRQ-A---L------AN--AGLT.A-----------------S--------------------------------
OL56_STRAT/296-414.-...IRA-A---L------AD--AGLA.P-----------------A--------------------------------
O52789_AMYMD/1984-2100.-...IRS-A---L------AG--AGLQ.P-----------------S--------------------------------
O54593_AMYMD/1958-2076.-...IRR-A---L------AG--AGLE.P-----------------S--------------------------------
O54593_AMYMD/287-403.-...IRK-A---L------AG--AGLV.A-----------------S--------------------------------
O52790_AMYMD/292-408.-...IRA-A---L------AN--AGIG.P-----------------S--------------------------------
O54666_AMYMD/888-1004.-...IRR-A---L------AA--AGLA.P-----------------S--------------------------------
O52545_AMYMD/293-411.-...IRK-A---L------AS--AGLT.P-----------------S--------------------------------
O54666_AMYMD/3430-3546.-...IRG-A---L------AS--AGLA.P-----------------S--------------------------------
Q50469_MYCTU/301-419.-...IQV-A---L------AN--AGLS.A-----------------A--------------------------------
O53490_MYCTU/289-408.-...VRA-A---L------AN--AGLS.A-----------------A--------------------------------
Q54297_STRHY/5130-5246.-...IQA-A---L------SN--AGLA.A-----------------H--------------------------------
O54666_AMYMD/2452-2568.-...IRK-A---L------AA--AGLS.T-----------------S--------------------------------
O33956_STRFR/1814-1932.-...IRQ-A---L------AD--AGLR.P-----------------E--------------------------------
O33955_STRFR/283-401.-...IED-A---L------RD--AGVG.P-----------------D--------------------------------
O30767_9ACTO/301-418.-...IRD-A---L------AD--AGLR.A-----------------D--------------------------------
O30764_9ACTO/1265-1382.-...IRD-A---L------SD--AGLS.A-----------------D--------------------------------
O30768_9ACTO/298-415.-...IRD-A---L------AD--AHLT.P-----------------D--------------------------------
O30766_9ACTO/1721-1838.-...IRD-A---L------AD--AGLT.A-----------------A--------------------------------
O33958_STRFR/296-414.-...IAE-A---L------AD--AGLS.P-----------------E--------------------------------
ERYA2_SACER/288-406.-...IRQ-A---L------ES--CGLE.P-----------------G--------------------------------
ERYA3_SACER/285-403.-...IRR-A---L------EN--AGVR.A-----------------G--------------------------------
Q9Z3T8_PSESX/297-415.-...IQL-A---L------QN--ARLR.S-----------------L--------------------------------
ERYA2_SACER/1747-1863.-...IRQ-A---L------AA--SGVP.A-----------------A--------------------------------
Q9ZGA4_9ACTO/3036-3152.-...IER-A---L------DD--AGLA.P-----------------G--------------------------------
ERYA1_SACER/763-879.-...IQQ-A---L------AE--SGLG.P-----------------A--------------------------------
Q9ZGI5_9ACTO/2862-2980.-...IRQ-A---L------AD--ARLA.P-----------------G--------------------------------
Q9ZGA4_9ACTO/1436-1552.-...IRQ-A---L------AN--AGLS.G-----------------A--------------------------------
Q9Z3T9_PSESX/864-981.-...IRH-A---L------AN--AGLQ.P-----------------E--------------------------------
Q9ZGA4_9ACTO/6250-6366.-...IRQ-A---L------AN--AGLQ.P-----------------S--------------------------------
ERYA3_SACER/1748-1866.-...IRK-A---W------AR--AGIT.G-----------------A--------------------------------
ERYA1_SACER/2234-2352.-...IRR-A---W------AR--AGIT.G-----------------A--------------------------------
MCAS_MYCBO/263-377.-...YRA-A---L------AA--AGVQ.P-----------------E--------------------------------
O53901_MYCTU/271-385.-...YRE-A---L------DV--AGVD.P-----------------A--------------------------------
PHAS_MYCTU/282-396.-...YRA-A---L------AA--GGVD.A-----------------A--------------------------------
O50436_MYCTU/264-378.-...YQQ-A---L------AA--AGVE.A-----------------S--------------------------------
O05170_STRVR/291-409.-...MRR-A---L------TA--AGVA.A-----------------D--------------------------------
Q49932_MYCLE/290-405.-...ITD-A---L------RS--SDVA.P-----------------E--------------------------------
Q49940_MYCLE/293-408.-...ITT-A---L------RL--ADIT.P-----------------D--------------------------------
Q49933_MYCLE/296-416.-...LRT-A---L------AS--SKLT.A-----------------A--------------------------------
Q92217_COCHE/272-388.-...IRS-V---Y------KK--AALD.P-----------------L--------------------------------
O86335_MYCTU/354-472.-...LEN-A---C------KS--ARVD.P-----------------L--------------------------------
P78584_ASPPA/269-387.-...ARK-A---L------DV--ARVD.A-----------------S--------------------------------
Q00290_ASPTE/302-420.-...AWN-A---L------RT--AGVD.P-----------------L--------------------------------
MSAS_PENPA/290-408.-...ANN-A---L------SA--ANID.P-----------------H--------------------------------
P87001_PENPA/302-422.-...AQK-A---L------KE--ARVT.P-----------------D--------------------------------
Q9ZGI5_9ACTO/346-464.-...LRE-A---H------ER--AGTA.P-----------------A--------------------------------
O30764_9ACTO/259-377.-...LRA-A---C------DQ--AGVR.P-----------------A--------------------------------
O33954_STRFR/279-399.-...LRQ-A---Y------RR--AGVS.T-----------------G--------------------------------
O54155_STRCO/1041-1159.-...MTG-A---L------ER--AGVQ.P-----------------G--------------------------------
PPSA_MYCTU/359-477.-...LRA-A---Y------TN--AGMQ.P-----------------S--------------------------------
O53579_MYCTU/374-492.-...LRR-A---Y------KD--AGID.P-----------------R--------------------------------
O51828_PSEFL/298-416.-...IRL-A---L------GQ--AGLQ.G-----------------S--------------------------------
O51827_PSEFL/1281-1399.-...ISE-A---L------AN--AGVH.P-----------------G--------------------------------
O51827_PSEFL/269-384.-...ISQ-A---L------KV--AGLS.V-----------------D--------------------------------
Q18559_CAEEL/2133-2242.-...LTS-V---I------NQ--SPSL..-----------------.--------------------------------
O96554_CRYPV/3296-3416.-...IKM-A---L------NQ--SKLN.S-----------------S--------------------------------
O96554_CRYPV/5522-5642.-...IQN-A---L------RN--ARLT.P-----------------N--------------------------------
O96554_CRYPV/1142-1260.-...INS-A---L------EY--AGIR.P-----------------N--------------------------------
O06586_MYCTU/230-347.-...IRR-A---M------SG--AGVD.C-----------------H--------------------------------
O54511_YEREN/284-402.-...IEE-A---L------ML--AAID.D-----------------R--------------------------------
PPSE_MYCTU/270-390.-...IAE-A---H------AV--SGID.S-----------------S--------------------------------
PKSR_BACSU/1766-1891.-...MLK-A---Y------QG--AQID.P-----------------K--------------------------------
PKSM_BACSU/3776-3894.-...IEN-I---Y------EK--NEIN.P-----------------L--------------------------------
PKSL_BACSU/3126-3244.-...ERD-I---Y------ET--YGIH.P-----------------E--------------------------------
PKSJ_BACSU/2018-2137.-...VQQ-V---M------NQ--TKVQ.P-----------------E--------------------------------
PKSL_BACSU/2189-2307.-...IKK-A---F------VE--AKVD.P-----------------R--------------------------------
PKSM_BACSU/2562-2680.-...IKE-A---I------ER--ADIP.A-----------------R--------------------------------
PKSR_BACSU/785-903.-...IVK-S---I------QQ--SGID.P-----------------E--------------------------------
PKSM_BACSU/655-773.-...IEA-C---L------EK--TGID.P-----------------R--------------------------------
PKSL_BACSU/695-813.-...IET-C---L------EK--TGID.P-----------------R--------------------------------
PKSJ_BACSU/3597-3724.-...LVR-A---Y------RQ--ADID.P-----------------S--------------------------------
O30776_NOSP7/342-460.-...LER-A---Y------ED--AGFS.P-----------------A--------------------------------
O33904_9GAMM/316-434.-...LNR-A---Y------DD--AGFA.P-----------------H--------------------------------
O54142_STRCO/307-424.-...AEA-A---H------RT--ADVA.P-----------------G--------------------------------

PF08540

HMCS_SCHPO/176-446-----VQK-A---Y------AR--LLYT-DSAAEPSNPELEGVRELLSTL.....DAKKSLTDKALEKGLMAITKERF--
Q5A3Z7_CANAL/178-450-----VTK-S---Y------AR--LLYN-DYVSNPS..KFADLIDETTRKHIDGLTYDESLTDKILEKTFVGLAKDET--
HMCS_ARATH/175-451-----VQK-S---F------AR--LLYN-DFLRNASS.IDEAAKEKFTPY..SSLTLDESYQSRDLEKVSQQIAKPFY--
HMCS2_BLAGE/177-455-----VQK-S---V------AR--LVLN-DFIQYPEK......YQDLQQL..RNLKFEDTYFDRDIEKIFMDKSKQLF--
HMCS2_HUMAN/224-506-----VQK-S---L------AR--LMFN-DFLS.ASSDTQTSLYKGLEAF..GGLKLEDTYTNKDLDKALLKASQDMF--
HMCS_CAEEL/183-448-----VQK-G---L------AV--MNYT-DSQLRHKQLNGNGVDHKLDEN............DRAGLAKMIELSAQVW--
HMCS1_BLAGE/174-451-----VQK-S---L------AR--LVLN-DFVR.ASEEERTTKYSSLEAL..KGVKLEDTYFDREVEKAVMTYSKNMF--
HMCS_YEAST/217-490-----VTK-S---Y------GR--LLYN-DFRANPQ..LFPEVDAELATR.....DYDESLTDKNIEKTFVNVAKPFH--
HMCS1_RAT/187-469-----VQK-S---L------AR--MFLN-DFLNDQNRDK.NSIYSGLEAF..GDVKLEDTYFDRDVEKAFMKASAELF--
P93773_PINSY/178-452-----VQK-S---F------GR--LLFN-DFSRHARS.VGKDAQEKLEPF..AGLSEQDSYNSRDLEKVSQQLAKPLY--

PF00108

THIL_ZOORA/3-262Q-IATGDASI---I------VA--GGM-ES-----------------MSMAPHCA..-----------.HLAGGVKMG--
THIL_YEAST/2-267S-IKCGNADV---V------VA--GGC-ES-----------------MTNAPYYMP.-----------.AARAGAKFG--
FADA_PSEFR/5-258A-IMTGNGDV---F------VV--GGV-EH-----------------MGHVSMMH..-----------.....GVDPN--
THIB_CANTR/3-267N-IICGTSDI---V------VV--GGA-ES-----------------MSNTPYYLP.-----------.SARSGARYG--
THIL_THIVI/2-264A-VACGDAEI---V------IA--GGQ-ES-----------------MSQSSHVLP.-----------.RSREGQRMG--
THLA_CLOAB/1-262I-IKAGDADV---I------IA--GGM-EN-----------------MSRAPYLAN.-----------.NARWGYRMG--
THIL_CUPNH/1-263A-IMAGDAEI---V------VA--GGQ-EN-----------------MSAAPHVLP.-----------.GSRDGFRMG--
YKA3_CAEEL/23-298M-LATGNANA---I------IA--GGV-EL-----------------LSDVPIRYNR-----------NARKAMLGMN--
YQEF_ECOLI/1-262A-IQCGEADI---V------IA--GGQ-EN-----------------MSRAPHVLT.-----------.DSRTGAQLG--
THIL_PARDE/1-261Q-VLLGDARI---V------VA--GGQ-ES-----------------MSLAPHAA..-----------.YIAPGQKMG--
THIM_HUMAN/4-266E-ICVKEAEV---V------LC--GGT-ES-----------------MSQAPYCVR.-----------.NVRFGTKLG--
ECHB_RAT/52-325L-IASGQCDV---V------VA--GGV-EL-----------------MSDVPIRHSR-----------NMRKMMLDLN--
ATOB_ECOLI/1-263A-IQAGQAQS---I------VA--GGM-EN-----------------MSLAPYLLD.-----------AKARSGYRLG--
FADA_ECOLI/1-254M-IMTGDAQA---C------LV--GGV-EH-----------------MGHVPMSH..-----------...GVDFHPG--
ATOB_HAEIN/1-263S-IISGDADI---V------VV--GGM-EN-----------------MSQAPYLLD.-----------SKVRQGVKMG--
FADA4_MYCLE/1-263L-IRAGEFDV---V------VA--GGQ-ES-----------------MTKAPHLLM.-----------.DSRSGYKYG--
THIKA_RAT/35-291G-IRNGSYDI---G------MA--CGV-ES-----------------MSLSNRGNPG-----------NISSRLLESD--
THIK_YARLI/27-284K-IRAGQIDI---G------IG--CGV-ES-----------------MSNQYGPN..-----------...SVTPFSN--
THIK_YEAST/33-289K-IKVGQIDI---G------LA--LGV-ES-----------------MTNNYKNV..-----------...NPLGMIS--
THIL_HUMAN/39-299S-LMCGHQDV---M------VA--GGM-ES-----------------MSNVPYVMN.-----------...RGSTPYG--
THIKA_CANTR/24-280K-IKTGEIEC---G------LA--GGA-ES-----------------MSTNYRDP..-----------...RVAPRID--
THL_BACSU/1-263M-IRAQDADI---L------VA--GGM-ES-----------------MSNIPYAVP.-----------.AGRWGARMG--

PF00109

Q18559_CAEEL/5257-5480K.FIQHAYLA---L------EN--SGY.VK-----------------QK....HELR...........CGVFAGAEPS..
Q18559_CAEEL/1-236M.LMQGVIKG---L------EN--AGI.TL-----------------EMA...SEAR...........VAVYTAAWCY..
Q18559_CAEEL/1888-2129L.LLECVQEC---L------EN--SGV.IE-----------------TS..................NVGVFVGLMEK..
Q18559_CAEEL/4241-4474L.LLCSVAKL---L------DS--LLI.TS-----------------......LTSN...........TGVFIGCSAN..
Q18559_CAEEL/824-1057L.LLNAAYNA---L------EK--SGL.TS-----------------..I...PDAD.............LFLAISAH..
FAS_HUMAN/1-239L.LLEVTYEA---I------VD--GGI.NP-----------------DSL...RGTH...........TGVWVGVSGS..
PKSM_BACSU/2319-2554L.FLQTAYAS---I------ED--AGY.TP-----------------DSL...CSSR..........KIGVFAGVMNK..
PKSL_BACSU/433-687L.FLETCWET---I------ED--AGY.TP-----------------KTL...AKPKGRN....KRQHVGVFAGVMHK..
Q92217_COCHE/11-264M.LLECSYEA---F------EN--SGT.PM-----------------SKI...VGTD...........TSVFVSSFAT..
PKSR_BACSU/1528-1758L.LLIHAWKA---M------ED--AGL.TG-----------------QVL...SSRP...........TGVFVAAGNT..
P91871_CAEEL/37-275L.LLEASWEA---M------VD--AGI.NP-----------------TDL...RGSK...........TGVFVGCSAS..
PKSM_BACSU/393-647L.FLETCWEA---I------ED--AGY.TP-----------------ETI...ASPQGEN....KRQHVGVFAGVMHK..
PKSJ_BACSU/4588-4821L.VLEECLKL---L------YH--AGY.TP-----------------EEI...KGKP...........VGVYIGGRSQ..
PKSJ_BACSU/3339-3589L.LMTYVWKA---L------ED--AGC.SP-----------------QSL...SGTG...........TGIFIGTGNT..
PKSL_BACSU/4082-4314A.VLEESLKL---W------YH--AGY.TE-----------------KEV...KGMR...........AGVYIGGRSQ..
PKSR_BACSU/527-777L.CLETVWET---F------ED--GGY.TR-----------------TRL...DKLRD.......DDGVGVFIGNMYN..
PKSF_BACSU/6-249A.ALVTLTEA---W------EE--AEL.DD-----------------..A...DSSR...........IGLVVGGSNF..
PKSJ_BACSU/1760-2010M.LLTHSWKA---I------ED--AGY.AA-----------------RQI...PQ.............TSVFMSASNN..
PKSL_BACSU/1926-2181L.FLQCVYET---M------ED--AGY.TR-----------------EHL..GRKRDAE.....LGGSVGVYVGVMYE..
PKSL_BACSU/2873-3118I.FLQEGYKA---F------ED--AGY.NA-----------------RTL...NEKK...........CGVYLGIMSN..
PKSM_BACSU/3529-3768I.FLEEAWHT---F------ED--AGY.MG-----------------DRI...KGKS...........CGVYVGVEEG..
ERYA2_SACER/1488-1739L.MLETAWEA---V------ER--AGI.DP-----------------DAL...RGTD...........TGVFVGMNGQ..
ERYA2_SACER/30-280L.LLETSWEL---V------EN--AGI.DP-----------------HSL...RGTA...........TGVFLGVAKF..
ERYA3_SACER/38-277I.MLEISWEA---L------ER--AGH.DP-----------------VSL...RGSA...........TGVFTGVGTV..
FABF_VIBHA/3-246Y.GIAAGIQA---L------DD--SGL.EI-----------------T.....EENA.........ARVGVAIGSGIG..
FABF_SHIFL/3-246Y.GIVAGVQA---M------QD--SGL.EI-----------------TEE...NATR...........IGAAIGSGIG..
ERYA3_SACER/1489-1739Q.VLETTWEL---F------EN--AGI.DP-----------------HSV...RGSD...........TGVFLGAAYQ..
Q56164_9ACTO/2-243L.ALVAADWA---L------AD--AGV.RP-----------------EEQ...DD...........FDMGVVTASASG..
MCAS_MYCBO/5-255L.LLETSWEA---I------EH--AGL.DP-----------------ASL...AGSS...........TAVFTGLTHE..
OXSM_SCHPO/1-253L.ALTSAAEA---L------KD--ARW.ID-----------------...I.DEQEK.........LATGVCFGTGIG..
Q54281_SACHI/2-251F.AVVCTRDA---V------AD--SGL.EF-----------------.....EQVPP.........ERIGVSLGSAVA..
O51827_PSEFL/9-261L.LLEVACES---V------AR--AGL.TR-----------------EQL...KGSR...........TAVYVGMLGM..
PPSA_MYCTU/101-351L.LLEVAWEA---L------EH--AGI.PP-----------------GTL...RRSA...........TGVFAGACLS..
O82520_CAPCH/75-321Y.CLVAGKRA---L------ED--ANL.GQ-----------------..QVLDTMDK.........TRIGVLVGSSMG..
O33954_STRFR/42-271L.MLELGWEA---L------ED--AGI.VP-----------------GDL...TGTD...........TGVFAGVASD..
Q48375_KIBAR/3-252F.AVVTAAEA---M------AD--SGL.DL-----------------.....SGVAP.........HRTGVTVGSTVG..
P95029_MYCTU/2548-2808W.NMVATVDA---