Sequence alignment for CL0051

PF07961

YD3B_SCHPO/40-266AISQRALKPMDIPFLQCYIEPIDNTSF..FLHPFKKIRFWWRYLFYGWWNLKKNQFLIK..RTFPDRDFSIAEIIQNALK
Q6BRJ5_DEBHA/41-283KTQQADISQIPIKSIGIIADFYVPPKY..LKSPVTS...WHKLLFRRMGLFAINTYSIVKFKRETGLKLHFNQWKDTAVE
Q74ZJ7_ASHGO/28-263GSGTKQQSGFNKRYLGVTDKIYVPTMYRNLPSVFRSPLVVANSLIRRIYMLGLNTVHVALFRVQSGYKPKFLLWKNKAIE
Q6CM11_KLULA/30-266DGVVKKPAPFNPRHMGVANQVYIAPSKKNMPNPITSPVAYFNVLVRKIYTLGMNTIQVALFRYQSGLKPNFLLWKNKAIE
Q6FJG9_CANGA/40-276KQDTKKIQDFNPRHLGVASELYVPASLSRLPSVITSPKLWFDNVIRRIYMLGLNTVQIGIFRFQTGIKPAFLLWKNKAIE
Q6CE08_YARLI/32-266SNNASKSQRLELKHIGIMNEPIIPLSH....APWTNPKGLVKHFYRRMYAFVVNTFNVAQYRLKTKKKPRFTEWKNDAIL
MBA1_YEAST/42-278KKDKSKQQDFNPRHLGVAAEIFIPSAYKNLPNVFAHPLIVANALIRRLYTFGLNSVQVALFRFQSGIKPSFLLWKNKAIE

PF04280

Q29AN0_DROPS/288-437---------------------------------------LSETM.TELVKI--------------DPAFDQKQFLRDCET
TI441_ARATH/315-467---------------------------------------SASTY.KEIRSR--------------DPSFSLPDFAAEIEE
Q74E73_GEOSL/170-314---------------------------------------ADSGL.AHVRQM--------------DGSFSEEQFRQLAQD
Q4WTB9_ASPFU/363-517---------------------------------------TAQVI.KKFREM--------------DPNFQMESFLREMRE
A7HSI5_PARL1/99-245---------------------------------------LAGAL.DAIADA--------------DRTFDTESFLSGARM
Q2LX56_SYNAS/191-336---------------------------------------GGGGL.DAIRQM--------------DYQFDERRFKDSVLD
A1AM45_PELPD/168-313---------------------------------------ADGGL.DHIRQM--------------DPGFDENRFNDMAMD
A5G6N4_GEOUR/172-317---------------------------------------VDTGM.AHIRQM--------------DPSFDESRFNDSVMD
Q92K63_RHIME/130-273---------------------------------------SAAAP.ASGNGD--------------EITVGQEDL.DRFEA
Q6BV22_DEBHA/267-421---------------------------------------QAKVI.KQFKQM--------------DPAFRVTDFTKTLTN
Q2N800_ERYLH/68-214---------------------------------------VEQGV.RAIAAA--------------DRGFDVSSFLEGAKG
Q6C8B1_YARLI/257-411---------------------------------------AGKVI.RMFKLM--------------DPSFNQDQFMKTTRE
RM45_XENTR/118-265---------------------------------------SQLAI.RKVKEY--------------DSEFTTKTFPEKAQE
Q29BD6_DROPS/140-288---------------------------------------SLIAV.RKIRSY--------------DESFSSDQFGAEAQE
RM45_BOVIN/118-266---------------------------------------SQLSI.RRIKES--------------DPNFKVKDFPEKAQD
Q4XQ84_PLACH/208-360---------------------------------------LAAAL.RVMKME--------------DKNFKLSELMYLFEF
Q89I32_BRADU/189-331---------------------------------------LGGFG.FGANNA--------------PLEIKPVDY.EAFER
Q2YAC8_NITMU/160-293---------------------------------------SAVAPVSGTGNI--------------PADFQVEPFLRNAKT
E0TF66_PARBH/73-216---------------------------------------WAE....TVRAD--------------YADFDPDEFVTGAKA
Q69V11_ORYSJ/315-468---------------------------------------TAVSF.REIRQR--------------DPSFSLPDFAGDVQE
Q8GXP7_ARATH/157-312---------------------------------------LRSAY.AIAKLR--------------KTGYSKNTFYIEALE
Q3SWG6_NITWN/86-232---------------------------------------LALGL.DAIAAQ--------------DSSFDPAHFLSGARS
A8XG07_CAEBR/268-418---------------------------------------VSEVL.TEIHKI--------------DANFDKQEWLKFCET
Q3IYG4_RHOS4/71-219---------------------------------------SAKAL.AGMKMA--------------EPGFSVSEFLTGARG
A1VKC3_POLNA/193-328---------------------------------------SGLSG.SQSWGV--------------PAGFDADGFLKACKA
Q0AKD2_MARMM/59-205---------------------------------------AAAGL.EAIAAV--------------DTRFDPTAVKEGAQN
Q1GRJ5_SPHAL/74-220---------------------------------------AEAGL.RQLLAN--------------DRNFDAGRFMEGARA
Q4N770_THEPA/227-378---------------------------------------LASAL.REMKRL--------------DPSFNLPDLVELVEH
Q39UB8_GEOMG/177-321---------------------------------------TSFGL.AHVRQM--------------DGSFDENRFKETAQD
TIM44_HUMAN/296-445---------------------------------------MSEVL.TEILRV--------------DPAFDKDRFLKQCEN
Q7Q8M7_ANOGA/261-411---------------------------------------LSAAL.TEVCRI--------------DPSFEAKQFLQFCER
B5EIY6_GEOBB/173-317---------------------------------------VATGL.SHLRQM--------------DPGFDEGRFNDLVMD
Q11CL9_CHESB/87-233---------------------------------------LNRGL.RAIKDA--------------DPSFDPNTFVDGAKL
Q2KE94_RHIEC/85-231---------------------------------------LNESL.RALNKA--------------DPSFSPKEFLNGARM
C5AZH9_METEA/91-237---------------------------------------VARGL.EQVVQL--------------EPAFEPRAFLEGAKG
Q5NM00_ZYMMO/68-215---------------------------------------AWDGI.RRIVSR--------------DAHFDLTGFIEGAKS
TI442_ARATH/310-462---------------------------------------SASTY.KEIRRR--------------DPSFSLPDFVSEIQE
Q218U8_RHOPB/188-330---------------------------------------GSGFG.IGATAA--------------PLEIGPADY.EAFEK
Q9A225_CAUCR/90-231---------------------------------------QAEGV.ATLRAR--------------QPDFDPARFLMGVRA
Q0C6A2_HYPNA/70-202---------------------------------------AAGAL.EDIYNA--------------DRSFSTEEFMRGAKA
Q0BPM0_GRABC/85-230---------------------------------------TGQVL.ARMKEV--------------DRSFDAVRFLNNAEQ
B0T6F5_CAUSK/55-196---------------------------------------ALSGL.AALRAR--------------QADFDIGHFLSGARQ
Q7D2D0_AGRFC/69-215---------------------------------------LNASL.RDVMTK--------------DPSFRPKEFLNGARM
A9BP44_DELAS/201-336---------------------------------------SALAG.SQNWGV--------------PEGFDTEGFLTAAKR
Q7CT45_AGRFC/71-213---------------------------------------HANA...VSEGD--------------EIGITQGDL.ETFQK
Q5KEX5_CRYNJ/294-447---------------------------------------TAQVI.RAMKAL--------------DPNFRMDRWTGELRE
Q5LLN6_RUEPO/70-218---------------------------------------QAQAL.AAMKRI--------------EPAFSVSEFVQGARG
Q21YX7_RHOFT/181-316---------------------------------------SGLAG.SQSWGV--------------PDGFDAEGFLTSAKA
A0A0D1C0U1_USTMA/407-560---------------------------------------FARVT.RQMKML--------------DPSFTMESFQRDLRE
Q2RN93_RHORT/70-216---------------------------------------LAGGL.TQIQLT--------------DPSFSPEGFLIGAKA
Q92TE6_RHIME/85-231---------------------------------------LNAQL.RAMTDA--------------DPNFNPAEFLNGAKM
A0CBB5_PARTE/242-397---------------------------------------VARAI.KQMRMI--------------DPDFDLYELEKEAKV
TIM44_SCHPO/266-420---------------------------------------ASQVM.RRFKEI--------------DPSFNTEHFLQYLRE
A7IGZ9_XANP2/102-248---------------------------------------TAAAL.DEIARI--------------EPDFDARHFLTGARA
Q82S83_NITEU/166-298---------------------------------------RQSTS.TDAPDI--------------PADFDVESFLKQAKR
A5FUT4_ACICJ/75-220---------------------------------------VGQTL.ARIAQA--------------ERGFDPARFLDGAEA
Q16CY5_ROSDO/72-220---------------------------------------AAEAL.ANMKRL--------------EPGFNVTEFLGGARG
A0LJ73_SYNFM/187-332---------------------------------------VERGF.QELRRF--------------DPGFNEESFKETVQD
Q16KX3_AEDAE/277-426---------------------------------------LSETL.TEICKI--------------DPNFDQKQFLRDCEN
A5VD09_SPHWW/78-224---------------------------------------AEAGV.RAIQSA--------------DGGFDAAQFLEGARS
Q1GCM9_RUEST/70-218---------------------------------------QSKAL.SDMKRS--------------DSSFQVAEFVQGARG
Q75AP0_ASHGO/257-411---------------------------------------SARVF.AQFKLL--------------DPTFNTEEFTKHLRE
A0L4W4_MAGMM/183-329---------------------------------------RQQTL.DRLLAE--------------DSNFDEFTFIDGAKR
Q28W04_JANSC/87-235---------------------------------------SAKAL.AAMKMA--------------EPGFRVGEFLGGARQ
Q2VYH8_MAGSA/132-278---------------------------------------MGQGL.AAIRAA--------------DRGFDLDGFLGGAKA
Q7QC22_ANOGA/140-288---------------------------------------SMMAI.RKIRNY--------------DEDFEPPEFATLAQD
B0UJF2_METS4/90-236---------------------------------------AARGL.DLVLQQ--------------EPGFDPRAFTDGAKI
Q986Y4_RHILO/184-327---------------------------------------SGGAS.LAADSE--------------EIRLAQTDL.DAFQQ
A7ARK8_BABBO/236-388---------------------------------------LAKAV.KEMKRL--------------DSSFDLPEFIESVEH
Q2GAU2_NOVAD/100-246---------------------------------------AEAGV.RAIIAA--------------DRRFDVAQFLAGAKG
B9KHK8_ANAMF/74-217---------------------------------------.SSVF.EAIKER--------------NKGFSVKHFIEGSAA
D5AKF4_RHOCB/72-217---------------------------------------.AVAL.AQMKRV--------------EPTFNVGAFLQGSKV
E4WZD3_OIKDI/234-385---------------------------------------.NDTI.KAIRQV--------------DKKFDQEAFVQFLES
E7F889_DANRE/126-271---------------------------------------.QLAI.RKIKDY--------------DSTFTSKEFPGIGQQ
E7QG67_YEASZ/271-422---------------------------------------.SRVY.SQFKLM--------------DPTFSNESFTRHLRE
Q2YQZ9_BRUA2/88-232---------------------------------------.NEGL.RAIYAV--------------DPTFEPARFVDGVKI
V6F5J3_9PROT/82-226---------------------------------------.ARGE.AAIRAR--------------DPSFSNTGFLSGARM

PF13474

B2UGF3_RALPJ/11-131-----------------------------------------------AEDI--------------L-E-A----YR-D-A
A5GCV2_GEOUR/9-131-----------------------------------------------IRQL--------------F-D-D----YL-R-M
C0QA63_DESAH/9-131-----------------------------------------------IRSL--------------F-D-E----YI-E-M
D3SFX3_THISK/13-133-----------------------------------------------VRDY--------------L-D-T----W.-.-.
Q0A9T2_ALKEH/13-139-----------------------------------------------VNQA--------------F-L-R----YL-D-T
D6XWI0_BACIE/11-137-----------------------------------------------LHQA--------------L-D-H----YY-D-V
D2PT47_KRIFD/6-126-----------------------------------------------IRTL--------------I-E-R----WA-D-A
Q92KR9_RHIME/14-134-----------------------------------------------IEEV--------------I-G-D----WA-E-A
C3MEI6_RHISN/13-133-----------------------------------------------IRAA--------------I-E-D----WA-G-A
D0LTP7_HALO1/11-135-----------------------------------------------VEAI--------------N-Q-A----FY-R-A
B5GPB4_STRC2/9-136-----------------------------------------------VEQA--------------N-T-A----FY-E-A
B5HIA9_STRPR/9-137-----------------------------------------------VEQA--------------N-T-A----FY-E-T
D7B847_NOCDD/11-139-----------------------------------------------VAEA--------------N-A-Q----FY-S-A
D1A544_THECD/9-137-----------------------------------------------VEEA--------------N-A-E----FY-A-A
A4YP86_BRASO/20-133-----------------------------------------------ILAA--------------N-A-A----FY-A-A
Q89F64_BRADU/7-119-----------------------------------------------VIAA--------------N-A-A----FY-A-A
B2IHF2_BEII9/4-117-----------------------------------------------ILAA--------------N-A-L----YY-A-A
B9GXK0_POPTR/174-290-----------------------------------------------IVNV--------------N-T-E----FF-N-I
B1ZXW2_OPITP/468-592-----------------------------------------------VKHC--------------I-E-Q----AI-G-W
Q01ZK2_SOLUE/25-147-----------------------------------------------VLEV--------------N-A-Q----MT-Q-A
B1ZMY8_OPITP/43-165-----------------------------------------------VLAT--------------N-T-Q----MI-A-A
C6X4B7_FLAB3/29-152-----------------------------------------------VLQI--------------N-S-A----YD-K-A
C4XSI3_DESMR/466-578-----------------------------------------------IRAA--------------V-E-S----WR-A-A
Q1DE35_MYXXD/42-156-----------------------------------------------ITAV--------------L-D-D----WH-Q-A
Q487W3_COLP3/33-147-----------------------------------------------ITKV--------------L-N-S----FH-Q-A
A3U720_CROAH/41-154-----------------------------------------------INSR--------------L-D-A----WH-K-A
A5FK93_FLAJ1/24-137-----------------------------------------------INQT--------------L-D-A----WH-K-A
A6GVS5_FLAPJ/25-138-----------------------------------------------INSV--------------L-D-N----WH-K-A
C6X3L7_FLAB3/38-151-----------------------------------------------VSKV--------------L-D-D----LN-M-Y
A4CH66_ROBBH/18-131-----------------------------------------------LDSL--------------L-T-A----WH-Q-A
A0M5Z5_GRAFK/38-151-----------------------------------------------INKT--------------I-G-S----WH-K-A
A2TYG4_9FLAO/37-150-----------------------------------------------VNTF--------------M-D-N----WH-L-A
A3QCF0_SHELP/31-139-----------------------------------------------ATQT--------------L-D-K----LH-G-Y
Q12PU2_SHEDO/77-185-----------------------------------------------INSL--------------L-N-Q----LH-E-S
Q085V8_SHEFN/80-188-----------------------------------------------VSAL--------------L-N-L----LH-E-S
A1S876_SHEAM/27-135-----------------------------------------------ANQV--------------L-D-A----LH-Q-H
D9QI29_BRESC/22-140-----------------------------------------------VAAV--------------L-D-S----LN-A-A
Q15XC4_PSEA6/38-153-----------------------------------------------VNNV--------------L-D-G----LH-E-A
B9TH82_RICCO/29-143-----------------------------------------------VNAF--------------V-D-G----WH-D-D
D4LV59_9FIRM/8-130-----------------------------------------------VVRL--------------T-A-E----CL-T-R
B8FCE8_DESAA/7-126-----------------------------------------------LKDL--------------Y-V-K----IC-E-A
Q5LP72_RUEPO/8-127-----------------------------------------------IEAI--------------V-R-R----WT-T-L
A3HV45_9BACT/11-133-----------------------------------------------VLAL--------------Y-Q-D----WL-Y-A
B8GG61_METPE/21-142-----------------------------------------------VRAT--------------M-D-A----YA-T-A
B8CPV1_SHEPW/7-128-----------------------------------------------IRST--------------L-E-D----YA-K-A
D4MSP2_9FIRM/78-205-----------------------------------------------VKKL--------------L-E-Q----FF-D-A
D9T710_MICAI/40-166-----------------------------------------------VRQL--------------L-N-D----LQ-T-A
Q13UI8_BURXL/13-130-----------------------------------------------..DT--------------L-N-A----YY-Q-A
Q3ZAF4_DEHM1/11-133-----------------------------------------------INQV--------------L-D-A----MK-E-A
Q63WV1_BURPS/13-127-----------------------------------------------..DT--------------L-N-A----YY-Q-A
Q8RYS9_ORYSJ/166-284-----------------------------------------------IMNV--------------N-T-E----FY-N-I
R5FDC6_9CLOT/10-131-----------------------------------------------.REI--------------A-R-R----IL-S-S
R5TK35_9CLOT/9-131-----------------------------------------------IESL--------------T-R-K----IL-T-T
R6QJ83_9FIRM/13-123-----------------------------------------------....--------------.-D-L----CR-C-W

PF14534

Q4KEE9_PSEF5/7-110-----------------------------------------------LLML--------------E-R.Q...-LQ.Q.A
A0JT09_ARTS2/213-310-----------------------------------------------VEAL--------------E-R.E...-LL.S.P
A1CFS1_ASPCL/12-120-----------------------------------------------LLNC--------------E-R.A...-LW.T.A
A1R3I0_ARTAT/269-366-----------------------------------------------VLAL--------------E-R.E...-LL.K.P
A1U4T2_MARHV/6-114-----------------------------------------------LKQV--------------R-E.N...-WY.S.A
A2QV30_ASPNC/167-275-----------------------------------------------LIGK--------------E-R.R...-LW.T.A
A3CS44_METMJ/8-106-----------------------------------------------LLDI--------------E-K.R...-AW.K.A
A3HWU2_9BACT/60-168-----------------------------------------------ILAQ--------------E-T.A...-WA.S.A
A3HZW5_9BACT/30-137-----------------------------------------------IKSL--------------D-A.K...-WE.E.A
A3I0D3_9BACT/31-149-----------------------------------------------IAKM--------------D-S.I...-YF.S.A
A3QEM3_SHELP/29-149-----------------------------------------------LNQF--------------Y-K.Q...-FS.V.A
A3QJ67_SHELP/5-108-----------------------------------------------IIEL--------------E-L.A...-LL.S.P
A4AQI2_MARSH/45-155-----------------------------------------------IVEM--------------D-R.I...-YF.T.A
A4CNU2_ROBBH/46-156-----------------------------------------------ILDL--------------D-Q.A...-YF.T.A
A4RV71_OSTLU/211-315-----------------------------------------------IVAI--------------H-E.G...-FY.R.A
A5FMK8_FLAJ1/6-112-----------------------------------------------IVTA--------------E-I.E...-LL.T.A
A5FMN4_FLAJ1/37-145-----------------------------------------------IIKM--------------D-S.L...-LF.DVA
A5G8N2_GEOUR/26-129-----------------------------------------------LHSV--------------A-L.Q...-RQ.Q.A
A5V3K3_SPHWW/11-125-----------------------------------------------IREI--------------V-E.Q...-MF.E.A
A5V8Q2_SPHWW/64-171-----------------------------------------------VIAA--------------E-Q.R...-RG.E.A
A5VGJ3_SPHWW/7-115-----------------------------------------------IEHA--------------E-G.R...-LR.A.A
A5WEC7_PSYWF/5-111-----------------------------------------------ISEL--------------E-Q.Q...-RF.N.Y
A6LYA2_CLOB8/8-113-----------------------------------------------ILQL--------------E-Q.E...-LL.K.S
A6VR33_ACTSZ/42-148-----------------------------------------------LTGI--------------Y-R.R...-IN.R.A
A6WA45_KINRD/27-133-----------------------------------------------IVQN--------------F-R.A...-QL.E.A
A6WB55_KINRD/3-111-----------------------------------------------IVEL--------------E-R.T...-RL.R.A
A8GEK8_SERP5/4-112-----------------------------------------------IQSL--------------E-V.K...-LH.L.P
A8LTG7_DINSH/19-134-----------------------------------------------IMAV--------------I-A.R...-ET.D.T
A9C0J7_DELAS/26-133-----------------------------------------------LQAL--------------E-V.R...-LH.D.P
A9GA01_SORC5/28-134-----------------------------------------------LKAV--------------L-I.A...-YF.D.C
B0SZM9_CAUSK/8-116-----------------------------------------------IAAR--------------R-K.L...-TN.K.L
B0T7A9_CAUSK/166-269-----------------------------------------------VRTA--------------E-D.S...-LA.K.V
B1M5Q7_METRJ/38-144-----------------------------------------------VEQA--------------V-D.A...-LT.R.A
B1ZQQ6_OPITP/36-143-----------------------------------------------VTAA--------------D-A.E...-RQ.A.A
B1ZZ14_OPITP/30-139-----------------------------------------------IRHL--------------E-E.D...-ER.K.A
B2GBD5_LACF3/9-117-----------------------------------------------VVEI--------------Y-R.A...-EN.R.A
B2JCD2_BURP8/9-116-----------------------------------------------IRGL--------------E-R.D...-RF.R.A
B2JPS0_BURP8/31-132-----------------------------------------------IRQL--------------E-E.N...-WV.Q.A
B3PI44_CELJU/32-141-----------------------------------------------VLKL--------------D-A.T...-YE.E.A
B4RBI8_PHEZH/167-269-----------------------------------------------VTAA--------------E-T.A...-LH.E.T
B4RHA1_PHEZH/45-153-----------------------------------------------IRKV--------------I-A.D...-ME.A.A
B5GTL4_STRC2/19-130-----------------------------------------------VSAV--------------V-K.A...-LE.E.A
B5I698_9ACTN/6-123-----------------------------------------------IDVV--------------T-A.E...-FF.D.A
B7JXD1_CYAP8/8-119-----------------------------------------------IRKV--------------F-E.Q...-TYPD.N
B8GT08_THISH/17-126-----------------------------------------------LWKR--------------V-N.D...-LW.S.L
B8MZS8_ASPFN/6-119-----------------------------------------------ILAL--------------E-H.K...-TW.D.A
B9E8X8_MACCJ/8-114-----------------------------------------------LHEI--------------Y-R.T...-LV.D.G
C1A7K4_GEMAT/10-121-----------------------------------------------VRLL--------------R-Q.Q...-SN.E.A
C1ABS4_GEMAT/430-537-----------------------------------------------VAAL--------------V-T.Q...-FL.T.A
C1CZM8_DEIDV/15-112-----------------------------------------------VLTL--------------D-D.L...-WN.A.A
C1F8H5_ACIC5/21-124-----------------------------------------------LRGL--------------E-E.S...-LL.Q.S
C3AMI1_BACMY/20-132-----------------------------------------------IQQT--------------I-T.E...-IE.S.A
C3ZF01_BRAFL/355-462-----------------------------------------------IEAK--------------N-Q.K...-YM.A.C
C4L6W4_EXISA/8-106-----------------------------------------------LQTL--------------E-E.A...-LL.T.T
C5BK93_TERTT/4-109-----------------------------------------------VIEL--------------E-K.R...-LL.E.P
C5CWD6_VARPS/8-118-----------------------------------------------LFAL--------------E-K.K...-FW.Q.S
C6XYF7_PEDHD/10-116-----------------------------------------------ILEQ--------------E-N.K...-LH.S.A
C6Y015_PEDHD/172-276-----------------------------------------------IATT--------------E-K.T...-LN.A.S
C7M5E0_CAPOD/27-132-----------------------------------------------VLQL--------------S-E.S...-LW.K.A
C7NFY8_KYTSD/186-282-----------------------------------------------VLAL--------------E-R.S...-LL.A.D
C7NIZ7_KYTSD/228-329-----------------------------------------------VLEL--------------E-R.E...-LQ.S.P
C7RBL7_KANKD/30-150-----------------------------------------------LTQQ--------------D-A.E...-FF.Q.R
C9YUI3_STRSW/23-131-----------------------------------------------IEEV--------------V-A.T...-VE.R.T
D2ATH3_STRRD/10-114-----------------------------------------------LLAL--------------E-E.Q...-GW.A.A
D2PZL0_KRIFD/6-115-----------------------------------------------LRRI--------------E-R.A...-RL.R.A
D3F9E1_CONWI/19-126-----------------------------------------------LDAA--------------E-S.A...-LQ.A.A
D3FXC8_BACPE/11-109-----------------------------------------------ILLL--------------E-E.K...-LL.Q.S
D3Q9C7_STANL/5-122-----------------------------------------------IEAI--------------H-R.T...-FA.E.Y
D3S9F1_THISK/27-146-----------------------------------------------IQRI--------------L-E.A...-KE.A.A
D5DIB8_BACMD/6-113-----------------------------------------------VIEY--------------E-E.M...-LR.S.A
D5SSM1_PLAL2/48-156-----------------------------------------------LKAS--------------A-A.G...-FE.R.A
D5SZ41_PLAL2/16-126-----------------------------------------------IRTV--------------Q-Y.R...-WL.E.A
D5UXJ0_TSUPD/21-126-----------------------------------------------ITDL--------------I-A.T...-LQ.S.G
D5X2H8_THIK1/9-116-----------------------------------------------IDAV--------------E-E.E...-LR.L.A
D5X508_THIK1/258-358-----------------------------------------------VSEA--------------V-E.S...-WA.D.A
D6YUD1_WADCW/33-146-----------------------------------------------ILEL--------------L-Q.K...-WP.K.D
D7DI86_METV0/10-122-----------------------------------------------ICKA--------------R-R.R...-YN.D.A
D7FUG0_ECTSI/213-343-----------------------------------------------VSET--------------T-L.A...-WT.E.T
D9SQZ0_CLOC7/8-113-----------------------------------------------IFQL--------------E-N.Q...-LL.K.S
D9T1Z4_MICAI/21-128-----------------------------------------------LRAA--------------E-R.R...-LQ.R.A
E0UKN5_CYAP2/8-124-----------------------------------------------IQKV--------------F-EVD...-YP.T.Y
E1VXQ5_ARTAR/20-119-----------------------------------------------IIDL--------------E-Q.E...-LL.D.P
E3EA41_PAEPS/6-112-----------------------------------------------IIEY--------------E-E.K...-LR.K.A
E3M5F2_CAERE/6-112-----------------------------------------------FQKI--------------H-D.E...-MR.A.L
E3NA36_CAERE/13-119-----------------------------------------------LKPQ--------------F-D.V...-YA.K.A
E3NA40_CAERE/13-119-----------------------------------------------LKPQ--------------F-E.A...-YC.K.A
E3Q3Z8_COLGM/20-132-----------------------------------------------TLEA--------------E-T.L...-LW.R.A
E4TM42_MARTH/40-139-----------------------------------------------LDRV--------------L-R.D...-YE.T.H
E6X731_CELAD/46-156-----------------------------------------------IAAM--------------D-A.T...-FF.E.A
E8WVR2_GRATM/66-173-----------------------------------------------IRAE--------------D-S.I...-VG.R.A
E8WVR2_GRATM/212-319-----------------------------------------------IDAN--------------G-R.A...-VG.H.A
E8WVR7_GRATM/60-181-----------------------------------------------LTAF--------------L-Q.T...-YD.E.A
E8WXR9_GRATM/62-172-----------------------------------------------LMEL--------------E-G.R...-FQ.E.A
E8X558_GRATM/30-138-----------------------------------------------LASA--------------G-Q.A...-LG.K.A
F2F0M6_SOLSS/9-106-----------------------------------------------LQQL--------------E-E.S...-HT.G.L
F2F328_SOLSS/60-162-----------------------------------------------IISA--------------F-N.E...-YI.A.A
F2RH14_STRVP/10-117-----------------------------------------------VAEA--------------I-E.RELL-LM.T.P
Q03DA3_PEDPA/8-116-----------------------------------------------IVQL--------------Y-R.A...-EN.E.A
Q0RLC8_FRAAA/20-126-----------------------------------------------LRAS--------------E-R.R...-LQ.A.A
Q11V67_CYTH3/7-113-----------------------------------------------ILDC--------------E-K.K...-LL.T.A
Q12Q38_SHEDO/8-111-----------------------------------------------LIDL--------------E-E.C...-LF.E.P
Q13U88_BURXL/31-133-----------------------------------------------LASM--------------E-H.A...-WV.D.A
Q1GMQ9_RUEST/19-122-----------------------------------------------LRAH--------------E-E.Q...-VW.D.A
Q1H132_METFK/13-128-----------------------------------------------IKAI--------------V-S.R...-WD.Q.G
Q1ISF5_KORVE/28-135-----------------------------------------------VVQR--------------S-Q.E...-LF.D.A
Q1ITS8_KORVE/8-111-----------------------------------------------IRRV--------------E-E.R...-LR.I.A
Q2G7A7_NOVAD/11-122-----------------------------------------------IRLR--------------R-A.E...-FN.R.A
Q2LTB1_SYNAS/390-491-----------------------------------------------ISSL--------------I-S.R...-WA.R.S
Q5LLC5_RUEPO/46-153-----------------------------------------------IAAK--------------S-R.R...-FE.E.N
Q5YUX5_NOCFA/23-128-----------------------------------------------LLAV--------------E-R.A...-GW.D.A
Q6AE79_LEIXX/186-283-----------------------------------------------VERL--------------E-R.E...-LL.D.P
Q82AU3_STRAW/26-136-----------------------------------------------IRAL--------------W-A.E...-MA.R.G
Q89JP5_BRADU/29-135-----------------------------------------------VEAI--------------A-S.E...-YA.A.S
Q89SG9_BRADU/39-147-----------------------------------------------VAKK--------------V-E.A...-FR.L.A
Q8YWM4_NOSS1/9-120-----------------------------------------------IRSI--------------F-E.E...-VYPD.N
Q9RS70_DEIRA/32-140-----------------------------------------------IRRS--------------Y-Q.E...-LM.R.A
B0SRG8_LEPBP/10-116-----------------------------------------------IESL--------------E-K.Q...-LI.E.A
B1HN37_LYSSC/64-167-----------------------------------------------ILAS--------------F-D.E...-YI.A.A
F9URX0_LACPL/18-126-----------------------------------------------IIQL--------------Y-R.D...-EN.I.A
F9UT77_LACPL/12-117-----------------------------------------------.ARV--------------V-H.Q...-QV.Q.G
Q5LTS8_RUEPO/9-110-----------------------------------------------.LDC--------------E-T.R...-VW.Q.A
Q8P937_XANCP/40-149-----------------------------------------------....--------------.-......-FW.K.A
Q8PBX0_XANCP/2-100-----------------------------------------------....--------------E-L.R...-LL.D.P
Q8YRK0_NOSS1/10-115-----------------------------------------------.IAN--------------E-K.N...-LL.S.A
Q8ZMH1_SALTY/11-112-----------------------------------------------...A--------------H-A.A...-IE.N.W
Q97G15_CLOAB/8-113-----------------------------------------------ILKL--------------E-N.D...-LL.K.P
Q9A9S2_CAUCR/46-158-----------------------------------------------.ASL--------------D-K.A...-LF.D.A
Q9RJZ2_STRCO/30-137-----------------------------------------------IERV--------------V-A.T...-VE.R.T

PF08332

KCC2D_CAEEL/587-711-------------------------------------------QKQDIVRV--------------T-Q-T----LL-D-A
Q8P5Y9_XANCP/36-159-------------------------------------------EAREVAAL--------------F-D-T----WN-A-A
KCC2A_DROME/389-516-------------------------------------------RRQEIIKI--------------T-E-Q----LI-E-A
Q5SIW7_THET8/3-128-------------------------------------------GEAELWNF--------------L-E-R----HL-R-S
F8WHB5_MOUSE/57-184-------------------------------------------RKQEIIKV--------------T-E-Q----LI-E-A

PF13577

C1GKF4_PARBD/8-161-------------------------------------------DYLLDRTN--------------I-H-D----VV-T-K
D9QIN2_BRESC/9-135-------------------------------------------ERVESVRA--------------I-K-R----LQ-H-A
D9QIN2_BRESC/195-322-------------------------------------------VRLEDEAA--------------I-V-R----LQ-N-S
D9QIN2_BRESC/413-542-------------------------------------------AATAAVDA--------------V-E-N----IA-T-A
D3Q8I0_STANL/19-151-------------------------------------------AELRDRTE--------------I-A-D----AL-H-R
Q0SJ13_RHOJR/45-175-------------------------------------------RQLEDRAL--------------I-S-E----RV-I-K
A5V679_SPHWW/6-139-------------------------------------------QTLLDKRA--------------L-D-E----MV-Y-K
B5HCB8_STRPR/23-148-------------------------------------------RALTDRAE--------------I-A-D----LL-D-R
E3IXY9_FRASU/16-146-------------------------------------------RRLLDKDA--------------I-V-D----LV-H-R
D2RZV4_HALTV/8-134-------------------------------------------ARLADRIA--------------I-Q-D----LR-S-N
Q0UXA3_PHANO/19-158-------------------------------------------PSALDHLA--------------I-S-N----VL-S-C
B1MBT8_MYCA9/7-136-------------------------------------------ETLVDIHE--------------I-T-E----LK-Y-R
A5V4W9_SPHWW/12-141-------------------------------------------ARIEARAE--------------I-T-D----LV-A-R
Q73Z53_MYCPA/11-137-------------------------------------------DTLPAIES--------------I-K-Q----LK-A-R
D0L747_GORB4/5-127-------------------------------------------EEISARLE--------------I-T-Q----VL-T-D
B4EDY3_BURCJ/5-132-------------------------------------------HTLSDHHD--------------I-R-E----RV-V-P
B0T6L6_CAUSK/8-137-------------------------------------------QLLIDKSD--------------I-H-D----MM-C-R
Q0UTX1_PHANO/50-179-------------------------------------------SSLESLRN--------------I-K-N----IQ-K-Q
Q0UTX1_PHANO/238-365-------------------------------------------QRLNDEDE--------------V-R-N----LV-H-A
Q0UTX1_PHANO/423-553-------------------------------------------LRSAAFDG--------------S-E-N----LS-H-A
A5VCU7_SPHWW/9-134-------------------------------------------RRLLDEQA--------------I-R-R----AA-T-L
B2A9N2_PODAN/33-173-------------------------------------------LRVESVRE--------------I-K-N----IQ-R-T
B2A9N2_PODAN/248-379-------------------------------------------AHLNEEDE--------------V-R-N----LV-H-G
A6VWC0_MARMS/15-150-------------------------------------------DALESDRA--------------I-R-A----CI-N-R
A0QWD2_MYCS2/19-160-------------------------------------------RRLEDERD--------------I-A-R----LI-A-S
A1SDG2_NOCSJ/13-135-------------------------------------------SFVDDIDQ--------------I-C-Q----LK-Y-R
A4XF70_NOVAD/24-149-------------------------------------------RLLEDREE--------------I-R-E----LI-A-R
C5DP23_ZYGRC/32-161-------------------------------------------SYLNDREA--------------I-E-D----AL-Y-R
A5V734_SPHWW/6-140-------------------------------------------SELVDEYR--------------I-R-R----LI-L-T
E3IXP4_FRASU/19-145-------------------------------------------RTLEDQVE--------------I-M-Q----LV-A-Q
E3IY46_FRASU/4-132-------------------------------------------GDLCEIEA--------------L-K-Q----LK-A-R
D0J3B0_COMT2/9-135-------------------------------------------EQVLLEHA--------------L-A-Q----TL-T-R
A8LAB8_FRASN/18-148-------------------------------------------GRLEDERA--------------I-Y-R----LM-C-R
A4XF68_NOVAD/127-253-------------------------------------------DELLAERA--------------I-R-D----GL-A-R
Q0S5K6_RHOJR/13-140-------------------------------------------AELVETGK--------------I-E-R----VL-F-D
C5AL89_BURGB/17-156-------------------------------------------SRLEAERE--------------V-R-H----AF-T-R
D0IVW3_COMT2/14-141-------------------------------------------QHLEDIQS--------------I-Q-A----LK-A-R
Q2G3D7_NOVAD/8-142-------------------------------------------TRLIAIEE--------------I-K-Q----LK-A-R
A5VH89_SPHWW/19-143-------------------------------------------QVLEARAD--------------I-T-D----CV-Y-R
E3J7S9_FRASU/5-125-------------------------------------------EQLLARDQ--------------I-R-Q----LA-E-R
A5DD79_PICGU/8-137-------------------------------------------NSITEREA--------------V-A-D----AL-Y-R
E3J7S1_FRASU/26-166-------------------------------------------RELEDDRA--------------I-R-D----LL-A-H
D2QII9_SPILD/28-157-------------------------------------------QQIEDRMA--------------L-K-A----LV-D-E
A5V526_SPHWW/11-135-------------------------------------------QALLDKQA--------------V-S-E----VL-L-G
E3IVD7_FRASU/14-137-------------------------------------------VELQAREA--------------I-R-R----LI-S-L
Q0S5K7_RHOJR/9-131-------------------------------------------RRLEDRAE--------------L-E-D----LA-V-R
D0LD89_GORB4/12-143-------------------------------------------SHLEQIED--------------I-K-R----LK-H-R
B2AQ89_PODAN/30-160-------------------------------------------SRIESLRE--------------I-K-D----VT-S-T
B2AQ89_PODAN/220-360-------------------------------------------EDLNDEDE--------------V-R-N----LQ-H-A
A5VBN9_SPHWW/10-129-------------------------------------------DRLESIDA--------------I-R-Q----LA-A-K
E6WNE5_PANSA/4-133-------------------------------------------HEIAQRLA--------------L-R-E----LV-D-T
B8MXL3_ASPFN/8-138-------------------------------------------PSLTTREA--------------I-T-D----AL-Y-R
C0ZQW7_RHOE4/8-149-------------------------------------------EELLAIEE--------------I-K-R----VF-A-A
E3IWW1_FRASU/10-135-------------------------------------------EELAAREA--------------I-R-Q----QL-H-N
D1ABN9_THECD/23-147-------------------------------------------RLLEDERE--------------I-T-R----LI-L-S
C0ZMD8_RHOE4/24-149-------------------------------------------DALVAKQE--------------I-Y-E----VL-A-R
C0ZQN1_RHOE4/6-139-------------------------------------------SRIVAESA--------------I-R-D----LL-C-E
A4XEZ3_NOVAD/13-139-------------------------------------------GVLEDKEA--------------I-R-A----LK-A-R
Q13HM1_BURXL/10-142-------------------------------------------AYLMAVNA--------------I-Q-M----TK-A-R
B5HT20_9ACTN/43-171-------------------------------------------NSVTAAAE--------------I-S-T----LL-D-R
B3E7N6_GEOLS/52-188-------------------------------------------WVLEAKEE--------------I-R-Y----KL-C-L
Q65SQ7_MANSM/19-149-------------------------------------------EQLIERQA--------------L-K-D----LV-D-T
A5VBG5_SPHWW/5-140-------------------------------------------DTLLAIEG--------------V-K-R----CK-A-E
C5E1P0_ZYGRC/8-136-------------------------------------------PFLSDREA--------------I-K-D----TI-Y-R
C7PBQ3_CHIPD/4-133-------------------------------------------QELADRIA--------------L-K-E----LV-D-K
A5V782_SPHWW/7-132-------------------------------------------SDLLAQSA--------------I-M-R----LI-H-T
E3J9Q1_FRASU/15-143-------------------------------------------RRVEDEGA--------------I-G-R----LI-L-T
Q28SS5_JANSC/28-163-------------------------------------------DTLLDRTE--------------M-I-R----IA-D-A
Q5YUE7_NOCFA/24-150-------------------------------------------EAMEDRWQ--------------I-L-E----LL-S-A
A5V765_SPHWW/9-128-------------------------------------------AAIADKIA--------------L-G-E----LV-A-R
Q2G4I2_NOVAD/20-164-------------------------------------------TELEDLNA--------------I-R-R----LQ-W-A
Q0RU80_FRAAA/13-137-------------------------------------------EELWVRAK--------------C-V-E----LG-A-R
C0ZY97_RHOE4/8-139-------------------------------------------DALEQIEE--------------I-K-K----LK-H-G
B0T6Q3_CAUSK/13-141-------------------------------------------QRLEDIES--------------I-R-T----LK-S-R
Q2G896_NOVAD/9-133-------------------------------------------MTADDMLS--------------I-Q-Q----AV-A-A
Q2G8B9_NOVAD/8-130-------------------------------------------RRLEDRAE--------------L-N-D----LV-V-A
A0R741_MYCS2/12-151-------------------------------------------RTIEDTLA--------------I-Y-A----LL-A-T
A2QQU7_ASPNC/9-142-------------------------------------------PALPLREA--------------I-V-D----PV-Y-R
A5V496_SPHWW/15-154-------------------------------------------ADLRAERA--------------V-R-A----VV-M-R
D3F909_CONWI/11-132-------------------------------------------QELTDRSE--------------I-A-D----LV-A-R
A5V4W4_SPHWW/9-135-------------------------------------------ERLEALRA--------------I-D-D----LI-A-D
A8LEQ5_FRASN/33-162-------------------------------------------RSAEDQLE--------------I-L-R----LL-N-S
Q5YMU1_NOCFA/9-129-------------------------------------------RDLADRAE--------------L-S-E----LV-A-R
B8MB56_TALSN/45-177-------------------------------------------EKTLAITE--------------I-K-N----VQ-S-L
A7HVX6_PARL1/27-151-------------------------------------------AMSDARTE--------------I-A-D----LV-N-N
Q47PW3_THEFY/16-138-------------------------------------------RRLEEMEI--------------A-R-N----HL-H-R
Q0RKC5_FRAAA/4-127-------------------------------------------AELRTRVG--------------A-A-H----LL-A-S
C0ZPG5_RHOE4/7-136-------------------------------------------VATEDVVA--------------I-H-Q----LY-G-H
Q2GA82_NOVAD/22-166-------------------------------------------TVREDELD--------------V-R-K----LQ-H-L
D1A615_THECD/11-138-------------------------------------------VTAEDYVD--------------I-L-S----FY-A-R
Q2J5F3_FRASC/12-141-------------------------------------------APAELYTQ--------------V-L-Q----FY-A-H
Q13GK3_BURXL/16-154-------------------------------------------RQVEDHLN--------------I-L-N----LI-A-A
Q2HFF4_CHAGB/8-157-------------------------------------------QYLLDRAN--------------I-H-D----TV-T-K
B2AMA1_PODAN/20-165-------------------------------------------SRVSDEAE--------------V-R-K----TH-F-K
Q2J5F8_FRASC/12-144-------------------------------------------PSAEIYHE--------------I-L-Q----FY-A-A
A4XER9_NOVAD/52-204-------------------------------------------QSSHDRGD--------------I-Q-N----LF-S-R
B5HIV3_STRPR/14-145-------------------------------------------DISALYAQ--------------V-Q-Q----FY-A-G
D4J4G2_9FIRM/14-173-------------------------------------------QRVWDVEE--------------I-K-K----LI-H-K
D4J4F8_9FIRM/15-157-------------------------------------------CKLEAQEA--------------C-R-N----LM-G-R
A2QCD6_ASPNC/23-149-------------------------------------------EEILDRLC--------------V-T-E----LL-K-G
Q0V2S9_PHANO/36-181-------------------------------------------DNIKDQED--------------V-R-K----LQ-Y-T
Q73XG8_MYCPA/12-127-------------------------------------------QAATSRAA--------------I-L-N----LN-A-R
B2HNY2_MYCMM/12-134-------------------------------------------...ADIAA--------------I-Q-Q----VK-Y-R
B4EK49_BURCJ/8-131-------------------------------------------..LHEYEQ--------------I-R-Q----LK-Y-R
D4AUD6_ARTBC/51-174-------------------------------------------.....RSE--------------V-G-Q----GV-S-L
D4Z258_SPHJU/6-129-------------------------------------------.RLASRAA--------------I-Q-D----LY-S-D
F2RC28_STRVP/29-155-------------------------------------------RELSDRAA--------------I-S-A----VC-D-R
F9UT75_LACPL/5-135-------------------------------------------QEVSDRLA--------------L-K-Q----VV-D-L
Q73VN5_MYCPA/6-129-------------------------------------------.EISDRLE--------------I-Q-Q----LL-V-D
Q7API7_STRCO/4-133-------------------------------------------QQLRDRYA--------------I-I-E----LC-T-R

PF11533

Q2KWZ9_BORA1/3-126-------------------------------------------TVINLPHV--------------L-A-E----VH-L-A
A4GA01_HERAR/3-127-------------------------------------------HEINLPEV--------------V-A-E----VT-A-A
Q2JJM3_SYNJB/2-130-------------------------------------------SVVNRPEV--------------V-A-E----LT-E-L
B2JQX3_BURP8/4-129-------------------------------------------ESINDPET--------------L-A-A----VE-A-A
B0T8S4_CAUSK/1-126-------------------------------------------MIVNAPDV--------------V-A-E----VT-A-A
A7IPC9_XANP2/2-128-------------------------------------------VEIDIPQV--------------K-A-E----VE-D-A
Q9A550_CAUCR/1-126-------------------------------------------MIINDPAV--------------L-A-E----VT-A-L
Q6D1E8_PECAS/4-128-------------------------------------------DDVNQADV--------------L-A-D----VT-A-A
Q89VK3_BRADU/1-127-------------------------------------------MEIDLPEV--------------I-A-E----VK-A-A
Q01TH6_SOLUE/1-127-------------------------------------------M.INQPET--------------I-A-T----IA-A-L
Q6N9S0_RHOPA/1-127-------------------------------------------MDIDLPEI--------------V-A-E----VS-E-A
A2SDU4_METPP/5-130-------------------------------------------HDINRPEV--------------L-A-E----MQ-A-V
Q5FP06_GLUOX/7-132-------------------------------------------PLLNDPDI--------------L-R-D----IT-A-L
A6T9D1_KLEP7/5-128-------------------------------------------DNVDRPAI--------------L-A-E----VT-A-A
A1WIE8_VEREI/2-125-------------------------------------------MPVNLPQV--------------V-A-Q----VE-Q-A
A8GA93_SERP5/4-128-------------------------------------------EYIDRPAV--------------L-A-E----VN-A-A
Q7CK76_YERPE/32-154-------------------------------------------.CIDHLAV--------------L-A-E----VT-A-A
Q8PDQ4_XANCP/7-128-------------------------------------------.SIDLPEV--------------I-A-E----VT-A-A

PF12893

A4YKR3_BRASO/3-119------------------------------------------ADRSTVESV--------------V-QG.----YF-D-A
Q6ARD2_DESPS/3-119------------------------------------------AEIREILDF--------------L-ET.----YF-V-M
Q5LU66_RUEPO/8-124------------------------------------------ASFAAVQAV--------------I-GT.----YF-D-G
A1TQB0_ACIAC/3-119------------------------------------------TPFDDITAL--------------L-QA.----YF-D-G
Q1GM60_RUEST/4-120------------------------------------------SPDAEVQDL--------------M-TR.----YF-E-G
Q16B55_ROSDO/5-121------------------------------------------PDEVAVRSL--------------M-KR.----YF-D-G
A1U866_MARHV/3-114------------------------------------------TEKPQLEAM--------------V-NE.----YF-Q-G
Q480Y3_COLP3/13-124------------------------------------------SDFNAIEDI--------------L-YS.----YF-D-G
Q12R73_SHEDO/9-120------------------------------------------SDFSTITAV--------------V-QG.----YF-E-G
A5FCS3_FLAJ1/29-145------------------------------------------IEIQAITDA--------------I-ENY----YF-K-G
C7PJE9_CHIPD/30-146------------------------------------------QDSLAIAGV--------------L-END----YF-K-A
Q47ZG0_COLP3/35-153------------------------------------------KEYQAVVET--------------A-YN.----YF-N-G
A9AXY9_HERA2/8-126------------------------------------------DDIAAIQQA--------------A-LD.----YL-E-S
Q9A9W5_CAUCR/33-150------------------------------------------ATVKAVEAV--------------A-FD.----YV-D-G
B4RCF3_PHEZH/43-158------------------------------------------AAVRAIEAV--------------A-YD.----YV-D-G
C1AE73_GEMAT/307-421------------------------------------------SETAGALEP--------------L-QA.----YL-D-G
Q0JYS5_CUPNH/10-124------------------------------------------SRHVAALAP--------------I-ED.----YL-Q-G
Q9F3P6_STRCO/275-388------------------------------------------DVEGAVLDP--------------L-RA.----YV-R-G
C7QIJ7_CATAD/267-380------------------------------------------AVDDAVLEP--------------L-RA.----YI-R-G
A3HY18_9BACT/11-124------------------------------------------NERELISET--------------I-QL.----YF-D-G
Q1H3V3_METFK/8-121------------------------------------------DDIDGITEV--------------L-NV.----YM-N-A
C5FTM8_ARTOC/16-127------------------------------------------KEKEAVLKA--------------A-RY.----YV-D-G
C7PBA6_CHIPD/41-154------------------------------------------ADYTAITAV--------------I-DG.----YV-E-G
A5VE46_SPHWW/17-129------------------------------------------GDHAEIARL--------------I-GR.----YV-D-G
Q5LUH0_RUEPO/5-117------------------------------------------EHIAALTAL--------------V-ET.----YV-M-A
Q2KDJ8_RHIEC/2-116------------------------------------------SDRQAVEQT--------------V-HL.----YV-E-G
B9J7G6_AGRRK/2-116------------------------------------------SEEQAIRAV--------------V-HL.----YV-D-G
C3MCQ3_RHISN/2-116------------------------------------------SDEQAISAV--------------V-HL.----YV-D-G
B8FB72_DESAA/6-121------------------------------------------QDLEMIKET--------------V-QN.----YF-D-G

PF12870

B2TQV7_CLOBB/21-124------------------------------------------CGCAEKQ.T--------------P-SNMVKN-YL-E-E
B9L7K8_NAUPA/17-130------------------------------------------TGCSKKD.S--------------P-ETAAKE-FI-S-S
A8ETE1_ARCB4/19-125------------------------------------------SGCFEE..T--------------A-ADATEN-FF-Y-S
B4EXW7_PROMH/19-133------------------------------------------SACGDKQDE--------------A-GKAAVE-FI-E-A
Q7VHU7_HELHP/20-130------------------------------------------VACGAN..S--------------P-KDVAIA-FT-K-D
D3Q127_STANL/126-231------------------------------------------VFSGG...G--------------P-SSAVDN-VV-N-A
B1MHS8_MYCA9/118-217------------------------------------------PAGGAA..T--------------A-EAAVKG-YL-E-A
C7PUV8_CHIPD/19-120------------------------------------------GSCKKSA.T--------------P-QEVALN-FM-H-A
Y142_AQUAE/19-135------------------------------------------KSCGEPYSG--------------A-KETVGE-FM-E-E
B4U8X6_HYDS0/35-135------------------------------------------PQTINNN.N--------------P-ETVLKN-FD-K-D

PF00866

Q9I0W9_PSEAE/15-157------------------------------------------RHAELCDAQ--------------D-WDG----YL-A-.
Q9I0W5_PSEAE/14-156------------------------------------------REARYLDDK--------------D-WDA----WL-A-.
BPHA2_RHOJR/32-181------------------------------------------WEAKLLNDR--------------R-FQE----WF-D-.
BENB_ACIAD/21-163------------------------------------------SEARFLDDE--------------Q-WDD----WL-E-.
ANTDB_ACIAD/15-157------------------------------------------KKAELCDNY--------------D-WDA----YI-D-.
HCAF_ECOLI/19-166------------------------------------------HEASLLDDW--------------K-FRD----WL-A-.
Q9I230_PSEAE/22-162------------------------------------------AEAELLDDR--------------L-LDT----WF-A-.
A0AWN1_ARTS2/49-192------------------------------------------.EAYLLDAQ--------------D-YDA----WM-S-.
A1T2D2_MYCVP/20-161------------------------------------------REAELLDGG--------------Q-FRE----WL-G-.
A1WAE7_ACISJ/40-186------------------------------------------REAHLLDIQ--------------A-YKA----WL-E-H
A4XDR9_NOVAD/19-159------------------------------------------.DANALDSK--------------D-MPG----WL-E-N
A4XDS6_NOVAD/23-168------------------------------------------REARLLDNE--------------D-FEG----WL-A-.
A4XDS8_NOVAD/30-176------------------------------------------REARLLDDE--------------H-YKA----WT-S-.
A4XDU7_NOVAD/18-157------------------------------------------QEAMALDDK--------------D-WDA----WL-A-.
A4XDY2_NOVAD/23-167------------------------------------------.EVRMLQNQ--------------Q-YRE----WF-D-T
A5V4P0_SPHWW/21-169------------------------------------------READLLDSW--------------E-WGK----WF-E-.
A5VGV9_SPHWW/24-171------------------------------------------EEAALLAER--------------R-FED----WY-A-.
A9I2P3_BORPD/32-180------------------------------------------WEAKLLNDR--------------R-FEE----WF-A-.
E7FJB3_9BURK/38-186------------------------------------------REAQLLDHH--------------N-YNA----WF-D-.
G8ML34_9BURK/14-155------------------------------------------REARFLDDR--------------Q-WDE----WL-G-.
K0C5V9_CYCSP/30-185------------------------------------------REALLLDNI--------------K-YED----WF-A-.
BPHE_BURXL/33-181------------------------------------------REAQLLDHR--------------A-YEA----WF-A-.
S6AQB4_PSERE/15-156------------------------------------------RNAEACDAQ--------------D-WDT----YL-S-.
S6BQW5_PSERE/33-166------------------------------------------REARLLDER--------------R-FWE----WD-R-.

PF02982

SCYD_ASPFU/9-168------------------------------------------TLEFHDYLA--------------L-KKVLFD-WA-D-S
SCYD_MAGO7/10-169------------------------------------------EITFSDYLG--------------L-MTCVYE-WA-D-S
SCYD_COLOR/7-166------------------------------------------NITFEDYLG--------------L-NAALFE-WA-D-S

PF12707

Q46H33_PROMT/23-149------------------------------------------SDSQQLEAL--------------I-Q-S----FA-D-R
Q46KI2_PROMT/2-129------------------------------------------SSKEEILSI--------------L-E-A----FA-S-T

PF05223

X1XHQ7_ACYPI/24-139------------------------------------------SKNSQINDT--------------L-D-A----IE-D--
Q8Y9T2_LISMO/44-163------------------------------------------NALAAAETF--------------T-S-N----IA-K--
Q97D06_CLOAB/26-144------------------------------------------TPKASFEKY--------------I-N-A----WN-K--
Q8NP18_CORGL/32-140------------------------------------------TADPIAEEF--------------L-Q-A----WA-S--
Q9F2L0_STRCO/54-166------------------------------------------AATEQARAF--------------L-A-D----WA-A--
Q9K7H2_BACHD/27-156------------------------------------------SPEEAFTTF--------------A-D-H----WK-N--
PBPC_BACSU/26-148------------------------------------------SPEDRMEAF--------------V-K-Q----WN-D--
Q9CBU6_MYCLE/35-143------------------------------------------GPGPAAAKF--------------F-D-A----LA-I--
B5GLC4_STRC2/58-167------------------------------------------AAAGQFDTF--------------L-G-A----WE-K--
H7C6V7_ENTFA/46-164------------------------------------------EAKKTATTF--------------L-N-V----LS-K--
I6TCQ1_ENTHA/44-162------------------------------------------AGEKKIQQF--------------A-E-R----LS-T--
Q3XZN6_ENTFC/44-162------------------------------------------AGEKTVEQF--------------V-Q-A----LN-K--
Q81E03_BACCR/24-142------------------------------------------KPQEAFDTY--------------V-K-A----WN-K--

PF12883

D9QJI7_BRESC/62-179------------------------------------------GPEPFVRAL--------------Y-A-Q----YVAG--
H2IPN3_RAHAC/22-145------------------------------------------QAGQQVKEF--------------Y-G-F----YL..--
I0K6B0_9BACT/55-189------------------------------------------QKAANQIDF--------------T-D-D----NGPH--
B8HJZ2_CYAP4/26-146------------------------------------------GPAATVEGF--------------Y-Q-W----YVSN--
A8AER7_CITK8/22-144------------------------------------------NAERRVSDF--------------Y-T-Y----YL..--
A8ADQ6_CITK8/22-144------------------------------------------DSTQDINQF--------------Y-L-S----WM..--
A7MF41_CROS8/40-159------------------------------------------GPDTVAEQF--------------Y-Q-H----RIEQ--
A7MM23_CROS8/24-142------------------------------------------TPTQFLKSL--------------Y-Q-S----YA..--
H2J156_RAHAC/32-164------------------------------------------DPVKITQSF--------------Y-T-Q----YM..--
YBJP_ECOLI/41-154------------------------------------------.PDNVAQQF--------------Y-D-Y----RI..--
YQHG_ECOLI/25-143------------------------------------------.VEQTVRHI--------------Y-Q-N----YK..--
Q8ZNB4_SALTY/23-142------------------------------------------.STQAVKQF--------------Y-T-S----WM..--

PF16022

F8EKS0_RUNSL/32-137-----------------------------------------------AEII--------------R-G-S----IK-T--
A3HU78_9BACT/72-173-----------------------------------------------IDSV--------------V-A-A----ID-G--
R5IFV9_9BACT/37-138-----------------------------------------------FVPI--------------A-K-Y----LQ-R--
A6LDQ2_PARD8/22-123-----------------------------------------------ITSI--------------S-N-A----FK-A--
C7PFY9_CHIPD/35-137-----------------------------------------------FDDV--------------V-T-A----IK-Q--
D0MG74_RHOM4/34-135-----------------------------------------------.QVL--------------V-E-A----LA-R--
R7JG97_9PORP/50-151-----------------------------------------------ITVI--------------T-T-A----LK-T--
X5E2C2_9BACT/31-135-----------------------------------------------PNEI--------------N-V-G----LA-T--
F4KWM2_HALH1/20-123-----------------------------------------------LDSI--------------T-K-A----IS-T--
C6XS70_PEDHD/36-138-----------------------------------------------IDNL--------------S-A-H----FK-A--
E4T0J0_PALPW/28-125-----------------------------------------------SPDI--------------I-S-A----LN-N--
U5Q3W3_9BACT/29-130-----------------------------------------------FVPI--------------A-K-Y----IQ-S--
Q5LFI3_BACFN/25-126-----------------------------------------------PVGV--------------V-V-A----FK-K--
G8TMR5_NIAKG/25-126-----------------------------------------------IDDV--------------V-A-A----MK-T--
I4AH41_FLELS/32-134-----------------------------------------------INTA--------------K-T-A----IG-A--
H1Y7M9_9SPHI/24-125-----------------------------------------------.EKT--------------L-I-L----LK-Q--
W0F4P0_9SPHI/48-149-----------------------------------------------LDGV--------------I-S-G----LK-S--
R6XTN3_9BACT/30-131-----------------------------------------------FVPI--------------A-K-Y----LG-N--
R5BZN7_9BACE/25-126-----------------------------------------------PAEV--------------L-T-A----FQ-K--
I6YSP9_MELRP/18-124-----------------------------------------------FANI--------------E-E-G----LP-A--
F4C3S4_SPHS2/29-131-----------------------------------------------IDNI--------------T-N-C----FR-T--
I0KEK5_9BACT/11-116-----------------------------------------------TQAI--------------G-D-S----MR-L--
D6D570_9BACE/25-126-----------------------------------------------PAGV--------------I-T-A----FK-R--
R5I3V3_9PORP/34-135-----------------------------------------------VQET--------------S-N-A----FR-T--
R6LFP6_9BACE/25-126-----------------------------------------------PVGV--------------V-V-A----FK-K--
I2EQ77_EMTOG/47-152-----------------------------------------------ADRI--------------R-M-S----FR-A--
R6ET03_9BACE/32-132-----------------------------------------------FVPI--------------A-K-Y----IR-L--
H8KRH1_SOLCM/26-128-----------------------------------------------VEAI--------------T-K-S----IE-S--
G0IWX7_CYCMS/28-130-----------------------------------------------NSSI--------------I-S-A----FQ-K--
R6FI22_9BACE/25-126-----------------------------------------------PNAL--------------V-M-A----FK-K--
L0FWK7_ECHVK/16-116-----------------------------------------------.KEI--------------A-I-S----IK-A--
F0SAG7_PSESL/32-134-----------------------------------------------IEEI--------------A-A-F----MK-S--
R6XEI4_9PORP/23-123-----------------------------------------------.VPI--------------S-N-A----FK-R--
E4TVS0_MARTH/30-131-----------------------------------------------FADV--------------R-S-A----LK-A--
F3ZTQ1_9BACE/24-125-----------------------------------------------NDDI--------------V-K-A----FE-Q--
I0ALN7_IGNAJ/34-140-----------------------------------------------FDDI--------------E-L-S----IR-E--
W8EV60_9BACT/29-129-----------------------------------------------.GPV--------------R-S-A----IR-S--
R5C1N0_9BACE/30-131-----------------------------------------------FSPI--------------G-K-Y----II-K--
Q2S4T9_SALRD/45-150-----------------------------------------------ARRV--------------A-T-A----FA-E--
D2QTL0_SPILD/27-131-----------------------------------------------SQTV--------------G-N-S----LR-S--
I3Z3H9_BELBD/27-126-----------------------------------------------..VI--------------F-I-S----FK-N--
R7DFE2_9PORP/25-126-----------------------------------------------PNDI--------------P-K-A----FK-T--
F2II17_FLUTR/23-125-----------------------------------------------FSAV--------------E-Q-A----FG-R--
R6LE89_9BACE/25-126-----------------------------------------------PAGV--------------V-T-A----FK-K--
Q11NQ0_CYTH3/50-153-----------------------------------------------IENI--------------R-V-S----IK-M--

PF13026

A4AWI0_MARSH/19-104-----------------------------------------------ASKF--------------Q-S-K----YN-A--
A6LM34_THEM4/24-113-----------------------------------------------ATDY--------------L-N-A----LI-T--
A8F7I3_PSELT/24-115-----------------------------------------------ALQF--------------I-T-L----LS-S--
A9KL18_CLOPH/74-163-----------------------------------------------SAKL--------------T-H-D----LL-T--
B1I2Q6_DESAP/43-137-----------------------------------------------AENI--------------L-Q-A----FN-D--
B8E211_DICTD/27-115-----------------------------------------------SEKF--------------I-Y-L----LV-S--
C3AGG3_BACMY/39-163-----------------------------------------------AEQK--------------E-D-M----RV-Y--
C8WGP2_EGGLE/123-216-----------------------------------------------AQKV--------------A-E-V----VG-E--
D4JFI6_9FIRM/118-209-----------------------------------------------AMEV--------------I-E-Y----AS-N--
D6E741_9ACTN/49-139-----------------------------------------------AREV--------------I-D-L----VN-A--
D6E742_9ACTN/53-143-----------------------------------------------ARDA--------------I-D-L----FV-A--
D7AW34_NOCDD/95-184-----------------------------------------------AASV--------------I-E-D----LA-S--
E3GDE8_EUBLK/46-135-----------------------------------------------AEKV--------------I-D-E----WN-S--
E3GFD2_EUBLK/40-131-----------------------------------------------TRSL--------------V-Q-V----LA-E--
E6TQB5_BACCJ/33-124-----------------------------------------------SRTI--------------I-G-L----MV-N--
E6TQB6_BACCJ/58-147-----------------------------------------------AEEY--------------I-S-H----LS-Q--
E6TY43_BACCJ/31-120-----------------------------------------------AVEY--------------L-E-Q----LK-A--
F0S9L8_PSESL/29-118-----------------------------------------------STQF--------------F-E-T----LN-E--
F4CEB4_SPHS2/28-116-----------------------------------------------AAKF--------------I-S-L----MV-D--
F6D290_METPW/13-102-----------------------------------------------AQNF--------------V-D-Q----FL-Q--
F6GEE1_LACS5/30-117-----------------------------------------------VSEF--------------Q-E-N----YN-Q--
G2MPX0_9ARCH/64-153-----------------------------------------------TQDF--------------L-E-A----LI-A--
G8LXF0_CLOCD/44-138-----------------------------------------------AENV--------------I-S-L----IN-A--
H1XTG9_9BACT/36-125-----------------------------------------------AAQF--------------I-D-L----LE-Q--
H1ZC72_MYROD/29-115-----------------------------------------------MEIF--------------M-E-D----YN-T--
Q73JX5_TREDE/37-132-----------------------------------------------AEEI--------------I-F-M----IN-D--
Q8EMU8_OCEIH/26-113-----------------------------------------------SEEL--------------I-D-N----LI-A--
D4M3N3_9FIRM/40-132-----------------------------------------------ATEY--------------F-N-Q----MM-D--
Q81P15_BACAN/37-125-----------------------------------------------AEEI--------------V-S-L----LN-E--
ESTD_THEMA/26-112-----------------------------------------------...F--------------V-Q-H----LT-S--
R5HS05_9FIRM/71-164-----------------------------------------------AEKI--------------I-G-L----LN-A--
R5QXD2_9FIRM/39-142-----------------------------------------------ADFI--------------V-Q-N----FS-M--
R5TTD3_9FIRM/55-147-----------------------------------------------AMED--------------I-E-I----AQ-S--
R5W2J2_9BACE/28-117-----------------------------------------------AQQI--------------L-Q-W----MK-N--
R6ELK1_9FIRM/40-141-----------------------------------------------ADAI--------------I-M-N----FS-N--
R6EMC8_9FIRM/45-140-----------------------------------------------AECV--------------V-G-W----FN-E--
R6F505_9FIRM/119-211-----------------------------------------------.ELI--------------I-Q-Y----LD-E--
R6LVU3_9FIRM/39-143-----------------------------------------------.DAV--------------F-D-I----IE-S--
R6PF09_9FIRM/42-138-----------------------------------------------AKDI--------------V-T-Q----VN-E--
R6UW08_9FIRM/46-137-----------------------------------------------ALQF--------------V-K-D----LT-Q--
W0EZS0_9SPHI/30-115-----------------------------------------------ADKV--------------E-K-F----YN-A--

PF16156

G2KS29_MICAA/81-180-----------------------------------------------IRMR--------------N-VTQCAA-IM-T--
F2IZS6_POLGS/37-137-----------------------------------------------FRRI--------------V-QDQMAA-FR-R--
Q1GEC2_RUEST/29-128-----------------------------------------------ITGV--------------I-GAQIEA-FQ-A--
A8LR20_DINSH/25-124-----------------------------------------------IEAV--------------I-GAQLEA-FK-A--
Q5LW85_RUEPO/25-124-----------------------------------------------IKAV--------------I-GNQIEA-FL-A--
Q28L79_JANSC/39-138-----------------------------------------------IEAV--------------I-GNQFDA-FR-E--
Q7NLT4_GLOVI/45-142-----------------------------------------------LEAV--------------I-QSQLAA-FR-K--
Q6MA17_PARUW/75-172-----------------------------------------------V.DV--------------I-DKQLEA-LR-N--
B2J495_NOSP7/11-111-----------------------------------------------IRSL--------------I-ENQLAA-FK-K--
Q8YXC7_NOSS1/11-111-----------------------------------------------IRSV--------------I-ESQLAA-FQ-Q--
D7BFD2_MEISD/33-133-----------------------------------------------IRAV--------------I-EAQLAA-FQ-Q--
A1VLU3_POLNA/45-145-----------------------------------------------VRAV--------------V-EGQLAA-LA-R--
F5Y526_RAMTT/37-137-----------------------------------------------VRQV--------------I-VTQLDA-LS-Q--
B1M6C1_METRJ/27-128-----------------------------------------------ARAV--------------I-AKQAQA-LG-R--
B9JFB3_AGRRK/27-129-----------------------------------------------AQTL--------------I-QGQIEA-FL-Q--
C3MD33_RHISN/28-126-----------------------------------------------.RSV--------------I-RAQIKA-FL-D--
E4PHZ6_MARAH/39-138-----------------------------------------------IRDT--------------I-LRQIEA-FA-N--
K9VG60_9CYAN/11-111-----------------------------------------------IRSV--------------V-EQQLQA-FQ-K--
Q16AU9_ROSDO/25-124-----------------------------------------------MRDV--------------I-DSQLSA-FQ-Q--
Q98M58_RHILO/71-171-----------------------------------------------.QAV--------------I-DGQLKA-LL-A--

PF07366

Q92YL1_RHIME/6-127---------------------------------------------ADIYRA--------------Y-L----D-CL....
Q81HA2_BACCR/57-169---------------------------------------------KMVVDF--------------Y-N----E-VF....
Q82GA1_STRAW/11-139---------------------------------------------ATLNRF--------------H-S----A-V.....
G3XDB6_PSESM/4-125---------------------------------------------TDHYRA--------------Y-I----A-CL....
Q7P1G6_CHRVO/10-136---------------------------------------------AVIQRF--------------N-R----E-VI....
Q7NU92_CHRVO/45-170---------------------------------------------KLAALR--------------Y-A----A-FW....
Q98IW1_RHILO/4-125---------------------------------------------TDLYRG--------------Y-I----D-CL....
Q8TQG8_METAC/22-156---------------------------------------------LQLMTT--------------L-D----D-AW....
Q8E9W0_SHEON/78-203---------------------------------------------ARAALL--------------Y-A----S-FW....
Q7CRD4_AGRFC/5-126---------------------------------------------NDIYLA--------------Y-L----D-SL....
Q82DI4_STRAW/115-241---------------------------------------------GTVRRF--------------L-L----E-VA....
Q7NP31_GLOVI/43-169---------------------------------------------ALVRKF--------------Y-E----E-VF....
Q1CYG6_MYXXD/36-152---------------------------------------------QRVRQL--------------T-E----E-LY....
Q8YNM4_NOSS1/8-132---------------------------------------------FIVLQA--------------Y-E----A-F.....
Q8YQT8_NOSS1/6-132---------------------------------------------TELLLQ--------------W-A----N-LW....
A0A0E1QP56_BORBO/18-131---------------------------------------------HLMDEM--------------L-A----T-LA....
Q8GPW3_PSEAI/8-133---------------------------------------------KIAQQF--------------Y-D----A-I.....
Q6LKM5_PHOPR/2-132---------------------------------------------SLTITK--------------Y-E----Q-IWVDGL
Q7NYY8_CHRVO/8-137---------------------------------------------RVVQGF--------------L-D----E-VR....
Q63FG7_BACCZ/60-176---------------------------------------------VHAAQR--------------F-Y----A-FW....
Q9RN64_STRNO/8-132---------------------------------------------ERCLEM--------------.-V----A-AW....
Q8KY43_STRCU/149-275---------------------------------------------ELVLGA--------------Y-R----D-VF....
DNRD_STRPE/5-133---------------------------------------------IDLVRR--------------M-V----E-AY....
Q9I3U3_PSEAE/7-128---------------------------------------------AERYRA--------------Y-I----D-CL....
DNRD_STRGJ/5-132---------------------------------------------IAAVRR--------------M-V----E-AY....
Q98JP4_RHILO/22-156---------------------------------------------AVVVRW--------------F-T----D-FW...G
Q7NGE5_GLOVI/21-149---------------------------------------------VVALRF--------------A-Q----E-GWG..T
Q63TL7_BURPS/56-181---------------------------------------------ILAARR--------------Y-D----T-FW....
Q82M76_STRAW/10-135---------------------------------------------ALLRTA--------------Y-Q----R-L.....

PF12680

B5I6W1_9ACTN/1-115-----------------------------------------------MDRL--------------T.E....A.V.----
B5HJN5_STRPR/117-228-----------------------------------------------ARRF--------------F.H...EI.A.----
B5H8J2_STRPR/32-138-----------------------------------------------VRRG--------------Y.T....A.F.----
C5CZF1_VARPS/22-124-----------------------------------------------VRRF--------------M.A....A.F.----
C5CZF1_VARPS/148-250-----------------------------------------------IRRF--------------N.E....V.F.----
B2J517_NOSP7/10-126-----------------------------------------------VRRY--------------FYE....V.F.----
B2J517_NOSP7/165-276-----------------------------------------------VSRY--------------F.D...EV.M.----
B5HLE5_9ACTN/167-263-----------------------------------------------VAAF--------------D.Q....L.I.----
D3ECJ4_GEOS4/142-239-----------------------------------------------VKSY--------------V.E....NIL.----
Q5LLC2_RUEPO/32-126-----------------------------------------------AVGL--------------L.E...QG.L.----
Q5LLC2_RUEPO/163-259-----------------------------------------------VTGL--------------VKD....V.L.----
C1D3J7_DEIDV/182-279-----------------------------------------------VARF--------------V.D...DI.L.----
D2SCU4_GEOOG/6-119-----------------------------------------------AQAY--------------L.D....A.W.----
B5HLM0_9ACTN/9-102-----------------------------------------------LTAA--------------G.E....L.F.----
B5HLM0_9ACTN/139-235-----------------------------------------------VAEF--------------A.Q...KV.L.----
A5V525_SPHWW/7-105-----------------------------------------------VLAF--------------I.E....A.W.----
B9L3S7_THERP/14-118-----------------------------------------------VRAV--------------L.A....A.L.----
B4RFR1_PHEZH/28-128-----------------------------------------------IRDF--------------I.E....A.W.----
A7HS76_PARL1/16-117-----------------------------------------------VADF--------------L.G....A.W.----
A6X4Q6_OCHA4/11-117-----------------------------------------------FSDL--------------F.D....A.F.----
C7PVH3_CATAD/11-120-----------------------------------------------VVRY--------------V.E....A.V.----
B0C0J0_ACAM1/35-144-----------------------------------------------VESV--------------A.T....L.A.----
B0C0J0_ACAM1/185-295-----------------------------------------------VLNF--------------L.T....A.L.----
Q1D9P4_MYXXD/10-115-----------------------------------------------ARAW--------------L.D....A.F.----
A5VCT4_SPHWW/11-120-----------------------------------------------VKRF--------------F.D....A.F.----
C7Q8T1_CATAD/8-117-----------------------------------------------VLRY--------------F.T....A.L.----
B0T3P4_CAUSK/9-118-----------------------------------------------VQRG--------------Y.D....C.F.----
C5CRN6_VARPS/10-123-----------------------------------------------IADA--------------W.K....A.F.----
B7KBU4_CYAP7/7-120-----------------------------------------------AEKF--------------F.D....A.L.----
C4ZJ89_THASP/28-128-----------------------------------------------LARF--------------Y.E....T.F.----
A5VDX7_SPHWW/10-121-----------------------------------------------VERV--------------I.G....A.W.----
D2B1F4_STRRD/9-111-----------------------------------------------VERY--------------V.E....A.L.----
B8ES54_METSB/10-116-----------------------------------------------VKDF--------------F.A....A.I.----
Q0S9H2_RHOJR/9-118-----------------------------------------------VRRF--------------Y.E....E.M.----
B9LPI7_HALLT/13-109-----------------------------------------------VRAY--------------Y.D....A.L.----
C7Q9Y2_CATAD/16-124-----------------------------------------------ARAF--------------F.R....L.L.----
A5VBH5_SPHWW/11-110-----------------------------------------------VQSY--------------V.E....A.F.----
B1MD21_MYCA9/14-115-----------------------------------------------IEGF--------------W.D....A.M.----
D1CA95_SPHTD/7-116-----------------------------------------------AGQY--------------F.D....A.W.----
Q88PF6_PSEPK/7-118-----------------------------------------------VNAY--------------Y.A....A.F.----
Q5QV19_IDILO/10-113-----------------------------------------------LKEF--------------Y.D....E.L.----
C5BYA4_BEUC1/11-106-----------------------------------------------IERL--------------W.A....R.M.----
A5VCU3_SPHWW/39-148-----------------------------------------------VHEL--------------Y.E....A.F.----
E4NSQ6_HALBP/19-128-----------------------------------------------IRRY--------------H.E......I.----
Q7NE84_GLOVI/10-111-----------------------------------------------VEQA--------------R.Q....A.W.----
Q5Z059_NOCFA/9-111-----------------------------------------------IERY--------------V.E....L.V.----
A8LIY8_DINSH/16-139-----------------------------------------------VRAL--------------N.A....A.L.----
A8LIY8_DINSH/193-315-----------------------------------------------VERM--------------V.AD.LSA.L.----
A5VFS9_SPHWW/9-116-----------------------------------------------VGAF--------------F.A....A.F.----
B5HJE1_STRPR/10-115-----------------------------------------------FHRA--------------L.E....A.F.----
B5HVP3_9ACTN/16-111-----------------------------------------------VERF--------------W.A....L.A.----
D2Q2I7_KRIFD/11-105-----------------------------------------------ARKY--------------F.D....T.L.----
Q1R0D2_CHRSD/10-113-----------------------------------------------FCRV--------------F.E....K.L.----
D0L730_GORB4/10-111-----------------------------------------------TTAY--------------L.D....A.L.----
Q0BQA1_GRABC/9-124-----------------------------------------------IRAY--------------Y.E....A.F.----
Q31QW3_SYNE7/11-117-----------------------------------------------VRNY--------------V.E....A.F.----
Q0RE76_FRAAA/8-122-----------------------------------------------VKRA--------------L.D....A.F.----
A2SCA2_METPP/13-116-----------------------------------------------VIAR--------------F.E....H.L.----
C5CK59_VARPS/9-108-----------------------------------------------LATA--------------N.A....A.I.----
D2B0D7_STRRD/15-117-----------------------------------------------IRTF--------------Y.D....A.F.----
A1VLA0_POLNA/8-116-----------------------------------------------VQQA--------------Y.E....A.F.----
Q1CVT2_MYXXD/62-168-----------------------------------------------AQRF--------------V.D....A.L.----
Q9EWM1_STRCO/9-118-----------------------------------------------FRRM--------------I.D....L.L.----
D2BAU3_STRRD/10-116-----------------------------------------------ARDS--------------Y.D....A.L.----
B0C619_ACAM1/7-113-----------------------------------------------LQEY--------------S.D....A.W.----
D7AYQ5_NOCDD/12-122-----------------------------------------------AEKF--------------V.E....R.L.----
A1SCF9_NOCSJ/9-115-----------------------------------------------VRRY--------------Y.D....L.V.----
D5UVL3_TSUPD/13-113-----------------------------------------------AERF--------------V.E....A.L.----
D3QAD1_STANL/13-107-----------------------------------------------ALAY--------------Y.E....A.W.----
D3STL0_NATMM/24-125-----------------------------------------------VHDY--------------Y.D....T.V.----
A9CHA2_AGRFC/13-121-----------------------------------------------VQHY--------------L.E....T.F.----
B5HLL8_9ACTN/11-108-----------------------------------------------AQAF--------------Y.D...LM.F.----
C6VS31_DYAFD/7-118-----------------------------------------------VQQY--------------Y.E....A.F.----
Q01YM1_SOLUE/9-121-----------------------------------------------VRRW--------------F.E...EV.W.----
Q7NU42_CHRVO/10-117-----------------------------------------------VRAT--------------Y.E....G.K.----
Q0S852_RHOJR/10-121-----------------------------------------------IRRF--------------Y.T....E.I.----
Q0SDB9_RHOJR/13-126-----------------------------------------------IQRF--------------F.A....S.V.----
A8I8X5_CHLRE/91-196-----------------------------------------------IVRY--------------Y.E....A.Y.----
Q89WH5_BRADU/12-118-----------------------------------------------LRAF--------------C.D....A.V.----
Q7NFQ8_GLOVI/11-120-----------------------------------------------VRRF--------------Y.E...EA.Y.----
A4FI35_SACEN/11-114-----------------------------------------------AIAY--------------C.E....R.V.----
Q1IJ26_KORVE/10-115-----------------------------------------------ATQW--------------A.A....A.W.----
A5V9B3_SPHWW/11-114-----------------------------------------------VRRF--------------W.D....A.I.----
Q7NT36_CHRVO/13-113-----------------------------------------------LLDW--------------Y.Q....T.L.----
C1A2X0_RHOE4/8-108-----------------------------------------------VNAM--------------F.A....A.L.----
B5HZI5_9ACTN/16-126-----------------------------------------------MNRF--------------V.E....F.I.----
Q89DK6_BRADU/65-174-----------------------------------------------VVHL--------------L.D....A.F.----
B0C5C3_ACAM1/11-121-----------------------------------------------VQRF--------------F.K....A.L.----
A4XEU5_NOVAD/14-116-----------------------------------------------LQAY--------------V.D....R.I.----
Q0RK85_FRAAA/9-111-----------------------------------------------VSQF--------------L.D....R.L.----
B1LXB4_METRJ/10-119-----------------------------------------------TEKF--------------G.E....L.V.----
Q1IJH6_KORVE/7-113-----------------------------------------------VQQL--------------FHD....G.F.----
B5HUL8_9ACTN/35-145-----------------------------------------------VTAF--------------I.D....ALF.----
C7PJ94_CHIPD/8-108-----------------------------------------------VTRY--------------M.E....G.F.----
B8HNZ9_CYAP4/16-120-----------------------------------------------IQQY--------------F.A....A.S.----
Q8ETH3_OCEIH/11-113-----------------------------------------------LQKY--------------L.E....G.F.----
B4EGT8_BURCJ/14-120-----------------------------------------------LAAF--------------S.D....A.F.----
C5CTR3_VARPS/11-118-----------------------------------------------VQRI--------------H.S....E.L.----
A1SE82_NOCSJ/305-416-----------------------------------------------FRRL--------------V.A....A.W.----
A1T7R4_MYCVP/21-154-----------------------------------------------VRKF--------------L.F....A.L.----
Q0ATM8_MARMM/33-142-----------------------------------------------AQAI--------------Y.D....A.F.----
A4VYE6_STRSY/19-125-----------------------------------------------FNAY--------------N.N....A.L.----
Q0AK67_MARMM/68-179-----------------------------------------------AEAW--------------L.D....A.Y.----
D1A779_THECD/12-112-----------------------------------------------VRSY--------------Y.E....H.V.----
B9M2F6_GEODF/33-141-----------------------------------------------IGRF--------------A.E...EV.F.----
B0RBH4_CLAMS/76-179-----------------------------------------------ISTL--------------F.T...AA.F.----
B0RBH4_CLAMS/225-319-----------------------------------------------AVGA--------------Y.D...TL.F.----
Q82NK0_STRAW/12-119-----------------------------------------------ARRF--------------V.AVWERA.W.----
B5I3N5_9ACTN/17-126-----------------------------------------------YRHS--------------L.R....L.L.----
C5CWJ6_VARPS/7-113-----------------------------------------------AKNY--------------I.H....A.A.----
B8HUP3_CYAP4/10-119-----------------------------------------------VLQF--------------Y.R....A.F.----
YESE_BACSU/13-122-----------------------------------------------LRKF--------------M.A....Y.M.----
Q0RZ59_RHOJR/13-116-----------------------------------------------LRRL--------------E.N....A.V.----
C0ZMD1_RHOE4/13-113-----------------------------------------------AREM--------------F.Q....A.W.----
E4NS77_HALBP/17-126-----------------------------------------------ARRI--------------P.E...DV.F.----
A0LVM2_ACIC1/13-121-----------------------------------------------VRRF--------------Y.E....A.L.----
A9B4R1_HERA2/9-105-----------------------------------------------VTQF--------------W.Q....L.M.----
B1MKK2_MYCA9/12-112-----------------------------------------------VQSY--------------C.D....L.L.----
A1AMJ6_PELPD/11-123-----------------------------------------------VRAG--------------L.E....A.L.----
Q0RKU0_FRAAA/7-102-----------------------------------------------IDDY--------------F.A....G.W.----
D1A9D6_THECD/22-131-----------------------------------------------ARRS--------------M.A....A.A.----
Q6KYU6_PICTO/7-107-----------------------------------------------CLDY--------------Y.N....A.V.----
Q1CVW7_MYXXD/8-109-----------------------------------------------ITDF--------------Y.S....A.F.----
D3Q1G6_STANL/8-116-----------------------------------------------VEAF--------------F.G....F.R.----
C1D0F3_DEIDV/8-109-----------------------------------------------MQAL--------------Q.Q....A.E.----
Q1IMY1_KORVE/8-111-----------------------------------------------IEQA--------------Y.S....A.F.----
Q2GAG8_NOVAD/26-123-----------------------------------------------VEDF--------------A.R....L.FY----
A4RY41_OSTLU/26-129-----------------------------------------------VREM--------------Y.E....R.I.----
B6IUF4_RHOCS/9-114-----------------------------------------------VLTL--------------H.A....A.L.----
Q0RWK4_RHOJR/10-112-----------------------------------------------VRGA--------------I.D....A.I.----
Q6D2X2_PECAS/50-158-----------------------------------------------VEAY--------------L.A....A.F.----
A1SQ29_NOCSJ/22-134-----------------------------------------------SQRS--------------Y.S....A.V.----
B8GR64_THISH/14-117-----------------------------------------------YAEF--------------F.A....T.L.----
A5V474_SPHWW/7-117-----------------------------------------------FDDL--------------E.Q....A.W.----
Q28KZ3_JANSC/183-305-----------------------------------------------VEAM--------------L.S....A.L.----
Q98HZ7_RHILO/7-115-----------------------------------------------VKNL--------------Y.D....A.Y.----
D3SXC1_NATMM/13-124-----------------------------------------------VRRE--------------I.E...TV.W.----
B4RCM5_PHEZH/40-139-----------------------------------------------VQGQ--------------L.D....A.Y.----
Q7NIX2_GLOVI/6-112-----------------------------------------------VERF--------------M.Q....T.L.----
Q7NCT6_GLOVI/10-113-----------------------------------------------VTTY--------------F.D....N.M.----
C7QIA1_CATAD/12-123-----------------------------------------------VELL--------------L.R....T.V.----
D2PU42_KRIFD/7-118-----------------------------------------------FLRL--------------V.H....G.V.----
Q11RX8_CYTH3/10-111-----------------------------------------------LEHF--------------Y.H....C.F.----
Q15W82_PSEA6/7-110-----------------------------------------------FVNF--------------Y.K....S.L.----
D5URT3_TSUPD/13-113-----------------------------------------------VRKF--------------L.A....D.L.----
C7PY66_CATAD/14-115-----------------------------------------------VLEA--------------V.S....R.F.----
D1AZA9_SULD5/9-119-----------------------------------------------IEEY--------------Y.E...VV.W.----
Q0RHL1_FRAAA/31-134-----------------------------------------------IAAY--------------Y.A....S.Y.----
Q0REI6_FRAAA/9-118-----------------------------------------------VREL--------------L.R....L.F.----
Q0ALT6_MARMM/8-104-----------------------------------------------TAAY--------------V.A....A.F.----
Q9RUP4_DEIRA/10-111-----------------------------------------------ITRL--------------F.T....I.I.----
Q5NW43_AROAE/11-116-----------------------------------------------VTRL--------------F.T....A.F.----
B5I914_9ACTN/103-211-----------------------------------------------SREF--------------F.E....R.A.----
D7BB21_MEISD/9-120-----------------------------------------------FRRF--------------V.D...EV.I.----
Q7CY40_AGRFC/43-140-----------------------------------------------VIDF--------------Y.D...TV.F.----
A1SDP9_NOCSJ/7-110-----------------------------------------------VRAF--------------L.E....H.L.----
C7PD65_CHIPD/5-107-----------------------------------------------AREW--------------L.H....A.W.----
Q0W0Z9_METAR/28-139-----------------------------------------------VRRY--------------Y.E....E.FY----
Q0AK68_MARMM/36-153-----------------------------------------------ARAY--------------M.A....L.Y.----
A1T3J1_MYCVP/7-115-----------------------------------------------VRAF--------------L.K....G.M.----
B2J333_NOSP7/11-117-----------------------------------------------ARRW--------------V.E....L.I.----
Q161D9_ROSDO/27-138-----------------------------------------------IEGM--------------V.D....G.L.----
Q1D054_MYXXD/25-142-----------------------------------------------VRAF--------------T.D....A.F.----
D2Q4E8_KRIFD/10-119-----------------------------------------------VRKA--------------F.A....E.I.----
A6W6K1_KINRD/24-129-----------------------------------------------YERY--------------L.A....C.C.----
D0LM99_HALO1/203-300-----------------------------------------------LERY--------------V.D....A.F.----
A0JTQ5_ARTS2/14-118-----------------------------------------------VRRM--------------L.A....A.A.----
C6W364_DYAFD/12-123-----------------------------------------------VRRF--------------N.E...EV.I.----
C1N6Y5_MICPC/11-117-----------------------------------------------VDAY--------------F.S....A.W.----
A8EWB0_ARCB4/10-120-----------------------------------------------VKLY--------------Y.D...EL.W.----
Q5YQ81_NOCFA/15-114-----------------------------------------------VREF--------------F.A....A.M.----
C1F799_ACIC5/9-124-----------------------------------------------LAQF--------------IRQ....V.W.----
D2QMN3_SPILD/5-118-----------------------------------------------IQAY--------------I.D....A.Y.----
A7HKH6_FERNB/25-126-----------------------------------------------WEKT--------------Y.N....E.Q.----
Q5DZG2_VIBF1/16-125-----------------------------------------------IQKF--------------I.AL.YGG.L.----
A1S3V2_SHEAM/29-141-----------------------------------------------AVNY--------------I.Q....A.L.----
A0R0F0_MYCS2/85-194-----------------------------------------------LEDV--------------F.A...TT.S.----
Q2G4A7_NOVAD/14-111-----------------------------------------------VIEM--------------Y.N...KV.L.----
Q6D526_PECAS/26-129-----------------------------------------------IREF--------------Y.R....E.L.----
A5FVD4_ACICJ/16-117-----------------------------------------------AAKV--------------F.A....A.I.----
Q0U711_PHANO/9-119-----------------------------------------------LQRF--------------I.E....F.I.----
C7PMQ6_CHIPD/9-116-----------------------------------------------VTQF--------------L.T....A.V.----
D2PQZ2_KRIFD/10-123-----------------------------------------------ARRF--------------F.E...EV.F.----
Q2SB33_HAHCH/8-108-----------------------------------------------VTRF--------------Y.D....A.F.----
Q2G9Q6_NOVAD/31-145-----------------------------------------------VRGF--------------L.D....E.V.----
C8XK42_NAKMY/10-121-----------------------------------------------LRRM--------------F.D...EG.F.----
D2SBX0_GEOOG/5-109-----------------------------------------------IARL--------------R.D....A.V.----
Q39TG5_GEOMG/5-106-----------------------------------------------IKKY--------------F.E....L.V.----
B6IS60_RHOCS/17-111-----------------------------------------------VTAL--------------W.E....G.M.----
B0T5N4_CAUSK/9-117-----------------------------------------------VRDF--------------L.D....A.W.----
C6XZD6_PEDHD/13-122-----------------------------------------------VRQF--------------Y.E....A.L.----
D0LWT7_HALO1/7-120-----------------------------------------------VTSY--------------F.R....A.V.----
Q0SJC1_RHOJR/11-111-----------------------------------------------TRKL--------------L.Q....A.A.----
D0LQY4_HALO1/7-114-----------------------------------------------LTAH--------------L.E....H.V.----
Q82RJ4_STRAW/12-109-----------------------------------------------IARW--------------R.S....A.E.----
A4XCF3_SALTO/8-104-----------------------------------------------VERQ--------------L.D....A.Y.----
B1VLR8_STRGG/5-111-----------------------------------------------VDRF--------------R.A....A.V.----
Q0C649_HYPNA/6-119-----------------------------------------------IRKY--------------I.A....A.Y.----
D3EBN8_GEOS4/13-118-----------------------------------------------VSAF--------------I.E...SF.W.----
C5BR99_TERTT/13-114-----------------------------------------------FKEF--------------Y.R....D.L.----
Q1LC18_RALME/11-130-----------------------------------------------VGRW--------------F.T....E.F.----
A9F1N2_SORC5/10-120-----------------------------------------------YREY--------------V.E....AVW.----
Q7NX64_CHRVO/8-108-----------------------------------------------VQAQ--------------L.D....A.Y.----
A6Q8S5_SULNB/27-140-----------------------------------------------LNGY--------------M.N....A.W.----
Q0RTS8_FRAAA/10-121-----------------------------------------------ARRL--------------Y.E...EV.V.----
B2HF34_MYCMM/13-118-----------------------------------------------VERS--------------P.R....A.A.----
Q5LS60_RUEPO/15-118-----------------------------------------------LKEW--------------Y.A...RV.W.----
C7NL72_KYTSD/199-297-----------------------------------------------VRAY--------------L.E....A.H.----
Q0RWC3_RHOJR/94-208-----------------------------------------------VDGF--------------W.G....D.L.----
A4X2J9_SALTO/11-126-----------------------------------------------LRAL--------------Y.R....N.F.----
A9FU94_SORC5/4-110-----------------------------------------------ASEF--------------I.E....A.L.----
D5UXD3_TSUPD/41-136-----------------------------------------------VTAF--------------Y.T...EG.F.----
B7G1I9_PHATC/141-251-----------------------------------------------VKKF--------------I.A...DI.W.----
Q144S2_BURXL/14-123-----------------------------------------------IEGF--------------Y.R....A.I.----
Q0K1J6_CUPNH/7-120-----------------------------------------------VKAF--------------F.A....R.Y.----
Q096A5_STIAD/35-145-----------------------------------------------VQAF--------------A.E...EV.Y.----
Q6DAK4_PECAS/16-123-----------------------------------------------VYRI--------------L.R...EL.L.----
Q8XQ60_RALSO/19-124-----------------------------------------------VDHI--------------V.E....V.F.----
A0JX05_ARTS2/16-130-----------------------------------------------VLGF--------------V.R....A.I.----
A1TNK1_ACIAC/52-157-----------------------------------------------VYDF--------------W.R...EV.F.----
Q01R35_SOLUE/14-114-----------------------------------------------FQQF--------------V.A....A.I.----
D2AXD2_STRRD/7-110-----------------------------------------------AQKY--------------I.E....I.W.----
Q0APW6_MARMM/28-136-----------------------------------------------LDAF--------------I.T....A.I.----
Y3332_PSEAE/7-115-----------------------------------------------LVHS--------------L.R....L.L.----
Q7NP00_GLOVI/24-117-----------------------------------------------IESY--------------V.D....T.F.----
A9U6M7_PHYPA/10-103-----------------------------------------------VKSY--------------L.K....M.W.----
B6QL61_PENMQ/29-132-----------------------------------------------IRRF--------------YKD....L.W.----
Q2KTK8_BORA1/35-133-----------------------------------------------VQAF--------------F.R...LM.F.----
B2HI14_MYCMM/11-120-----------------------------------------------GRRS--------------R.E....A.V.----
Q7P1D6_CHRVO/11-112-----------------------------------------------AREW--------------I.D....A.W.----
Q1INA8_KORVE/18-129-----------------------------------------------VDEH--------------V.R....C.E.----
B6IRE4_RHOCS/14-115-----------------------------------------------YVRY--------------F.E....A.L.----
A8L6M7_FRASN/9-119-----------------------------------------------VEQV--------------R.R....M.V.----
C5CYM4_VARPS/7-110-----------------------------------------------LEAF--------------I.A....A.V.----
B0C5C2_ACAM1/10-116-----------------------------------------------ARRF--------------F.T....A.V.----
Q5YR20_NOCFA/14-119-----------------------------------------------VQAS--------------P.R....A.V.----
Q89SK5_BRADU/7-110-----------------------------------------------VEAF--------------A.K....R.L.----
B9JZV5_AGRVS/9-119-----------------------------------------------VRKL--------------I.E....E.V.----
C5CZ61_VARPS/13-119-----------------------------------------------IRAL--------------Y.E....D.WL----
B7KLH5_CYAP7/9-116-----------------------------------------------VEMF--------------F.Y....A.L.----
D7DZ07_NOSA0/16-121-----------------------------------------------FEYF--------------T.N....G.L.----
Q5YYT4_NOCFA/5-107-----------------------------------------------VAQY--------------L.E....I.W.----
Q4K710_PSEF5/11-111-----------------------------------------------VEAQ--------------L.Q....A.Y.----
Q11GL1_CHESB/10-122-----------------------------------------------IARA--------------L.A....S.F.----
B8FA80_DESAA/11-124-----------------------------------------------IEKY--------------I.A....A.Y.----
C7PKK5_CHIPD/8-113-----------------------------------------------YLNY--------------L.G....C.L.----
C7PVH9_CATAD/7-110-----------------------------------------------VTAW--------------A.A....A.W.----
Q023S0_SOLUE/22-116-----------------------------------------------LDQH--------------W.A....A.S.----
B0T2P8_CAUSK/7-113-----------------------------------------------AADL--------------V.A....L.C.----
A4FLI3_SACEN/9-124-----------------------------------------------YRRW--------------L.P....G.L.----
Q1GVF6_SPHAL/12-129-----------------------------------------------VRRH--------------M.A....L.E.----
A5VGC4_SPHWW/32-139-----------------------------------------------VTAF--------------L.A....Q.C.----
Q67LR1_SYMTH/49-143-----------------------------------------------VTRF--------------F.H....M.C.----
Q1GGN5_RUEST/7-110-----------------------------------------------LKYW--------------F.E...EV.W.----
Q7N5H3_PHOLL/10-114-----------------------------------------------VRRF--------------Y.D........----
C5ANY4_BURGB/9-119-----------------------------------------------VREF--------------Y.E...QV.W.----
A0JTF8_ARTS2/8-119-----------------------------------------------LRRF--------------Y.E...EV.L.----
B0UQZ5_METS4/10-111-----------------------------------------------IRAM--------------F.E....A.F.----
B2FKH0_STRMK/10-123-----------------------------------------------IEHY--------------L.Q....A.Y.----
Q28P04_JANSC/192-309-----------------------------------------------VLDM--------------H.N....A.L.----
D0LQN7_HALO1/43-156-----------------------------------------------VQNF--------------Y.D....L.L.----
C6WH72_ACTMD/42-148-----------------------------------------------FDRW--------------N.T....S.L.----
A4VFV4_PSEU5/16-125-----------------------------------------------HDAF--------------E.Q....A.I.----
B9JGC5_AGRRK/8-110-----------------------------------------------AERY--------------I.A....V.W.----
Q28SU5_JANSC/41-153-----------------------------------------------VLRL--------------F.D...EG.W.----
A5FDF3_FLAJ1/20-129-----------------------------------------------IERF--------------Y.A....A.W.----
D2QKG8_SPILD/51-161-----------------------------------------------LTDF--------------V.G....A.L.----
Q2RYS6_SALRD/468-568-----------------------------------------------VFQL--------------H.N....A.Y.----
Q7U6B9_SYNPX/19-120-----------------------------------------------ARMA--------------E.N....A.W.----
A1T202_MYCVP/12-136-----------------------------------------------AARW--------------A.N....A.L.----
C0Z8U2_BREBN/10-123-----------------------------------------------IENY--------------V.Q....A.Y.----
Q5WJ97_BACSK/7-113-----------------------------------------------LEAY--------------I.N....A.T.----
Q4K7Y4_PSEF5/14-123-----------------------------------------------IDNW--------------Q.Q....A.V.----
B9K0R3_AGRVS/19-126-----------------------------------------------VREF--------------Y.R...RV.F.----
A2SP57_METPP/26-134-----------------------------------------------VSGY--------------A.L....G.W.----
D7B2K3_NOCDD/208-308-----------------------------------------------LDRY--------------V.D....A.F.----
Q2G5Y7_NOVAD/7-112-----------------------------------------------AKAM--------------I.A....A.Y.----
A9WET4_CHLAA/10-121-----------------------------------------------IRRF--------------VKE....V.L.----
B4RFA6_PHEZH/12-124-----------------------------------------------IDEH--------------F.A....F.E.----
B1YHC8_EXIS2/7-115-----------------------------------------------LDRY--------------F.D....L.F.----
Q01XW8_SOLUE/26-133-----------------------------------------------DAQW--------------S.K....A.A.----
A5FF04_FLAJ1/226-327-----------------------------------------------VENH--------------L.K....I.W.----
Q7N5R6_PHOLL/8-109-----------------------------------------------TAEL--------------L.S....S.M.----
D2SF32_GEOOG/10-120-----------------------------------------------VEEM--------------L.R....R.Q.----
D2QKG9_SPILD/49-156-----------------------------------------------VGDL--------------L.D....A.L.----
D3SG09_THISK/73-180-----------------------------------------------FDAW--------------N.D....A.L.----
Q6MQX3_BDEBA/10-106-----------------------------------------------VQGQ--------------L.E....A.Y.----
A9F1I8_SORC5/106-215-----------------------------------------------LLTF--------------Y.R....A.F.----
D3PMI5_MEIRD/6-117-----------------------------------------------YDEY--------------I.R....R.F.----
A8I8N5_CHLRE/87-201-----------------------------------------------AVKF--------------Y.H....L.S.----
Q5NR56_ZYMMO/9-110-----------------------------------------------VRQV--------------F.E....T.L.----
Q0C1I4_HYPNA/38-144-----------------------------------------------VDAF--------------A.A....A.L.----
B5HCB5_STRPR/12-122-----------------------------------------------IERW--------------A.D....A.V.----
B2HE10_MYCMM/16-127-----------------------------------------------VRHY--------------T.TVVEGC.S.----
B7G7G0_PHATC/222-327-----------------------------------------------FHLW--------------N.D....A.L.----
A8GD70_SERP5/44-162-----------------------------------------------AEFY--------------W.R....S.L.----
C7QAG6_CATAD/10-122-----------------------------------------------VEKA--------------I.G....I.L.----
A5FAS7_FLAJ1/7-104-----------------------------------------------AQNF--------------L.K...LA.A.----
Q21ST0_RHOFT/17-124-----------------------------------------------LRAL--------------N.D....A.W.----
Q5FU45_GLUOX/16-117-----------------------------------------------IRDM--------------F.T....M.F.----
D7B8A1_NOCDD/24-135-----------------------------------------------VETY--------------M.N....T.R.----
A8J8F4_CHLRE/267-381-----------------------------------------------VELY--------------F.H....T.Y.----
Q7UYI8_RHOBA/149-257-----------------------------------------------IHQW--------------S.T....A.L.----
Q0RQ61_FRAAA/35-150-----------------------------------------------AVQW--------------L.K....A.F.----
Q2W516_MAGSA/7-130-----------------------------------------------MQGY--------------K.A....A.W.----
A5G225_ACICJ/10-127-----------------------------------------------WEAH--------------C.R...YE.F.----
Q7KPV8_CAEEL/16-120-----------------------------------------------FEAY--------------S.K....A.V.----
A6WAE9_KINRD/9-131-----------------------------------------------AVRL--------------F.E....V.L.----
A4VGJ2_PSEU5/10-121-----------------------------------------------VRQH--------------I.D...LT.W.----
C8X7I4_NAKMY/10-121-----------------------------------------------IAR.--------------I.D....A.L.----
B5HVQ1_9ACTN/52-162-----------------------------------------------FTTW--------------N.A....A.L.----
B6QRJ3_PENMQ/14-121-----------------------------------------------LEDF--------------H.K....H.M.----
B2FS27_STRMK/53-161-----------------------------------------------AERF--------------N.R....A.L.----
Q89CA0_BRADU/26-125-----------------------------------------------NRDY--------------V.A....S.V.----
Q82PT2_STRAW/13-123-----------------------------------------------ADAL--------------V.A....A.F.----
B0UAU1_METS4/29-133-----------------------------------------------NAEF--------------E.S....A.F.----
A8N708_COPC7/26-128-----------------------------------------------VINY--------------Y.T....A.F.----
C6WNT0_ACTMD/15-117-----------------------------------------------VLEH--------------L.E....A.E.----
Q74BD7_GEOSL/66-172-----------------------------------------------LGEF--------------D.H....A.F.----
B1MAG0_MYCA9/29-157-----------------------------------------------ASTW--------------F.D....A.W.----
B1W484_STRGG/11-119-----------------------------------------------VLEY--------------F.E....R.V.----
B2HT68_MYCMM/15-114-----------------------------------------------VNRY--------------M.S....V.L.----
B4ELH6_BURCJ/39-136-----------------------------------------------VLAF--------------Y.E...KG.L.----
B4EM94_BURCJ/9-110-----------------------------------------------IQRF--------------Y.T....A.F.----
C0ZSH3_RHOE4/57-155-----------------------------------------------VTDF--------------Y.E...LA.F.----
C0ZUW8_RHOE4/11-107-----------------------------------------------VEDY--------------V.K....Y.L.----
C1A207_RHOE4/8-107-----------------------------------------------.TDF--------------C.A....L.W.----
C3KP75_RHISN/30-139-----------------------------------------------...F--------------Y.A....A.E.----
D4ZDV5_SHEVD/27-130-----------------------------------------------VEGF--------------I.A....A.Y.----
D7BSM4_STRBB/12-130-----------------------------------------------.REH--------------S.R....R.L.----
G2NZK4_STRVO/13-110-----------------------------------------------..EY--------------A.R....R.M.----
G2NZK5_STRVO/16-131-----------------------------------------------....--------------..R....R.M.----
G8PMR8_PSEUV/42-153-----------------------------------------------.AAF--------------Y.E....V.A.----
G8PNR5_PSEUV/31-139-----------------------------------------------..KF--------------Y.E....V.A.----
M1FFV3_9ALTE/24-124-----------------------------------------------.REL--------------F.N....T.L.----
O06820_MYCTU/10-109-----------------------------------------------VEGF--------------A.D....F.W.----
Q0RMU9_FRAAA/11-107-----------------------------------------------....--------------..V....A.I.----
Q0S498_RHOJR/22-121-----------------------------------------------VRAF--------------L.D....A.L.----
Q0SA13_RHOJR/47-144-----------------------------------------------.TSW--------------N.D....A.L.----
Q0SAM4_RHOJR/12-111-----------------------------------------------VERY--------------I.E....A.V.----
Q63P16_BURPS/8-114-----------------------------------------------VRES--------------Y.E....A.F.----
Q67TV4_ORYSJ/71-167-----------------------------------------------VRAF--------------Y.D....G.V.----
Q73X32_MYCPA/11-110-----------------------------------------------VNRY--------------L.A....L.V.----
Q7MG68_VIBVY/11-132-----------------------------------------------VREY--------------F.S....A.M.----
Q7SFH5_NEUCR/300-405-----------------------------------------------..DY--------------I.A....C.I.----
Q88EB0_PSEPK/13-117-----------------------------------------------IERW--------------M.Q....A.V.----
Q8F037_LEPIN/9-109-----------------------------------------------.KEF--------------Y.E....A.F.----
Q8PDF7_XANCP/13-124-----------------------------------------------VQAY--------------Y.E....A.F.----
Q9A5Z0_CAUCR/10-110-----------------------------------------------AQRF--------------V.A....A.I.----
Q9A6F0_CAUCR/10-117-----------------------------------------------IRRV--------------Y.A....A.L.----
Q9A8Y8_CAUCR/11-113-----------------------------------------------.TQL--------------Y.E....A.F.----
Q9HS78_HALSA/7-104-----------------------------------------------VTAY--------------Y.D....A.V.----
Q9KSY8_VIBCH/9-112-----------------------------------------------VAQF--------------Y.Q....Q.L.----
R5F452_9CLOT/94-205-----------------------------------------------.RHT--------------Y.D....I.W.----

PF07858

Q8XW85_RALSO/2-128-----------------------------------------PTPLETVSHF--------------C-A----A-F-----
Q9A482_CAUCR/6-128-----------------------------------------PSPAQVVRAF--------------M-K----A-M-----
Q8XW86_RALSO/2-128-----------------------------------------STPIEIVTAF--------------C-A----T-F-----
EPHG_MYCTU/15-135-----------------------------------------TEAIRAVEAF--------------L-N----A-L-----
Q73W09_MYCPA/9-129-----------------------------------------VANTRTVEGF--------------L-N----A-L-----
Q9CCC2_MYCLE/30-150-----------------------------------------.ENIRTVEVF--------------L-A----A-L-----

PF10184

A0ZAJ9_NODSP/1-107-----------------------------------------MDIIEILKQD--------------Y-Q----R.F-----
A0ZEU7_NODSP/8-120-----------------------------------------EQVIKTLEED--------------F-P----TLF-----
A3KPX0_DANRE/247-372-----------------------------------------ALMHEKLRVE--------------L-P----RFF-----
A4RYB4_OSTLU/40-152-----------------------------------------ARMRKALAED--------------L-T----HLF-----
A7RV61_NEMVE/173-295-----------------------------------------ATVFLALRDE--------------L-P----LFF-----
O82347_ARATH/89-201-----------------------------------------GHAVRSIREE--------------F-P----LLF-----
P74420_SYNY3/15-121-----------------------------------------DRILTILQQD--------------Y-A----N.F-----
Q0DJX6_ORYSJ/116-228-----------------------------------------GDAIRALREE--------------L-P----AAF-----
Q10VR9_TRIEI/4-116-----------------------------------------QQVIERLKLD--------------L-P----TLF-----
Q11AD5_TRIEI/1-107-----------------------------------------MDIISRLKQD--------------Y-Q----K.F-----
Q2JJ41_SYNJB/11-117-----------------------------------------ADLVAILRAD--------------Y-A----R.F-----
CF136_HUMAN/149-274-----------------------------------------SVMYERLRQE--------------L-P----KLF-----
Q69VD1_ORYSJ/67-177-----------------------------------------ERLAEFLRED--------------L-P----HLF-----
Q7NHQ0_GLOVI/5-111-----------------------------------------MDILEILKAD--------------Y-Q----R.F-----
Q7PFX4_ANOGA/132-264-----------------------------------------HRVYHVLSQT--------------L-P----KLF-----
Q8VZ90_ARATH/62-172-----------------------------------------EELVGFLYED--------------L-P----HLF-----
Q8YTL6_NOSS1/1-107-----------------------------------------MKIIEILKQD--------------Y-Q----R.F-----
Q94K63_ARATH/78-191-----------------------------------------DDVMGILRSD--------------Y-R----NFY-----
Q9SA31_ARATH/87-199-----------------------------------------GVAVRTLRED--------------L-P----LLF-----
B1WUH0_CYAA5/2-107-----------------------------------------.KLLETIKND--------------Y-Q----T.F-----
B8JJ69_MOUSE/150-274-----------------------------------------.VMHERLRQE--------------L-P----TLF-----
Q31NT1_SYNE7/7-112-----------------------------------------.DLLETLRQD--------------Y-A----R.F-----
Q7XLD2_ORYSJ/92-203-----------------------------------------.TAVRTLRDD--------------L-P----AVF-----
Q9W1F2_DROME/84-215-----------------------------------------.RAYEVLRTT--------------L-P----KLF-----

PF07080

B1LSK3_METRJ/3-144--------------------------------RPPLPPFD.EQSAITKVRL--------------AED----G-W-----
B8ERM2_METSB/7-147--------------------------------.LPLPPFT.AESAVEKIRL--------------AEN----G-W-----
D7C7X3_STRBB/6-147--------------------------------RPPFPPFT.RESAIEKVRA--------------AED----G-W-----
A8HSN6_AZOC5/11-152--------------------------------RPPLPPFT.AETASLKARM--------------AED----A-W-----
G7DX40_MIXOS/2-131--------------------------------......FT.HSSAQAKVKA--------------AQR----L-W-----
B2ILG8_BEII9/4-143--------------------------------..LVPPFT.FETATAKVRF--------------AED----A-W-----
A9HBR6_GLUDA/3-144--------------------------------RPPLPPFD.AETAALKTRL--------------AED----A-W-----
S3BYH4_OPHP1/13-151--------------------------------RPPVPPFT.QETAHKKVKA--------------AQD----A-W-----
Q7ULD7_RHOBA/9-146--------------------------------....PPFT.SESAIQKVRA--------------AED----A-W-----
Q7V2T4_PROMP/4-145--------------------------------KPPIPPFN.FETAIKKVRL--------------AEN----A-W-----
B2IKS1_BEII9/5-145--------------------------------.LPLPPFD.TASAAAKVRL--------------AED----A-W-----
B8GEL7_METPE/7-147--------------------------------.LPLPPFS.FETAVEKVRM--------------AED----G-W-----
J4G7Y6_FIBRA/6-142--------------------------------...KPPFT.AATAEQKVKL--------------AQN----L-W-----
R4LE54_9ACTN/2-140--------------------------------RPPVPPFT.RESALAKVQA--------------AED----A-W-----
D2VSI5_NAEGR/4-136--------------------------------..ILPPFT.LETAQKKVKL--------------AQD----N-W-----
E2LUP3_MONPE/4-137--------------------------------...RPPFT.LGSAIDKVKI--------------AQK----L-W-----
L8GCZ6_PSED2/11-144--------------------------------RPPYPPFT.LETAKQTVKA--------------AQA----A-W-----
Q5NPJ1_ZYMMO/5-147--------------------------------RPPFPPFLKKEAAAEKVRR--------------AED----A-W-----
U4L3Z6_PYROM/5-144--------------------------------...FPPFT.AETAKAKVKA--------------AQN----L-W-----
Q5LKF9_RUEPO/3-144--------------------------------RPPLPPFT.AETAAEKVRL--------------AEN----G-W-----
F6IE59_9SPHN/9-150--------------------------------RPPLPPFS.AASAADKVQA--------------AED----G-W-----
A4SXK9_POLSQ/6-145--------------------------------..PLPPFT.KETAIQKIRM--------------AED----A-W-----
B0C3H8_ACAM1/7-148--------------------------------KPPLPPFD.IESATAKVRF--------------AED----A-W-----
K9VV28_9CYAN/4-139--------------------------------KPPLPPFT.LETAKAKVQA--------------AED----A-W-----
G8TDI0_NIAKG/7-136--------------------------------....PPFT.RETALAKVKL--------------AED----A-W-----
G8S011_ACTS5/13-151--------------------------------RHPLPPFT.VDTARAKVQA--------------AED----A-W-----
A7IEF3_XANP2/4-145--------------------------------RPPLPPFT.VETAAQKARL--------------AED----A-W-----
S5T289_9CORY/4-145--------------------------------RPPFPPFT.AETAAQKARG--------------AED----A-W-----
Q885A5_PSESM/6-147--------------------------------RPPLPPFT.LETAIQKVRG--------------AED----G-W-----
C5CRQ3_VARPS/4-139--------------------------------RPPLPPFT.LETATKKVQA--------------AED----A-W-----
A8GGW9_SERP5/4-145--------------------------------KPPLPPFT.RESAIEKVRL--------------AED----A-W-----
H1VKH9_COLHI/8-137--------------------------------RPPFPPFT.EATAKAKVKA--------------AQD----A-.-----
C9SC71_VERA1/6-139--------------------------------KPPCPPFT.AETARIKVKA--------------AQD----A-W-----
A4AWU7_MARSH/5-136--------------------------------...TPPFN.NESAAAKVQA--------------AED----A-W-----
G0S1P6_CHATD/5-138--------------------------------KPPFPPFT.WEEAHQKVKA--------------AQA----A-W-----
A6TFT2_KLEP7/5-146--------------------------------RPPLPPFT.RDSAIQKVRA--------------AED----G-W-----
I3TTF4_TISMK/2-143--------------------------------RPPIPPFT.AEAAALKVRA--------------AED----G-W-----
F0XKI1_GROCL/3-145--------------------------------.PPVPPFT.LETAEKKVKA--------------AQD----A-W-----
H5WUV2_9BURK/4-145--------------------------------KPPLPPFT.AESAAQKVRG--------------AED----A-W-----
B2J4W5_NOSP7/43-183--------------------------------.LPLPPFD.NESAIQKVRI--------------AED----A-W-----
I1XFA4_METNJ/7-148--------------------------------KPPFPPFT.LETAKQKVRM--------------AED----G-W-----
Q22CF4_TETTS/39-179--------------------------------..LVPPFT.LETAIKKVRL--------------AED----N-W-----
L0D9F8_SINAD/3-142--------------------------------...VPPFT.RESAIQKVRM--------------AED----A-W-----
Q13SF9_BURXL/8-149--------------------------------RPPLPPFT.RETAIQKVRA--------------AED----G-W-----
B0SVP8_CAUSK/2-143--------------------------------RPPLPPFT.QDTARLKVQA--------------AED----G-W-----
J9ZA59_LEPFM/171-312--------------------------------RPPFPPFT.QETAKLKVRM--------------AED----A-W-----
B2HLU4_MYCMM/8-145--------------------------------RPPFPPFT.FETATQKVQA--------------AED----A-W-----
B6JDE8_OLICO/4-144--------------------------------.PLVPPFT.FDTATAKVRM--------------AED----G-W-----
Q0SDQ5_RHOJR/4-146--------------------------------RPPVPPFT.RDTAIAKVRA--------------AED----G-W-----
K9P7V3_CYAGP/12-153--------------------------------RPPFPPFD.AESAATKVRL--------------AED----A-W-----
E8UXY2_TERSS/9-148--------------------------------..LVPPFT.RETAIAKVRK--------------AED----G-W-----
A1TEA6_MYCVP/5-143--------------------------------RPPFPPFD.LTTALQKVQA--------------AED----A-W-----
H3G8D3_PHYRM/7-149--------------------------------RPPVPPFT.RESAALKVRA--------------AED----A-W-----
B5HC01_STRPR/5-139--------------------------------RPPFPPFD.LDSALAKVQA--------------AED----A-W-----
D8J274_HERSS/4-146--------------------------------RPPLPPFT.RETAIEKVRL--------------AEN----G-W-----
A9CLA1_AGRFC/3-144--------------------------------RPPVPPFT.CKTAIEKVRL--------------AED----G-W-----
U9U4M7_RHIID/3-136--------------------------------QPIVPPFT.KETANLKVKN--------------AQN----L-W-----
R7YWN8_CONA1/3-136--------------------------------..LIPPFS.AGTAQAKVKK--------------AQD----L-W-----
D5SQM6_PLAL2/13-153--------------------------------..LVPPFT.QETALRKVRL--------------AED----S-W-----
B2VFK9_ERWT9/4-145--------------------------------RPPLPPFT.RESAIEKVRL--------------AED----G-W-----
G2XW21_BOTF4/6-139--------------------------------KPPVPPFT.EETARIKVKA--------------AQD----V-W-----
G0QZB1_ICHMG/9-148--------------------------------K...PPFT.LETAIKKVRI--------------AEN----A-W-----
B2GL83_KOCRD/106-244--------------------------------RNPIPPFT.AKTAARKVQA--------------AED----A-W-----
Q5YSZ9_NOCFA/2-140--------------------------------RPPLPPFD.RTAALAKVRA--------------AEH----A-W-----
C1D428_DEIDV/3-144--------------------------------RPPLPPFT.IHTARDKVRL--------------AED----A-W-----
Q54IV5_DICDI/7-149--------------------------------..PVPPFNNIEDAIKKVRM--------------AED----A-W-----
V5X9V4_MYCNE/4-146--------------------------------KPPVPPFT.DESAALKVRL--------------AED----A-W-----
K0CAH5_ALCDB/6-147--------------------------------RPPLPPFT.RDSAIEKVRL--------------AED----G-W-----
Q7N4C4_PHOLL/8-149--------------------------------RQPVPPFT.RETAIQKVRL--------------AED----G-W-----
H5X2U0_9PSEU/4-142--------------------------------RPPFPPFD.ETTAAQKVQA--------------AED----A-W-----
D8PXS5_SCHCM/5-141--------------------------------.PLVPPFT.EETARAKVKI--------------AQN----L-W-----
Q9EWS6_STRCO/6-144--------------------------------RPPLPPFT.RETAERKVRA--------------AED----A-W-----
D7A7G0_STAND/5-147--------------------------------RPPLPPFT.RETAIQKVRG--------------AED----G-W-----
Q89E77_BRADU/3-145--------------------------------RPPLPPFT.RETAAQKARM--------------AED----A-W-----
W5TP00_9NOCA/5-143--------------------------------RPPLPPFT.PETAPVKVQA--------------AED----A-W-----
D4Z2H4_SPHJU/1-139--------------------------------...MPPFT.RESAIEKIRK--------------AED----A-W-----
U7PTH1_SPOS1/14-164--------------------------------RPPFPPFT.RETAEKKVKA--------------AQD----A-W-----
Q98G19_RHILO/5-146--------------------------------RPPLPPFT.AETAAQKARM--------------AED----A-W-----
D2R1I3_PIRSD/5-144--------------------------------R...PPFT.LETATAKVRA--------------AED----A-W-----
E8WVZ4_GRATM/7-146--------------------------------..LVPPFT.METAKAKVRK--------------AED----G-W-----
X5DM97_9CORY/10-144--------------------------------RPPLPPFT.RENAVAKVQA--------------AED----A-W-----
F0YBN4_AURAN/19-160--------------------------------RPPLPPFT.LESAVQKVRA--------------AED----A-W-----
W0AHH8_9SPHN/3-144--------------------------------RPPLPPFT.HDSAVQKVRL--------------AED----G-W-----
G4QL15_GLANF/4-145--------------------------------RPPVPPFD.HASATQKVRL--------------AED----G-W-----
Q0BTU2_GRABC/10-152--------------------------------RPPLPPFS.WEDAVKKVRA--------------AED----A-W-----
G0A5W1_METMM/4-145--------------------------------KPPLPPFT.EETAAQKVRM--------------AED----A-W-----
E3RSR6_PYRTT/4-136--------------------------------...SPPFT.EEIAHTKVKK--------------AQD----L-W-----
B9JD81_AGRRK/3-144--------------------------------TPLIPPFT.RETAIAKVRM--------------AED----G-W-----
F4CJE3_PSEUX/3-141--------------------------------RPPFPPFD.AAGAAKKVQA--------------AED----A-W-----
S8EP88_FOMPI/6-139--------------------------------....PPFT.LETAREKVKI--------------AQR----L-W-----
U5VZT1_9ACTN/7-144--------------------------------RPPLPPFD.EAGARAKVQA--------------AED----A-W-----
G8MBF7_9BURK/4-145--------------------------------KPPFPPFD.EESAKLKVRL--------------AED----A-W-----
M5BXI4_THACB/11-144--------------------------------..LVPPFT.EETARAKVKT--------------AQH----L-W-----
C7JB99_ACEP3/3-144--------------------------------RPPFPPFD.IESATRKVRL--------------AED----A-W-----
H6R3X0_NOCCG/2-140--------------------------------RPPLPPFD.RSSAEAKVRA--------------AED----A-W-----
M5ED51_MALS4/5-143--------------------------------...APPFT.LESATQKVRE--------------YEN----Y-W-----
G9N5Z7_HYPVG/7-140--------------------------------RPPYPPFT.AETAQKKVKA--------------AQD----A-W-----
E2Q788_STRC2/27-168--------------------------------KPPVPPFT.RETAAEKARL--------------AED----A-W-----
B1ZPU1_OPITP/4-139--------------------------------RPPLPPFT.EATARQKVQA--------------AED----A-W-----
Q15WT6_PSEA6/4-145--------------------------------RPPLPPFN.EQSAMEKVRL--------------AED----G-W-----
K3X756_PYTUL/14-156--------------------------------RGPLPPFT.RESAAIKVRA--------------AED----A-W-----
D0L163_HALNC/4-145--------------------------------KPPVPPFD.VESATQKVRL--------------AED----A-W-----
A2SLJ7_METPP/6-147--------------------------------RPPVPPFT.VESASRKVRL--------------AED----A-W-----
A1R1Y4_ARTAT/3-145--------------------------------RPPFPPYT.EATAIQKVRA--------------AED----G-W-----
Q9HTG9_PSEAE/5-146--------------------------------RPPLPPFT.AETAAQKVRA--------------AED----G-W-----
I0IPS3_LEPFC/8-149--------------------------------RPPFPPFT.KETALQKVRM--------------AED----G-W-----
B0UGB1_METS4/5-146--------------------------------RPPLPPFT.AETASRKARA--------------AED----A-W-----
E3J6U8_FRASU/6-147--------------------------------RPPLPPFT.AQSAREKVRK--------------AED----A-W-----
M7T297_EUTLA/9-142--------------------------------KPPYPPFT.AETAQIKVKT--------------AQD----A-W-----
C7Z2B0_NECH7/5-138--------------------------------KPPLPPFT.RETAQIKVKA--------------AQD----A-W-----
H5WPP8_9BURK/3-144--------------------------------RPPLPPYS.LEAAIQKVRL--------------AED----A-W-----
G8PVW6_PSEUV/16-157--------------------------------RPPLPPFT.RETASAKIRA--------------AED----G-W-----
A0QXH1_MYCS2/44-186--------------------------------TPLVPPFA.SATAIAKVRA--------------AEN----L-W-----
M2MCV5_BAUCO/3-135--------------------------------...APPFN.AETAQQRVKK--------------AQD----L-W-----
F0ZYB6_DICPU/10-150--------------------------------..PVPPFS.LESAIEKVRK--------------AED----A-W-----
B7FPL0_PHATC/7-147--------------------------------.APFPPFT.RETAIQKIRL--------------AED----A-W-----
M9R4P9_9RHOB/4-146--------------------------------RPPIPPFS.YSDAVQKVRM--------------AEN----A-W-----
K9Z981_CYAAP/4-141--------------------------------KPPFPPFN.LETAQQKVQM--------------AED----A-W-----
K5W331_PHACS/5-139--------------------------------...YPPFT.RETAIRKVKA--------------GQD----L-W-----
Q55953_SYNY3/3-145--------------------------------TPLVPPFT.KEIAIAKVRM--------------AEN----A-W-----
D3VFP0_XENNA/15-155--------------------------------.APFPPFT.YETAIQKVRM--------------AED----A-W-----
X4ZP44_9BORD/5-146--------------------------------RPPLPPFS.HESAVLKVRA--------------AED----A-W-----
J7Q4K9_METSZ/3-144--------------------------------RPPLPPFT.LETATQKVRM--------------AED----A-W-----
G8NNR6_GRAMM/8-147--------------------------------..LVPPFD.RDTAAQKVRK--------------AED----G-W-----
F5Z8Z6_ALTSS/2-143--------------------------------RPPLPPFT.KETAIEKIRL--------------AED----A-W-----
A1SY21_PSYIN/11-152--------------------------------RKPLPIFS.KEEAILKARL--------------AED----A-W-----
Q21GU9_SACD2/13-154--------------------------------RSPLPPFT.REDALQKVRM--------------AEN----A-W-----
Q21F42_SACD2/3-144--------------------------------RPPLPPFN.EETAKRKIRL--------------AED----G-W-----
V9VX09_9RHOB/6-147--------------------------------RPPLPPFT.RETAIAKVRA--------------AED----G-W-----
Q5KH63_CRYNJ/33-166--------------------------------.PPLPPFN.DETAHKSV..--------------AST----Y-P-----
Q1GQL6_SPHAL/3-142--------------------------------RPPLPPFD.AVSAARKVRL--------------AED----G-W-----
C0ZND5_RHOE4/4-146--------------------------------RAPIPPFT.HETAVQKVRL--------------AED----G-W-----
C5BRE0_TERTT/11-152--------------------------------REPLPPFT.RDTAIKKIRL--------------AED----A-W-----
B1MD11_MYCA9/3-141--------------------------------RPPLPPFD.IETAHQKVRA--------------AEN----A-W-----
M2QHK1_CERS8/5-140--------------------------------...APPFT.RETALQKVKA--------------AQR----L-W-----
E4N6H5_KITSK/5-143--------------------------------RPPHPPFT.RATALAKVQA--------------AED----A-W-----
Q47FW0_DECAR/5-146--------------------------------KPPLPPFT.AETATQKVRL--------------AED----A-W-----
Q2S7F5_HAHCH/11-143--------------------------------..PVPPFT.EASARAKVKM--------------AED----A-W-----
B0CZ00_LACBS/4-135--------------------------------..ILPPFC.ADTAHKKVKA--------------AQA----L-W-----
K9WB99_9CYAN/25-158--------------------------------RPPLPPFT.LETAKAKVQA--------------AED----A-W-----
D3B3X0_POLPA/7-146--------------------------------..PIPPFD.DVTAREKVRL--------------AED----A-W-----
H6RTK1_BLASD/3-141--------------------------------RPPFPPFT.LETARQKVQA--------------AED----G-W-----
I4F4V6_MODMB/4-137--------------------------------RPPLPPFT.AETAAQKVQA--------------AED----A-W-----
C6WWQ1_METML/8-149--------------------------------KPPLPPFT.RETAAQKVRL--------------AED----G-W-----
K2SA46_MACPH/4-136--------------------------------...APPFT.RETAHAKVKK--------------AQD----L-W-----
N0BCT9_9RHIZ/4-145--------------------------------RPPLPPFT.RETAAQKVRG--------------AED----A-W-----
G3JBC0_CORMM/6-139--------------------------------KPPFPPFT.LETAKIKVKA--------------AQD----A-W-----
F5YW52_MYCSD/4-135--------------------------------..PCPPFD.AESARRKVRA--------------AED----A-W-----
A0R5M4_MYCS2/6-147--------------------------------RPPLPPFT.TETAAQKVRL--------------AED----A-W-----
Q7NUJ9_CHRVO/4-145--------------------------------RPPLPPFT.RETAIEKIRL--------------AED----G-W-----
K7SXB6_GLUOY/4-145--------------------------------RPPLPPFT.REAAIQKVRA--------------AED----A-W-----
E6WG68_PANSA/2-141--------------------------------..LIPPFD.EQSATQKVRM--------------AED----A-W-----
R4STA4_AMYOR/5-143--------------------------------RPPYPPFT.RETALRKVQA--------------AED----A-W-----

PF02136

NTF2_ARATH/9-123------------------------------------------VSKAFVEHY--------------Y-S----T-F-----
Q9M2S5_ARATH/166-285------------------------------------------ESAGFVKVY--------------Y-E----L-P-----
Q9AK31_STRCO/205-316------------------------------------------EQQKLLERY--------------V-A----A-F-----
O53486_MYCTU/8-130------------------------------------------ELLAAVERS--------------P-Q----A-A-----
Q9LDI9_ARATH/13-128------------------------------------------IAAEFVRQY--------------Y-H----V-L-----
Q9FND0_ARATH/11-125------------------------------------------VGSYFVGQY--------------Y-Q----V-L-----
Q9LMX6_ARATH/15-131------------------------------------------IGNSFVEKY--------------Y-N----L-L-----
NTF2_ORYSJ/6-119------------------------------------------VAKAFVEHY--------------Y-R----T-F-----
NTF2_YEAST/8-121------------------------------------------LAQNFTQFY--------------Y-N----Q-F-----
G3BP2_MOUSE/11-133------------------------------------------VGREFVRQY--------------Y-T----L-L-----
NTF2_RAT/10-121------------------------------------------IGSSFIQHY--------------Y-Q----L-F-----
OCP_SYNY3/193-308------------------------------------------VTNATVLNY--------------M-D----N-L-----
Q9A8Y8_CAUCR/127-234------------------------------------------GVDRLLRRL--------------Y-D----A-I-----
NTF2_CAEEL/10-128------------------------------------------VAKAFIQHY--------------Y-S----K-F-----
NXT1_MOUSE/16-135------------------------------------------AAEEFVNVY--------------Y-T----T-M-----
G3BP_SCHPO/18-134------------------------------------------IGWMFVQEY--------------Y-T----Y-L-----
NTF2_NEUCR/8-121------------------------------------------IATQFVAHY--------------Y-S----T-F-----
NXT2_HUMAN/17-136------------------------------------------AAEEFVNIY--------------Y-E----T-M-----
Q9M2S5_ARATH/32-154------------------------------------------LANCFLQSY--------------F-L----N-L-----
G3BP1_MOUSE/11-133------------------------------------------VGREFVRQY--------------Y-T----L-L-----
Q21351_CAEEL/36-143------------------------------------------VGGAFCHQF--------------Y-I----T-V-----
Q9ZPR2_ARATH/15-131------------------------------------------VGNGFVQEY--------------Y-N----H-L-----
NXF1_RAT/385-535------------------------------------------LVLHFLQQY--------------Y-A----I-Y-----
Q9C9I5_ARATH/70-192------------------------------------------SASEVVSSF--------------Y-A----A-V-----
NXT1_CAEEL/19-135------------------------------------------ESKKFMDVY--------------Y-D----V-M-----
NTF2_SCHPO/7-120------------------------------------------LATQFTQFY--------------Y-Q----T-F-----
NTF2_YARLI/8-121------------------------------------------LAKQFCEFY--------------Y-Q----T-F-----
Q9VRD6_DROME/10-124------------------------------------------IGKGFVQQY--------------Y-A----I-F-----
BRE5_YEAST/8-140------------------------------------------ICFAFLQNY--------------Y-E----R-M-----
NXT1_DROME/15-130------------------------------------------TADTFTRLY--------------Y-A----S-V-----
Q9FME2_ARATH/15-131------------------------------------------VGRAFVEQY--------------Y-H----I-L-----
B4R173_DROSI/16-129------------------------------------------VGREFVRQY--------------Y-T----L-L-----
D0J389_COMT2/2-115------------------------------------------..TAVVQRY--------------V-A----A-L-----
F4JED3_ARATH/281-394------------------------------------------VGDEFARQY--------------Y-N----T-L-----
F4JED3_ARATH/948-1060------------------------------------------....FSEHY--------------Y-N----N-L-----
I6WZD7_MYCTU/11-135------------------------------------------...IASQSS--------------W-R----C-V-----
Q84JH2_ARATH/16-133------------------------------------------VGSAFVNQY--------------Y-Y----I-F-----
Q8VYJ4_ARATH/19-135------------------------------------------VGNAFVPQY--------------Y-H----I-L-----

PF03284

PHZA2_PSEAE/1-162--------------------------------MREYQRLKGFTDNLELRRR--------------NRA----T-V-----
C5AHF3_BURGB/12-165--------------------------------E........NHAHAAVRQH--------------NRK----I-V-----
PHZB2_PSEAE/1-162--------------------------------MLDNAIPQGFEDAVELRRK--------------NRE----T-V-----
M4RPB3_9BIFI/2-155--------------------------------T........FEDDQTRREH--------------NRA----V-V-----

PF10429

Q6CF15_YARLI/5-151-----------------------------NGPTQQQVTHTVTNTESFLRQF--------------F-K----A-L-----
Q6CWP0_KLULA/2-178-----------------------------NRQPQI........VETFVKKV--------------L-A----H-L-----
MTR2_YEAST/13-184-----------------------------ANQAQI........TATFTKKI--------------L-A----H-L-----
Q757C4_ASHGO/6-167-----------------------------AGHSQA........AETFVKKL--------------L-A----H-L-----
Q6BMR4_DEBHA/2-178-----------------------------SNIQRD........PKPYLKKI--------------L-S----S-L-----
Q6FWG2_CANGA/8-183-----------------------------NSQYHL........IDIFVKKV--------------L-A----H-L-----

PF07107

WUN1_SOLTU/1-105-----------------------------------------------MQIL--------------TGT----A-------
Q9LZX2_ARATH/59-162-----------------------------------------------MRLL--------------TG.----E-------
I1PUL3_ORYGL/142-253-----------------------------------------------MRLL--------------TG.----G-------
Q0DSM5_ORYSJ/106-228-----------------------------------------------MRLL--------------TG.----A-------
Q94AK6_ARATH/1-110-----------------------------------------------MRVL--------------TGG----V-------

PF04335

A7ICW5_XANP2/23-226----------------------------------------------RAAQV--------------WDDRIGSARV-----
Q89B84_BRADU/23-226----------------------------------------------RAAQV--------------WDERIGSARV-----
Q6N7N1_RHOPA/23-226----------------------------------------------RAAQA--------------WDDRIGSARI-----
Q98P55_RHILO/23-226----------------------------------------------KAEQI--------------WDERIGSARV-----
Q210W3_RHOPB/21-224----------------------------------------------KAAQV--------------WDERIGSARV-----
Q2GBL4_NOVAD/21-224----------------------------------------------RAAQV--------------WDDRIGSARV-----
A5V2M3_SPHWW/23-226----------------------------------------------RAQQA--------------WDDRIGSARA-----
B0T8Q8_CAUSK/22-225----------------------------------------------RAGQA--------------WDERIGSARV-----
A7HU75_PARL1/22-225----------------------------------------------KAAQL--------------WDERIGAARV-----
Q989I9_RHILO/22-225----------------------------------------------KAAQL--------------WDERIGSSRV-----
Q9A4Y5_CAUCR/22-225----------------------------------------------KAGQL--------------WDDRIGAARA-----
B0T6U6_CAUSK/22-225----------------------------------------------AAGQL--------------WDQRIGSARV-----
E0TGX7_PARBH/22-225----------------------------------------------KAGQI--------------WDDRIGSARV-----
E0TDN5_PARBH/22-225----------------------------------------------RAAQV--------------WDDRIGSARV-----
B0T9G1_CAUSK/24-227----------------------------------------------RAAQV--------------WDDRIGAARV-----
B0T9T9_CAUSK/23-226----------------------------------------------RASRE--------------WDNRIGSAVV-----
B4S3J2_PROA2/22-230----------------------------------------------RARQE--------------WDNRMGSAVI-----
B4S9L7_PROA2/20-228----------------------------------------------RAQKE--------------WDDRMGSAIV-----
TRBF_RHISN/13-219----------------------------------------------AARQE--------------WTERYGSYVR-----
A1VQ85_POLNA/9-215----------------------------------------------NARRE--------------WDERYGGLIS-----
Q6LGW6_PHOPR/15-221----------------------------------------------RGRHE--------------WDERMGSVTH-----
Q6AIG6_DESPS/13-218----------------------------------------------IGRQA--------------WAEENGSIIN-----
B2JXV8_BURP8/50-259----------------------------------------------QAREF--------------ERSKMEMAEE-----
A5VH54_SPHWW/19-226----------------------------------------------HARSW--------------DQDRQRKSLR-----
Q9PHJ3_XYLFA/16-224----------------------------------------------EARTW--------------ETDKVHDLLK-----
Q1QFH3_NITHX/19-226----------------------------------------------DGATW--------------ERDIARRNRN-----
Q981S1_RHILO/24-232----------------------------------------------DAAIW--------------EKDIARRNRW-----
Q11N51_CHESB/15-223----------------------------------------------QGDIW--------------EQEIIKRAKR-----
Q6D6R5_PECAS/10-223----------------------------------------------ASRSF--------------ESIMLEKEER-----
A7HZU3_CAMHC/9-222----------------------------------------------TAISY--------------EASIRYLVEK-----
Q07GT5_ROSDO/6-215----------------------------------------------TDYTF--------------QDEVFFQLRR-----
A5FU44_ACICJ/23-231----------------------------------------------DVESF--------------QATEKRTARR-----
Q2GI57_EHRCR/27-235----------------------------------------------TTYSW--------------HVSRYNSVVI-----
Q2GD27_NEOSM/14-223----------------------------------------------KVAHW--------------YEEHVGRVTL-----
Q120E6_POLSJ/33-240----------------------------------------------DGANK--------------FAEIYGSAMV-----
A1VV42_POLNA/4-211----------------------------------------------AAMQV--------------YFERGSLEAI-----
A1WP55_VEREI/21-227----------------------------------------------AAAQA--------------YFERGSSQAM-----
Q7WWY4_CUPNH/6-214----------------------------------------------RPEQV--------------IFDRTTRITV-----
B2UCL3_RALPJ/26-235----------------------------------------------SIAQA--------------VFDQTTAVKV-----
B2UKI9_RALPJ/22-233----------------------------------------------QGVRG--------------WFAAFQKPIL-----
Q21QK4_RHOFT/33-246----------------------------------------------KARNE--------------YYDSVGQPVV-----
A1WDP4_ACISJ/46-258----------------------------------------------AARRT--------------WNDHVGGVVS-----
A8AEX8_CITK8/10-222----------------------------------------------.SRTF--------------EQQMIERDKR-----
A8LT11_DINSH/7-212----------------------------------------------..EII--------------EEELVYGALR-----
A9BTR6_DELAS/23-225----------------------------------------------.AAQV--------------WDERIGSARV-----
B2FJH7_STRMK/20-240----------------------------------------------.AVSY--------------EITVADMARR-----
B4EIS2_BURCJ/10-220----------------------------------------------.ALDF--------------EASLTALQAC-----
B9KHB0_ANAMF/20-227----------------------------------------------..DDW--------------YHDRYSSVVV-----
C4YUX8_9RICK/37-241----------------------------------------------..QNW--------------YEERYDKLIV-----
G4RA85_PELHB/22-225----------------------------------------------KAAQA--------------WDERIGSARV-----
N0BBW1_9RHIZ/21-224----------------------------------------------KAGQV--------------WDERIGSARV-----
O24879_HELPY/40-239----------------------------------------------.....--------------....QSVFRL-----
VIRB8_AGRFC/23-227----------------------------------------------..EAF--------------QTARAKSARR-----
Q13XJ1_BURXL/12-220----------------------------------------------...DI--------------EASLTYLQER-----
VIRB8_BRUA2/26-234----------------------------------------------.ALNW--------------EAAHVRLVEK-----
Q73IY8_WOLPM/19-224----------------------------------------------...NW--------------NSNRYSTVIA-----
Q7D3R5_AGRFC/13-220----------------------------------------------KARRF--------------DQDRMIQVER-----
PTLE_BORPE/21-229----------------------------------------------.AVDW--------------EASRLYRLAQ-----
Q9PBT6_XYLFA/26-237----------------------------------------------.ARRS--------------WNSHVGQVMQ-----

PF14729

Q2G174_STAA8/25-118-------------------------------------------YQKDIDKV--------------YKEQNQMNKI-----
YDDJ_BACSU/24-118-------------------------------------------YDDAIDDV--------------I......SQY-----
Q2FVL6_STAA8/19-113-------------------------------------------YVKEIDEA--------------VKIQNQKQEQ-----
Q5HQP4_STAEQ/24-116-------------------------------------------YHDEIKKI--------------LKIQEKTHQE-----
Q5HLI7_STAEQ/24-118-------------------------------------------YADKIDKA--------------VKLQEKKQQK-----

PF07961

YD3B_SCHPO/40-266LHSG-VNKALANH---D---------------------------L...........QQ----L-----------E-----
Q6BRJ5_DEBHA/41-283QLVK-TNKIFAAS---C---------------------------SISNAKREKYLKSQ----L-----------E-----
Q74ZJ7_ASHGO/28-263TYVE-VNRAFARR---D---------------------------L...........EA----A-----------Q-----
Q6CM11_KLULA/30-266TYVQ-VNEAFAKR---E---------------------------L...........DT----I-----------K-----
Q6FJG9_CANGA/40-276TYVQ-VNANFASK---S---------------------------V...........EK----L-----------K-----
Q6CE08_YARLI/32-266NYIA-VNKAFAAR---E---------------------------L...........ES----V-----------D-----
MBA1_YEAST/42-278TYIN-VNTSFAHK---N---------------------------L...........SD----I-----------K-----

PF04280

Q29AN0_DROPS/288-437DIIPNVLEAIVRG---D---------------------------L-----------EI----L-----------K-----
TI441_ARATH/315-467VIKP.VLNAYSEG---D---------------------------V-----------ET----L-----------K-----
Q74E73_GEOSL/170-314VFFR.VQGAWTRR---D---------------------------L-----------SS----A-----------R-----
Q4WTB9_ASPFU/363-517YILPEVLDAYVKG---D---------------------------I-----------ET----L-----------K-----
A7HSI5_PARL1/99-245AYEM.IVTAFAAG---D---------------------------R-----------AT----L-----------K-----
Q2LX56_SYNAS/191-336HFFQ.IQGAWAGR---D---------------------------M-----------SG----V-----------R-----
A1AM45_PELPD/168-313TFFK.IQGAWMNR---D---------------------------L-----------AP----V-----------S-----
A5G6N4_GEOUR/172-317IFFK.IQGAWMNR---D---------------------------L-----------SS----V-----------S-----
Q92K63_RHIME/130-273MLRD.VQAAYGAE---D---------------------------Y-----------AA----L-----------R-----
Q6BV22_DEBHA/267-421YIVPELLDSYIKN---D---------------------------E-----------KV----L-----------K-----
Q2N800_ERYLH/68-214AYGM.VLEAYWKG---D---------------------------K-----------ET----L-----------R-----
Q6C8B1_YARLI/257-411YIIPEVLEAWVTG---D---------------------------G-----------ET----L-----------K-----
RM45_XENTR/118-265LFIA.AHQCLTKF---D---------------------------R-----------HE----L-----------H-----
Q29BD6_DROPS/140-288IYVA.AHTLMAAK---E---------------------------K-----------YK----I-----------R-----
RM45_BOVIN/118-266IFIE.AHLCLNNS---D---------------------------H-----------DR----L-----------H-----
Q4XQ84_PLACH/208-360VISKHIVESYLIG---D---------------------------E-----------ET----L-----------R-----
Q89I32_BRADU/189-331LLGD.VQTAWSNE---D---------------------------V-----------AK----L-----------H-----
Q2YAC8_NITMU/160-293SFIR.LQAANDAR---D---------------------------L-----------ND----I-----------R-----
E0TF66_PARBH/73-216AYEM.IIEAFANG---R---------------------------L-----------DD----V-----------R-----
Q69V11_ORYSJ/315-468MIKP.VLTAYSKG---D---------------------------V-----------KT----L-----------K-----
Q8GXP7_ARATH/157-312LYKQ.INIQMANG---E---------------------------K-----------KT----I-----------R-----
Q3SWG6_NITWN/86-232AYEM.IVLAFANG---D---------------------------R-----------RT----L-----------K-----
A8XG07_CAEBR/268-418KIIPNILEAFIRF---D---------------------------L-----------EV----L-----------Q-----
Q3IYG4_RHOS4/71-219AYEM.IVMAFEKG---E---------------------------L-----------EQ----I-----------R-----
A1VKC3_POLNA/193-328NFVT.LQDAWDRS---D---------------------------I-----------QN----L-----------R-----
Q0AKD2_MARMM/59-205AYVM.IVEAFAAG---D---------------------------R-----------KV----L-----------E-----
Q1GRJ5_SPHAL/74-220AYRM.ILEAFWKG---D---------------------------R-----------ET----L-----------R-----
Q4N770_THEPA/227-378VIAPHVVESYLKG---D---------------------------G-----------EA----L-----------K-----
Q39UB8_GEOMG/177-321IFFR.VQGAWTRR---D---------------------------L-----------SP----V-----------A-----
TIM44_HUMAN/296-445DIIPNVLEAMISG---E---------------------------L-----------DI----L-----------K-----
Q7Q8M7_ANOGA/261-411HVIPNVLESILRG---E---------------------------L-----------DV----L-----------R-----
B5EIY6_GEOBB/173-317NFFK.IQGGWMNR---D---------------------------L-----------AV----L-----------A-----
Q11CL9_CHESB/87-233AYEM.IVMAFADG---D---------------------------R-----------RT----L-----------K-----
Q2KE94_RHIEC/85-231AYEM.VVMAYADG---D---------------------------R-----------KT----L-----------K-----
C5AZH9_METEA/91-237AYET.IVTAFAKG---D---------------------------R-----------KT----L-----------R-----
Q5NM00_ZYMMO/68-215AYGK.ILEAFWQN---D---------------------------R-----------SK----L-----------A-----
TI442_ARATH/310-462AIRP.VLNAYSKG---D---------------------------A-----------KT----L-----------K-----
Q218U8_RHOPB/188-330LLSE.IQTTWSNG---D---------------------------V-----------GH----L-----------H-----
Q9A225_CAUCR/90-231AYEQ.IVKAYAEG---D---------------------------R-----------ET----L-----------T-----
Q0C6A2_HYPNA/70-202AYQL.IVGAYARG---D---------------------------R-----------NA----L-----------R-----
Q0BPM0_GRABC/85-230AFRV.IVTAYAQG---E---------------------------R-----------EA----L-----------R-----
B0T6F5_CAUSK/55-196AYEM.IVKAFAAG---D---------------------------R-----------ET----L-----------K-----
Q7D2D0_AGRFC/69-215AYEM.IVMGFADG---D---------------------------R-----------KT----L-----------K-----
A9BP44_DELAS/201-336NFVT.LQSAWDRS---D---------------------------I-----------AS----L-----------R-----
Q7CT45_AGRFC/71-213MLQD.VQSAYGAE---D---------------------------Y-----------GT----L-----------R-----
Q5KEX5_CRYNJ/294-447YIVPEVVDAYLSA---D---------------------------R-----------ES----L-----------K-----
Q5LLN6_RUEPO/70-218AYEM.IVMGFERG---N---------------------------L-----------DE----I-----------E-----
Q21YX7_RHOFT/181-316NFVS.LQAAWDKS---D---------------------------I-----------NA----L-----------R-----
A0A0D1C0U1_USTMA/407-560YVVPELIDAYHGA---A---------------------------R-----------HL----L-----------R-----
Q2RN93_RHORT/70-216AFEM.ILMAYAKG---D---------------------------K-----------AV----L-----------K-----
Q92TE6_RHIME/85-231AYEM.IVMAFADG---D---------------------------R-----------KT----L-----------K-----
A0CBB5_PARTE/242-397IFEQ.IYNLYLLG---D---------------------------L-----------ES----L-----------Q-----
TIM44_SCHPO/266-420YIVPEVTEAYVKG---D---------------------------K-----------EV----L-----------K-----
A7IGZ9_XANP2/102-248AYEM.IVTAFAAG---D---------------------------R-----------RA----L-----------K-----
Q82S83_NITEU/166-298SFIA.LQLAHDAG---D---------------------------L-----------EE----I-----------R-----
A5FUT4_ACICJ/75-220SFRR.IVLAFAAG---D---------------------------L-----------AA----L-----------R-----
Q16CY5_ROSDO/72-220AYEM.IVMGYENG---E---------------------------L-----------AD----I-----------Q-----
A0LJ73_SYNFM/187-332LFFR.IQAGWMNR---S---------------------------L-----------DG----I-----------E-----
Q16KX3_AEDAE/277-426DIIPNILEAMIRG---D---------------------------L-----------EV----L-----------K-----
A5VD09_SPHWW/78-224AYRM.ILEAYWRG---D---------------------------E-----------EA----L-----------R-----
Q1GCM9_RUEST/70-218AYEM.ILMGFETG---E---------------------------L-----------DG----I-----------Q-----
Q75AP0_ASHGO/257-411YIIPEVLEAYVKG---D---------------------------E-----------QV----L-----------K-----
A0L4W4_MAGMM/183-329CFEM.LQTSWSTF---D---------------------------M-----------TT----L-----------Q-----
Q28W04_JANSC/87-235AYEM.ILMAFERG---D---------------------------V-----------DG----L-----------R-----
Q2VYH8_MAGSA/132-278AFEM.IVIAFAHG---D---------------------------K-----------AT----L-----------Q-----
Q7QC22_ANOGA/140-288IYIE.AHKTLCEK---N---------------------------K-----------YK----L-----------R-----
B0UJF2_METS4/90-236AYET.IVMAFAKG---D---------------------------R-----------RT----L-----------K-----
Q986Y4_RHILO/184-327LLTD.IQEAFGRE---D---------------------------H-----------AA----L-----------R-----
A7ARK8_BABBO/236-388VVAPHIVQCYLDG---D---------------------------S-----------KS----L-----------E-----
Q2GAU2_NOVAD/100-246AYGM.ILEAFWRG---D---------------------------K-----------EE----L-----------A-----
B9KHK8_ANAMF/74-217AFEA.IVKALSQG---N---------------------------A-----------EF----L-----------S-----
D5AKF4_RHOCB/72-217AYEM.ILMAFERG---D---------------------------L-----------SA----V-----------R-----
E4WZD3_OIKDI/234-385EMIPIILEAKAIN---D---------------------------V-----------AV----I-----------E-----
E7F889_DANRE/126-271IFID.AHAALTEF---N---------------------------K-----------EK----L-----------H-----
E7QG67_YEASZ/271-422YIVPEILEAYVKG---D---------------------------V-----------KV----L-----------K-----
Q2YQZ9_BRUA2/88-232AYEM.IVMSFADG---D---------------------------R-----------EV----L-----------K-----
V6F5J3_9PROT/82-226AFEM.IVGAFAAG---D---------------------------K-----------KA----L-----------R-----

PF13474

B2UGF3_RALPJ/11-131.L-----K-R--R---D---A-------D-------G-------A-L---------KL----W-----------LD...E
A5GCV2_GEOUR/9-131.Y-----S-S--R---D---.-------D-------R-------L-T---------TY----F-----------S.....
C0QA63_DESAH/9-131.Y-----A-S--R---D---.-------D-------R-------L-T---------SR----F-----------S.....
D3SFX3_THISK/13-133.L-----R-R--R---D---T-------D-------R-------L-L---------AL----H-----------S.....
Q0A9T2_ALKEH/13-139WL-----R-K--R---D---A-------A-------A-------L-H---------DL----N-----------G.....
D6XWI0_BACIE/11-137YF-----R-R--G---D---I-------R-------E-------T-L---------AL----V-----------D.....
D2PT47_KRIFD/6-126.V-----H-T--G---N---L-------A-------G-------V-L---------AD----H-----------S.....
Q92KR9_RHIME/14-134.L-----R-R--K---D---A-------A-------R-------V-L---------AH----G-----------T.....
C3MEI6_RHISN/13-133.L-----R-R--K---D---A-------G-------R-------V-L---------SH----G-----------T.....
D0LTP7_HALO1/11-135.F-----E-Q--C---D---I-------E-------Q-------M-D---------QI----W-----------SH...G
B5GPB4_STRC2/9-136.L-----E-R--G---D---F-------E-------A-------L-S---------AL----W-----------L....D
B5HIA9_STRPR/9-137.M-----E-R--G---D---F-------D-------E-------L-S---------DL----W-----------L....D
D7B847_NOCDD/11-139.I-----E-N--G---D---I-------D-------L-------M-R---------SV----W-----------AEEHEA
D1A544_THECD/9-137.F-----E-N--G---D---L-------D-------R-------M-S---------AV----W-----------AD...G
A4YP86_BRASO/20-133.F-----A-A--G---D---F-------A-------N-------L-A---------AL----W-----------AD...R
Q89F64_BRADU/7-119.F-----S-T--G---D---F-------A-------G-------M-E---------QM----W-----------AD...D
B2IHF2_BEII9/4-117.F-----S-S--G---D---F-------A-------K-------M-S---------AL----W-----------A....P
B9GXK0_POPTR/174-290.I-----R-E--R---S---L-------Q-------A-------M-S---------QL----W-----------LN...S
B1ZXW2_OPITP/468-592.A-----I-E--K---D---F-------D-------A-------M-F---------HL----W-----------G.....
Q01ZK2_SOLUE/25-147.A-----E-A--R---D---I-------D-------R-------L-F---------GF----M-----------LP...N
B1ZMY8_OPITP/43-165.A-----N-R--L---D---V-------D-------A-------F-F---------AY----I-----------VD...T
C6X4B7_FLAB3/29-152.T-----L-S--G---D---V-------S-------Y-------F-E---------RV----L-----------A.....
C4XSI3_DESMR/466-578.W-----E-R--G---R---I-------E-------D-------Y-L---------AH----Y-----------A.....
Q1DE35_MYXXD/42-156.A-----A-A--A---D---E-------A-------R-------Y-F---------GH----F-----------T.....
Q487W3_COLP3/33-147.A-----A-D--A---Q---A-------T-------P-------Y-F---------NL----L-----------S.....
A3U720_CROAH/41-154.A-----A-E--T---N---F-------D-------I-------Y-F---------NI----M-----------T.....
A5FK93_FLAJ1/24-137.A-----G-E--V---K---F-------D-------A-------Y-F---------NV----L-----------A.....
A6GVS5_FLAPJ/25-138.A-----S-Q--A---N---Y-------D-------N-------Y-M---------HA----M-----------T.....
C6X3L7_FLAB3/38-151.A-----A-K--T---D---F-------K-------N-------Y-F---------DL----F-----------A.....
A4CH66_ROBBH/18-131.A-----S-D--A---D---F-------D-------A-------Y-F---------GL----M-----------A.....
A0M5Z5_GRAFK/38-151.A-----A-S--A---K---F-------E-------D-------Y-F---------EL----M-----------T.....
A2TYG4_9FLAO/37-150.A-----T-E--A---N---Y-------E-------N-------Y-F---------SK----L-----------D.....
A3QCF0_SHELP/31-139.A-----A-S--A---D---W-------D-------N-------Y-F---------AL----Y-----------T.....
Q12PU2_SHEDO/77-185.A-----M-S--A---D---W-------D-------T-------Y-F---------DL----Y-----------H.....
Q085V8_SHEFN/80-188.A-----A-A--A---D---W-------T-------T-------Y-F---------SL----Y-----------H.....
A1S876_SHEAM/27-135.A-----A-N--A---N---W-------D-------A-------Y-F---------SL----Y-----------T.....
D9QI29_BRESC/22-140.S-----T-A--A---D---G-------E-------A-------Y-F---------AL----F-----------S.....
Q15XC4_PSEA6/38-153.A-----S-Q--A---D---L-------S-------K-------Y-L---------GS----F-----------T.....
B9TH82_RICCO/29-143.A-----A-H--A---R---M-------.-------R-------Y-F---------DK----M-----------A.....
D4LV59_9FIRM/8-130.Y-----W-K--R---D---Y-------T-------F-------I-F---------SH----C-----------A.....
B8FCE8_DESAA/7-126.Q-----A-I--G---D---Y-------A-------F-------F-Q---------EM----F-----------SQ...E
Q5LP72_RUEPO/8-127.I-----R-S--H---K---V-------A-------D-------L-P---------HY----L-----------SQ...S
A3HV45_9BACT/11-133.Y-----I-N--G---D---I-------K-------T-------Y-D---------SY----F-----------S.....
B8GG61_METPE/21-142.Y-----R-T--K---D---F-------Q-------E-------M-M---------AI----F-----------S.....
B8CPV1_SHEPW/7-128.Y-----C-A--K---D---I-------D-------S-------L-M---------HI----F-----------ED...S
D4MSP2_9FIRM/78-205CL-----I-E--G---N---V-------E-------K-------A-L---------TF----A-----------S.....
D9T710_MICAI/40-166.F-----A-E--K---N---A-------D-------A-------I-V---------DS----L-----------A.....
Q13UI8_BURXL/13-130.V-----A-E--V---N---I-------D-------S-------L-M---------GL----W-----------ID...E
Q3ZAF4_DEHM1/11-133.V-----E-A--K---N---I-------E-------A-------L-V---------AQ----V-----------DS...E
Q63WV1_BURPS/13-127.V-----A-D--A---N---L-------D-------A-------L-M---------VL----W-----------ID...E
Q8RYS9_ORYSJ/166-284.I-----R-E--G---S---L-------P-------A-------M-S---------HF----W-----------LN...A
R5FDC6_9CLOT/10-131YF-----C-E--N---D---V-------E-------F-------L-I---------ST----F-----------A.....
R5TK35_9CLOT/9-131YF-----C-D--S---D---M-------E-------F-------M-I---------ST----F-----------A.....
R6QJ83_9FIRM/13-123.F-----E-Q--R---D---A-------E-------K-------T-A---------GY----L-----------S.....

PF14534

Q4KEE9_PSEF5/7-110.E.....V.R..A---D---R-------Q.----..A-------L.E---------AL----L-----------A----.
A0JT09_ARTS2/213-310.D.....T.R..A---D---I-------G.----..R-------T.G---------VL----L-----------H----.
A1CFS1_ASPCL/12-120.L.....T.S..A---D---P-------G.----.PA-------I.E---------KL----S-----------S----.
A1R3I0_ARTAT/269-366.D.....V.R..A---D---I-------G.----..R-------I.G---------VL----L-----------H----.
A1U4T2_MARHV/6-114.F.....F.A..R---D---V-------A.----..H-------L.A---------RV----Q-----------A----.
A2QV30_ASPNC/167-275.L.....T.S..A---D---P-------G.----.PE-------I.K---------KM----C-----------N----.
A3CS44_METMJ/8-106.A.....D.V..R---D---V-------E.----..F-------Y.R---------EY----L-----------A----.
A3HWU2_9BACT/60-168.L.....V.A..D---D---I-------S.----..F-------V.E---------SI----M-----------H----.
A3HZW5_9BACT/30-137.N.....L.H..P---N---P-------E.----..F-------L.D---------EL----L-----------G----.
A3I0D3_9BACT/31-149.Q.....N.A..C---D---L-------E.----..K-------Y.A---------SY----L-----------S----.
A3QEM3_SHELP/29-149.F.....E.Q..L---D---A-------A.----..V-------I.Q---------DI----Y-----------A----.
A3QJ67_SHELP/5-108.E.....V.R..C---D---A-------N.----..V-------L.D---------EL----I-----------H----.
A4AQI2_MARSH/45-155.Y.....N.T..C---D---M-------E.----..T-------Q.A---------DL----Y-----------D----.
A4CNU2_ROBBH/46-156.Y.....N.E..C---D---M-------A.----..T-------Q.E---------KL----L-----------S----.
A4RV71_OSTLU/211-315.L.....G.E..G---D---E-------E.----..A-------M.A---------AI----W-----------S----.
A5FMK8_FLAJ1/6-112.I.....R.N..S---D---I-------A.----..V-------L.E---------KL----L-----------H----.
A5FMN4_FLAJ1/37-145.F.....N.Q..C---D---A-------G.----..A-------F.K---------KI----I-----------A----.
A5G8N2_GEOUR/26-129.L.....R.N..K---D---I-------N.----..L-------Y.L---------TL----L-----------S----.
A5V3K3_SPHWW/11-125.INWSADK.A..P---D---F-------T.----..A-------F.A---------AA----V-----------R----.
A5V8Q2_SPHWW/64-171.L.....V.A..R---D---F-------A.----..T-------L.R---------TL----V-----------A----.
A5VGJ3_SPHWW/7-115.M.....L.A..S---D---V-------A.----..T-------L.D---------AL----L-----------S----.
A5WEC7_PSYWF/5-111.L.....L.N..K---Q---Y-------D.----..E-------F.A---------AL----C-----------D----.
A6LYA2_CLOB8/8-113.E.....V.R..K---S---A-------D.----..K-------I.N---------GM----L-----------S----.
A6VR33_ACTSZ/42-148.M.....L.D..K---D---S-------E.----..T-------I.D---------RL----T-----------A----.
A6WA45_KINRD/27-133.M.....V.A..G---D---T-------V.----..Q-------L.A---------HL----L-----------T----.
A6WB55_KINRD/3-111.I.....V.D..V---D---R-------H.----..V-------L.E---------DL----H-----------H----.
A8GEK8_SERP5/4-112.V.....T.R..N---N---V-------A.----..V-------V.S---------EL----L-----------H----.
A8LTG7_DINSH/19-134.F.....V.V..R---D---F-------D.----..G-------W.A---------AC----W-----------V----.
A9C0J7_DELAS/26-133.Q.....V.R..S---D---A-------G.----..Q-------L.Q---------AL----L-----------H----.
A9GA01_SORC5/28-134.I.....S.K..K---D---F-------T.----..G-------M.R---------SL----I-----------T----.
B0SZM9_CAUSK/8-116.I.....A.G..K---D---A-------R.----..R-------L.A---------PF----L-----------A----.
B0T7A9_CAUSK/166-269.A.....D.G..D---A---P-------K.----..A-------Y.R---------AV----L-----------T----.
B1M5Q7_METRJ/38-144.L.....L.S..A---D---G-------P.----..A-------L.D---------AL----V-----------L----.
B1ZQQ6_OPITP/36-143.F.....V.A..G---D---R-------A.----..Q-------L.D---------AI----L-----------S----.
B1ZZ14_OPITP/30-139.V.....L.A..S---D---T-------A.----..K-------L.E---------EL----W-----------S----.
B2GBD5_LACF3/9-117.M.....V.E..R---D---Q-------A.----..T-------L.E---------RI----L-----------A----.
B2JCD2_BURP8/9-116.M.....V.E..G---N---G-------Q.----..Q-------L.H---------AL----L-----------S----.
B2JPS0_BURP8/31-132.S.....M.H..R---D---T-------D.----..T-------L.K---------LL----L-----------D----.
B3PI44_CELJU/32-141.L.....R.I..G---D---V-------K.----..L-------L.D---------SL----L-----------A----.
B4RBI8_PHEZH/167-269.A.....K.T..D---V---P-------A.----..A-------F.L---------AV----A-----------A----.
B4RHA1_PHEZH/45-153.W.....N.R..G---D---F-------R.----..G-------Y.M---------DG----F-----------L----.
B5GTL4_STRC2/19-130.F.....N.T..K---N---P-------I.----..A-------L.G---------EQ----F-----------A----.
B5I698_9ACTN/6-123.FDNRGGK.A..A---D---V-------A.----..R-------I.H---------RL----V-----------L----.
B7JXD1_CYAP8/8-119.V.....R.S..R---D---L-------E.----..S-------Y.G---------QM----Y-----------T----.
B8GT08_THISH/17-126.S.....M.E..R---N---A-------E.----..K-------I.R---------ST----L-----------H----.
B8MZS8_ASPFN/6-119.L.....C.I..S---.---G-------S.----..T-------L.I---------PL----L-----------S----.
B9E8X8_MACCJ/8-114.M.....I.E..K---D---T-------H.----..A-------I.D---------RV----M-----------M----.
C1A7K4_GEMAT/10-121.I.....A.A..R---D---A-------D.----..R-------V.V---------SF----M-----------D----.
C1ABS4_GEMAT/430-537.L.....G.T..G---D---S-------T.----..T-------A.L---------RT----L-----------G----.
C1CZM8_DEIDV/15-112.Y.....H.L..R---D---P-------Q.----..R-------M.A---------GV----L-----------A----.
C1F8H5_ACIC5/21-124.A.....V.R..K---N---A-------A.----..K-------V.A---------EL----L-----------A----.
C3AMI1_BACMY/20-132.F.....N.A..H---D---A-------D.----..E-------L.D---------RY----F-----------T----.
C3ZF01_BRAFL/355-462.F.....K.A..N---D---M-------K.----..G-------V.A---------SL----Y-----------T----.
C4L6W4_EXISA/8-106.E.....V.R..Q---S---T-------E.----..R-------L.R---------EL----L-----------T----.
C5BK93_TERTT/4-109.A.....I.R..R---S---R-------P.----..L-------H.E---------SL----L-----------H----.
C5CWD6_VARPS/8-118.M.....V.D..S---D---T-------N.----..T-------A.I---------DL----L-----------C----.
C6XYF7_PEDHD/10-116.I.....K.N..G---N---I-------T.----..A-------L.D---------QL----L-----------H----.
C6Y015_PEDHD/172-276.L.....K.S..Y---G---I-------A.----..A-------F.G---------GF----L-----------N----.
C7M5E0_CAPOD/27-132.M.....Q.Q..A---D---K-------Q.----..T-------L.V---------EN----I-----------A----.
C7NFY8_KYTSD/186-282.G.....T.R..T---D---P-------A.----..E-------V.A---------AL----L-----------H----.
C7NIZ7_KYTSD/228-329.S.....A.R..G---D---A-------H.----..R-------L.A---------EL----L-----------S----.
C7RBL7_KANKD/30-150GF.....N.E..C---D---I-------D.----..Y-------L.Q---------QH----V-----------S----.
C9YUI3_STRSW/23-131.Q.....R.A..R---D---A-------E.----..G-------F.L---------AL----F-----------H----.
D2ATH3_STRRD/10-114.I.....S.V..G---D---G-------D.----..F-------Y.R---------RL----I-----------T----.
D2PZL0_KRIFD/6-115.L.....V.E..K---D---V-------V.----..A-------A.E---------LV----H-----------A----.
D3F9E1_CONWI/19-126.I.....A.A..N---D---P-------D.----..A-------I.G---------QQ----L-----------H----.
D3FXC8_BACPE/11-109.H.....T.R..T---S---P-------E.----..Q-------L.E---------EL----L-----------A----.
D3Q9C7_STANL/5-122.Q.....EHQ..T---E---P-------E.----..P-------F.L---------AM----H-----------R----.
D3S9F1_THISK/27-146.W.....E.A..G---D---G-------D.----..A-------W.A---------RD----Y-----------Q----.
D5DIB8_BACMD/6-113.M.....L.S..N---N---I-------E.----..L-------L.E---------EL----L-----------S----.
D5SSM1_PLAL2/48-156.F.....N.A..G---D---A-------K.----..A-------I.A---------AQ----F-----------T----.
D5SZ41_PLAL2/16-126.T.....R.K..F---D---R-------Q.----..V-------L.S---------SL----M-----------T----.
D5UXJ0_TSUPD/21-126.F.....D.S..G---D---A-------D.----..R-------Y.D---------AF----F-----------A----.
D5X2H8_THIK1/9-116.M.....L.A..S---D---V-------E.----..S-------L.D---------AL----I-----------S----.
D5X508_THIK1/258-358.W.....Q.N..K---N---L-------P.----..G-------Y.F---------AA----Y-----------A----.
D6YUD1_WADCW/33-146.F.....N.Q..K---N---I-------P.----..A-------V.C---------EL----F-----------S----.
D7DI86_METV0/10-122.I.....L.H..R---D---V-------D.----..A-------I.C---------RF----F-----------A----.
D7FUG0_ECTSI/213-343.V.....T.R..G---T---Y-------DA----PKR-------T.A---------EL----Y-----------A----.
D9SQZ0_CLOC7/8-113.E.....V.R..K---S---S-------K.----..R-------I.N---------EI----L-----------T----.
D9T1Z4_MICAI/21-128.Q.....L.S..S---D---V-------A.----..E-------L.D---------RL----I-----------D----.
E0UKN5_CYAP2/8-124.V.....R.N..K---D---R-------E.----..N-------Y.G---------TM----Y-----------T----.
E1VXQ5_ARTAR/20-119.S.....R.R..S---S---V-------E.----..E-------L.K---------RL----L-----------H----.
E3EA41_PAEPS/6-112.M.....L.A..S---D---V-------Q.----..I-------L.N---------EL----I-----------H----.
E3M5F2_CAERE/6-112.K.....T.A..G---K---H-------D.----..E-------F.A---------KK----F-----------A----A
E3NA36_CAERE/13-119.V.....D.D..E---K---W-------D.----..V-------V.E---------GF----Y-----------H----.
E3NA40_CAERE/13-119.I.....D.N..L---E---W-------D.----..I-------V.P---------TY----Y-----------H----.
E3Q3Z8_COLGM/20-132.M.....C.D..S---K---P-------K.----..H-------L.K---------KY----L-----------D----.
E4TM42_MARTH/40-139.W.....Q.N..S---D---A-------A.----..Q-------L.A---------SL----F-----------T----.
E6X731_CELAD/46-156.Y.....N.Q..C---D---L-------E.----..K-------Q.A---------SI----Y-----------S----.
E8WVR2_GRATM/66-173.I.....A.T..H---D---F-------A.----..I-------L.Q---------RY----W-----------S----.
E8WVR2_GRATM/212-319.I.....A.T..M---D---F-------A.----..A-------L.E---------KL----W-----------S----.
E8WVR7_GRATM/60-181.W.....A.S..H---N---P-------Q.----..A-------I.A---------ML----H-----------A----.
E8WXR9_GRATM/62-172.V.....A.A..G---G---G-------K.----..V-------F.S---------EW----F-----------A----.
E8X558_GRATM/30-138.L.....A.T..H---D---Q-------A.----..A-------L.E---------KL----W-----------S----.
F2F0M6_SOLSS/9-106.E.....V.R..R---S---K-------E.----..K-------L.D---------AI----L-----------A----.
F2F328_SOLSS/60-162.F.....N.E..K---D---L-------E.----..R-------Y.K---------NI----I-----------S----.
F2RH14_STRVP/10-117.A.....V.R..S---S---R-------E.----..L-------S.E---------RY----L-----------D----.
Q03DA3_PEDPA/8-116.M.....V.K..K---D---I-------S.----..R-------L.D---------MI----L-----------G----.
Q0RLC8_FRAAA/20-126.Q.....L.A..S---D---V-------E.----..V-------L.D---------EP----I-----------D----.
Q11V67_CYTH3/7-113.I.....Q.N..N---D---V-------E.----..S-------L.E---------VL----L-----------H----.
Q12Q38_SHEDO/8-111.K.....V.R..G---S---I-------A.----..E-------L.D---------KL----L-----------G----.
Q13U88_BURXL/31-133.A.....I.H..G---D---R-------A.----..T-------L.D---------QL----L-----------A----.
Q1GMQ9_RUEST/19-122.L.....V.R..G---D---A-------D.----..L-------D.A---------SL----L-----------C----.
Q1H132_METFK/13-128.W.....A.D..F---D---A-------A.----..L-------A.S---------RD----Y-----------A----.
Q1ISF5_KORVE/28-135.V.....A.V..G---N---K-------D.----..P-------W.Q---------KY----F-----------A----.
Q1ITS8_KORVE/8-111.Q.....L.H..C---D---P-------K.----..V-------L.D---------QL----L-----------D----.
Q2G7A7_NOVAD/11-122.L.....A.A..R---D---L-------E.----..A-------I.G---------GI----L-----------S----.
Q2LTB1_SYNAS/390-491.W.....E.S..D---D---M-------P.----..A-------Y.Q---------DC----Y-----------A----.
Q5LLC5_RUEPO/46-153.F.....A.R..G---D---V-------P.----..A-------LVA---------DY----Y-----------N----.
Q5YUX5_NOCFA/23-128.L.....C.A..S---T---G-------A.----.RF-------Y.G---------AV----M-----------T----.
Q6AE79_LEIXX/186-283.A.....V.R..A---D---S-------S.----..Q-------V.A---------AL----L-----------H----.
Q82AU3_STRAW/26-136.W.....A.A..G---D---A-------A.----..L-------F.A---------AS----F-----------A----.
Q89JP5_BRADU/29-135.F.....N.K..Q---D---G-------A.----..G-------I.A---------AL----F-----------A----.
Q89SG9_BRADU/39-147.Q.....I.A..A---D---P-------K.----..A-------L.G---------AL----C-----------W----.
Q8YWM4_NOSS1/9-120.V.....R.G..R---D---L-------S.----..A-------Y.A---------DM----Y-----------T----.
Q9RS70_DEIRA/32-140.T.....V.A..G---D---S-------A.----..T-------I.L---------RF----Y-----------A----.
B0SRG8_LEPBP/10-116.I.....K.K..S---D---I-------P.----..F-------L.E---------SV----I-----------H----.
B1HN37_LYSSC/64-167.L.....N.A..E---E---I-------D.----..R-------Y.M---------KT----I-----------S----.
F9URX0_LACPL/18-126.M.....V.Q..K---N---L-------S.----..R-------L.N---------EI----L-----------A----.
F9UT77_LACPL/12-117.M.....L.E..K---N---L-------E.----..L-------L.D---------QV----I-----------A----.
Q5LTS8_RUEPO/9-110.L.....V.D..G---D---A-------A.----..A-------D.E---------AA----L-----------D----.
Q8P937_XANCP/40-149.Y.....N.A..C---D---L-------P.----..A-------A.G---------KL----L-----------S----.
Q8PBX0_XANCP/2-100.Q.....V.R..G---S---A-------A.----..E-------L.E---------TL----L-----------D----.
Q8YRK0_NOSS1/10-115.M.....K.T..N---N---V-------K.----..L-------L.D---------KL----L-----------H----.
Q8ZMH1_SALTY/11-112.L.....S.KGVG---S---L-------E.----..A-------L.I---------AR----F-----------A----.
Q97G15_CLOAB/8-113.E.....I.R..Q---C---E-------A.----..R-------T.S---------EL----L-----------A----.
Q9A9S2_CAUCR/46-158SF.....V.T..C---D---A-------A.----..K-------A.N---------AI----F-----------A----.
Q9RJZ2_STRCO/30-137.Q.....R.D..K---D---A-------E.----..G-------F.L---------TL----F-----------R----.

PF08332

KCC2D_CAEEL/587-711-I-----S-C--K---D---F-------E-------T-------Y-T---------RL----C-----------D-----
Q8P5Y9_XANCP/36-159-L-----A-T--G---N---P-------H-------K-------V-A---------DL----Y-----------A-----
KCC2A_DROME/389-516-I-----N-S--G---D---F-------D-------G-------Y-T---------KI----C-----------D-----
Q5SIW7_THET8/3-128-I-----Y-E--G---D---W-------A-------T-------Y-E---------AT----T-----------H-----
F8WHB5_MOUSE/57-184-I-----S-N--G---D---F-------E-------S-------Y-T---------KM----C-----------D-----

PF13577

C1GKF4_PARBD/8-161-L-----NFY--L---D---T....Y..QW....DKL-------I.D.--------EV----F---------..I-----
D9QIN2_BRESC/9-135-W-----AHY--A---Q---I....G..LW....D.D-------I.A.--------AL----F---------..A-----
D9QIN2_BRESC/195-322-W-----GYY--V---D---R....R..QW....D.D-------V.A.--------DL----F---------..A-----
D9QIN2_BRESC/413-542-Y-----GYY--I---D---E....F..RW....A.E-------V.R.--------DL----F---------..S-----
D3Q8I0_STANL/19-151-F-----ALG--Q---D---L....K..DR....E.L-------F.A.--------SA----F---------..A-----
Q0SJ13_RHOJR/45-175-Y-----AMA--V---D---R....A..DW....E.M-------F.A.--------DC----F---------..T-----
A5V679_SPHWW/6-139-C-----MHA--M---D---T....H..QW....A.L-------Y.R.--------AN----I---------..V-----
B5HCB8_STRPR/23-148-Y-----LRS--L---D---E....GPLDE....E.W-------A.R.--------AF----H---------..T-----
E3IXY9_FRASU/16-146-Y-----SYC--V---D---H....K..LN....D.E-------L.A.--------AL----F---------..T-----
D2RZV4_HALTV/8-134-Y-----CYA--I---D---D....R..DF....E.S-------L.P.--------HL----F---------..T-----
Q0UXA3_PHANO/19-158-Y-----CEA--L---D---T....K..NF....E.L-------L.E.--------EV----F---------..V-----
B1MBT8_MYCA9/7-136-Y-----ART--L---D---N....K..LW....D.E-------F.A.--------DT----L---------..T-----
A5V4W9_SPHWW/12-141-Y-----ARG--A---D---R....K.NDP....A.I-------L.G.--------PL----F---------..A-----
Q73Z53_MYCPA/11-137-Y-----CRY--L---D---T....K..DW....A.A-------W.R.--------TI----F---------..T-----
D0L747_GORB4/5-127-Y-----STA--V---D---A....G..RF....D.D-------L.D.--------RV----F---------..V-----
B4EDY3_BURCJ/5-132-Y-----SSA--I---D---S....C..DF....D.A-------L.D.--------TV----F---------..T-----
B0T6L6_CAUSK/8-137-Y-----ARG--V---D---R....M..DK....D.L-------V.L.--------TC----F---------..W-----
Q0UTX1_PHANO/50-179-I-----SHL--A---Q---F....G..EW....R.T-------I.S.--------HL----F---------..T-----
Q0UTX1_PHANO/238-365-R-----GFY--V---D---R....R..MW....G.D-------V.V.--------DL----H---------..T-----
Q0UTX1_PHANO/423-553-Y-----GYY--A---D---D....I..LG....P.E-------L.G.--------GL----F---------..A-----
A5VCU7_SPHWW/9-134-Y-----AIG--A---D---R....R..DP....A.I-------W.T.--------AI----M---------..A-----
B2A9N2_PODAN/33-173-Y-----AQL--A---Q---H....G..RW....K.G-------M.A.--------SL----F---------..A-----
B2A9N2_PODAN/248-379-M-----GYY--V---D---R....R..MW....P.D-------V.I.--------SL----F---------..T-----
A6VWC0_MARMS/15-150-Y-----MDL--C---D---H....L..NPATPLD.E-------L.G.--------DL----F---------..T-----
A0QWD2_MYCS2/19-160-Y-----GPA--V---D---A....A..DA....D.T-------A.A.--------GL----W---------..A-----
A1SDG2_NOCSJ/13-135-Y-----LRT--L---D---T....K..RW....D.E-------F.A.--------DC----F---------..L-----
A4XF70_NOVAD/24-149-Y-----GPL--A---D---S....G..DA....E.A-------L.S.--------EL----W---------..V-----
C5DP23_ZYGRC/32-161-C-----VLG--L---D---T....A..DV....T.L-------F.E.--------SA----L---------..I-----
A5V734_SPHWW/6-140-W-----LDG--I---D---T....R..DP....E.K-------I.R.--------AA----W---------..A-----
E3IXP4_FRASU/19-145-Y-----GPA--V---D---S....G..SA....Q.A-------T.A.--------AL----W---------..T-----
E3IY46_FRASU/4-132-Y-----LRL--V---D---E....K..KW....D.E-------W.A.--------DV----F---------..T-----
D0J3B0_COMT2/9-135-Y-----ATA--C---D---T....R..NW....D.L-------L.Q.--------QV----F---------..T-----
A8LAB8_FRASN/18-148-Y-----GEA--L---D---Y....G..LD....D.Q-------L.V.--------DL----F---------..T-----
A4XF68_NOVAD/127-253-F-----ARV--L---D---A....K..AW....D.A-------L.G.--------DV----F---------..A-----
Q0S5K6_RHOJR/13-140-Y-----AYN--L---D---M....N..RP....D.D-------L.V.--------AL----F---------..T-----
C5AL89_BURGB/17-156-Y-----MAL--C---D---VPVRPL..AG....E.S-------L.A.--------AL----F---------..T-----
D0IVW3_COMT2/14-141-Y-----LRA--C---D---Q....K..QP....N.A-------M.R.--------EC----F---------..V-----
Q2G3D7_NOVAD/8-142-Y-----FRC--M---D---T....K..DY....A.G-------L.R.--------QV----F---------..A-----
A5VH89_SPHWW/19-143-L-----ARA--G---D---R....L..DR....A.L-------M.Q.--------SA----F---------..A-----
E3J7S9_FRASU/5-125-Y-----ALA--V---D---G....K..DL....D.S-------L.A.--------AL----F---------..A-----
A5DD79_PICGU/8-137-A-----ASA--F---D---D....N..DV....G.L-------F.N.--------SA----M---------..C-----
E3J7S1_FRASU/26-166-Y-----GYT--A---D---T....C..KD....E.E-------F.V.--------EL----Y---------..T-----
D2QII9_SPILD/28-157-F-----SIL--A---D---R....K..DV....A.T-------Q.V.--------LL----F---------..T-----
A5V526_SPHWW/11-135-Y-----CRA--I---D---R....R..DA....E.L-------M.R.--------RV----Y---------..W-----
E3IVD7_FRASU/14-137-Y-----GQL--L---D---D....L..RL....E.E-------W.G.--------HL----F---------..T-----
Q0S5K7_RHOJR/9-131-Y-----FLA--S---D---F....D..DF....D.A-------I.A.--------DV----F---------..A-----
D0LD89_GORB4/12-143-Y-----WRA--C---D---A....K..DP....K.T-------F.R.--------EC----F---------..I-----
B2AQ89_PODAN/30-160-F-----AQL--A---Q---F....G..RY....A.D-------M.A.--------AL----F---------..A-----
B2AQ89_PODAN/220-360-W-----GYY--V---D---R....R..LW....G.E-------V.G.--------EL----F---------..G-----
A5VBN9_SPHWW/10-129-Y-----SLA--L---D---M....R..DA....D.A-------W.V.--------GL----F---------..P-----
E6WNE5_PANSA/4-133-F-----SNL--A---D---E....K..DV....A.A-------Q.I.--------PL----F---------..T-----
B8MXL3_ASPFN/8-138-C-----VTG--F---D---T....A..DT....A.L-------F.D.--------SA----F---------..T-----
C0ZQW7_RHOE4/8-149-R-----LRC--M---D---T....K..QW....H.V-------Y.P.--------TL----H---------..T-----
E3IWW1_FRASU/10-135-Y-----CRA--M---D---R....R..DD....P.L-------G.Y.--------AV----W---------..H-----
D1ABN9_THECD/23-147-Y-----GPL--V---D---S....G..CA....Q.A-------V.A.--------EL----W---------..E-----
C0ZMD8_RHOE4/24-149-F-----LRA--A---D---R....G..DV....E.D-------A.R.--------RC----Y---------..L-----
C0ZQN1_RHOE4/6-139-Y-----THL--I---D---Q....G..RL....G.E-------V.A.--------AL----F---------..A-----
A4XEZ3_NOVAD/13-139-Y-----LRA--C---D---L....K..EV....E.D-------V.R.--------DC----F---------..A-----
Q13HM1_BURXL/10-142-Y-----CRF--V---D---T....K..QW....D.R-------L.R.--------TL----F---------..T-----
B5HT20_9ACTN/43-171-Y-----LIG--L---D---D....D..KL...ND.A-------W.AS--------AL----F---------..S-----
B3E7N6_GEOLS/52-188-Y-----CRG--D---D---R....Q..DA....E.E-------G.K.--------KM----F---------..A-----
Q65SQ7_MANSM/19-149-F-----SNL--A---D---E....K..NV....A.A-------Q.M.--------PL----F---------..T-----
A5VBG5_SPHWW/5-140-Y-----FRC--I---D---E....Q..DW....D.A-------L.V.--------AN----F---------..T-----
C5E1P0_ZYGRC/8-136-C-----VLS--V---D---T....A..DV....E.L-------F.D.--------SG----L---------..L-----
C7PBQ3_CHIPD/4-133-V-----SIL--A---D---R....K..DV....H.A-------Q.V.--------QL----F---------..T-----
A5V782_SPHWW/7-132-Y-----PRG--L---D---R....L..DK....E.L-------L.L.--------SI----G---------..H-----
E3J9Q1_FRASU/15-143-Y-----GPA--A---D---A....G..LA....D.L-------A.A.--------SV----W---------..R-----
Q28SS5_JANSC/28-163-L-----DAA--V---D---A....Q..DW....P.A-------A.R.--------AL----F---------..T-----
Q5YUE7_NOCFA/24-150-Y-----GPA--V---D---S....G..SA....D.V-------A.A.--------DL----W---------..L-----
A5V765_SPHWW/9-128-Y-----AWL--V---G---Q....G..RG....A.E-------V.P.--------AL----F---------..T-----
Q2G4I2_NOVAD/20-164-Y-----GYY--I---D---Y....N..RP....E.E-------V.A.--------GL----F---------..A-----
Q0RU80_FRAAA/13-137-Y-----CHG--V---D---R....A..DQ....E.T-------F.L.--------SI----W---------..H-----
C0ZY97_RHOE4/8-139-Y-----WRA--C---D---A....K..DP....V.R-------F.R.--------SS----F---------..I-----
B0T6Q3_CAUSK/13-141-Y-----HTL--V---N---D....T..DF....D.Q-------I.G.--------GL----F---------..A-----
Q2G896_NOVAD/9-133-Y-----GAA--L---D---G....A..EV....S.L-------F.E.--------RC----F---------..T-----
Q2G8B9_NOVAD/8-130-Y-----FLA--S---D---G....D..DL....A.T-------V.G.--------NS----F---------..T-----
A0R741_MYCS2/12-151-H-----PIS--A---D---T....G..EP....E.L-------I.E.--------GI----Y---------..T-----
A2QQU7_ASPNC/9-142-A-----VLS--F---D---G....N..DL....P.L-------F.E.--------SA----F---------..F-----
A5V496_SPHWW/15-154-Y-----FRL--C---D---TLGPDT..SL....D.D-------L.G.--------LC----F---------..T-----
D3F909_CONWI/11-132-L-----GAW--L---D---R....Q..RP....DDD-------P.R.--------TI----F---------..D-----
A5V4W4_SPHWW/9-135-L-----GRA--F---D---A....G.PSA....A.A-------L.R.--------EL----F---------..V-----
A8LEQ5_FRASN/33-162-Y-----GPL--V---D---S....G..SA....E.E-------A.A.--------DL----W---------..I-----
Q5YMU1_NOCFA/9-129-H-----SVW--V---D---E....G...F....A.D-------T.D.--------RL----F---------..T-----
B8MB56_TALSN/45-177-Y-----GTI--I---D---A....K..TM....K.D-------L.S.--------RV----F---------..T-----
A7HVX6_PARL1/27-151-W-----AFY--R---D---Q....E..AW....S.K-------L.G.--------AT----F---------..H-----
Q47PW3_THEFY/16-138-Y-----AAT--L---D---N....P..TP....E.A-------V.A.--------AL----F---------..T-----
Q0RKC5_FRAAA/4-127-Y-----TYF--A---D---S....G..RL....G.P-------L.V.--------DL----F---------..L-----
C0ZPG5_RHOE4/7-136-Q-----SHC--I---D---S....G..RQ....Q.D-------W.A.--------QT----F---------..T-----
Q2GA82_NOVAD/22-166-Y-----GYL--I---D---K....C..MY....N.E-------T.V.--------DL----F---------..T-----
D1A615_THECD/11-138-Q-----MHL--L---D---G....L..RL....E.E-------Y.A.--------DT----F---------..T-----
Q2J5F3_FRASC/12-141-Q-----MGL--L---D---E....R..QA....D.S-------W.A.--------DT----F---------..A-----
Q13GK3_BURXL/16-154-H-----PPC--V---D---T....G..SA....E..-------Y.A.--------EN----M---------..S-----
Q2HFF4_CHAGB/8-157-V-----PLY--Y---D---T....I..NL....P.A-------LQA.--------EV----Y---------..G-----
B2AMA1_PODAN/20-165-Y-----GYY--L---D---K....C..LY....N.E-------V.V.--------DM----F---------..S-----
Q2J5F8_FRASC/12-144-Q-----MSL--L---D---G....ADPDP....D.G-------W.V.--------RT----F---------..T-----
A4XER9_NOVAD/52-204-Y-----MYL--H---N---A....F..RD....P.E-------I.V.--------PL----W---------..A-----
B5HIV3_STRPR/14-145-Q-----VRH--L---D---T....M..RA....E.E-------F.A.--------AS----F---------..T-----
D4J4G2_9FIRM/14-173-R-----VIY--I---T---N...EM..RK....E.E-------L.N.--------DL----W---------..V-----
D4J4F8_9FIRM/15-157-Y-----SYY--R---T---A....F..QN....K.E-------M.V.--------EL----W---------..A-----
A2QCD6_ASPNC/23-149-W-----PVY--R---D---A....S..EW....A.H-------Y.R.--------NC----F---------..A-----
Q0V2S9_PHANO/36-181-Y-----GYY--L---D---K....C..LY....K.E-------V.A.--------DL----Y---------SNH-----
Q73XG8_MYCPA/12-127-H-----NRA--Y---S---D....G..DR....D.G-------W.I.--------AT----F---------..R-----
B2HNY2_MYCMM/12-134-Y-----LRA--L---D---T....K..HW....D.E-------F.A.--------DT----L---------..T-----
B4EK49_BURCJ/8-131-Y-----FRA--V---D---T....H..DW....T.L-------L.A.--------AC----L---------..T-----
D4AUD6_ARTBC/51-174-F-----FLL--V---D---E....H..RF....E.E-------M.N.--------KV----F---------..T-----
D4Z258_SPHJU/6-129-K-----LIA--V---D---K....R..QE....G.R-------L.A.--------SI----W---------..W-----
F2RC28_STRVP/29-155-Y-----AMH--L---D---KD..RG..SD....D.W-------F.G.--------AV----F---------..T-----
F9UT75_LACPL/5-135-F-----SNY--S---D---T....K..EN....E.K-------Q.V.--------QL----F---------..L-----
Q73VN5_MYCPA/6-129-Y-----STA--I---D---N....R..RF....D.D-------L.D.--------DV----F---------..T-----
Q7API7_STRCO/4-133-M-----AWH--L---D---H....C..EW....D.Q-------L.V.--------DL----F---------..T-----

PF11533

Q2KWZ9_BORA1/3-126FSRYEAALVS--N---D---I-------A-------V-------L-D---------EL----F---------WNS-----
A4GA01_HERAR/3-127FMRYEAALTG--N---D---V-------A-------V-------L-D---------EL----F---------WNN-----
Q2JJM3_SYNJB/2-130YHQYEAALTS--N---D---V-------P-------T-------L-T---------RL----F---------WDG-----
B2JQX3_BURP8/4-129FDEYERALTT--N---D---V-------A-------V-------L-D---------AL----F---------WNS-----
B0T8S4_CAUSK/1-126VDAYETALMT--N---D---V-------E-------A-------L-D---------GF----F---------RDA-----
A7IPC9_XANP2/2-128FARYEAALVN--N---D---V-------A-------T-------L-E---------AL----F---------HDD-----
Q9A550_CAUCR/1-126VDAYEVALMA--N---D---V-------E-------A-------L-D---------AA----F---------WTS-----
Q6D1E8_PECAS/4-128FYRYEKALTG--N---D---V-------A-------V-------L-D---------EL----F---------WHD-----
Q89VK3_BRADU/1-127FDRYEQALVT--N---D---V-------T-------V-------L-G---------EL----F---------RND-----
Q01TH6_SOLUE/1-127HEEYEAALIS--N---D---V-------G-------K-------L-T---------GF----F---------WDS-----
Q6N9S0_RHOPA/1-127FARYEAALVG--N---D---V-------A-------T-------L-N---------EL----F---------HND-----
A2SDU4_METPP/5-130FARYEDALVH--N---R---I-------E-------V-------L-D---------AL----F---------WPS-----
Q5FP06_GLUOX/7-132SDRYERALGE--N---E---L-------Q-------E-------L-D---------RL----F---------YDG-----
A6T9D1_KLEP7/5-128FYQYEEALVS--N---N---I-------E-------A-------L-D---------AL----F---------WHD-----
A1WIE8_VEREI/2-125FADYEHALLI--H---D---V-------P-------A-------L-D---------RW----F---------WYA-----
A8GA93_SERP5/4-128FYRYEQALTG--N---D---I-------D-------V-------L-D---------EL----F---------WHD-----
Q7CK76_YERPE/32-154FYRYEQALIG--N---D---I-------A-------V-------L-D---------AL----F---------WHD-----
Q8PDQ4_XANCP/7-128FHAYEHALMH--D---D---I-------A-------A-------M-D---------AL----F---------HAA-----

PF12893

A4YKR3_BRASO/3-119-------LYE--G---D---A-------D-------K-------L-G---------AV----F-----------H-----
Q6ARD2_DESPS/3-119-------LYE--G---D---A-------E-------T-------M-E---------KV----F-----------H-----
Q5LU66_RUEPO/8-124-------LHH--A---D---S-------A-------R-------L-R---------QV----F-----------H-----
A1TQB0_ACIAC/3-119-------LYH--S---D---A-------E-------K-------L-R---------TV----F-----------H-----
Q1GM60_RUEST/4-120-------LYH--S---D---S-------D-------V-------L-R---------TV----F-----------H-----
Q16B55_ROSDO/5-121-------LYH--S---D---S-------T-------V-------L-R---------SV----F-----------H-----
A1U866_MARHV/3-114-------LHT--G---D---A-------N-------R-------L-A---------PL----F-----------H-----
Q480Y3_COLP3/13-124-------LYH--G---D---V-------A-------K-------L-D---------SI----F-----------H-----
Q12R73_SHEDO/9-120-------LYH--G---D---V-------A-------K-------L-S---------GL----F-----------H-----
A5FCS3_FLAJ1/29-145-------IYE--G---D---E-------I-------L-------L-G---------SV----F-----------Q-----
C7PJE9_CHIPD/30-146-------IYE--G---D---T-------D-------R-------L-G---------NI----L-----------Y-----
Q47ZG0_COLP3/35-153-------AAN--G---D---Q-------K-------L-------L-S---------KA----F-----------D-----
A9AXY9_HERA2/8-126-------QHN--L---D---P-------A-------Q-------M-Q---------RS----I-----------H-----
Q9A9W5_CAUCR/33-150-------QLE--G---D---T-------A-------R-------V-T---------RA----L-----------H-----
B4RCF3_PHEZH/43-158-------QLE--G---D---P-------A-------R-------V-A---------RA----L-----------H-----
C1AE73_GEMAT/307-421-------HAT--G---Q---E-------A-------H-------F-R---------RA----F-----------A-----
Q0JYS5_CUPNH/10-124-------HIT--G---K---A-------E-------F-------M-Y---------KA----F-----------A-----
Q9F3P6_STRCO/275-388-------HAT--G---D---P-------G-------H-------F-R---------DA----F-----------L-----
C7QIJ7_CATAD/267-380-------HAT--G---D---P-------A-------H-------F-R---------EA----F-----------L-----
A3HY18_9BACT/11-124-------MIE--R---D---K-------S-------K-------L-E---------KA----F-----------I-----
Q1H3V3_METFK/8-121-------AES--G---T---G-------E-------E-------M-S---------AA----F-----------H-----
C5FTM8_ARTOC/16-127-------LKT--G---N---I-------E-------H-------S-R---------QG----F-----------H-----
C7PBA6_CHIPD/41-154-------LRL--G---D---V-------A-------K-------L-K---------KA----F-----------H-----
A5VE46_SPHWW/17-129-------ARA--G---D---S-------G-------P-------M-R---------EV----F-----------S-----
Q5LUH0_RUEPO/5-117-------MTR--G---D---R-------P-------A-------L-E---------RI----F-----------F-----
Q2KDJ8_RHIEC/2-116-------MAF--A---N---A-------A-------A-------L-K---------KA----F-----------H-----
B9J7G6_AGRRK/2-116-------MAF--A---N---E-------P-------A-------L-R---------KA----L-----------H-----
C3MCQ3_RHISN/2-116-------MAF--A---N---E-------A-------A-------L-R---------KA----F-----------H-----
B8FB72_DESAA/6-121-------MYY--G---D---V-------A-------R-------L-E---------KA----F-----------H-----

PF12870

B2TQV7_CLOBB/21-124-------VKK--G---E---N-------A-------D-------F-S---------KL----L-----------N-----
B9L7K8_NAUPA/17-130-------FMT--G---D---V-------E-------S-------F-N---------KY----A-----------T-----
A8ETE1_ARCB4/19-125-------VKE--G---N---V-------E-------D-------Y-H---------KY----S-----------T-----
B4EXW7_PROMH/19-133-------VAS--G---D---G-------D-------K-------A-V---------SL----M-----------Y-----
Q7VHU7_HELHP/20-130-------AYK--G---N---G-------D-------R-------L-I---------KY----I-----------H-----
D3Q127_STANL/126-231-------LED--G---D---Y-------A-------A-------F-K---------EA----L-----------C-----
B1MHS8_MYCA9/118-217-------LSK--G---D---A-------E-------A-------A-L---------SY----S-----------A-----
C7PUV8_CHIPD/19-120-------IQE--S---N---F-------D-------L-------A-R---------DY----A-----------T-----
Y142_AQUAE/19-135-------IAE--G---E---G-------R-------D-------A-I---------KY----L-----------Y-----
B4U8X6_HYDS0/35-135-------IEN--G---D---F-------K-------D-------A-A---------KL----L-----------N-----

PF00866

Q9I0W9_PSEAE/15-157-------QFD--E---Q---C---------------E-------FHL---------PQ----W-----------E-----
Q9I0W5_PSEAE/14-156-------LYA--A---D---A---------------S-------FWM---------PS----W-----------D-----
BPHA2_RHOJR/32-181-------LLA--E---D---I---------------H-------YFM---------PI----R-----------T-----
BENB_ACIAD/21-163-------CYA--P---Q---A---------------S-------FWM---------PA----W-----------D-----
ANTDB_ACIAD/15-157-------LYD--E---D---S---------------E-------YHI---------PQ----W-----------I-----
HCAF_ECOLI/19-166-------QLD--E---E---I---------------R-------YTM---------RT----T-----------V-----
Q9I230_PSEAE/22-162-------LFE--R---A---A---------------R-------YRV---------LP----L-----------Q-----
A0AWN1_ARTS2/49-192-------RIA--E---D---V---------------H-------YLM---------PV----R-----------V-----
A1T2D2_MYCVP/20-161-------LLD--P---D---I---------------R-------YVV---------PV----R-----------T-----
A1WAE7_ACISJ/40-186-------CVA--P---E---I---------------K-------YQV---------IS----R-----------E-----
A4XDR9_NOVAD/19-159-------YAE--E---D---Q---------------A-------SYY---------CR----A-----------A-----
A4XDS6_NOVAD/23-168-------MLG--K---D---V---------------S-------YRL---------EL----K-----------S-----
A4XDS8_NOVAD/30-176-------MLA--E---D---L---------------H-------YHM---------PG----I-----------E-----
A4XDU7_NOVAD/18-157-------LYH--E---E---A---------------E-------YWV---------PA----W-----------D-----
A4XDY2_NOVAD/23-167-------VIA--E---D---I---------------H-------YWM---------PV----Y-----------E-----
A5V4P0_SPHWW/21-169-------LFT--E---D---V---------------R-------YWM---------PL----R-----------R-----
A5VGV9_SPHWW/24-171-------LIA--E---D---I---------------H-------YAV---------PA----R-----------E-----
A9I2P3_BORPD/32-180-------LLA--A---D---I---------------H-------YFM---------PI----R-----------T-----
E7FJB3_9BURK/38-186-------LLE--Q---D---I---------------H-------YWM---------PI----R-----------T-----
G8ML34_9BURK/14-155-------CYA--E---D---V---------------T-------YWM---------PA----W-----------D-----
K0C5V9_CYCSP/30-185-------LLD--D---D---I---------------H-------YYM---------PI----R-----------R-----
BPHE_BURXL/33-181-------LLD--K---D---I---------------H-------YFM---------PL----R-----------T-----
S6AQB4_PSERE/15-156-------MFS--D---D---S---------------E-------FHL---------PQ----W-----------D-----
S6BQW5_PSERE/33-166-------LFT--D---S---G---------------M-------YWA---------PQ----Q-----------H-----

PF02982

SCYD_ASPFU/9-168-------YDA--K---D---W-------D-------R-------L-R---------SI----I-----------A-----
SCYD_MAGO7/10-169-------YDS--K---D---W-------D-------R-------L-R---------KV----I-----------A-----
SCYD_COLOR/7-166-------YDS--K---D---W-------D-------R-------L-R---------KC----I-----------A-----

PF12707

Q46H33_PROMT/23-149-------SQN--K---T---F---------------L-------L-A---------NT----T-----------N-----
Q46KI2_PROMT/2-129-------ERM--G---S---F---------------F-------L-D---------NA----T-----------A-----

PF05223

X1XHQ7_ACYPI/24-139------------K---N---V-------K-------Q-------V-F---------KN----S-----------T-----
Q8Y9T2_LISMO/44-163------------E---K---Y-------D-------K-------L-G---------GS----V-----------S-----
Q97D06_CLOAB/26-144------------N---D---Y-------K-------T-------M-Y---------SI----L-----------S-----
Q8NP18_CORGL/32-140------------Q---D---F-------D-------T-------I-A---------DI----T-----------D-----
Q9F2L0_STRCO/54-166------------G---R---L-------P-------S-------A-A---------AR----T-----------T-----
Q9K7H2_BACHD/27-156------------E---D---Y-------G-------Q-------M-Y---------HM----L-----------S-----
PBPC_BACSU/26-148------------Q---Q---F-------D-------D-------M-Y---------QS----L-----------T-----
Q9CBU6_MYCLE/35-143------------G---D---T-------A-------T-------A-A---------QL----S-----------D-----
B5GLC4_STRC2/58-167------------G---D---A-------P-------T-------A-A---------GL----T-----------D-----
H7C6V7_ENTFA/46-164------------Q---E---F-------D-------K-------L-P---------SV----V-----------Q-----
I6TCQ1_ENTHA/44-162------------G---D---Y-------K-------K-------A-M---------SY----T-----------Q-----
Q3XZN6_ENTFC/44-162------------G---D---Y-------N-------K-------A-A---------EM----T-----------S-----
Q81E03_BACCR/24-142------------Q---K---F-------A-------D-------M-Y---------DQ----L-----------S-----

PF12883

D9QJI7_BRESC/62-179-------GPK--G---E---............QPAPG....---Q-E---------PL----Y-----------S-----
H2IPN3_RAHAC/22-145-------TTF--A---G---......DTPPPKYDSAV....---M-K---------KY----I-----------A-----
I0K6B0_9BACT/55-189-------LTL--N---Q---EKLERYLARFAASNFV.....---S-R---------EF----I-----------A-----
B8HJZ2_CYAP4/26-146-------QDR--L---R---............QKLSQ....---Q-K---------DL----F-----------E-----
A8AER7_CITK8/22-144-------NVF--A---N---......SEGKIKPAPEK....---M-D---------EY----I-----------S-----
A8ADQ6_CITK8/22-144-------KTF--T---E---......DQDTPHDKSAL....---M-Q---------RY----V-----------A-----
A7MF41_CROS8/40-159-------RSQ--G---L---............TNLTS....---L-R---------PY----L-----------S-----
A7MM23_CROS8/24-142-------KGN--.---.---........EPVDFASKG....---E-Q---------QI----L-----------S-----
H2J156_RAHAC/32-164-------QLY--F---K---.........IVPPEAPAFKKL---M-Q---------NN----I-----------T-----
YBJP_ECOLI/41-154-------LHR--S---.---............NDITA....---L-R---------PY----L-----------S-----
YQHG_ECOLI/25-143-------SDA--T---A---..........PYFGETG....---E-R---------AI----T-----------S-----
Q8ZNB4_SALTY/23-142-------TTF--T---N---......DVNTPDDTTAL....---M-Q---------RY----V-----------A-----

PF16022

F8EKS0_RUNSL/32-137------------G---N---A-------H-------T-------L-A---------GH----F-----------E-----
A3HU78_9BACT/72-173------------N---S---S-------S-------D-------L-A---------RY----F-----------E-----
R5IFV9_9BACT/37-138------------G---D---A-------E-------C-------L-A---------AW----F-----------A-----
A6LDQ2_PARD8/22-123------------G---N---A-------S-------S-------L-S---------GA----M-----------D-----
C7PFY9_CHIPD/35-137------------G---D---A-------G-------A-------L-S---------RY----L-----------D-----
D0MG74_RHOM4/34-135------------G---D---A-------A-------R-------L-L---------EQ----A-----------P-----
R7JG97_9PORP/50-151------------G---N---A-------T-------N-------L-Q---------TC----M-----------D-----
X5E2C2_9BACT/31-135------------G---D---A-------K-------V-------L-S---------TY----F-----------N-----
F4KWM2_HALH1/20-123------------G---N---V-------T-------A-------L-E---------PY----L-----------D-----
C6XS70_PEDHD/36-138------------G---N---A-------K-------E-------I-A---------AN----F-----------S-----
E4T0J0_PALPW/28-125------------G---G---A-------G-------Q-------L-S---------AH----L-----------S-----
U5Q3W3_9BACT/29-130------------G---D---S-------E-------K-------L-S---------AW----F-----------A-----
Q5LFI3_BACFN/25-126------------G---N---S-------Q-------E-------L-N---------RY----L-----------G-----
G8TMR5_NIAKG/25-126------------G---N---A-------N-------Q-------L-S---------KY----F-----------D-----
I4AH41_FLELS/32-134------------A---S---T-------K-------E-------L-V---------KL----C-----------H-----
H1Y7M9_9SPHI/24-125------------S---S---W-------A-------E-------L-C---------KA----F-----------A-----
W0F4P0_9SPHI/48-149------------G---N---A-------A-------Q-------V-A---------GN----V-----------G-----
R6XTN3_9BACT/30-131------------G---D---A-------E-------R-------L-S---------AW----F-----------D-----
R5BZN7_9BACE/25-126------------G---S---P-------K-------G-------L-T---------RY----M-----------G-----
I6YSP9_MELRP/18-124------------G---S---I-------D-------R-------F-S---------NY----F-----------A-----
F4C3S4_SPHS2/29-131------------G---N---S-------K-------E-------L-S---------FY----L-----------S-----
I0KEK5_9BACT/11-116------------G---E---A-------K-------R-------L-A---------SY----F-----------D-----
D6D570_9BACE/25-126------------G---S---S-------Q-------E-------L-S---------KY----M-----------G-----
R5I3V3_9PORP/34-135------------G---D---T-------A-------K-------L-V---------QV----M-----------S-----
R6LFP6_9BACE/25-126------------G---N---S-------Q-------E-------L-N---------RY----L-----------G-----
I2EQ77_EMTOG/47-152------------G---N---S-------R-------M-------L-A---------SC----L-----------N-----
R6ET03_9BACE/32-132------------G---D---A-------E-------K-------L-S---------AW----F-----------D-----
H8KRH1_SOLCM/26-128------------A---N---T-------R-------E-------I-S---------KY----L-----------N-----
G0IWX7_CYCMS/28-130------------G---S---S-------K-------A-------L-S---------SF----L-----------G-----
R6FI22_9BACE/25-126------------G---N---S-------Q-------E-------L-G---------KY----W-----------G-----
L0FWK7_ECHVK/16-116------------G---S---S-------K-------D-------L-A---------AF----F-----------D-----
F0SAG7_PSESL/32-134------------G---D---V-------K-------S-------M-S---------GY----F-----------A-----
R6XEI4_9PORP/23-123------------G---N---V-------S-------S-------L-S---------GS----M-----------D-----
E4TVS0_MARTH/30-131------------G---S---S-------K-------E-------L-S---------QH----F-----------H-----
F3ZTQ1_9BACE/24-125------------G---Q---A-------S-------L-------L-T---------NH----L-----------S-----
I0ALN7_IGNAJ/34-140------------G---N---V-------P-------R-------L-S---------KY----L-----------G-----
W8EV60_9BACT/29-129------------S---S---S-------H-------D-------L-A---------QF----F-----------A-----
R5C1N0_9BACE/30-131------------G---D---T-------E-------S-------L-A---------AW----F-----------D-----
Q2S4T9_SALRD/45-150------------G---N---A-------R-------R-------L-L---------TP----S-----------A-----
D2QTL0_SPILD/27-131------------G---D---A-------G-------R-------L-S---------AR----F-----------A-----
I3Z3H9_BELBD/27-126------------G---S---S-------K-------D-------L-A---------KH----F-----------E-----
R7DFE2_9PORP/25-126------------G---D---V-------Q-------C-------L-E---------KY----M-----------E-----
F2II17_FLUTR/23-125------------E---D---A-------T-------K-------I-I---------SY----G-----------K-----
R6LE89_9BACE/25-126------------G---D---S-------Q-------E-------L-N---------GH----L-----------S-----
Q11NQ0_CYTH3/50-153------------A---N---S-------K-------E-------L-T---------TF----M-----------G-----

PF13026

A4AWI0_MARSH/19-104------------S---N---Y-------E-------D-------V.H---------NM----L---------..D-----
A6LM34_THEM4/24-113------------E---N---Y-------Q-------K-------A.L---------EL----S---------..S-----
A8F7I3_PSELT/24-115------------N---D---F-------E-------N-------A.Q---------KM----V---------..S-----
A9KL18_CLOPH/74-163------------E---N---F-------E-------E-------V.Y---------SY----L---------..E-----
B1I2Q6_DESAP/43-137------------D---D---Y-------D-------R-------F.F---------KD----F---------..S-----
B8E211_DICTD/27-115------------G---R---Y-------E-------E-------A.R---------DF----F---------..D-----
C3AGG3_BACMY/39-163------------R---D---V-------H-------N-------KYD---------EK----M---------..N-----
C8WGP2_EGGLE/123-216------------G---D---Y-------D-------K-------L.R---------PM----L---------..D-----
D4JFI6_9FIRM/118-209------------D---D---Y-------E-------A-------I.A---------NI----G---------..I-----
D6E741_9ACTN/49-139------------R---D---F-------D-------E-------V.A---------AR----W---------..D-----
D6E742_9ACTN/53-143------------R---D---Y-------D-------G-------L.A---------AL----F---------..G-----
D7AW34_NOCDD/95-184------------G---R---W-------S-------R-------V.T---------ER----F---------..D-----
E3GDE8_EUBLK/46-135------------Q---E---F-------D-------A-------I.A---------AE----V---------..S-----
E3GFD2_EUBLK/40-131------------G---D---Y-------A-------K-------A.A---------DD----F---------PYT-----
E6TQB5_BACCJ/33-124------------G---D---L-------E-------E-------V.V---------HD----F---------.FS-----
E6TQB6_BACCJ/58-147------------G---D---F-------E-------I-------A.Y---------DF----F---------..N-----
E6TY43_BACCJ/31-120------------E---N---F-------D-------E-------A.S---------AM----F---------..N-----
F0S9L8_PSESL/29-118------------N---K---F-------K-------E-------A.Q---------LF----F---------..D-----
F4CEB4_SPHS2/28-116------------S---N---Y-------K-------E-------A.L---------DL----T---------..S-----
F6D290_METPW/13-102------------A---D---F-------A-------A-------A.S---------SR----F---------..D-----
F6GEE1_LACS5/30-117------------Q---D---Y-------K-------A-------I.Y---------NM----L---------..N-----
G2MPX0_9ARCH/64-153------------E---S---F-------D-------E-------A.Y---------DY----A---------..S-----
G8LXF0_CLOCD/44-138------------R---D---S-------E-------G-------I.K---------AL----C---------..T-----
H1XTG9_9BACT/36-125------------A---Q---F-------D-------S-------A.V---------GY----M---------..D-----
H1ZC72_MYROD/29-115------------S---N---Y-------D-------K-------F.Y---------HR----F---------..S-----
Q73JX5_TREDE/37-132------------K---D---W-------E-------G-------I.R---------NL----S---------..T-----
Q8EMU8_OCEIH/26-113------------G---N---F-------E-------D-------V.R---------DS----Y---------.FS-----
D4M3N3_9FIRM/40-132------------G---D---F-------E-------T-------F.F---------NA----L---------..P-----
Q81P15_BACAN/37-125------------A---K---Y-------K-------E-------V.H---------EK----F---------..D-----
ESTD_THEMA/26-112------------E---N---F-------E-------S-------A.L---------NM----C---------..S-----
R5HS05_9FIRM/71-164------------E---D---F-------D-------S-------L.Q---------SL----V---------..V-----
R5QXD2_9FIRM/39-142------------M---G---.-------E-------A-------D.F---------QN----F---------SDM-----
R5TTD3_9FIRM/55-147------------K---D---Y-------E-------S-------W.K---------SR----F---------..A-----
R5W2J2_9BACE/28-117------------A---Q---S-------D-------S-------I.Y---------AC----F---------..D-----
R6ELK1_9FIRM/40-141------------M---D---.-------D-------E-------A.M---------DT----F---------RDM-----
R6EMC8_9FIRM/45-140------------Q---E---Y-------G-------K-------I.I---------EA----G---------..S-----
R6F505_9FIRM/119-211------------E---N---Y-------Q-------E-------I.K---------KL----S---------..I-----
R6LVU3_9FIRM/39-143------------G---S---I-------T-------S-------D.Q---------IT----E---------..M-----
R6PF09_9FIRM/42-138------------G---N---V-------E-------S-------VYN---------DI----F---------..S-----
R6UW08_9FIRM/46-137------------R---K---Y-------D-------K-------L.Q---------KD----Y---------AYD-----
W0EZS0_9SPHI/30-115------------A---Q---F-------D-------S-------I.F---------AM----F---------..S-----

PF16156

G2KS29_MICAA/81-180------------R---D---F-------R-------E-------N..---------.L----A-----------Q-----
F2IZS6_POLGS/37-137------------N---D---A-------A-------G-------A.Y---------AL----A-----------T-----
Q1GEC2_RUEST/29-128------------N---D---M-------G-------T-------A.F---------GF----A-----------S-----
A8LR20_DINSH/25-124------------D---D---F-------A-------Q-------A.F---------SY----A-----------S-----
Q5LW85_RUEPO/25-124------------D---D---F-------A-------T-------A.F---------TF----A-----------S-----
Q28L79_JANSC/39-138------------G---A---L-------L-------D-------A.W---------QY----A-----------S-----
Q7NLT4_GLOVI/45-142------------G---D---Y-------A-------K-------A.Y---------TF----A-----------S-----
Q6MA17_PARUW/75-172------------N---E---I-------S-------K-------AYY---------EY----T-----------S-----
B2J495_NOSP7/11-111------------D---D---A-------Q-------G-------A.F---------AF----A-----------S-----
Q8YXC7_NOSS1/11-111------------D---D---A-------P-------S-------A.F---------AC----A-----------A-----
D7BFD2_MEISD/33-133------------D---D---A-------V-------R-------A.F---------SF----A-----------A-----
A1VLU3_POLNA/45-145------------D---D---A-------R-------A-------A.F---------SF----A-----------A-----
F5Y526_RAMTT/37-137------------D---D---A-------D-------R-------A.F---------AT----T-----------T-----
B1M6C1_METRJ/27-128------------D---D---A-------Q-------T-------A.Y---------EQ----A-----------A-----
B9JFB3_AGRRK/27-129------------N---D---A-------A-------T-------A.Y---------SF----A-----------A-----
C3MD33_RHISN/28-126------------D---D---P-------E-------T-------A.Y---------SF----A-----------S-----
E4PHZ6_MARAH/39-138------------N---D---E-------E-------Q-------A.W---------AH----A-----------S-----
K9VG60_9CYAN/11-111------------D---D---A-------A-------G-------A.F---------AF----A-----------S-----
Q16AU9_ROSDO/25-124------------D---D---F-------A-------Q-------A.M---------EY----A-----------S-----
Q98M58_RHILO/71-171------------D---D---G-------A-------K-------A.Y---------SF----A-----------A-----

PF07366

Q92YL1_RHIME/6-127N------R----Q---A---W---------------....D-E-L--G--------HF----V---------D-N-----
Q81HA2_BACCR/57-169N------K----H---N---I---------------....D-I-I--P--------KY----V---------S-E-----
Q82GA1_STRAW/11-139N------S----G---D---L---------------DIISK-A-I--D--------EF----V---------A-P-----
G3XDB6_PSESM/4-125N------D----R---S---W---------------....H-Q-L--G--------NF----V---------D-D-----
Q7P1G6_CHRVO/10-136E------N----G---D---M---------------....A-A-F--A--------EL----V---------A-P-----
Q7NU92_CHRVO/45-170N------T----G---D---P---------------....R-Y-A--E--------LA----L---------D-P-----
Q98IW1_RHILO/4-125N------N----Q---D---W---------------....Q-R-L--H--------RF----V---------H-D-----
Q8TQG8_METAC/22-156N------S----Q---D---W---------------....D-T-F--E--------KR----H---------T-E-----
Q8E9W0_SHEON/78-203D------T----G---D---P---------------....R-F-A--H--------WA----L---------A-T-----
Q7CRD4_AGRFC/5-126N------H----Q---A---F---------------....D-E-L--G--------TF----V---------D-D-----
Q82DI4_STRAW/115-241T------E----G---E---L---------------....P-P-L--N--------DV----M---------A-E-----
Q7NP31_GLOVI/43-169N------R----R---N---L---------------....A-L-A--D--------EL----V---------T-P-----
Q1CYG6_MYXXD/36-152N------L----R---M---L---------------....D-R-I--P--------EF----I---------A-E-----
Q8YNM4_NOSS1/8-132D------L----G---D---I---------------....E-K-G--K--------TF----V---------A-S-----
Q8YQT8_NOSS1/6-132S------S----G---N---V---------------....E-S-F--L--------SL----F---------A-E-----
A0A0E1QP56_BORBO/18-131D------E----.---.---.---------------....N-P-V--R--------DE----V---------A-G-----
Q8GPW3_PSEAI/8-133N------A----A---K---F---------------....D-A-L--Y--------DL----C---------S-E-----
Q6LKM5_PHOPR/2-132N------R----G---D---V---------------....S-G-A--D--------EA----F---------A-T-----
Q7NYY8_CHRVO/8-137S------G----R---D---P---------------....D-A-A--G--------RY----L---------A-A-----
Q63FG7_BACCZ/60-176D------T----G---K---E---------------....E-L-L--S--------QT----V---------T-E-----
Q9RN64_STRNO/8-132N------R----W---D---V---------------....S-G-V--V--------AH----W---------A-P-----
Q8KY43_STRCU/149-275S------E----H---R---L---------------....E-L-A--E--------RY----Y---------H-Q-----
DNRD_STRPE/5-133N------T----G---K---T---------------....D-D-V--A--------EF----I---------H-L-----
Q9I3U3_PSEAE/7-128N------R----Q---D---W---------------....A-R-L--G--------DF----V---------H-D-----
DNRD_STRGJ/5-132N------T----G---K---T---------------....D-D-V--A--------DY----I---------H-P-----
Q98JP4_RHILO/22-156E------T----C---D---L---------------....S-V-V--D--------DI----A---------A-P-----
Q7NGE5_GLOVI/21-149N------P----G---W---E---------------....K-I-W--D--------EL----I---------D-P-----
Q63TL7_BURPS/56-181H------N----G---D---P---------------....A-L-A--R--------AA----L---------A-D-----
Q82M76_STRAW/10-135Q------S----G---D---L---------------....D-A-C--V--------EL----L---------T-E-----

PF12680

B5I6W1_9ACTN/1-115T......H----P...D...L---------------....K.V.I-.A........DL....Y--------.A.Q-----
B5HJN5_STRPR/117-228A......G----G...N...L---------------....N.A.I-.D........EV....F--------.A.T-----
B5H8J2_STRPR/32-138A......A----G...D...M---------------....N.T.L-.S........EL....I--------.T.A-----
C5CZF1_VARPS/22-124R......H----K...D...A---------------....A.A.I-.R........EL....V--------.A.P-----
C5CZF1_VARPS/148-250Q......R----H...D...P---------------....T.A.L-.P........EL....I--------.A.A-----
B2J517_NOSP7/10-126N......E----G...N...I---------------....T.T.L-.E........EI....C--------.G.P-----
B2J517_NOSP7/165-276N......Q----G...K...L---------------....E.A.I-.D........EI....M--------.A.A-----
B5HLE5_9ACTN/167-263V......K----K...D...L---------------....S.A.L-.D........RY....W--------.G.P-----
D3ECJ4_GEOS4/142-239L......G----K...N...P---------------....D.L.L-.A........SY....F--------.D.G-----
Q5LLC2_RUEPO/32-126A......K----G...D...R---------------....D.F.I-.M........TH....V--------.A.E-----
Q5LLC2_RUEPO/163-259M......G----G...K...I---------------....D.R.I-.D........DY....I--------.A.E-----
C1D3J7_DEIDV/182-279V......H----G...R...M---------------....D.K.L-.T........AY....F--------.D.G-----
D2SCU4_GEOOG/6-119N......A----H...D...S---------------....A.A.V-.T........SF....W--------.A.D-----
B5HLM0_9ACTN/9-102G......Q----K...D...P---------------....S.A.V-.D........RW....V--------.A.A-----
B5HLM0_9ACTN/139-235V......G----A...D...Y---------------....S.V.L-.T........DY....I--------.STE-----
A5V525_SPHWW/7-105N......R----L...D...E---------------....D.R.I-.Y........GL....M--------.A.E-----
B9L3S7_THERP/14-118N......R----G...D...L---------------....E.T.A-.L........GY....C--------.A.D-----
B4RFR1_PHEZH/28-128S......R----L...D...P---------------....E.E.L-.A........GF....F--------.A.E-----
A7HS76_PARL1/16-117Q......K----R...D...I---------------....P.G.I-.M........DC....F--------.A.P-----
A6X4Q6_OCHA4/11-117N......R----H...D...I---------------....D.A.I-.M........AF....F--------.A.D-----
C7PVH3_CATAD/11-120R......D----G...D...T---------------....E.T.I-.V........AS....F--------.A.E-----
B0C0J0_ACAM1/35-144D......R----G...E...F---------------....S.A.L-.E........HL....Y--------.D.D-----
B0C0J0_ACAM1/185-295E......E----K...D...M---------------....E.K.F-.A........SV....W--------.S.M-----
Q1D9P4_MYXXD/10-115N......A----Y...D...V---------------....D.A.L-.V........AL....Y--------.A.E-----
A5VCT4_SPHWW/11-120N......A----G...D...I---------------....A.A.A-.F........AT....L--------.S.P-----
C7Q8T1_CATAD/8-117A......E----G...D...Q---------------....Q.T.I-.R........DC....W--------.A.E-----
B0T3P4_CAUSK/9-118V......K----G...D...L---------------....D.G.L-.F........ST....M--------.T.D-----
C5CRN6_VARPS/10-123A......S----R...D...P---------------....Q.R.I-.A........SW....F--------.T.E-----
B7KBU4_CYAP7/7-120N......A----H...D...L---------------....D.T.V-.V........SM....I--------.S.P-----
C4ZJ89_THASP/28-128T......P----A...A...L---------------....P.G.L-.D........QL....Y--------.A.P-----
A5VDX7_SPHWW/10-121E......T----R...D...S---------------....Q.A.F-.F........EL....F--------.H.H-----
D2B1F4_STRRD/9-111N......R----H...D...P---------------....G.E.I-.A........AC....V--------.T.P-----
B8ES54_METSB/10-116G......R----G...D...R---------------....E.A.L-.L........AL....V--------.A.E-----
Q0S9H2_RHOJR/9-118N......N----D...R...K---------------...NE.I.A-.E........EL....F--------.S.S-----
B9LPI7_HALLT/13-109D......T----G...D...Y---------------....D.R.L-.A........TL....L--------.A.P-----
C7Q9Y2_CATAD/16-124S......A----K...D...I---------------....A.A.W-.A........DL....W--------.H.P-----
A5VBH5_SPHWW/11-110D......K----G...D...P---------------....E.M.V-.V........AL....F--------.A.A-----
B1MD21_MYCA9/14-115R......R----S...D...L---------------....A.A.L-.D........AL....L--------.E.D-----
D1CA95_SPHTD/7-116N......R----R...D...P---------------....D.A.I-.M........AT....F--------.A.E-----
Q88PF6_PSEPK/7-118N......A----G...D...M---------------....P.A.F-.L........AL....L--------.S.E-----
Q5QV19_IDILO/10-113K......T----E...N...L---------------....D.D.L-.D........EL....Y--------.H.D-----
C5BYA4_BEUC1/11-106S......A----R...D...W---------------....T.G.L-.G........EL....I--------.A.E-----
A5VCU3_SPHWW/39-148E......R----G...D...M---------------....A.A.L-.E........RL....I--------.A.P-----
E4NSQ6_HALBP/19-128T......E----G...G...L---------------....A.A.A-.D........EV....L--------.A.E-----
Q7NE84_GLOVI/10-111L......A----A...D...G---------------....E.A.F-.A........NL....F--------.T.E-----
Q5Z059_NOCFA/9-111G......S----G...P...T---------------....Q.G.I-.V........DL....Y--------.T.E-----
A8LIY8_DINSH/16-139EGA..MAA----D...K...A---------------....A.A.L-.A........DH....V--------.A.P-----
A8LIY8_DINSH/193-315NRS.GNDR----A...G...I---------------....E.M.L-.R........AS....W--------.H.D-----
A5VFS9_SPHWW/9-116G......A----G...D...V---------------....P.G.A-.M........AL....L--------.A.P-----
B5HJE1_STRPR/10-115S......A----G...D...M---------------....E.A.L-.A........EV....F--------.H.P-----
B5HVP3_9ACTN/16-111E......A----R...D...W---------------....T.A.F-.A........DT....L--------.A.E-----
D2Q2I7_KRIFD/11-105N......G----R...A...W---------------....E.E.F-.A........AL....L--------.A.E-----
Q1R0D2_CHRSD/10-113D......K----R...C...T---------------....R.S.L-.E........NL....Y--------.T.E-----
D0L730_GORB4/10-111A......R----D...D...I---------------....D.A.A-.M........AN....L--------.D.D-----
Q0BQA1_GRABC/9-124N......A----G...D...E---------------....A.A.F-.L........AL....L--------.T.D-----
Q31QW3_SYNE7/11-117N......R----G...D...L---------------....A.A.L-.K........AL....L--------.A.E-----
Q0RE76_FRAAA/8-122D......A----G...D...E---------------....A.A.V-.H........AL....L--------.D.D-----
A2SCA2_METPP/13-116T......R----A...D...L---------------....P.R.L-.G........EI....Y--------.T.E-----
C5CK59_VARPS/9-108M......D----G...D...F---------------....E.G.F-.L........KF....C--------.T.E-----
D2B0D7_STRRD/15-117G......R----R...D...A---------------....D.A.M-.E........RC....Y--------.H.P-----
A1VLA0_POLNA/8-116G......R----G...D...V---------------....P.A.M-.L........NL....V--------.A.D-----
Q1CVT2_MYXXD/62-168AKL..EKE----G...D...L---------------....E.A.L-.V........SL....F--------.S.D-----
Q9EWM1_STRCO/9-118L......A----K...D...M---------------....N.A.V-.A........DL....W--------.A.P-----
D2BAU3_STRRD/10-116A......K----G...D...L---------------....D.H.V-.R.......DNL....L--------.A.D-----
B0C619_ACAM1/7-113N......E----H...D...I---------------....D.K.I-.M........KF....M--------.T.E-----
D7AYQ5_NOCDD/12-122G......R----Q...D...P---------------....D.G.I-.Q........EL....F--------.A.E-----
A1SCF9_NOCSJ/9-115N......A----G...S...P---------------....E.R.F-.D........EV....C--------.S.P-----
D5UVL3_TSUPD/13-113G......S----G...D...F---------------....E.I.A-.E........QL....L--------.A.K-----
D3QAD1_STANL/13-107S......G----G...D...F---------------....D.K.A-.M........TH....L--------.S.P-----
D3STL0_NATMM/24-125D......D----E...R...Y---------------....D.D.L-.V........EL....F--------.T.E-----
A9CHA2_AGRFC/13-121F......K----K...D...V---------------....E.K.T-.L........QC....L--------.T.E-----
B5HLL8_9ACTN/11-108N......Q----C...R...P---------------....A.E.A-.I........HQ....Y--------.A.G-----
C6VS31_DYAFD/7-118N......A----K...N...W---------------....K.G.M-.L........AL....L--------.H.P-----
Q01YM1_SOLUE/9-121N......Q----G...R...E---------------....A.A.V-.D........EL....F--------.A.A-----
Q7NU42_CHRVO/10-117S......E----D...N...G---------------....R.N.L-.L........AA....L--------.A.P-----
Q0S852_RHOJR/10-121D......A----G...N...I---------------....D.A.L-.D........EL....V--------.D.E-----
Q0SDB9_RHOJR/13-126D......A----H...D...F---------------....D.R.V-.E........SM....L--------.D.P-----
A8I8X5_CHLRE/91-196N......A----G...D...I---------------....D.T.I-.A........GL....L--------.A.P-----
Q89WH5_BRADU/12-118E......Q----R...N...G---------------....R.A.F-.A........DL....F--------.I.K-----
Q7NFQ8_GLOVI/11-120N......Q----K...R...E---------------....A.V.L-.D........EI....I--------.S.P-----
A4FI35_SACEN/11-114T......A----G...D...V---------------....E.G.I-.L........EL....F--------.E.P-----
Q1IJ26_KORVE/10-115N......R----R...D...V---------------....E.A.V-.L........AH....F--------.A.D-----
A5V9B3_SPHWW/11-114G......S----G...D...V---------------....D.A.Y-.L........AT....F--------.A.P-----
Q7NT36_CHRVO/13-113T......P----D...T...L---------------....P.D.I-.G........RY....Y--------.A.E-----
C1A2X0_RHOE4/8-108T......D----F...D...V---------------....D.A.A-.A........EL....M--------.T.D-----
B5HZI5_9ACTN/16-126N......T----G...N...E---------------....D.L.A-.R........EV....I--------.S.P-----
Q89DK6_BRADU/65-174A......R----G...D...I---------------....E.A.A-.L........SC....C--------.T.D-----
B0C5C3_ACAM1/11-121E......A----E...N...P---------------....E.Q.V-.A........TF....F--------.A.E-----
A4XEU5_NOVAD/14-116N......A----G...D...A---------------....A.G.V-.T........AL....F--------.A.P-----
Q0RK85_FRAAA/9-111V......E----R...D...Y---------------....D.A.A-.A........SY....V--------.A.A-----
B1LXB4_METRJ/10-119N......G----G...Q...F---------------....D.A.F-.P........EV....V--------.A.P-----
Q1IJH6_KORVE/7-113N......A----K...N...P---------------....A.A.I-.Q........QV....V--------.A.D-----
B5HUL8_9ACTN/35-145T......R----G...D...L---------------....S.A.V-.D........VY....L--------.A.E-----
C7PJ94_CHIPD/8-108R......K----K...D...H---------------....E.M.V-.M........SC....L--------.T.D-----
B8HNZ9_CYAP4/16-120R......G----S...N...L---------------...VE.D.M-.V........AC....F--------.A.P-----
Q8ETH3_OCEIH/11-113N......E----G...N...S---------------....E.K.V-.I........SL....F--------.A.E-----
B4EGT8_BURCJ/14-120N......R----H...D...A---------------....H.A.L-.M........GF....M--------.T.E-----
C5CTR3_VARPS/11-118D......Q----G...N...G---------------....Q.F.F-.I........DS....L--------.A.D-----
A1SE82_NOCSJ/305-416A......S----S...D...F---------------....D.T.L-.L........DC....F--------.A.D-----
A1T7R4_MYCVP/21-154A......E----Q...D...F---------------....D.T.F-.E........SL....A--------.A.P-----
Q0ATM8_MARMM/33-142A......V----G...D...V---------------....P.A.F-.T........AL....L--------.D.P-----
A4VYE6_STRSY/19-125I......A----G...D...F---------------....A.A.L-.F........ET....M--------.A.D-----
Q0AK67_MARMM/68-179A......R----Q...D...F---------------....D.R.M-.R........SL....M--------.T.A-----
D1A779_THECD/12-112D......A----H...R...L---------------....E.E.M-.L........AL....F--------.D.E-----
B9M2F6_GEODF/33-141V......K----K...D...L---------------....S.E.V-.E........RY....V--------.R.A-----
B0RBH4_CLAMS/76-179PDP..ASA----G...A...Q---------------....A.A.V-.L........AA....V--------.A.P-----
B0RBH4_CLAMS/225-319R......D----H...D...A---------------....S.V.L-.D........RS....F--------.D.P-----
Q82NK0_STRAW/12-119A......A----H...D...V---------------....D.A.I-.V........GL....Y--------.A.E-----
B5I3N5_9ACTN/17-126L......D----K...N...I---------------....P.A.W-.V........DL....W--------.A.E-----
C5CWJ6_VARPS/7-113Q......S----G...D...Q---------------....A.L.L-.A........SL....I--------.S.P-----
B8HUP3_CYAP4/10-119D......D----R...Q...L---------------....E.R.A-.M........EL....L--------.T.A-----
YESE_BACSU/13-122L......E----K...D...M---------------....K.S.W-.T........EL....W--------.D.E-----
Q0RZ59_RHOJR/13-116N......A----H...D...L---------------....D.A.V-.V........DC....F--------.A.S-----
C0ZMD1_RHOE4/13-113D......V----M...D...W---------------....A.R.V-.V........DL....F--------.A.E-----
E4NS77_HALBP/17-126G......D----G...G...L---------------....D.V.L-.G........DL....Y--------.A.P-----
A0LVM2_ACIC1/13-121T......T----G...D...S---------------....I.L.V-.D........QA....L--------.A.P-----
A9B4R1_HERA2/9-105Q......T----N...D...F---------------....V.A.V-.G........SV....L--------.H.D-----
B1MKK2_MYCA9/12-112T......S----G...T...A---------------....A.Q.I-.A........DL....Y--------.A.D-----
A1AMJ6_PELPD/11-123N......R----R...D...V---------------....S.T.F-.L........SS....W--------.A.E-----
Q0RKU0_FRAAA/7-102N......K----Q...D...T---------------....D.A.I-.L........AT....L--------.T.P-----
D1A9D6_THECD/22-131A......A----G...R...K---------------....D.E.W-.L........AL....F--------.A.P-----
Q6KYU6_PICTO/7-107D......S----R...D...L---------------....K.T.L-.F........SI....F--------.D.D-----
Q1CVW7_MYXXD/8-109Q......R----R...D...A---------------....Q.A.M-.A........AC....Y--------.H.P-----
D3Q1G6_STANL/8-116A......K----N...D...I---------------....D.G.L-.L........TL....I--------.A.D-----
C1D0F3_DEIDV/8-109Q......T----G...N...V---------------....D.A.L-.V........AL....H--------.A.P-----
Q1IMY1_KORVE/8-111N......Q----R...D...I---------------....D.G.V-.L........AL....M--------.T.E-----
Q2GAG8_NOVAD/26-123V......E----R...D...V---------------...KK.A.F-.E........AY....V--------.A.P-----
A4RY41_OSTLU/26-129N......A----R...D...V---------------....D.G.A-.L........AC....V--------.D.E-----
B6IUF4_RHOCS/9-114A......R----K...D...M---------------....D.T.I-.R........AL....V--------.H.P-----
Q0RWK4_RHOJR/10-112T......R----G...D...W---------------....D.A.L-.G........EF....I--------.A.A-----
Q6D2X2_PECAS/50-158A......E----G...K...L---------------....D.D.I-.V........SL....L--------.D.D-----
A1SQ29_NOCSJ/22-134A......K----G...D...L---------------....A.E.W-.L........TV....Y--------.A.E-----
B8GR64_THISH/14-117T......P----Q...S...L---------------....D.R.L-.D........EL....F--------.T.H-----
A5V474_SPHWW/7-117S......D----K...D...I---------------....D.R.L-.V........SL....F--------.T.P-----
Q28KZ3_JANSC/183-305H......V----Y...D...P---------------....D.S.F-.GSDGQVGAGGT....W--------.A.P-----
Q98HZ7_RHILO/7-115S......K----R...D...I---------------....V.G.A-.L........GH....C--------.S.D-----
D3SXC1_NATMM/13-124N......D----D...N...L---------------....D.M.I-.D........DL....V--------.T.D-----
B4RCM5_PHEZH/40-139N......A----Q...D...L---------------....D.A.F-.C........AF....Y--------.A.D-----
Q7NIX2_GLOVI/6-112QHT..EQS----G...D...V---------------....E.S.L-.V........NL....F--------.A.E-----
Q7NCT6_GLOVI/10-113A......A----M...N...V---------------....D.E.W-.L........TV....F--------.A.E-----
C7QIA1_CATAD/12-123V......E----G...S...R---------------....D.E.L-.A........DL....Y--------.A.E-----
D2PU42_KRIFD/7-118A......D----R...D...F---------------....A.A.L-.P........GL....Y--------.A.E-----
Q11RX8_CYTH3/10-111K......Y----K...D...A---------------....E.G.M-.V........SC....Y--------.H.D-----
Q15W82_PSEA6/7-110D......T----Q...S...L---------------....S.E.L-.K........NI....Y--------.S.D-----
D5URT3_TSUPD/13-113A......D----A...R...V---------------....E.D.A-.L........AA....F--------.D.E-----
C7PY66_CATAD/14-115G......A----G...D...I---------------....A.G.F-.T........EL....L--------.G.E-----
D1AZA9_SULD5/9-119N......E----Q...K...L---------------....D.Q.A-.H........HF....L--------.S.P-----
Q0RHL1_FRAAA/31-134A......A----G...D...V---------------....A.G.R-.E........AL....F--------.S.D-----
Q0REI6_FRAAA/9-118D......E----G...D...F---------------VGNMD.R.L-.L........AQ....F--------.A.E-----
Q0ALT6_MARMM/8-104D......A----R...D...L---------------....D.K.V-.S........RF....F--------.A.E-----
Q9RUP4_DEIRA/10-111D......S----A...D...Y---------------....D.R.L-.G........DV....F--------.A.A-----
Q5NW43_AROAE/11-116G......N----A...D...I---------------....A.Q.I-.V........DL....L--------.H.D-----
B5I914_9ACTN/103-211G......R----A...G...T---------------....A.E.L-.F........AR....F--------.A.D-----
D7BB21_MEISD/9-120N......R----G...D...L---------------....G.A.V-.D........EL....L--------.A.P-----
Q7CY40_AGRFC/43-140N......K----H...E...V---------------....A.K.G-.A........AV....I--------.V.D-----
A1SDP9_NOCSJ/7-110S......R----A...E...S---------------....E.A.A-.L........AL....L--------.D.A-----
C7PD65_CHIPD/5-107N......T----H...D...L---------------....E.A.I-.M........AH....Y--------.A.P-----
Q0W0Z9_METAR/28-139D......R----R...N...L---------------....A.V.I-.D........EL....V--------.S.E-----
Q0AK68_MARMM/36-153S......A----V...D...W---------------....D.G.M-.E........AL....L--------.A.E-----
A1T3J1_MYCVP/7-115EQ...PIS----K...V...P---------------....E.H.L-.R........ES....M--------.T.H-----
B2J333_NOSP7/11-117S......E----H...R...I---------------....E.D.I-.C........EM....T--------.A.P-----
Q161D9_ROSDO/27-138N......D----H...R...I---------------....D.D.I-.G........AF....F--------.A.E-----
Q1D054_MYXXD/25-142N......R----D...D...L---------------....D.A.V-.M........AY....F--------.T.P-----
D2Q4E8_KRIFD/10-119S......A----G...N...W---------------....E.A.M-.V........QG....M--------.A.P-----
A6W6K1_KINRD/24-129N......E----H...R...F---------------....D.D.L-.G........EF....V--------.S.E-----
D0LM99_HALO1/203-300R......R----Y...D...V---------------....A.A.L-.T........SL....L--------.H.E-----
A0JTQ5_ARTS2/14-118A......R----Y...D...L---------------....E.A.M-.V........SQ....F--------.A.D-----
C6W364_DYAFD/12-123A......E----G...N...L---------------....E.S.F-.K........EL....M--------.D.E-----
C1N6Y5_MICPC/11-117N......A----Q...D...A---------------....A.K.L-.R........EC....F--------.D.E-----
A8EWB0_ARCB4/10-120N......K----H...K...K---------------....E.Y.I-.D........IV....F--------.D.D-----
Q5YQ81_NOCFA/15-114E......L----G...A...V---------------....G.E.A-.L........EL....L--------.D.P-----
C1F799_ACIC5/9-124D......E----G...N...A---------------....D.A.V-.D........AY....L--------.A.P-----
D2QMN3_SPILD/5-118N......A----K...D...I---------------....P.A.M-.L........AL....L--------.D.D-----
A7HKH6_FERNB/25-126G......K----L...D...W---------------....S.H.L-.L........PY....Y--------.A.D-----
Q5DZG2_VIBF1/16-125N......K----H...T...L---------------....H.H.L-.S........EI....Y--------.S.Y-----
A1S3V2_SHEAM/29-141T......E----H...D...Y---------------....S.A.L-.A........RY....Y--------.N.R-----
A0R0F0_MYCS2/85-194Q......T----G...F...G---------------....E.T.F-.L........DR....L--------.S.D-----
Q2G4A7_NOVAD/14-111I......A----M...D...S---------------....S.A.V-.D........RY....I--------.A.P-----
Q6D526_PECAS/26-129T......T----E...G...L---------------....A.E.L-.G........EI....Y--------.H.Q-----
A5FVD4_ACICJ/16-117D......R----Q...D...A---------------....A.A.F-.A........SL....F--------.A.N-----
Q0U711_PHANO/9-119N......S----G...D...T---------------....K.I.G-.Q........EV....V--------.S.D-----
C7PMQ6_CHIPD/9-116Q......Q----G...D...N---------------....Q.T.L-.A........AL....L--------.D.P-----
D2PQZ2_KRIFD/10-123T......A----G...R...L---------------....D.V.M-.D........EI....A--------.S.P-----
Q2SB33_HAHCH/8-108K......D----K...D...Y---------------....R.T.M-.Q........AC....Y--------.H.D-----
Q2G9Q6_NOVAD/31-145R......S----G...R..AP---------------....E.K.T-.V........NY....L--------.A.P-----
C8XK42_NAKMY/10-121A......T----G...N...D---------------....A.I.V-.D........EL....C--------.S.P-----
D2SBX0_GEOOG/5-109N......A----H...N...V---------------....D.A.M-.V........EL....I--------.A.P-----
Q39TG5_GEOMG/5-106N......S----D...S...V---------------....D.G.L-.L........EL....W--------.N.D-----
B6IS60_RHOCS/17-111A......A----R...H...W---------------....D.T.V-.R........RL....V--------.A.E-----
B0T5N4_CAUSK/9-117S......A----G...P...E---------------P.LEQ.A.I-.R........DL....F--------.R.P-----
C6XZD6_PEDHD/13-122A......N----R...E...L---------------....E.K.L-.L........LL....F--------.S.T-----
D0LWT7_HALO1/7-120E......S----H...D...F---------------....D.Q.V-.A........RW....L--------.H.P-----
Q0SJC1_RHOJR/11-111D.......----T...D...I---------------....A.E.F-.F........DY....F--------.S.D-----
D0LQY4_HALO1/7-114T......R----D...D....---------------....A.R.W-.L........AL....F--------.A.D-----
Q82RJ4_STRAW/12-109E......R----G...D...V---------------....D.A.A-.V........AC....L--------.S.P-----
A4XCF3_SALTO/8-104N......T----H...N...L---------------....E.A.F-.V........NT....Y--------.A.P-----
B1VLR8_STRGG/5-111D......R----R...D...L---------------....D.A.L-.D........DL....F--------.T.E-----
Q0C649_HYPNA/6-119N......E----R...D...I---------------....D.A.M-.L........TY....V--------.T.D-----
D3EBN8_GEOS4/13-118N......Q----S...D...M---------------....D.S.T-.D........QF....L--------.S.P-----
C5BR99_TERTT/13-114N......G----T...R...L---------------....D.S.L-.P........NV....Y--------.D.S-----
Q1LC18_RALME/11-130WG....KN----P...N...L---------------....A.V.I-.D........EI....A--------.A.P-----
A9F1N2_SORC5/10-120H......R----R...N...V---------------....A.A.A-.D........DY....F--------.T.D-----
Q7NX64_CHRVO/8-108N......A----R...N...L---------------....D.A.F-.A........AC....Y--------.A.D-----
A6Q8S5_SULNB/27-140A......E----H...N...I---------------....S.K.I-.D........SY....Y--------.N.Q-----
Q0RTS8_FRAAA/10-121N......Y----G...K...A---------------....E.L.L-.E........TF....V--------.A.D-----
B2HF34_MYCMM/13-118A......A----H...D...R---------------....A.G.W-.V........SL....F--------.T.S-----
Q5LS60_RUEPO/15-118E......Q----G...D...V---------------....E.A.I-.D........QF....F--------.A.Q-----
C7NL72_KYTSD/199-297G......R----G...D...I---------------....T.A.V-.V........EL....F--------.T.A-----
Q0RWC3_RHOJR/94-208DSG.PPTG----K...E...L---------------....A.A.W-.K........DW....F--------.A.E-----
A4X2J9_SALTO/11-126N......E----N...N...L---------------....D.G.A-.M........AL....L--------.T.E-----
A9FU94_SORC5/4-110RRI..EES----G...D...V---------------....E.P.M-.A........RL....F--------.A.P-----
D5UXD3_TSUPD/41-136V......N----K...D...L---------------....A.G.A-.A.......HRY....I--------.G.D-----
B7G1I9_PHATC/141-251N......R----G...E...I---------------....D.L.I-.P........EV....C--------.S.P-----
Q144S2_BURXL/14-123E......Q----K...S...V---------------....A.L.L-.R........QV....V--------.T.P-----
Q0K1J6_CUPNH/7-120R......E----H...D...I---------------....N.G.M-.L........AM....F--------.S.Q-----
Q096A5_STIAD/35-145A......Q----H...R...L---------------....D.R.I-.P........VY....V--------.A.E-----
Q6DAK4_PECAS/16-123D......A----G...H...W---------------....E.K.A-.D........EL....L--------.S.A-----
Q8XQ60_RALSO/19-124N......T----L...D...I---------------....D.A.I-.V........AL....F--------.S.E-----
A0JX05_ARTS2/16-130E......A----G...G..GA---------------....A.E.V-.D........GF....L--------.A.E-----
A1TNK1_ACIAC/52-157E......S----G...Q...V---------------....E.L.A-.D........RY....M--------.K.E-----
Q01R35_SOLUE/14-114N......R----H...D...V---------------....E.A.L-.A........AL....M--------.T.T-----
D2AXD2_STRRD/7-110N......E----R...D...A---------------GRRRS.A.I-.D........AV....L--------.T.E-----
Q0APW6_MARMM/28-136S......S----E...D...A---------------....S.A.L-.A........QL....Y--------.T.E-----
Y3332_PSEAE/7-115E......N----G...D...A---------------....R.G.W-.C........DL....F--------.H.P-----
Q7NP00_GLOVI/24-117N......R----H...D...L---------------....T.A.L-.G........KL....F--------.H.P-----
A9U6M7_PHYPA/10-103N......T----G...D...V---------------....T.I.A-.D........EV....L--------.S.P-----
B6QL61_PENMQ/29-132D......K----Q...D...T---------------....S.L.I-.P........AL....I--------.H.S-----
Q2KTK8_BORA1/35-133E......E----H...Q...V---------------....EEA.V-.S........RY....V--------.D.R-----
B2HI14_MYCMM/11-120T......A----R...D...K---------------....Q.A.W-.L........AV....F--------.A.D-----
Q7P1D6_CHRVO/11-112N......S----H...D...L---------------....A.R.I-.L........AH....Y--------.R.D-----
Q1INA8_KORVE/18-129N......A----H...D...L---------------....D.G.V-.I........AT....F--------.G.A-----
B6IRE4_RHOCS/14-115T......P----D...T...L---------------....D.R.L-.D........RL....A--------.V.P-----
A8L6M7_FRASN/9-119.......A----G...E...G---------------....V.V.F-.A........DL....F--------.A.E-----
C5CYM4_VARPS/7-110E......S----G..AH...A---------------....Q.A.I-.E........DY....Y--------.T.E-----
B0C5C2_ACAM1/10-116D......A----Q...N...A---------------....D.G.L-.R........PF....L--------.A.D-----
Q5YR20_NOCFA/14-119L......A----H...D...K---------------....T.A.W-.V........RL....F--------.T.P-----
Q89SK5_BRADU/7-110E......D----G...D...F---------------...VG.A.I-.E........QF....Y--------.A.P-----
B9JZV5_AGRVS/9-119Q.....VG----G...N...Y---------------....A.V.F-.D........AL....M--------.H.P-----
C5CZ61_VARPS/13-119S......H----G...R...F---------------....E.E.L-.Q........DS....I--------.A.D-----
B7KLH5_CYAP7/9-116E......T----G...Q...F---------------....E.M.L-.K........EI....F--------.A.E-----
D7DZ07_NOSA0/16-121E......N----G...N...W---------------....Q.D.F-.I........DM....L--------.T.D-----
Q5YYT4_NOCFA/5-107N......T----T...D...A---------------AARRA.A.I-.A........RV....F--------.T.D-----
Q4K710_PSEF5/11-111N......R----K...D...L---------------....E.A.W-.L........AT....Y--------.A.V-----
Q11GL1_CHESB/10-122N......A----R...D...V---------------....E.A.M-.M........AC....L--------.S.E-----
B8FA80_DESAA/11-124N......A----F...D...L---------------....E.S.M-.E........SL....L--------.H.P-----
C7PKK5_CHIPD/8-113N......D----K...D...W---------------....R.Q.L-.A........DF....V--------.S.A-----
C7PVH9_CATAD/7-110T......G----T...N...P---------------....N.A.L-.G........TL....F--------.A.A-----
Q023S0_SOLUE/22-116D......A----N...D...F---------------....E.T.E-.H........RI....Y--------.H.E-----
B0T2P8_CAUSK/7-113K......A----G...K...F---------------....D.E.A-GE........KY....W--------.A.D-----
A4FLI3_SACEN/9-124W......N----A...P...P---------------....E.E.M-.AGI....AEGI....F--------.T.A-----
Q1GVF6_SPHAL/12-129I......A----H...D...W---------------....D.G.V-.I........AT....F--------DH.P-----
A5VGC4_SPHWW/32-139G......N----G...KNEMM---------------....D.A.F-.R........TY....F--------.T.A-----
Q67LR1_SYMTH/49-143N......S----H...C...P---------------....G.N.V-.A........PL....L--------.T.A-----
Q1GGN5_RUEST/7-110N......K----D...N...L---------------....S.V.I-.D........EL....L--------.D.P-----
Q7N5H3_PHOLL/10-114S......T----G...D...I---------------....D.V.L-.R........QI....M--------.A.S-----
C5ANY4_BURGB/9-119D......R----Q...V...V---------------....Q.L.L-.P........SM....F--------.H.S-----
A0JTF8_ARTS2/8-119V......G----G...N...L---------------....A.L.I-.D........EF....V--------.L.D-----
B0UQZ5_METS4/10-111C......D----L...DR.PV---------------....E.E.I-.A........AY....F--------.A.P-----
B2FKH0_STRMK/10-123N......R----F...D...I---------------....D.A.M-.L........AV....L--------.A.H-----
Q28P04_JANSC/192-309N......T----HVGAD...V---------------....S.G.L-TM........AH....W--------.D.P-----
D0LQN7_HALO1/43-156S......D----P...T...T---------------SEADA.R.T-.A........EF....M--------.D.D-----
C6WH72_ACTMD/42-148A......A----G...D...L---------------....D.G.V-.V........DQ....Y--------.A.A-----
A4VFV4_PSEU5/16-125G......A----K...D...L---------------....D.R.I-.M........AQ....Y--------.A.P-----
B9JGC5_AGRRK/8-110N......E----T...D...A---------------....E.R.R-.R........ALITEAW--------.T.E-----
Q28SU5_JANSC/41-153G......A----Q...D...G---------------W..RD.V.W-.R........ET....M--------.T.P-----
A5FDF3_FLAJ1/20-129N......L----K...K...P---------------....E.V.L-.D........EI....C--------.M.P-----
D2QKG8_SPILD/51-161T......A----A...D...W---------------....E.K.T-.R........SL....A--------.A.S-----
Q2RYS6_SALRD/468-568N......T----H...D...P---------------....D.A.F-.L........DA....L--------.A.D-----
Q7U6B9_SYNPX/19-120N......S----K...D...P---------------....D.K.V-.S........LA....Y--------.T.E-----
A1T202_MYCVP/12-136.......S----S...D...T---------------....D.A.A-.V........AL....Y--------.A.D-----
C0Z8U2_BREBN/10-123N......S----F...D...V---------------....E.G.M-.A........RL....L--------.H.T-----
Q5WJ97_BACSK/7-113N......T----H...D...F---------------....N.E.V-.K........KI....L--------.H.P-----
Q4K7Y4_PSEF5/14-123M......D----R...D...I---------------....Q.R.I-.V........SY....Y--------.A.D-----
B9K0R3_AGRVS/19-126D......G----Q...N...P---------------....A.A.V-.K........DF....V--------.T.E-----
A2SP57_METPP/26-134D......R----H...D...V---------------....N.L.L-.L........SV....F--------.H.E-----
D7B2K3_NOCDD/208-308E......S----Y...D...I---------------....S.A.I-.T........EV....F--------.T.A-----
Q2G5Y7_NOVAD/7-112N......A----Q...D...V---------------....D.T.Y-.V........SY....M--------.T.D-----
A9WET4_CHLAA/10-121N......D----K...N...L---------------....A.V.I-.D........EI....C--------.P.P-----
B4RFA6_PHEZH/12-124A......N----D...D...V---------------....E.G.V-.L........AT....L--------.T.P-----
B1YHC8_EXIS2/7-115DAS.RTDE----K...A...F---------------....D.D.L-.I........SL....F--------.S.D-----
Q01XW8_SOLUE/26-133S......A----N...D...L---------------....D.A.T-.V........SF....Y--------.S.D-----
A5FF04_FLAJ1/226-327N......E----K...D...E---------------....T.K.R-.K........AL....L--------.N.Q-----
Q7N5R6_PHOLL/8-109N......Q----Y...D...L---------------....K.R.L-.D........NI....F--------.S.E-----
D2SF32_GEOOG/10-120Q......A----G...D...D---------------....T.F.L-.D........EL....V--------.A.V-----
D2QKG9_SPILD/49-156L......T----E...K...L---------------....D.K.A-.R........SL....M--------.A.A-----
D3SG09_THISK/73-180Q......T----G...D...A---------------....R.R.V-.T........AL....Y--------.A.D-----
Q6MQX3_BDEBA/10-106N......A----R...D...I---------------....E.K.F-.C........SF....Y--------.H.A-----
A9F1I8_SORC5/106-215S......E----R...R...P---------------....E.L.I-.D........EA....V--------.T.Q-----
D3PMI5_MEIRD/6-117N......A----Q...D...P---------------....T.V.F-.E........EF....L--------.T.P-----
A8I8N5_CHLRE/87-201E......T----N...D...F---------------....K.D.F-.A........SI....V--------.T.P-----
Q5NR56_ZYMMO/9-110SD....FN----R...P...A---------------....E.E.M-.L........AF....F--------.T.E-----
Q0C1I4_HYPNA/38-144D......A----G...D...T---------------....A.A.L-.S........AL....M--------.A.P-----
B5HCB5_STRPR/12-122H......R----G...D...L---------------....P.D.V-.L........AD....H--------.T.D-----
B2HE10_MYCMM/16-127A......S----G...D...W---------------....R.P.F-.A........DL....F--------.T.E-----
B7G7G0_PHATC/222-327A......T----G...D...S---------------....R.V.V-.A........DR....Y--------.A.K-----
A8GD70_SERP5/44-162NG....WS----E...K...P---------------....A.N.V-.A........KY....F--------.T.P-----
C7QAG6_CATAD/10-122S......G----Q...T...P---------------....E.D.F-.A.......QEA....F--------.A.A-----
A5FAS7_FLAJ1/7-104S......G----H...S...H---------------....E.G.F-.K........LY....V--------.H.E-----
Q21ST0_RHOFT/17-124T......Q----G...D...P---------------....D.D.L-.V........NY....F--------.H.P-----
Q5FU45_GLUOX/16-117AD....FG----S...D...L---------------....D.A.L-.T........AF....M--------.T.P-----
D7B8A1_NOCDD/24-135G......Q----D...R...L---------------....K.R.H-.L.........L....F--------.T.E-----
A8J8F4_CHLRE/267-381N......T----G...H...Y---------------....G.V.L-.D........HI....V--------.D.P-----
Q7UYI8_RHOBA/149-257E......A----R...D...Y---------------....D.G.L-.V........AN....Y--------.T.E-----
Q0RQ61_FRAAA/35-150R.......----E...S...A---------------....E.K.V-.C........AL....Y--------.A.D-----
Q2W516_MAGSA/7-130E......Q----R...D...P---------------....S.M.F-.A........AL....F--------.A.A-----
A5G225_ACICJ/10-127E......T----R...D...V---------------....D.ATM-.A........TM....V--------.A.D-----
Q7KPV8_CAEEL/16-120N......N----A...D...W---------------....D.T.V-.A........SF....Y--------.H.P-----
A6WAE9_KINRD/9-131E......H----G...D...D---------------....V.L.A-.S........YL....V--------.H.P-----
A4VGJ2_PSEU5/10-121N......R----G...H...L---------------....A.L.A-.E........HL....H--------.S.K-----
C8X7I4_NAKMY/10-121G......N----GD.AD...L---------------....A.E.L-.D........EL....C--------.Q.P-----
B5HVQ1_9ACTN/52-162K......T----G...D...P---------------....D.K.V-.A........SL....Y--------.A.K-----
B6QRJ3_PENMQ/14-121D......A----M...D...P---------------....NLA.I-.P........KF....Y--------.T.D-----
B2FS27_STRMK/53-161S......S----G...D...L---------------....A.T.V-.E........AL....L--------.A.A-----
Q89CA0_BRADU/26-125Q......N----C...D...V---------------....K.R.F-.D........QI....L--------.A.P-----
Q82PT2_STRAW/13-123A......E----G...R...L---------------....D.D.Y-.F........GA....F--------.A.P-----
B0UAU1_METS4/29-133R......S----G...N...F---------------....S.A.V-.A........NM....Y--------.T.E-----
A8N708_COPC7/26-128D......T----N...D...P---------------....S.F.A-.S........TF....Y--------.T.R-----
C6WNT0_ACTMD/15-117N......E----R...D...F---------------....V.T.T-.I........AA....F--------.D.R-----
Q74BD7_GEOSL/66-172Q......S----R...N...V---------------....D.A.L-.K........QL....F--------.A.P-----
B1MAG0_MYCA9/29-157A......E----Q...D...I---------------....K.K.I-.D........YC....I--------.A.E-----
B1W484_STRGG/11-119N......A----K...D...L---------------....D.G.V-.V........KL....F--------.A.T-----
B2HT68_MYCMM/15-114A......D----G...G...A---------------....D.D.L-.V........GF....Y--------.A.D-----
B4ELH6_BURCJ/39-136N......E----K...D...A---------------....D.A.A-.L........AY....V--------.G.D-----
B4EM94_BURCJ/9-110Q......Q----R...D...I---------------....D.T.M-.L........AC....Y--------.A.D-----
C0ZSH3_RHOE4/57-155N......G----R...Q...V---------------....Q.Q.A-.A........DR....Y--------.L.G-----
C0ZUW8_RHOE4/11-107G......S----H...D...V---------------....D.G.L-.V........AL....F--------.A.S-----
C1A207_RHOE4/8-107A......A----A...D...V---------------....A.K.I-.V........DY....F--------.T.D-----
C3KP75_RHISN/30-139TVYLAPGG----G...D...F---------------....G.P.I-.A........ET....L--------.D.P-----
D4ZDV5_SHEVD/27-130N......S----H...D...V---------------....K.Q.M-.V........QY....T--------.T.H-----
D7BSM4_STRBB/12-130S......E----G...D...I---------------....D.G.L-.L........DL....Y--------.A.K-----
G2NZK4_STRVO/13-110N......A----G...D...V---------------....E.A.V-.L........EL....F--------.S.D-----
G2NZK5_STRVO/16-131N......A----A...D...I---------------....D.G.L-.L........EL....Y--------.A.D-----
G8PMR8_PSEUV/42-153D......A----RP.FD...R---------------....E.T.F-.V........SF....F--------.S.E-----
G8PNR5_PSEUV/31-139D......S----RP.FD...R---------------....A.K.L-.A........EF....Y--------.A.D-----
M1FFV3_9ALTE/24-124D......K----G...N...L---------------....N.K.L-.A........GV....Y--------.A.E-----
O06820_MYCTU/10-109K......A----P...S...P---------------....D.R.L-.T........DH....L--------.H.P-----
Q0RMU9_FRAAA/11-107N......S----H...V...P---------------....E.R.I-.A........SC....F--------.T.D-----
Q0S498_RHOJR/22-121V......A----G...D...P---------------....D.A.A-.Q........QY....L--------.H.Q-----
Q0SA13_RHOJR/47-144E......S----G...D...A---------------....S.R.V-.A........AL....Y--------.R.P-----
Q0SAM4_RHOJR/12-111A......T----G...T...T---------------....D.D.V-.V........AL....Y--------.A.E-----
Q63P16_BURPS/8-114H......R----R...D...L---------------....P.G.V-.L........AA....L--------.A.P-----
Q67TV4_ORYSJ/71-167N......R----R...D...L---------------....A.A.V-.E........PL....I--------.A.E-----
Q73X32_MYCPA/11-110A......T----G...T...A---------------....D.D.I-.V........TL....Y--------.A.A-----
Q7MG68_VIBVY/11-132E......N----A...T...Y---------------....K.N.V-.AEV....LKAH....T--------.S.E-----
Q7SFH5_NEUCR/300-405N......G----K...T...M---------------...QQ.D.L-.H........QY....C--------.K.E-----
Q88EB0_PSEPK/13-117R......D----R...D...I---------------....P.G.I-.I........AP....Y--------.A.D-----
Q8F037_LEPIN/9-109Q......K----K...D...A---------------....T.K.M-.G........TL....Y--------.S.D-----
Q8PDF7_XANCP/13-124N......R----G...D...W---------------....D.A.M-.L........AF....L--------.A.E-----
Q9A5Z0_CAUCR/10-110Q......A----G...D...A---------------....E.A.V-.R........AF....Y--------.A.S-----
Q9A6F0_CAUCR/10-117E......T----G...D...Q---------------....S.V.F-.G........DS....V--------.H.P-----
Q9A8Y8_CAUCR/11-113N......R----R...A...F---------------....D.R.C-.I........AM....L--------.A.P-----
Q9HS78_HALSA/7-104D......E----G...D...I---------------....S.A.V-.L........AL....F--------.S.D-----
Q9KSY8_VIBCH/9-112D......K----S...Q...L---------------....H.R.L-.I........EI....Y--------.H.P-----
R5F452_9CLOT/94-205D......D----K...G...M---------------....G.K.I-.Y........DH....Y--------.K.H-----

PF07858

Q8XW85_RALSO/2-128V------E----D---G---G-------------------RPA-V--R--------RW----F---------T-P-----
Q9A482_CAUCR/6-128E------R----L---D---Y-------------------DAA-V--Q--------HL----A---------P-A-----
Q8XW86_RALSO/2-128P------E----D---D---G-------------------KAA-I--R--------RY----F---------T-P-----
EPHG_MYCTU/15-135Q------N----E---D---F-------------------DTV-D--A--------AL----G---------D-D-----
Q73W09_MYCPA/9-129Q------D----A---D---Y-------------------DAA-E--A--------AL----A---------D-D-----
Q9CCC2_MYCLE/30-150Q------D----A---G---L-------------------RNR-I--R--------DV----G---------R-Q-----

PF10184

A0ZAJ9_NODSP/1-107-------P----L---N---Q-------------------..T-Y-----------SI----Y---------A-E-----
A0ZEU7_NODSP/8-120-------E----K---D---I-------------------..S-Y-----------DI----Y---------T-Q-----
A3KPX0_DANRE/247-372-------R----K---N---H-------------------..D-Y-----------SI----Y---------S-E-----
A4RYB4_OSTLU/40-152-------D----D---E---G-------------------.ID-P-----------SL----Y---------A-K-----
A7RV61_NEMVE/173-295-------Q----N---G---H-------------------..G-Y-----------SL----Y---------H-E-----
O82347_ARATH/89-201-------Y----K---E---L-------------------..N-F-----------DI----Y---------R-D-----
P74420_SYNY3/15-121-------P----W---H---Q-------------------..T-F-----------SI----Y---------D-P-----
Q0DJX6_ORYSJ/116-228-------Y----R---E---P-------------------..S-F-----------HI----Y---------R-D-----
Q10VR9_TRIEI/4-116-------E----K---D---I-------------------..S-Y-----------DI----Y---------T-K-----
Q11AD5_TRIEI/1-107-------P----A---D---Q-------------------..T-Y-----------SI----Y---------A-E-----
Q2JJ41_SYNJB/11-117-------P----R---D---Q-------------------..T-Y-----------AI----Y---------D-P-----
CF136_HUMAN/149-274-------L----Q---S---H-------------------..D-Y-----------SL----Y---------S-L-----
Q69VD1_ORYSJ/67-177-------D----D---V---G-------------------.VD-R-----------SA----Y---------D-D-----
Q7NHQ0_GLOVI/5-111-------P----E---D---Q-------------------..T-Y-----------AI----Y---------A-N-----
Q7PFX4_ANOGA/132-264-------V----Q---P---L-------------------..D-Y-----------SI----Y---------S-P-----
Q8VZ90_ARATH/62-172-------D----D---Q---G-------------------.ID-K-----------TA----Y---------D-E-----
Q8YTL6_NOSS1/1-107-------P----V---N---Q-------------------..T-Y-----------SI----Y---------A-E-----
Q94K63_ARATH/78-191-------F----V---T---G-------------------VLT-S-----------AI----Y---------S-D-----
Q9SA31_ARATH/87-199-------T----R---D---L-------------------..N-Y-----------DI----Y---------R-D-----
B1WUH0_CYAA5/2-107-------P----K---N---Q-------------------..T-Y-----------SV----Y---------A-D-----
B8JJ69_MOUSE/150-274-------L----R---S---H-------------------..D-Y-----------TI----Y---------S-M-----
Q31NT1_SYNE7/7-112-------P----K---D---Q-------------------..S-F-----------EV----Y---------D-P-----
Q7XLD2_ORYSJ/92-203-------V----R---E---P-------------------..N-Y-----------DI----Y---------R-E-----
Q9W1F2_DROME/84-215-------V----E---P---L-------------------..D-Y-----------SI----Y---------S-P-----

PF07080

B1LSK3_METRJ/3-144N------G----R---D---P-------------------A-K-V--A--------LA----Y---------T-T-----
B8ERM2_METSB/7-147N------S----R---N---P-------------------E-R-V--S--------LA----Y---------S-V-----
D7C7X3_STRBB/6-147N------T----R---D---P-------------------E-K-V--A--------LA----Y---------S-V-----
A8HSN6_AZOC5/11-152N------T----Q---D---P-------------------E-K-V--S--------LA----Y---------T-T-----
G7DX40_MIXOS/2-131N------T----R---T---P-------------------S-K-I--V--------KA----Y---------T-D-----
B2ILG8_BEII9/4-143N------S----Q---D---A-------------------H-R-V--C--------LA----Y---------T-E-----
A9HBR6_GLUDA/3-144N------G----R---D---P-------------------E-K-V--A--------LA----Y---------T-P-----
S3BYH4_OPHP1/13-151N------T----M---D---P-------------------V-V-I--V--------PA----Y---------T-E-----
Q7ULD7_RHOBA/9-146N------S----R---D---P-------------------Q-R-V--S--------LA----Y---------S-I-----
Q7V2T4_PROMP/4-145N------T----K---D---P-------------------V-T-V--S--------HA----Y---------T-E-----
B2IKS1_BEII9/5-145N------G----R---D---P-------------------E-R-V--A--------LA----Y---------T-P-----
B8GEL7_METPE/7-147N------S----R---N---P-------------------E-L-V--S--------LA----Y---------S-I-----
J4G7Y6_FIBRA/6-142N------T----C---D---P-------------------V-R-V--S--------LA----Y---------T-P-----
R4LE54_9ACTN/2-140N------T----C---D---P-------------------G-R-V--A--------LA----Y---------T-E-----
D2VSI5_NAEGR/4-136N------S----K---D---P-------------------E-R-I--A--------LA----Y---------T-E-----
E2LUP3_MONPE/4-137N------T----K---D---P-------------------A-K-V--A--------MA----Y---------T-P-----
L8GCZ6_PSED2/11-144N------T----K---D---P-------------------K-R-I--A--------LA----Y---------T-L-----
Q5NPJ1_ZYMMO/5-147N------S----Q---N---P-------------------E-K-I--A--------LS----Y---------T-V-----
U4L3Z6_PYROM/5-144N------T----K---D---P-------------------A-R-V--A--------LA----Y---------T-P-----
Q5LKF9_RUEPO/3-144N------N----R---S---A-------------------D-V-V--T--------PA----Y---------S-D-----
F6IE59_9SPHN/9-150N------S----R---D---P-------------------A-K-V--A--------LA----Y---------T-P-----
A4SXK9_POLSQ/6-145N------T----R---D---P-------------------E-K-V--S--------LV----Y---------T-E-----
B0C3H8_ACAM1/7-148N------G----R---N---P-------------------E-K-V--S--------LA----Y---------S-V-----
K9VV28_9CYAN/4-139N------T----R---D---P-------------------A-R-V--A--------LA----Y---------T-E-----
G8TDI0_NIAKG/7-136N------T----R---N---P-------------------E-K-V--A--------LA----Y---------S-V-----
G8S011_ACTS5/13-151N------T----R---D---P-------------------R-R-V--A--------AA----Y---------T-P-----
A7IEF3_XANP2/4-145N------S----R---D---P-------------------E-R-V--S--------LA----Y---------T-P-----
S5T289_9CORY/4-145N------T----R---D---P-------------------E-K-V--S--------LA----Y---------T-P-----
Q885A5_PSESM/6-147N------S----R---D---A-------------------A-K-V--A--------LA----Y---------T-E-----
C5CRQ3_VARPS/4-139N------T----R---D---P-------------------V-R-V--S--------LA----Y---------T-P-----
A8GGW9_SERP5/4-145N------S----R---D---P-------------------E-R-V--S--------QV----Y---------S-V-----
H1VKH9_COLHI/8-137.------.----.---N---P-------------------A-K-V--K--------LA----Y---------T-T-----
C9SC71_VERA1/6-139N------T----K---D---P-------------------E-T-V--K--------MA----Y---------T-P-----
A4AWU7_MARSH/5-136N------S----R---D---A-------------------K-K-V--S--------MA----Y---------T-L-----
G0S1P6_CHATD/5-138N------T----R---N---P-------------------E-A-V--Q--------YA----Y---------T-P-----
A6TFT2_KLEP7/5-146N------S----R---D---A-------------------E-K-V--A--------LA----Y---------T-V-----
I3TTF4_TISMK/2-143N------S----R---D---P-------------------E-R-V--A--------GA----Y---------T-P-----
F0XKI1_GROCL/3-145N------T----K---D---P-------------------V-T-V--V--------PA----Y---------T-D-----
H5WUV2_9BURK/4-145N------T----R---D---P-------------------E-V-C--A--------RV----Y---------T-E-----
B2J4W5_NOSP7/43-183N------T----H---N---P-------------------E-L-V--S--------LA----Y---------T-S-----
I1XFA4_METNJ/7-148N------S----R---D---P-------------------E-K-V--A--------LA----Y---------T-V-----
Q22CF4_TETTS/39-179N------G----Q---K---P-------------------E-K-V--C--------LA----Y---------T-E-----
L0D9F8_SINAD/3-142N------S----R---D---P-------------------E-R-V--S--------LA----Y---------T-E-----
Q13SF9_BURXL/8-149N------T----R---D---P-------------------E-R-V--S--------LA----Y---------T-K-----
B0SVP8_CAUSK/2-143N------S----R---D---P-------------------K-A-V--A--------QA----Y---------T-P-----
J9ZA59_LEPFM/171-312N------S----R---I---P-------------------E-R-V--A--------MA----Y---------T-H-----
B2HLU4_MYCMM/8-145N------T----R---D---P-------------------Q-R-V--S--------LA----Y---------T-V-----
B6JDE8_OLICO/4-144N------S----R---D---P-------------------H-K-V--A--------LV----Y---------T-E-----
Q0SDQ5_RHOJR/4-146N------S----R---D---P-------------------E-K-V--A--------QA----Y---------T-E-----
K9P7V3_CYAGP/12-153N------G----R---D---P-------------------E-R-V--A--------LA----Y---------S-P-----
E8UXY2_TERSS/9-148N------S----R---D---P-------------------E-R-V--S--------LA----Y---------T-P-----
A1TEA6_MYCVP/5-143N------T----C---D---P-------------------H-R-V--S--------LA----Y---------T-P-----
H3G8D3_PHYRM/7-149N------S----R---D---P-------------------S-R-V--A--------LA----Y---------T-V-----
B5HC01_STRPR/5-139N------T----R---D---P-------------------H-K-V--A--------LA----Y---------T-E-----
D8J274_HERSS/4-146N------T----R---D---A-------------------E-K-V--A--------LA----Y---------T-E-----
A9CLA1_AGRFC/3-144N------S----R---D---A-------------------A-K-V--A--------LA----Y---------T-V-----
U9U4M7_RHIID/3-136N------T----K---D---P-------------------Y-K-V--V--------KA----Y---------T-K-----
R7YWN8_CONA1/3-136N------T----K---D---P-------------------Q-N-V--A--------KA----Y---------T-E-----
D5SQM6_PLAL2/13-153N------S----R---D---P-------------------V-R-V--S--------LA----Y---------T-E-----
B2VFK9_ERWT9/4-145N------S----R---N---P-------------------A-N-V--A--------LA----Y---------S-A-----
G2XW21_BOTF4/6-139N------T----K---N---P-------------------Q-V-V--K--------NA----Y---------T-E-----
G0QZB1_ICHMG/9-148N------S----R---D---P-------------------E-K-V--S--------LA----Y---------T-I-----
B2GL83_KOCRD/106-244N------T----R---D---P-------------------E-T-V--A--------QA----Y---------S-V-----
Q5YSZ9_NOCFA/2-140N------T----R---D---P-------------------E-L-V--A--------AA----Y---------T-A-----
C1D428_DEIDV/3-144N------S----R---D---P-------------------A-R-V--A--------QA----Y---------T-E-----
Q54IV5_DICDI/7-149N------S----R---N---A-------------------E-T-V--S--------LA----Y---------S-L-----
V5X9V4_MYCNE/4-146N------S----R---D---P-------------------Q-R-V--A--------EG----Y---------S-V-----
K0CAH5_ALCDB/6-147N------S----R---D---A-------------------D-K-V--A--------MA----Y---------S-L-----
Q7N4C4_PHOLL/8-149N------S----R---D---P-------------------E-K-V--S--------LA----Y---------S-L-----
H5X2U0_9PSEU/4-142N------T----R---D---P-------------------E-R-V--A--------LA----Y---------T-E-----
D8PXS5_SCHCM/5-141N------T----R---D---P-------------------H-T-V--A--------KA----Y---------T-P-----
Q9EWS6_STRCO/6-144N------T----R---D---P-------------------H-Q-V--A--------LA----Y---------S-E-----
D7A7G0_STAND/5-147N------S----C---N---P-------------------E-R-V--S--------LV----Y---------T-P-----
Q89E77_BRADU/3-145N------S----R---D---P-------------------V-R-V--S--------LA----Y---------T-E-----
W5TP00_9NOCA/5-143N------T----R---D---P-------------------E-R-V--A--------LA----Y---------T-P-----
D4Z2H4_SPHJU/1-139N------S----R---D---P-------------------E-R-V--S--------LA----Y---------T-V-----
U7PTH1_SPOS1/14-164N------T----K---N---P-------------------S-I-V--A--------PA----Y---------T-E-----
Q98G19_RHILO/5-146N------S----R---D---P-------------------A-R-V--A--------LA----Y---------T-T-----
D2R1I3_PIRSD/5-144N------S----R---D---P-------------------Q-R-V--S--------LA----Y---------S-E-----
E8WVZ4_GRATM/7-146N------S----R---N---P-------------------A-Q-V--S--------LA----Y---------T-V-----
X5DM97_9CORY/10-144N------S----R---D---P-------------------E-R-V--A--------LA----Y---------T-P-----
F0YBN4_AURAN/19-160N------N----R---D---P-------------------T-K-V--P--------LA----Y---------T-E-----
W0AHH8_9SPHN/3-144N------S----R---N---P-------------------Q-Q-V--A--------QA----Y---------T-V-----
G4QL15_GLANF/4-145N------N----R---N---P-------------------E-A-V--S--------KA----Y---------S-L-----
Q0BTU2_GRABC/10-152N------G----R---N---P-------------------A-R-I--A--------LA----Y---------T-S-----
G0A5W1_METMM/4-145N------S----R---D---P-------------------D-R-V--V--------QV----Y---------T-E-----
E3RSR6_PYRTT/4-136N------S----Q---N---P-------------------T-E-I--A--------KA----Y---------T-P-----
B9JD81_AGRRK/3-144N------S----R---D---P-------------------E-R-V--S--------KV----Y---------T-E-----
F4CJE3_PSEUX/3-141N------T----R---D---P-------------------E-K-V--S--------LA----Y---------T-P-----
S8EP88_FOMPI/6-139N------T----R---D---P-------------------Q-K-V--C--------LA----Y---------T-P-----
U5VZT1_9ACTN/7-144N------S----R---D---P-------------------E-R-V--A--------AA----Y---------T-P-----
G8MBF7_9BURK/4-145N------T----R---E---P-------------------E-R-V--S--------LA----Y---------S-V-----
M5BXI4_THACB/11-144N------G----Q---D---P-------------------E-K-I--A--------LA----Y---------T-P-----
C7JB99_ACEP3/3-144N------S----Q---N---P-------------------E-Q-V--A--------QA----Y---------T-V-----
H6R3X0_NOCCG/2-140N------T----R---E---P-------------------E-R-V--A--------AA----Y---------T-P-----
M5ED51_MALS4/5-143N------T----R---N---V-------------------D-G-L--L--------QS----Y---------A-P-----
G9N5Z7_HYPVG/7-140N------T----R---N---P-------------------D-G-V--K--------MA----Y---------T-P-----
E2Q788_STRC2/27-168N------S----R---T---P-------------------D-R-V--A--------LA----Y---------T-E-----
B1ZPU1_OPITP/4-139N------S----R---D---P-------------------E-R-V--A--------LA----Y---------T-E-----
Q15WT6_PSEA6/4-145N------S----R---N---P-------------------A-K-V--S--------LA----Y---------T-V-----
K3X756_PYTUL/14-156N------S----R---D---P-------------------K-R-V--A--------QA----Y---------S-V-----
D0L163_HALNC/4-145N------S----R---D---P-------------------E-R-V--A--------LV----Y---------T-L-----
A2SLJ7_METPP/6-147N------T----R---D---P-------------------D-V-V--V--------RV----Y---------T-E-----
A1R1Y4_ARTAT/3-145N------T----R---D---P-------------------E-R-I--S--------LA----Y---------S-E-----
Q9HTG9_PSEAE/5-146N------S----R---D---P-------------------Q-R-V--S--------LA----Y---------S-P-----
I0IPS3_LEPFC/8-149N------S----R---I---P-------------------E-K-V--A--------LA----Y---------T-L-----
B0UGB1_METS4/5-146N------H----R---D---P-------------------V-R-V--S--------LA----Y---------T-P-----
E3J6U8_FRASU/6-147N------S----R---D---P-------------------G-A-V--A--------LA----Y---------S-A-----
M7T297_EUTLA/9-142N------T----K---N---P-------------------D-H-V--K--------LA----Y---------T-P-----
C7Z2B0_NECH7/5-138N------T----M---T---P-------------------S-K-V--K--------MA----Y---------T-P-----
H5WPP8_9BURK/3-144N------G----R---N---P-------------------A-R-V--A--------LA----Y---------S-P-----
G8PVW6_PSEUV/16-157N------S----R---D---P-------------------Q-K-V--A--------LA----Y---------T-P-----
A0QXH1_MYCS2/44-186N------T----R---E---P-------------------E-R-V--A--------RG----Y---------S-T-----
M2MCV5_BAUCO/3-135N------T----Q---D---P-------------------E-K-V--S--------KA----Y---------T-E-----
F0ZYB6_DICPU/10-150N------S----R---D---P-------------------E-L-V--S--------KA----Y---------S-I-----
B7FPL0_PHATC/7-147N------S----Q---D---P-------------------D-R-V--K--------MA----Y---------T-A-----
M9R4P9_9RHOB/4-146N------S----R---D---P-------------------A-S-V--A--------MA----Y---------T-P-----
K9Z981_CYAAP/4-141N------T----R---D---P-------------------E-K-V--V--------LA----Y---------T-I-----
K5W331_PHACS/5-139N------T----Q---D---P-------------------H-K-V--A--------QA----Y---------T-P-----
Q55953_SYNY3/3-145N------G----R---N---P-------------------D-K-V--C--------MA----Y---------T-E-----
D3VFP0_XENNA/15-155N------T----R---D---A-------------------S-K-V--A--------LA----Y---------S-K-----
X4ZP44_9BORD/5-146N------G----R---D---P-------------------V-K-V--S--------LA----Y---------T-P-----
J7Q4K9_METSZ/3-144N------T----R---D---P-------------------E-R-V--S--------LA----Y---------T-V-----
G8NNR6_GRAMM/8-147N------S----R---D---P-------------------E-K-V--S--------LV----Y---------T-V-----
F5Z8Z6_ALTSS/2-143N------S----R---S---P-------------------V-R-V--A--------AA----Y---------T-A-----
A1SY21_PSYIN/11-152N------N----Q---D---P-------------------T-K-I--A--------TA----Y---------S-L-----
Q21GU9_SACD2/13-154N------N----K---D---P-------------------H-K-V--A--------TA----Y---------T-L-----
Q21F42_SACD2/3-144N------S----R---D---P-------------------H-K-V--A--------LA----Y---------T-E-----
V9VX09_9RHOB/6-147N------S----R---N---P-------------------E-A-V--A--------QA----Y---------T-L-----
Q5KH63_CRYNJ/33-166Y------T----K---N---P-------------------S-L-I--S--------PA----Y---------T-P-----
Q1GQL6_SPHAL/3-142N------S----R---D---P-------------------A-R-V--A--------LA----Y---------S-E-----
C0ZND5_RHOE4/4-146N------S----R---D---P-------------------H-K-V--S--------LA----Y---------T-P-----
C5BRE0_TERTT/11-152N------L----K---N---A-------------------E-K-I--A--------TA----Y---------S-L-----
B1MD11_MYCA9/3-141N------T----R---D---P-------------------E-G-V--A--------AA----Y---------T-E-----
M2QHK1_CERS8/5-140N------T----R---D---A-------------------H-K-V--S--------LA----Y---------T-P-----
E4N6H5_KITSK/5-143N------T----R---D---P-------------------E-R-V--A--------LA----Y---------T-P-----
Q47FW0_DECAR/5-146N------S----R---D---P-------------------D-R-V--V--------LV----Y---------T-E-----
Q2S7F5_HAHCH/11-143N------T----C---N---P-------------------E-V-V--A--------LG----Y---------T-E-----
B0CZ00_LACBS/4-135N------T----R---D---P-------------------Q-K-V--S--------LA----Y---------T-P-----
K9WB99_9CYAN/25-158N------T----R---D---P-------------------E-R-V--S--------LA----Y---------T-E-----
D3B3X0_POLPA/7-146N------S----R---D---P-------------------T-R-V--S--------QA----Y---------T-V-----
H6RTK1_BLASD/3-141N------T----R---D---P-------------------E-K-V--A--------LA----Y---------T-E-----
I4F4V6_MODMB/4-137N------S----R---D---P-------------------H-R-V--S--------LA----Y---------T-E-----
C6WWQ1_METML/8-149N------S----R---D---P-------------------Q-R-V--S--------LV----Y---------T-P-----
K2SA46_MACPH/4-136N------T----Q---K---P-------------------E-D-V--V--------KA----Y---------T-E-----
N0BCT9_9RHIZ/4-145N------M----R---D---P-------------------E-R-V--A--------LA----Y---------T-E-----
G3JBC0_CORMM/6-139N------T----K---T---P-------------------D-T-V--K--------MA----Y---------T-P-----
F5YW52_MYCSD/4-135N------T----R---D---P-------------------E-R-V--A--------QA----Y---------T-D-----
A0R5M4_MYCS2/6-147N------S----R---D---P-------------------Q-R-V--S--------LA----Y---------T-V-----
Q7NUJ9_CHRVO/4-145N------S----R---D---P-------------------A-R-V--A--------QA----Y---------S-L-----
K7SXB6_GLUOY/4-145N------G----Q---C---S-------------------E-H-V--A--------LA----Y---------T-Q-----
E6WG68_PANSA/2-141N------S----R---D---A-------------------Q-R-V--S--------QV----Y---------S-E-----
R4STA4_AMYOR/5-143N------T----R---D---P-------------------R-K-V--S--------SA----Y---------T-P-----

PF02136

NTF2_ARATH/9-123D------T....N---R---V-------------------G-.-L--A--------GL----Y--------...Q-----
Q9M2S5_ARATH/166-285M------R.....---.---.-------------------E-E-L--G--------LM----Y--------...V-----
Q9AK31_STRCO/205-316E------G....Y---D---M-------------------T-A-L--T--------AL----L--------H..E-----
O53486_MYCTU/8-130A------A....H---D---R-------------------A-G-W--V--------GL----F--------T..G-----
Q9LDI9_ARATH/13-128G------Q.....---L---P-------------------H-E-A--R--------RL----.--------Y..V-----
Q9FND0_ARATH/11-125Q------Q.....---Q---P-------------------D-L-I--H--------QF----Y--------S..E-----
Q9LMX6_ARATH/15-131Y------K.....---S---P-------------------S-Q-V--H--------QF----.--------Y..L-----
NTF2_ORYSJ/6-119D------T....N---R---P-------------------A-.-L--V--------SL----Y--------...Q-----
NTF2_YEAST/8-121D------T....D---R---S-------------------Q-.-L--G--------NL----Y--------...R-----
G3BP2_MOUSE/11-133N------K.....---A---P-------------------E-Y-L--H--------RF----.--------Y..G-----
NTF2_RAT/10-121D------N....D---R---T-------------------Q-.-L--G--------AI----Y--------...I-----
OCP_SYNY3/193-308N------A....N---D---F-------------------D-T-L--I--------EL----F--------T..S-----
Q9A8Y8_CAUCR/127-234N------A....G---D---V-------------------D-G-A--A--------AC----F--------G..D-----
NTF2_CAEEL/10-128D------VGDGMS---R---A-------------------Q-G-L--S--------DL----Y--------D..P-----
NXT1_MOUSE/16-135D------K.....---R---R-------------------R-L-L--S--------RL----Y--------...M-----
G3BP_SCHPO/18-134N------K.....---E---P-------------------N-R-L--H--------CF----.--------Y..T-----
NTF2_NEUCR/8-121D------S....D---R---K-------------------N-.-L--A--------GL----Y--------...R-----
NXT2_HUMAN/17-136D------K.....---R---R-------------------R-A-L--T--------RL----Y--------...L-----
Q9M2S5_ARATH/32-154G------V.....---Y---P-------------------E-V-V--Q--------MM----W--------Y..A-----
G3BP1_MOUSE/11-133N------Q.....---A---P-------------------D-M-L--H--------RF----.--------Y..G-----
Q21351_CAEEL/36-143S------E.....---N---R-------------------K-A-I--T--------KF----Y--------...G-----
Q9ZPR2_ARATH/15-131Y------D.....---S---T-------------------S-E-V--H--------KF----.--------Y..L-----
NXF1_RAT/385-535D------S....G---D---R-------------------Q-G-L--L--------DA----Y--------HDGA-----
Q9C9I5_ARATH/70-192N------V....H---D---L-------------------S-S-V--T--------DL----I--------A..Q-----
NXT1_CAEEL/19-135D------R.....---K---R-------------------E-K-I--G--------FL----Y--------...T-----
NTF2_SCHPO/7-120D------S....D---R---S-------------------Q-.-L--S--------SL----Y--------...R-----
NTF2_YARLI/8-121D------T.....---D---R-------------------S-Q-L--G--------NL----Y--------...R-----
Q9VRD6_DROME/10-124D------DP..AN---R---A-------------------N-.-V--V--------NF----Y--------S..A-----
BRE5_YEAST/8-140R------T.....---D---P-------------------S-K-L--A--------YF----Y--------ASTA-----
NXT1_DROME/15-130D------N.....---R---R-------------------Q-Q-I--G--------RL----Y--------...L-----
Q9FME2_ARATH/15-131H------Q.....---S---P-------------------G-L-V--H--------RF----.--------Y..Q-----
B4R173_DROSI/16-129N------K.....---A---P-------------------N-H-L--H--------RF----Y--------...N-----
D0J389_COMT2/2-115N------A....G---D---L-------------------D-G-I--V--------AL----F--------A..D-----
F4JED3_ARATH/281-394Q------N.....---A---P-------------------E-N-L--Y--------KL----Y--------...K-----
F4JED3_ARATH/948-1060Q------N.....---S---P-------------------E-I-L--P--------GY----Y--------...K-----
I6WZD7_MYCTU/11-135Q------A....H---D---R-------------------E-G-W--L--------AL----M--------A..D-----
Q84JH2_ARATH/16-133C------N.....---M---P-------------------E-H-L--P--------RF----Y--------...Q-----
Q8VYJ4_ARATH/19-135H------Q.....---S---P-------------------E-H-V--H--------RF----Y--------...Q-----

PF03284

PHZA2_PSEAE/1-162EHYMRM.K----G---A-----------------------E-RLQ-RH--------SL----F---------V-E-----
C5AHF3_BURGB/12-165EQYMHT.R----G---E-----------------------A-RLK-RH--------LL----F---------T-E-----
PHZB2_PSEAE/1-162VKYMNT.K----G---Q-----------------------D-RLR-RH--------EL----F---------V-E-----
M4RPB3_9BIFI/2-155DKYLHSGH----G---D-----------------------A-LLH-RH--------EL----F---------C-E-----

PF10429

Q6CF15_YARLI/5-151D.......----....D---H-------------------R-Q-N--L--------PQ----F........LR-P-----
Q6CWP0_KLULA/2-178D......E----PDPAK---L-------------------E-Q-F--L--------QL----F........NP-H-----
MTR2_YEAST/13-184D......D----PDSNK---L-------------------A-Q-F--V--------QL----F........NP-N-----
Q757C4_ASHGO/6-167D......E----CDVDR---L-------------------Q-Q-A--L--------PL----F........QP-H-----
Q6BMR4_DEBHA/2-178DIQYQGPS----QQFPN---V-------------------E-S-Y--A--------TQ----FG.....KQLK-P-----
Q6FWG2_CANGA/8-183D......E----QDPNK---L-------------------M-N-F--L--------QL----FQSSKNMPPSP-T-----

PF07107

WUN1_SOLTU/1-105K------F----D---N-----------------------A-S-F--Q--------------F---------L-H-----
Q9LZX2_ARATH/59-162P------P----R---Q-----------------------V-S-F--R--------------F---------E-P-----
I1PUL3_ORYGL/142-253G------G----G---A-----------------------A-G-L--P--------------F---------K-V-----
Q0DSM5_ORYSJ/106-228D------H----G---E-----------------------S-R-F--L--------------F---------S-P-----
Q94AK6_ARATH/1-110S------P----S---S-----------------------S-S-F--E--------------F---------V-P-----

PF04335

A7ICW5_XANP2/23-226Q------A----K---N---W---------------RLMAFGC-L-AL--------SA----G---------LS.-----
Q89B84_BRADU/23-226Q------A----R---N---W---------------RLMAFGS-L-ML--------SC----G---------LA.-----
Q6N7N1_RHOPA/23-226Q------A----R---N---W---------------RLMAFGS-L-FL--------SA----G---------LS.-----
Q98P55_RHILO/23-226Q------A----R---N---W---------------RAMALGS-L-IL--------SA----G---------LA.-----
Q210W3_RHOPB/21-224Q------A----K---N---W---------------RLMAFGS-L-ML--------SA----G---------LA.-----
Q2GBL4_NOVAD/21-224Q------A----R---S---W---------------RLAFFGA-L-GL--------ST----C---------LT.-----
A5V2M3_SPHWW/23-226Q------A----Y---S---W---------------RLMAFGA-I-AV--------.L----G---------LS.-----
B0T8Q8_CAUSK/22-225Q------A----A---N---W---------------RLIALGL-L-AS--------NI----V---------QS.-----
A7HU75_PARL1/22-225Q------A----R---N---W---------------RLMAFGS-L-AL--------SA----G---------LS.-----
Q989I9_RHILO/22-225Q------A----R---N---W---------------RFMALGC-L-TL--------AA----G---------LS.-----
Q9A4Y5_CAUCR/22-225Q------A----H---N---W---------------RLAFFGS-L-TL--------AS----V---------LA.-----
B0T6U6_CAUSK/22-225Q------A----H---N---W---------------RLAFFGM-F-AL--------SC----G---------LA.-----
E0TGX7_PARBH/22-225Q------A----K---N---W---------------RLMALGC-L-GL--------CF----V---------TS.-----
E0TDN5_PARBH/22-225Q------A----E---N---W---------------RLTALVA-L-AL--------AF----V---------MS.-----
B0T9G1_CAUSK/24-227Q------A----R---N---W---------------RLMALAC-A-GL--------AA----L---------SL.-----
B0T9T9_CAUSK/23-226Q------A----K---N---W---------------RMAAFGC-M-GL--------AA----L---------AL.-----
B4S3J2_PROA2/22-230Q------A----K---N---W---------------RLATFAT-L-LL--------VA----F---------PSL-----
B4S9L7_PROA2/20-228Q------A----K---N---W---------------RLATFAT-I-CF--------IA----L---------PSL-----
TRBF_RHISN/13-219A------A----A---A---W---------------RTVGILG-L-AM--------AV----I---------GF.-----
A1VQ85_POLNA/9-215R------A----R---N---W---------------QLIAAGS-L-AV--------AV----V---------AV.-----
Q6LGW6_PHOPR/15-221Q------A----H---V---W---------------KLAFFAA-L-AI--------TA----L---------SV.-----
Q6AIG6_DESPS/13-218S------R----N---N---W---------------RSCGFIA-L-AL--------LS----F---------SL.-----
B2JXV8_BURP8/50-259K------A----R---V---A---------------DRRSVLS-G-GI--------AL----A---------AVF-----