Sequence alignment for CL0047

PF02728

CAO2_SCHPO/105-207---PIITADLLAITDEIVR..NDANVIEQCKICGVPESGLSNVYCDPWTIGYDERYG...SGRRLQQALMYYKPGDS...
AOC3_MOUSE/169-269---RPVLDREYQDIEEMIFHRELPQASGLLHHCCFYKH..QGQNLLTMTTAPRGLQS....GDRATWFGLYYNLSGA...
AOC2_HUMAN/165-263---RPVLRAEFTQMWRHLK..EVELPKAPIFLSS.TFN.YNGSTLAAVHATPRGLRS....GDRATWMALYHNISGV...
AOC1_RAT/141-241---RPISTAEYDLLYHTLKRATMPLHQFFLDTTGFSFLGCDDRCLTFTDVAPRGVAS....GQRRSWFIVQRYVEG....
AOCX_BOVIN/168-268---RPVLLREYLDIDQMIFNRELPQAAGVLHHCCSYKQ..GGQKLLTMNSAPRGVQS....GDRSTWFGIYYNITKG...
Q9STI4_ARATH/177-277---PIVTSEEMDSAASAPF..SNADFNRTINSRG..VN.LTDVICIPISSGWFGNKD..DNTKRVTKIQCFSTQDTP...
A1R2C3_ARTAT/111-210---.PVLLEEFGIIEDILA..VDPQWNAALASRG.LT..PAQVRVAPLSAGVFEYGN..EEGKRLLRGLGFRQDHPA...
A6T8H8_KLEP7/216-317---.MVLLDDFVSVQNIIN..TSSEFAEVLKKHG.ITD.PGKVVTTPLTVGFFDGKDGLQQDARLLKVVSYLDTGDG...
I1KXB5_SOYBN/199-302---PPMDAVEYAECEAVVK..DFPPFREAMKKRG.IED.MDLVMVDPWCAGYHSEAD..APSRRLAKPLIFCRTESDCPM
O23349_ARATH/119-216---PSFTFIELFKASKLPL..TYPPFKKSILDRS..LN.ISEVSCIPFTVGWYGETT....TRRELKASCFYRDGSV...
Q8L742_ARATH/175-274---PMMTIEEMNDITVVPF..SNADFNRTIISRG..VN.LTDVICFPISCGWFGNKE...ENARVIKSQCFMTQGTP...
W1QDC8_OGAPD/114-215---PILTVEDLCATEDVIR..NDPAVIEQCVLSGIPANEMHKVYCDPWTIGYDERWG...TGKRLQQALVYYRSDED...

PF02727

AOC1_HUMAN/39-125QELKAVHSFLWSKKELRLQPSSTTTMA.KNTVFLIEMLLPKKYHVLRF....LDKGERH..PVREARAVIFFGDQE.---
AOC3_HUMAN/66-152EELTAVMRFLTQRLGPGLVDAAQARPS.DNCVFSVELQLPPKAAALAH....LDRGSPP..PAREALAIVFFGRQP.---
AMO_ECOLI/124-210HPLNALTADEIKQAVEIVKASA.DFKP.NTRFTEISLLPPDKEAVWAF.....ALENKPVDQPRKADVIMLDGKHI.---
O23349_ARATH/23-113HPLDPLTPQEINKTSFIVKKSHLGNLK.DLTFHYLDLEEPNKSHVLQWLSPNPSKKPPP..PRRRSFVVVRAGGQT.---
AOC1_RAT/39-125QEIKAVHSFLMNREELGLQPSKEPTLA.KNSVFLIEMLLPKKKHVLKF....LDEGRKG..PNREARAVIFFGAQD.---
Q9STI4_ARATH/84-170HPLDPLTVMEINKVRSILSSHALFASRVPHLLNSVVLEEPDKNLVRQW.....EKGDQL..PPRKASVIARVGGNS.---
A6T8H8_KLEP7/124-209HPLNSLSAAEISEAVTIVKAAP.EFQP.NTRFTEISLHEPDKAAVWAF.....ALQGTPVDAPRTADVVMLDGKHV.---
Q8L742_ARATH/82-167HPLDPLTVSEINKIRSILSSHALFTSGTPHALHTVVLEEPEKNLVRHW.....EKGNPL..PPRKASVIARVGADT.---
W1QDC8_OGAPD/25-108..LDPLSTAEIKAVTSTVKSYF..AGK.QISFNTVTLREPARKAYIQW....KEQGGPL..PPRLAYYVILEAGKPG---

PF02728

CAO2_SCHPO/105-207GHLRSIPLD.FCPIIDVDQKKVIAIDIPKVRRPIP
AOC3_MOUSE/169-269.GFYPHPIG.LELLIDHKALDPALWTIQKVFYQGR
AOC2_HUMAN/165-263.GLFLHPVG.LELLLDHRALDPAHWTVQQVFYLGH
AOC1_RAT/141-241..YFLHPTG.LEILLDHGSTDVQDWRVEQLWYNGK
AOCX_BOVIN/168-268.GPYLHPVG.LELLVDHKALDPADWTVQKVFFQGR
Q9STI4_ARATH/177-277.NFYMRPIEGLTLLFDLDTKRILEITDTGQSIPIP
A1R2C3_ARTAT/111-210DHPWAHPIDGLVAFVDIENRRVNHLIDDG.PVPVP
A6T8H8_KLEP7/216-317.NYWAHPIENLVAVVDLEAKKIIKIEEGP.VIPVP
I1KXB5_SOYBN/199-302ENGYARPVEGIHVLVDMQNMVVLEFEDRK.LVPL.
O23349_ARATH/119-216.NVFTRPIEGITVTIDVDSMQVIKYSDRF.RKPIP
Q8L742_ARATH/175-274.NFYMRPIEGLTILIDLDTKQVIEITDTGRAIPIP
W1QDC8_OGAPD/114-215DSQYSHPLD.FCPIVDTEEKKVIFIDIPNRRRKV.

PF02727

AOC1_HUMAN/39-125---------.HPNVTEFAVGPLPGPCYM-------
AOC3_HUMAN/66-152---------.QPNVSELVVGPLPHPSYM-------
AMO_ECOLI/124-210---------.IEAVVDLQNNKLLSWQPI-------
O23349_ARATH/23-113---------.YELIIDLTTSKIASSRIY-------
AOC1_RAT/39-125---------.YPNVTEFAVGPLPRPYYI-------
Q9STI4_ARATH/84-170---------.HLLIVDLSTSRVDQADSP-------
A6T8H8_KLEP7/124-209---------.IEAVVDLQNKKILSWTP.-------
Q8L742_ARATH/82-167---------.HVLTVDISTGRVDSENS.-------
W1QDC8_OGAPD/25-108---------VKEGLVDLASLSVIETRA.-------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window