Sequence alignment for CL0047

PF02728

AMO_ENTAE/215-317---GMVLLDDFVSVQNIIN..TSSEFAEVLKKHG.ITD.PGKVVTTPLTVGFFDGKDGLQQDARLLKVVSYLDTGDG...
CAO2_SCHPO/105-207---PIITADLLAITDEIVR..NDANVIEQCKICGVPESGLSNVYCDPWTIGYDERYG...SGRRLQQALMYYKPGDS...
O48552_ARATH/137-234---PSFTFIELFKASKLPL..TYPPFKKSILDRS..LN.ISEVSCIPFTVGWYGETT....TRRELKASCFYRDGSV...
AOC3_MOUSE/169-269---RPVLDREYQDIEEMIFHRELPQASGLLHHCCFYKH..QGQNLLTMTTAPRGLQS....GDRATWFGLYYNLSGA...
AOC2_HUMAN/165-263---RPVLRAEFTQMWRHLK..EVELPKAPIFLSS.TFN.YNGSTLAAVHATPRGLRS....GDRATWMALYHNISGV...
AMO_PICAN/114-216---PILTVEDLCSTEEVIR..NDPAVIEQCVLSGIPANEMHKVYCDPWTIGYDERWG...TGKRLQQALVYYRSDED...
ABP1_RAT/141-241---RPISTAEYDLLYHTLKRATMPLHQFFLDTTGFSFLGCDDRCLTFTDVAPRGVAS....GQRRSWFIVQRYVEG....
PAOX_ARTGO/98-198---LPVLEEEFEVVEQLLA..TDERWLKALAARN.LD..VSKVRVAPLSAGVFEYAE..ERGRRILRGLAFVQDFPE...
AMO1_ARTS1/103-203---PPFMLDEFAECEDACR..KDPEVIAALAKRG.LTN.LDLVCFEPWSVGYFGEDN...EGRRLMRALVFVRDEAD...
AOCX_BOVIN/168-268---RPVLLREYLDIDQMIFNRELPQAAGVLHHCCSYKQ..GGQKLLTMNSAPRGVQS....GDRSTWFGIYYNITKG...
AMO_PEA/126-223---PILSVDEQSLAIKLPL..KYPPFIDSVKKRG.LN..LSEIVCSSFTMGWFGEEK....NVRTVRLDCFMKESTV...
AMOH_ARTGO/119-219---LPVLLEEFGIIEDILS..EDPQWNAALTARG.LT..PAQVRVAPLSAGVFEYGN..EEGKRLLRGLGFRQDHPA...
Q9SLB1_ARATH/205-310---PPMDAAEYAECEAIVK..DFPPFIEAMKRRG.IED.MDLVMVDPWCVGYHSEAD..APSRRLAKPLIYCRTDSDSPM
Q9STI2_ARATH/190-289---PMMTIEEMNDITVVPF..SNADFNRTIISRG..VN.LTDVICFPISCGWFGNKE...ENARVIKSQCFMTQGTP...
Q9STI4_ARATH/177-277---PIVTSEEMDSAASAPF..SNADFNRTINSRG..VN.LTDVICIPISSGWFGNKD..DNTKRVTKIQCFSTQDTP...
Q9SW88_CANLI/174-275---PTMTLEEMVGVLEVPL..KSPEFNKTISKRG..VN.LADLTCIPVASGWYGTQVE.EENGRLIKVQCYSHKGTV...
Q9XHP4_SOYBN/133-238---PPMDAVEYAECEAVVK..DFPPFREANEGRGGIEE.MDLVMVDPWCAGYHSEAD..APSRRLAKPLIFCRTESDCPM

PF02727

AMO_ENTAE/124-210HPLNSLSAAEISKAVTIVKAAP.EFQP.NTRFTEISLHEPDKAAVWAF.....ALQGTPVDAPRTADVVMLDGKHV.---
ABP1_HUMAN/39-125QELKAVHSFLWSKKELRLQPSSTTTMA.KNTVFLIEMLLPKKYHVLRF....LDKGERH..PVREARAVIFFGDQE.---
AOC3_HUMAN/66-152EELTAVMRFLTQRLGPGLVDAAQARPS.DNCVFSVELQLPPKAAALAH....LDRGSPP..PAREALAIVFFGRQP.---
AMO_PICAN/23-109HPLDPLSTAEIKAATNTVKSYF..AGK.KISFNTVTLREPARKAYIQW....KEQGGPL..PPRLAYYVILEAGKPG---
AMO_LENCU/26-113HPLDPITKEEFLAVQTIVQNKYPISNN.KLAFHYIGVDDPEKDLVLKY.....ETSPTLISIPRKIFVVAIINSQT.---
AMO_ECOLI/124-210HPLNALTADEIKQAVEIVKASA.DFKP.NTRFTEISLLPPDKEAVWAF.....ALENKPVDQPRKADVIMLDGKHI.---
AMOH_ARTGO/28-111HPLEQLSAEEIHEARRILAEAG.LVGE.STRFAYLGLIEPPKT..........TRQGDVTGAARLVRAMLWDAAQSR---
O23349_ARATH/23-113HPLDPLTPQEINKTSFIVKKSHLGNLK.DLTFHYLDLEEPNKSHVLQWLSPNPSKKPPP..PRRRSFVVVRAGGQT.---
Q9STI2_ARATH/97-183HPLDPLTVSEINKIRSILSSHALFTSGTPHALHTVVLEEPEKNLVRHW.....EKGNPL..PPRKASVIARVGADT.---
Q9SW88_CANLI/80-166HPLDPLTIQEFNKVRNILSTHPLFKSPSSYILHSIVLDEPDKKLVLKW.....KKGDPL..LPRKASVIARVNRVA.---
AMO1_ARTS1/15-97HPLDPLSRVEIARAVAILKEGP.AAAE.SFRFISVELREPSK...........DDLRAGVAVAREADAVLVDRAQAR---
ABP1_RAT/39-125QEIKAVHSFLMNREELGLQPSKEPTLA.KNSVFLIEMLLPKKKHVLKF....LDEGRKG..PNREARAVIFFGAQD.---
O65749_CICAR/29-116HPLDPLTKEEFSIVQTVVLHKYPTSKN.SVAFHYIGLDDPDKDDVLKY.....ETQPTLITIPRKSFVVAIINSQN.---
Q9STI4_ARATH/84-170HPLDPLTVMEINKVRSILSSHALFASRVPHLLNSVVLEEPDKNLVRQW.....EKGDQL..PPRKASVIARVGGNS.---

PF02728

AMO_ENTAE/215-317.NYWAHPIENLVAVVDLEAKKIIKIEEGP.VIPVP
CAO2_SCHPO/105-207GHLRSIPLD.FCPIIDVDQKKVIAIDIPKVRRPIP
O48552_ARATH/137-234.NVFTRPIEGITITIDVDSMQVVKYSDRF.RKPLP
AOC3_MOUSE/169-269.GFYPHPIG.LELLIDHKALDPALWTIQKVFYQGR
AOC2_HUMAN/165-263.GLFLHPVG.LELLLDHRALDPAHWTVQQVFYLGH
AMO_PICAN/114-216DSQYSHPLD.FCPIVDTEEKKVIFIDIPNRRRKVS
ABP1_RAT/141-241..YFLHPTG.LEILLDHGSTDVQDWRVEQLWYNGK
PAOX_ARTGO/98-198DSAWAHPVDGLVAYVDVVSKEVTRVIDTG.VFPVP
AMO1_ARTS1/103-203DSPYAHPIENFIVFYDLNAGKVVRLEDDQ.AIPVP
AOCX_BOVIN/168-268.GPYLHPVG.LELLVDHKALDPADWTVQKVFFQGR
AMO_PEA/126-223.NIYVRPITGITIVADLDLMKIVEYHDRD.IEAVP
AMOH_ARTGO/119-219DHPWAHPIDGLVAFVDVENRRVNHLIDDG.PVPVP
Q9SLB1_ARATH/205-310ENGYARPVEGIYVLVDMQNMVVIEFEDRESRGGVD
Q9STI2_ARATH/190-289.NFYMRPIEGLTILIDLDTKQVIEITDTGRAIPIP
Q9STI4_ARATH/177-277.NFYMRPIEGLTLLFDLDTKRILEITDTGQSIPIP
Q9SW88_CANLI/174-275.NFYMKPIEGVNALVDMDRKKVLAILDNGQNIPVS
Q9XHP4_SOYBN/133-238ENGYARPVEGIHVLVDMQNMVVLEFEDRK.LVPLP

PF02727

AMO_ENTAE/124-210---------.IEAVVDLQNKKILSWTPI-------
ABP1_HUMAN/39-125---------.HPNVTEFAVGPLPGPCYM-------
AOC3_HUMAN/66-152---------.QPNVSELVVGPLPHPSYM-------
AMO_PICAN/23-109---------VKEGLVDLASLSVIETRAL-------
AMO_LENCU/26-113---------.HEILIDLTIKSIVSDNIH-------
AMO_ECOLI/124-210---------.IEAVVDLQNNKLLSWQPI-------
AMOH_ARTGO/28-111---------SLDVRLSLATGLVVDRREL-------
O23349_ARATH/23-113---------.YELIIDLTTSKIASSRIY-------
Q9STI2_ARATH/97-183---------.HVLTVDISTGRVDSENSP-------
Q9SW88_CANLI/80-166---------.YVLTVDLSTGEVTGGERD-------
AMO1_ARTS1/15-97---------SFEAVVDLEAGTVDSWKLL-------
ABP1_RAT/39-125---------.YPNVTEFAVGPLPRPYYI-------
O65749_CICAR/29-116---------.HEIVIDLRLKTIVSDNIH-------
Q9STI4_ARATH/84-170---------.HLLIVDLSTSRVDQADSP-------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window