Sequence alignment for CL0051

PF13474

B2UGF3_RALPJ/11-131-----------------------------------------------------------------------------AE-
A5GCV2_GEOUR/9-131-----------------------------------------------------------------------------IR-
C0QA63_DESAH/9-131-----------------------------------------------------------------------------IR-
D3SFX3_THISK/13-133-----------------------------------------------------------------------------VR-
Q0A9T2_ALKEH/13-139-----------------------------------------------------------------------------VN-
D6XWI0_BACIE/11-137-----------------------------------------------------------------------------LH-
D2PT47_KRIFD/6-126-----------------------------------------------------------------------------IR-
Q92KR9_RHIME/14-134-----------------------------------------------------------------------------IE-
C3MEI6_RHISN/13-133-----------------------------------------------------------------------------IR-
D0LTP7_HALO1/11-135-----------------------------------------------------------------------------VE-
B5GPB4_STRC2/9-136-----------------------------------------------------------------------------VE-
B5HIA9_STRPR/9-137-----------------------------------------------------------------------------VE-
D7B847_NOCDD/11-139-----------------------------------------------------------------------------VA-
D1A544_THECD/9-137-----------------------------------------------------------------------------VE-
A4YP86_BRASO/20-133-----------------------------------------------------------------------------IL-
Q89F64_BRADU/7-119-----------------------------------------------------------------------------VI-
B2IHF2_BEII9/4-117-----------------------------------------------------------------------------IL-
B9GXK0_POPTR/174-290-----------------------------------------------------------------------------IV-
B1ZXW2_OPITP/468-592-----------------------------------------------------------------------------VK-
Q01ZK2_SOLUE/25-147-----------------------------------------------------------------------------VL-
B1ZMY8_OPITP/43-165-----------------------------------------------------------------------------VL-
C6X4B7_FLAB3/29-152-----------------------------------------------------------------------------VL-
C4XSI3_DESMR/466-578-----------------------------------------------------------------------------IR-
Q1DE35_MYXXD/42-156-----------------------------------------------------------------------------IT-
Q487W3_COLP3/33-147-----------------------------------------------------------------------------IT-
A3U720_CROAH/41-154-----------------------------------------------------------------------------IN-
A5FK93_FLAJ1/24-137-----------------------------------------------------------------------------IN-
A6GVS5_FLAPJ/25-138-----------------------------------------------------------------------------IN-
C6X3L7_FLAB3/38-151-----------------------------------------------------------------------------VS-
A4CH66_ROBBH/18-131-----------------------------------------------------------------------------LD-
A0M5Z5_GRAFK/38-151-----------------------------------------------------------------------------IN-
A2TYG4_9FLAO/37-150-----------------------------------------------------------------------------VN-
A3QCF0_SHELP/31-139-----------------------------------------------------------------------------AT-
Q12PU2_SHEDO/77-185-----------------------------------------------------------------------------IN-
Q085V8_SHEFN/80-188-----------------------------------------------------------------------------VS-
A1S876_SHEAM/27-135-----------------------------------------------------------------------------AN-
D9QI29_BRESC/22-140-----------------------------------------------------------------------------VA-
Q15XC4_PSEA6/38-153-----------------------------------------------------------------------------VN-
B9TH82_RICCO/29-143-----------------------------------------------------------------------------VN-
D4LV59_9FIRM/8-130-----------------------------------------------------------------------------VV-
B8FCE8_DESAA/7-126-----------------------------------------------------------------------------LK-
Q5LP72_RUEPO/8-127-----------------------------------------------------------------------------IE-
A3HV45_9BACT/11-133-----------------------------------------------------------------------------VL-
B8GG61_METPE/21-142-----------------------------------------------------------------------------VR-
B8CPV1_SHEPW/7-128-----------------------------------------------------------------------------IR-
D4MSP2_9FIRM/78-205-----------------------------------------------------------------------------VK-
D9T710_MICAI/40-166-----------------------------------------------------------------------------VR-
Q13UI8_BURXL/13-130-----------------------------------------------------------------------------..-
Q3ZAF4_DEHM1/11-133-----------------------------------------------------------------------------IN-
Q63WV1_BURPS/13-127-----------------------------------------------------------------------------..-
Q8RYS9_ORYSJ/166-284-----------------------------------------------------------------------------IM-
R5FDC6_9CLOT/10-131-----------------------------------------------------------------------------.R-
R5TK35_9CLOT/9-131-----------------------------------------------------------------------------IE-
R6QJ83_9FIRM/13-123-----------------------------------------------------------------------------..-

PF14534

Q4KEE9_PSEF5/7-110-----------------------------------------------------------------------------LL-
A0JT09_ARTS2/213-310-----------------------------------------------------------------------------VE-
A1CFS1_ASPCL/12-120-----------------------------------------------------------------------------LL-
A1R3I0_ARTAT/269-366-----------------------------------------------------------------------------VL-
A1U4T2_MARAV/6-114-----------------------------------------------------------------------------LK-
A2QV30_ASPNC/167-275-----------------------------------------------------------------------------LI-
A3CS44_METMJ/8-106-----------------------------------------------------------------------------LL-
A3HWU2_9BACT/60-168-----------------------------------------------------------------------------IL-
A3HZW5_9BACT/30-137-----------------------------------------------------------------------------IK-
A3I0D3_9BACT/31-149-----------------------------------------------------------------------------IA-
A3QEM3_SHELP/29-149-----------------------------------------------------------------------------LN-
A3QJ67_SHELP/5-108-----------------------------------------------------------------------------II-
A4AQI2_MARSH/45-155-----------------------------------------------------------------------------IV-
A4CNU2_ROBBH/46-156-----------------------------------------------------------------------------IL-
A4RV71_OSTLU/211-315-----------------------------------------------------------------------------IV-
A5FMK8_FLAJ1/6-112-----------------------------------------------------------------------------IV-
A5FMN4_FLAJ1/37-145-----------------------------------------------------------------------------II-
A5G8N2_GEOUR/26-129-----------------------------------------------------------------------------LH-
A5V3K3_SPHWW/11-125-----------------------------------------------------------------------------IR-
A5V8Q2_SPHWW/64-171-----------------------------------------------------------------------------VI-
A5VGJ3_SPHWW/7-115-----------------------------------------------------------------------------IE-
A5WEC7_PSYWF/5-111-----------------------------------------------------------------------------IS-
A6LYA2_CLOB8/8-113-----------------------------------------------------------------------------IL-
A6VR33_ACTSZ/42-148-----------------------------------------------------------------------------LT-
A6WA45_KINRD/27-133-----------------------------------------------------------------------------IV-
A6WB55_KINRD/3-111-----------------------------------------------------------------------------IV-
A8GEK8_SERP5/4-112-----------------------------------------------------------------------------IQ-
A8LTG7_DINSH/19-134-----------------------------------------------------------------------------IM-
A9C0J7_DELAS/26-133-----------------------------------------------------------------------------LQ-
A9GA01_SORC5/28-134-----------------------------------------------------------------------------LK-
B0SZM9_CAUSK/8-116-----------------------------------------------------------------------------IA-
B0T7A9_CAUSK/166-269-----------------------------------------------------------------------------VR-
B1M5Q7_METRJ/38-144-----------------------------------------------------------------------------VE-
B1ZQQ6_OPITP/36-143-----------------------------------------------------------------------------VT-
B1ZZ14_OPITP/30-139-----------------------------------------------------------------------------IR-
B2GBD5_LACF3/9-117-----------------------------------------------------------------------------VV-
B2JCD2_BURP8/9-116-----------------------------------------------------------------------------IR-
B2JPS0_BURP8/31-132-----------------------------------------------------------------------------IR-
B3PI44_CELJU/32-141-----------------------------------------------------------------------------VL-
B4RBI8_PHEZH/167-269-----------------------------------------------------------------------------VT-
B4RHA1_PHEZH/45-153-----------------------------------------------------------------------------IR-
B5GTL4_STRC2/19-130-----------------------------------------------------------------------------VS-
B5I698_9ACTO/6-123-----------------------------------------------------------------------------ID-
B7JXD1_CYAP8/8-119-----------------------------------------------------------------------------IR-
B8GT08_THISH/17-126-----------------------------------------------------------------------------LW-
B8MZS8_ASPFN/6-119-----------------------------------------------------------------------------IL-
B9E8X8_MACCJ/8-114-----------------------------------------------------------------------------LH-
C1A7K4_GEMAT/10-121-----------------------------------------------------------------------------VR-
C1ABS4_GEMAT/430-537-----------------------------------------------------------------------------VA-
C1CZM8_DEIDV/15-112-----------------------------------------------------------------------------VL-
C1F8H5_ACIC5/21-124-----------------------------------------------------------------------------LR-
C3AMI1_BACMY/20-132-----------------------------------------------------------------------------IQ-
C3ZF01_BRAFL/355-462-----------------------------------------------------------------------------IE-
C4L6W4_EXISA/8-106-----------------------------------------------------------------------------LQ-
C5BK93_TERTT/4-109-----------------------------------------------------------------------------VI-
C5CWD6_VARPS/8-118-----------------------------------------------------------------------------LF-
C6XYF7_PEDHD/10-116-----------------------------------------------------------------------------IL-
C6Y015_PEDHD/172-276-----------------------------------------------------------------------------IA-
C7M5E0_CAPOD/27-132-----------------------------------------------------------------------------VL-
C7NFY8_KYTSD/186-282-----------------------------------------------------------------------------VL-
C7NIZ7_KYTSD/228-329-----------------------------------------------------------------------------VL-
C7RBL7_KANKD/30-150-----------------------------------------------------------------------------LT-
C9YUI3_STRSW/23-131-----------------------------------------------------------------------------IE-
D2ATH3_STRRD/10-114-----------------------------------------------------------------------------LL-
D2PZL0_KRIFD/6-115-----------------------------------------------------------------------------LR-
D3F9E1_CONWI/19-126-----------------------------------------------------------------------------LD-
D3FXC8_BACPE/11-109-----------------------------------------------------------------------------IL-
D3Q9C7_STANL/5-122-----------------------------------------------------------------------------IE-
D3S9F1_THISK/27-146-----------------------------------------------------------------------------IQ-
D5DIB8_BACMD/6-113-----------------------------------------------------------------------------VI-
D5SSM1_PLAL2/48-156-----------------------------------------------------------------------------LK-
D5SZ41_PLAL2/16-126-----------------------------------------------------------------------------IR-
D5UXJ0_TSUPD/21-126-----------------------------------------------------------------------------IT-
D5X2H8_THIK1/9-116-----------------------------------------------------------------------------ID-
D5X508_THIK1/258-358-----------------------------------------------------------------------------VS-
D6YUD1_WADCW/33-146-----------------------------------------------------------------------------IL-
D7DI86_METV0/10-122-----------------------------------------------------------------------------IC-
D7FUG0_ECTSI/213-343-----------------------------------------------------------------------------VS-
D9SQZ0_CLOC7/8-113-----------------------------------------------------------------------------IF-
D9T1Z4_MICAI/21-128-----------------------------------------------------------------------------LR-
E0UKN5_CYAP2/8-124-----------------------------------------------------------------------------IQ-
E1VXQ5_ARTAR/20-119-----------------------------------------------------------------------------II-
E3EA41_PAEPS/6-112-----------------------------------------------------------------------------II-
E3M5F2_CAERE/6-112-----------------------------------------------------------------------------FQ-
E3NA36_CAERE/13-119-----------------------------------------------------------------------------LK-
E3NA40_CAERE/13-119-----------------------------------------------------------------------------LK-
E3Q3Z8_COLGM/20-132-----------------------------------------------------------------------------TL-
E4TM42_MARTH/40-139-----------------------------------------------------------------------------LD-
E6X731_CELAD/46-156-----------------------------------------------------------------------------IA-
E8WVR2_ACISM/66-173-----------------------------------------------------------------------------IR-
E8WVR2_ACISM/212-319-----------------------------------------------------------------------------ID-
E8WVR7_ACISM/60-181-----------------------------------------------------------------------------LT-
E8WXR9_ACISM/62-172-----------------------------------------------------------------------------LM-
E8X558_ACISM/30-138-----------------------------------------------------------------------------LA-
F2F0M6_SOLSS/9-106-----------------------------------------------------------------------------LQ-
F2F328_SOLSS/60-162-----------------------------------------------------------------------------II-
F2RH14_STRVP/10-117-----------------------------------------------------------------------------VA-
Q03DA3_PEDPA/8-116-----------------------------------------------------------------------------IV-
Q0RLC8_FRAAA/20-126-----------------------------------------------------------------------------LR-
Q11V67_CYTH3/7-113-----------------------------------------------------------------------------IL-
Q12Q38_SHEDO/8-111-----------------------------------------------------------------------------LI-
Q13U88_BURXL/31-133-----------------------------------------------------------------------------LA-
Q1GMQ9_RUEST/19-122-----------------------------------------------------------------------------LR-
Q1H132_METFK/13-128-----------------------------------------------------------------------------IK-
Q1ISF5_KORVE/28-135-----------------------------------------------------------------------------VV-
Q1ITS8_KORVE/8-111-----------------------------------------------------------------------------IR-
Q2G7A7_NOVAD/11-122-----------------------------------------------------------------------------IR-
Q2LTB1_SYNAS/390-491-----------------------------------------------------------------------------IS-
Q5LLC5_RUEPO/46-153-----------------------------------------------------------------------------IA-
Q5YUX5_NOCFA/23-128-----------------------------------------------------------------------------LL-
Q6AE79_LEIXX/186-283-----------------------------------------------------------------------------VE-
Q82AU3_STRAW/26-136-----------------------------------------------------------------------------IR-
Q89JP5_BRADU/29-135-----------------------------------------------------------------------------VE-
Q89SG9_BRADU/39-147-----------------------------------------------------------------------------VA-
Q8YWM4_NOSS1/9-120-----------------------------------------------------------------------------IR-
Q9RS70_DEIRA/32-140-----------------------------------------------------------------------------IR-
B0SRG8_LEPBP/10-116-----------------------------------------------------------------------------IE-
B1HN37_LYSSC/64-167-----------------------------------------------------------------------------IL-
F9URX0_LACPL/18-126-----------------------------------------------------------------------------II-
F9UT77_LACPL/12-117-----------------------------------------------------------------------------.A-
Q5LTS8_RUEPO/9-110-----------------------------------------------------------------------------.L-
Q8P937_XANCP/40-149-----------------------------------------------------------------------------..-
Q8PBX0_XANCP/2-100-----------------------------------------------------------------------------..-
Q8YRK0_NOSS1/10-115-----------------------------------------------------------------------------.I-
Q8ZMH1_SALTY/11-112-----------------------------------------------------------------------------..-
Q97G15_CLOAB/8-113-----------------------------------------------------------------------------IL-
Q9A9S2_CAUCR/46-158-----------------------------------------------------------------------------.A-
Q9RJZ2_STRCO/30-137-----------------------------------------------------------------------------IE-

PF08332

KCC2D_CAEEL/587-711-------------------------------------------------------------------------QKQDIV-
Q8P5Y9_XANCP/36-159-------------------------------------------------------------------------EAREVA-
KCC2A_DROME/389-516-------------------------------------------------------------------------RRQEII-
Q5SIW7_THET8/3-128-------------------------------------------------------------------------GEAELW-
F8WHB5_MOUSE/57-184-------------------------------------------------------------------------RKQEII-

PF13577

D9QIN2_BRESC/9-135-------------------------------------------------------------------------ERVESV-
D9QIN2_BRESC/195-322-------------------------------------------------------------------------VRLEDE-
D9QIN2_BRESC/413-542-------------------------------------------------------------------------AATAAV-
D3Q8I0_STANL/19-151-------------------------------------------------------------------------AELRDR-
Q0SJ13_RHOSR/45-175-------------------------------------------------------------------------RQLEDR-
A5V679_SPHWW/6-139-------------------------------------------------------------------------QTLLDK-
B5HCB8_STRPR/23-148-------------------------------------------------------------------------RALTDR-
E3IXY9_FRASU/16-146-------------------------------------------------------------------------RRLLDK-
D2RZV4_HALTV/8-134-------------------------------------------------------------------------ARLADR-
Q0UXA3_PHANO/19-158-------------------------------------------------------------------------PSALDH-
B1MBT8_MYCA9/7-136-------------------------------------------------------------------------ETLVDI-
A5V4W9_SPHWW/12-141-------------------------------------------------------------------------ARIEAR-
Q73Z53_MYCPA/11-137-------------------------------------------------------------------------DTLPAI-
D0L747_GORB4/5-127-------------------------------------------------------------------------EEISAR-
B4EDY3_BURCJ/5-132-------------------------------------------------------------------------HTLSDH-
B0T6L6_CAUSK/8-137-------------------------------------------------------------------------QLLIDK-
Q0UTX1_PHANO/50-179-------------------------------------------------------------------------SSLESL-
Q0UTX1_PHANO/238-365-------------------------------------------------------------------------QRLNDE-
Q0UTX1_PHANO/423-553-------------------------------------------------------------------------LRSAAF-
A5VCU7_SPHWW/9-134-------------------------------------------------------------------------RRLLDE-
B2A9N2_PODAN/33-173-------------------------------------------------------------------------LRVESV-
B2A9N2_PODAN/248-379-------------------------------------------------------------------------AHLNEE-
A6VWC0_MARMS/15-150-------------------------------------------------------------------------DALESD-
A0QWD2_MYCS2/19-160-------------------------------------------------------------------------RRLEDE-
A1SDG2_NOCSJ/13-135-------------------------------------------------------------------------SFVDDI-
A4XF70_NOVAD/24-149-------------------------------------------------------------------------RLLEDR-
C5DP23_ZYGRC/32-161-------------------------------------------------------------------------SYLNDR-
A5V734_SPHWW/6-140-------------------------------------------------------------------------SELVDE-
E3IXP4_FRASU/19-145-------------------------------------------------------------------------RTLEDQ-
E3IY46_FRASU/4-132-------------------------------------------------------------------------GDLCEI-
D0J3B0_COMT2/9-135-------------------------------------------------------------------------EQVLLE-
A8LAB8_FRASN/18-148-------------------------------------------------------------------------GRLEDE-
A4XF68_NOVAD/127-253-------------------------------------------------------------------------DELLAE-
Q0S5K6_RHOSR/13-140-------------------------------------------------------------------------AELVET-
C5AL89_BURGB/17-156-------------------------------------------------------------------------SRLEAE-
D0IVW3_COMT2/14-141-------------------------------------------------------------------------QHLEDI-
Q2G3D7_NOVAD/8-142-------------------------------------------------------------------------TRLIAI-
A5VH89_SPHWW/19-143-------------------------------------------------------------------------QVLEAR-
E3J7S9_FRASU/5-125-------------------------------------------------------------------------EQLLAR-
A5DD79_PICGU/8-137-------------------------------------------------------------------------NSITER-
E3J7S1_FRASU/26-166-------------------------------------------------------------------------RELEDD-
D2QII9_SPILD/28-157-------------------------------------------------------------------------QQIEDR-
A5V526_SPHWW/11-135-------------------------------------------------------------------------QALLDK-
E3IVD7_FRASU/14-137-------------------------------------------------------------------------VELQAR-
Q0S5K7_RHOSR/9-131-------------------------------------------------------------------------RRLEDR-
D0LD89_GORB4/12-143-------------------------------------------------------------------------SHLEQI-
B2AQ89_PODAN/30-160-------------------------------------------------------------------------SRIESL-
B2AQ89_PODAN/220-360-------------------------------------------------------------------------EDLNDE-
A5VBN9_SPHWW/10-129-------------------------------------------------------------------------DRLESI-
E6WNE5_PANSA/4-133-------------------------------------------------------------------------HEIAQR-
B8MXL3_ASPFN/8-138-------------------------------------------------------------------------PSLTTR-
C0ZQW7_RHOE4/8-149-------------------------------------------------------------------------EELLAI-
E3IWW1_FRASU/10-135-------------------------------------------------------------------------EELAAR-
D1ABN9_THECD/23-147-------------------------------------------------------------------------RLLEDE-
C0ZMD8_RHOE4/24-149-------------------------------------------------------------------------DALVAK-
C0ZQN1_RHOE4/6-139-------------------------------------------------------------------------SRIVAE-
A4XEZ3_NOVAD/13-139-------------------------------------------------------------------------GVLEDK-
Q13HM1_BURXL/10-142-------------------------------------------------------------------------AYLMAV-
B5HT20_9ACTO/43-171-------------------------------------------------------------------------NSVTAA-
B3E7N6_GEOLS/52-188-------------------------------------------------------------------------WVLEAK-
Q65SQ7_MANSM/19-149-------------------------------------------------------------------------EQLIER-
A5VBG5_SPHWW/5-140-------------------------------------------------------------------------DTLLAI-
C5E1P0_ZYGRC/8-136-------------------------------------------------------------------------PFLSDR-
C7PBQ3_CHIPD/4-133-------------------------------------------------------------------------QELADR-
A5V782_SPHWW/7-132-------------------------------------------------------------------------SDLLAQ-
E3J9Q1_FRASU/15-143-------------------------------------------------------------------------RRVEDE-
Q28SS5_JANSC/28-163-------------------------------------------------------------------------DTLLDR-
Q5YUE7_NOCFA/24-150-------------------------------------------------------------------------EAMEDR-
A5V765_SPHWW/9-128-------------------------------------------------------------------------AAIADK-
Q2G4I2_NOVAD/20-164-------------------------------------------------------------------------TELEDL-
Q0RU80_FRAAA/13-137-------------------------------------------------------------------------EELWVR-
C0ZY97_RHOE4/8-139-------------------------------------------------------------------------DALEQI-
C1GKF4_PARBD/8-153-------------------------------------------------------------------------DYLLDR-
B0T6Q3_CAUSK/13-141-------------------------------------------------------------------------QRLEDI-
Q2G896_NOVAD/9-133-------------------------------------------------------------------------MTADDM-
Q2G8B9_NOVAD/8-130-------------------------------------------------------------------------RRLEDR-
A0R741_MYCS2/12-151-------------------------------------------------------------------------RTIEDT-
A2QQU7_ASPNC/9-142-------------------------------------------------------------------------PALPLR-
A5V496_SPHWW/15-154-------------------------------------------------------------------------ADLRAE-
D3F909_CONWI/11-132-------------------------------------------------------------------------QELTDR-
A5V4W4_SPHWW/9-135-------------------------------------------------------------------------ERLEAL-
A8LEQ5_FRASN/33-162-------------------------------------------------------------------------RSAEDQ-
Q5YMU1_NOCFA/9-129-------------------------------------------------------------------------RDLADR-
B8MB56_TALSN/45-177-------------------------------------------------------------------------EKTLAI-
A7HVX6_PARL1/27-151-------------------------------------------------------------------------AMSDAR-
Q47PW3_THEFY/16-138-------------------------------------------------------------------------RRLEEM-
Q0RKC5_FRAAA/4-127-------------------------------------------------------------------------AELRTR-
C0ZPG5_RHOE4/7-136-------------------------------------------------------------------------VATEDV-
Q2GA82_NOVAD/22-166-------------------------------------------------------------------------TVREDE-
D1A615_THECD/11-138-------------------------------------------------------------------------VTAEDY-
Q2J5F3_FRASC/12-141-------------------------------------------------------------------------APAELY-
Q13GK3_BURXL/16-154-------------------------------------------------------------------------RQVEDH-
Q2HFF4_CHAGB/8-157-------------------------------------------------------------------------QYLLDR-
B2AMA1_PODAN/20-165-------------------------------------------------------------------------SRVSDE-
Q2J5F8_FRASC/12-144-------------------------------------------------------------------------PSAEIY-
A4XER9_NOVAD/52-204-------------------------------------------------------------------------QSSHDR-
B5HIV3_STRPR/14-145-------------------------------------------------------------------------DISALY-
D4J4G2_9FIRM/14-173-------------------------------------------------------------------------QRVWDV-
D4J4F8_9FIRM/15-157-------------------------------------------------------------------------CKLEAQ-
A2QCD6_ASPNC/23-149-------------------------------------------------------------------------EEILDR-
Q0V2S9_PHANO/36-181-------------------------------------------------------------------------DNIKDQ-
Q73XG8_MYCPA/12-127-------------------------------------------------------------------------QAATSR-
B2HNY2_MYCMM/12-134-------------------------------------------------------------------------...ADI-
B4EK49_BURCJ/8-131-------------------------------------------------------------------------..LHEY-
D4AUD6_ARTBC/51-174-------------------------------------------------------------------------.....R-
D4Z258_SPHJU/6-129-------------------------------------------------------------------------.RLASR-
F2RC28_STRVP/29-155-------------------------------------------------------------------------RELSDR-
F9UT75_LACPL/5-135-------------------------------------------------------------------------QEVSDR-
Q73VN5_MYCPA/6-129-------------------------------------------------------------------------.EISDR-
Q7API7_STRCO/4-133-------------------------------------------------------------------------QQLRDR-

PF12893

Q390L3_BURS3/2-118------------------------------------------------------------------------TQTQAVT-
A4YKR3_BRASO/3-119------------------------------------------------------------------------ADRSTVE-
A3SYD4_9RHOB/2-118------------------------------------------------------------------------TLHPDLL-
A3N8A5_BURP6/1-117------------------------------------------------------------------------MEIDAIS-
Q6ARD2_DESPS/3-119------------------------------------------------------------------------AEIREIL-
A3U1L9_9RHOB/8-121------------------------------------------------------------------------AIEAEVR-
C0VIK1_9GAMM/4-120------------------------------------------------------------------------HAIFDIQ-
B8H2L6_CAUCN/2-118------------------------------------------------------------------------SDFAGVQ-
A0NVB1_9RHOB/3-119------------------------------------------------------------------------SALIALE-
Q5LU66_RUEPO/8-124------------------------------------------------------------------------ASFAAVQ-
A1TQB0_ACIAC/3-119------------------------------------------------------------------------TPFDDIT-
A8TQD6_9PROT/3-119------------------------------------------------------------------------PRYAAAV-
Q1GM60_RUEST/4-120------------------------------------------------------------------------SPDAEVQ-
Q16B55_ROSDO/5-121------------------------------------------------------------------------PDEVAVR-
A4ESW6_9RHOB/4-120------------------------------------------------------------------------NDHKQVG-
A8TNA8_9PROT/3-119------------------------------------------------------------------------TAYAELA-
A1U866_MARAV/3-114------------------------------------------------------------------------TEKPQLE-
Q2BPK3_NEPCE/9-120------------------------------------------------------------------------DDFTMIR-
A3YEG3_9GAMM/7-118------------------------------------------------------------------------TDFDLVV-
Q480Y3_COLP3/13-124------------------------------------------------------------------------SDFNAIE-
Q12R73_SHEDO/9-120------------------------------------------------------------------------SDFSTIT-
A1ZW12_9BACT/4-119------------------------------------------------------------------------NKLKQIE-
D7VZN4_9FLAO/30-146------------------------------------------------------------------------ASETEIR-
A5FCS3_FLAJ1/29-145------------------------------------------------------------------------IEIQAIT-
C7PJE9_CHIPD/30-146------------------------------------------------------------------------QDSLAIA-
Q47ZG0_COLP3/35-153------------------------------------------------------------------------KEYQAVV-
A4A731_9GAMM/38-147------------------------------------------------------------------------DDIDGVR-
B8KPV9_9GAMM/26-135------------------------------------------------------------------------DDVAAIR-
A9AXY9_HERA2/8-126------------------------------------------------------------------------DDIAAIQ-
B8L8C5_9GAMM/32-148------------------------------------------------------------------------ATIAAIE-
Q9A9W5_CAUCR/33-150------------------------------------------------------------------------ATVKAVE-
B4RCF3_PHEZH/43-158------------------------------------------------------------------------AAVRAIE-
A1ZL32_9BACT/31-153------------------------------------------------------------------------TKKAEVK-
A8UKV2_9FLAO/14-126------------------------------------------------------------------------SEIEQIN-
C1AE73_GEMAT/307-421------------------------------------------------------------------------SETAGAL-
Q46X76_CUPPJ/10-124------------------------------------------------------------------------PQYAAAL-
Q0JYS5_CUPNH/10-124------------------------------------------------------------------------SRHVAAL-
L2ENA4_9BURK/8-121------------------------------------------------------------------------AEYLAAL-
B7WZC2_COMTE/10-123------------------------------------------------------------------------PEEAAVR-
Q9F3P6_STRCO/275-388------------------------------------------------------------------------DVEGAVL-
C7QIJ7_CATAD/267-380------------------------------------------------------------------------AVDDAVL-
A1ZP43_9BACT/24-134------------------------------------------------------------------------QEKKAII-
A3HY18_9BACT/11-124------------------------------------------------------------------------NERELIS-
Q1H3V3_METFK/8-121------------------------------------------------------------------------DDIDGIT-
C3KBS1_PSEFS/33-147------------------------------------------------------------------------EDYQAIT-
C3KBQ7_PSEFS/8-122------------------------------------------------------------------------EDYNAIV-
A3D088_SHEB5/8-122------------------------------------------------------------------------QEYHAIV-
Q3KE19_PSEPF/8-121------------------------------------------------------------------------QEYNAIV-
C5FTM8_ARTOC/16-127------------------------------------------------------------------------KEKEAVL-
C3KBQ8_PSEFS/11-124------------------------------------------------------------------------LDYNAVV-
C7PBA6_CHIPD/41-154------------------------------------------------------------------------ADYTAIT-
A5VE46_SPHWW/17-129------------------------------------------------------------------------GDHAEIA-
Q5LUH0_RUEPO/5-117------------------------------------------------------------------------EHIAALT-
Q2KDJ8_RHIEC/2-116------------------------------------------------------------------------SDRQAVE-
B9J7G6_AGRRK/2-116------------------------------------------------------------------------SEEQAIR-
A6UF76_SINMW/2-116------------------------------------------------------------------------SEEQAIS-
C3MCQ3_RHISN/2-116------------------------------------------------------------------------SDEQAIS-
B8FB72_DESAA/6-121------------------------------------------------------------------------QDLEMIK-
A0Z962_9GAMM/3-119------------------------------------------------------------------------TDKQKIE-

PF11533

Q2KWZ9_BORA1/3-126-------------------------------------------------------------------------TVINLP-
A4GA01_HERAR/3-127-------------------------------------------------------------------------HEINLP-
Q2JJM3_SYNJB/2-130-------------------------------------------------------------------------SVVNRP-
B2JQX3_BURP8/4-129-------------------------------------------------------------------------ESINDP-
B0T8S4_CAUSK/1-126-------------------------------------------------------------------------MIVNAP-
A7IPC9_XANP2/2-128-------------------------------------------------------------------------VEIDIP-
Q9A550_CAUCR/1-126-------------------------------------------------------------------------MIINDP-
Q6D1E8_PECAS/4-128-------------------------------------------------------------------------DDVNQA-
Q89VK3_BRADU/1-127-------------------------------------------------------------------------MEIDLP-
Q01TH6_SOLUE/1-127-------------------------------------------------------------------------M.INQP-
Q6N9S0_RHOPA/1-127-------------------------------------------------------------------------MDIDLP-
A2SDU4_METPP/5-130-------------------------------------------------------------------------HDINRP-
Q5FP06_GLUOX/7-132-------------------------------------------------------------------------PLLNDP-
A6T9D1_KLEP7/5-128-------------------------------------------------------------------------DNVDRP-
A1WIE8_VEREI/2-125-------------------------------------------------------------------------MPVNLP-
A8GA93_SERP5/4-128-------------------------------------------------------------------------EYIDRP-
Q7CK76_YERPE/32-154-------------------------------------------------------------------------.CIDHL-
Q8PDQ4_XANCP/7-128-------------------------------------------------------------------------.SIDLP-

PF12870

B2TQV7_CLOBB/21-124------------------------------------------------------------------------CGCAEKQ.
D1PEL1_9BACT/17-132------------------------------------------------------------------------SSCKEEKP
B3ZXI6_BACCE/23-125------------------------------------------------------------------------SGCTGDKR
C2Q545_BACCE/14-115------------------------------------------------------------------------AACGNNR.
C2UNV5_BACCE/11-113------------------------------------------------------------------------AACGNNR.
B9L7K8_NAUPA/17-130------------------------------------------------------------------------TGCSKKD.
A8ETE1_ARCB4/19-125------------------------------------------------------------------------SGCFEE..
B4EXW7_PROMH/19-133------------------------------------------------------------------------SACGDKQD
B7X013_COMTE/26-141------------------------------------------------------------------------SACATA..
A0A059GNW7_CAMJU/1-111------------------------------------------------------------------------MAYGSS..
Q7VHU7_HELHP/20-130------------------------------------------------------------------------VACGAN..
C0DXX5_EIKCO/20-134------------------------------------------------------------------------AACSGGG.
B3CFI0_9BACE/18-132------------------------------------------------------------------------AACSSSS.
B3JFG8_9BACE/19-131------------------------------------------------------------------------VSCTPS..
D3Q127_STANL/126-231------------------------------------------------------------------------VFSGG...
B1MHS8_MYCA9/118-217------------------------------------------------------------------------PAGGAA..
B5D1Y3_BACPM/17-129------------------------------------------------------------------------AACSSN..
C7PUV8_CHIPD/19-120------------------------------------------------------------------------GSCKKSA.
C2M310_CAPGI/17-114------------------------------------------------------------------------ASCSGN..
B3QM74_CHLP8/19-124------------------------------------------------------------------------ASCGLFKP
Y142_AQUAE/19-135------------------------------------------------------------------------KSCGEPYS
A8UYQ1_9AQUI/18-134------------------------------------------------------------------------KSCGEPYD
B4U8X6_HYDS0/35-135------------------------------------------------------------------------PQTINNN.

PF00866

Q9I0W9_PSEAE/15-157------------------------------------------------------------------------RHAELCD-
Q9I0W5_PSEAE/14-156------------------------------------------------------------------------REARYLD-
Q53123_RHOSR/32-181------------------------------------------------------------------------WEAKLLN-
BENB_ACIAD/21-163------------------------------------------------------------------------SEARFLD-
ANTDB_ACIAD/15-157------------------------------------------------------------------------KKAELCD-
HCAF_ECOLI/19-166------------------------------------------------------------------------HEASLLD-
Q9I230_PSEAE/22-162------------------------------------------------------------------------AEAELLD-
A0AWN1_ARTS2/49-192------------------------------------------------------------------------.EAYLLD-
A1T2D2_MYCVP/20-161------------------------------------------------------------------------REAELLD-
A1WAE7_ACISJ/40-186------------------------------------------------------------------------REAHLLD-
A4XDR9_NOVAD/19-159------------------------------------------------------------------------.DANALD-
A4XDS6_NOVAD/23-168------------------------------------------------------------------------REARLLD-
A4XDS8_NOVAD/30-176------------------------------------------------------------------------REARLLD-
A4XDU7_NOVAD/18-157------------------------------------------------------------------------QEAMALD-
A4XDY2_NOVAD/23-167------------------------------------------------------------------------.EVRMLQ-
A5V4P0_SPHWW/21-169------------------------------------------------------------------------READLLD-
A5VGV9_SPHWW/24-171------------------------------------------------------------------------EEAALLA-
A9I2P3_BORPD/32-180------------------------------------------------------------------------WEAKLLN-
E7FJB3_9BURK/38-186------------------------------------------------------------------------REAQLLD-
G8ML34_9BURK/14-155------------------------------------------------------------------------REARFLD-
K0C5V9_CYCSP/30-185------------------------------------------------------------------------REALLLD-
BPHE_BURXL/33-181------------------------------------------------------------------------REAQLLD-
S6AQB4_PSERE/15-156------------------------------------------------------------------------RNAEACD-
S6BQW5_PSERE/33-166------------------------------------------------------------------------REARLLD-

PF05223

Q8Y9T2_LISMO/44-163------------------------------------------------------------------------NALAAAE-
Q97D06_CLOAB/26-144------------------------------------------------------------------------TPKASFE-
Q8NP18_CORGL/32-140------------------------------------------------------------------------TADPIAE-
Q9F2L0_STRCO/54-166------------------------------------------------------------------------AATEQAR-
Q9K7H2_BACHD/27-156------------------------------------------------------------------------SPEEAFT-
PBPC_BACSU/26-148------------------------------------------------------------------------SPEDRME-
Q9CBU6_MYCLE/35-143------------------------------------------------------------------------GPGPAAA-
B5GLC4_STRC2/58-167------------------------------------------------------------------------AAAGQFD-
H7C6V7_ENTFA/46-164------------------------------------------------------------------------EAKKTAT-
I6TCQ1_ENTHA/44-162------------------------------------------------------------------------AGEKKIQ-
Q3XZN6_ENTFC/44-162------------------------------------------------------------------------AGEKTVE-
Q81E03_BACCR/24-142------------------------------------------------------------------------KPQEAFD-
X1XHQ7_ACYPI/24-139------------------------------------------------------------------------SKNSQIN-

PF02982

SCYD_ASPFU/9-168--------------------------------------------------------------------TLEFHDYLALK-
SCYD_MAGO7/10-169--------------------------------------------------------------------EITFSDYLGLM-
SCYD_COLOR/7-166--------------------------------------------------------------------NITFEDYLGLN-

PF12707

Q46H33_PROMT/23-149------------------------------------------------------------------------SDSQQLE-
Q46KI2_PROMT/2-129------------------------------------------------------------------------SSKEEIL-

PF12883

D9QJI7_BRESC/62-179------------------------------------------------------------------------GPEPFVR-
H2IPN3_RAHAC/22-145------------------------------------------------------------------------QAGQQVK-
I0K6B0_9BACT/55-189------------------------------------------------------------------------QKAANQI-
B8HJZ2_CYAP4/26-146------------------------------------------------------------------------GPAATVE-
A8AER7_CITK8/22-144------------------------------------------------------------------------NAERRVS-
A8ADQ6_CITK8/22-144------------------------------------------------------------------------DSTQDIN-
A7MF41_CROS8/40-159------------------------------------------------------------------------GPDTVAE-
A7MM23_CROS8/24-142------------------------------------------------------------------------TPTQFLK-
H2J156_RAHAC/32-164------------------------------------------------------------------------DPVKITQ-
YBJP_ECOLI/41-154------------------------------------------------------------------------.PDNVAQ-
YQHG_ECOLI/25-143------------------------------------------------------------------------.VEQTVR-
Q8ZNB4_SALTY/23-142------------------------------------------------------------------------.STQAVK-

PF13026

A4AWI0_MARSH/19-104-----------------------------------------------------------------------------AS-
A6LM34_THEM4/24-113-----------------------------------------------------------------------------AT-
A8F7I3_THELT/24-115-----------------------------------------------------------------------------AL-
A9KL18_CLOPH/74-163-----------------------------------------------------------------------------SA-
B1I2Q6_DESAP/43-137-----------------------------------------------------------------------------AE-
B8E211_DICTD/27-115-----------------------------------------------------------------------------SE-
C3AGG3_BACMY/39-163-----------------------------------------------------------------------------AE-
C8WGP2_EGGLE/123-216-----------------------------------------------------------------------------AQ-
D4JFI6_9FIRM/118-209-----------------------------------------------------------------------------AM-
D6E741_9ACTN/49-139-----------------------------------------------------------------------------AR-
D6E742_9ACTN/53-143-----------------------------------------------------------------------------AR-
D7AW34_NOCDD/95-184-----------------------------------------------------------------------------AA-
E3GDE8_EUBLK/46-135-----------------------------------------------------------------------------AE-
E3GFD2_EUBLK/40-131-----------------------------------------------------------------------------TR-
E6TQB5_BACCJ/33-124-----------------------------------------------------------------------------SR-
E6TQB6_BACCJ/58-147-----------------------------------------------------------------------------AE-
E6TY43_BACCJ/31-120-----------------------------------------------------------------------------AV-
F0S9L8_PEDSD/29-118-----------------------------------------------------------------------------ST-
F4CEB4_SPHS2/28-116-----------------------------------------------------------------------------AA-
F6D290_METSW/13-102-----------------------------------------------------------------------------AQ-
F6GEE1_LACS5/30-117-----------------------------------------------------------------------------VS-
G2MPX0_9ARCH/64-153-----------------------------------------------------------------------------TQ-
G8LXF0_CLOCD/44-138-----------------------------------------------------------------------------AE-
H1XTG9_9BACT/36-125-----------------------------------------------------------------------------AA-
H1ZC72_MYROD/29-115-----------------------------------------------------------------------------ME-
Q73JX5_TREDE/37-132-----------------------------------------------------------------------------AE-
Q8EMU8_OCEIH/26-113-----------------------------------------------------------------------------SE-
D4M3N3_9FIRM/40-132-----------------------------------------------------------------------------AT-
Q81P15_BACAN/37-125-----------------------------------------------------------------------------AE-
Q9WYH1_THEMA/26-112-----------------------------------------------------------------------------..-
R5HS05_9FIRM/71-164-----------------------------------------------------------------------------AE-
R5QXD2_9FIRM/39-142-----------------------------------------------------------------------------AD-
R5TTD3_9FIRM/55-147-----------------------------------------------------------------------------AM-
R5W2J2_9BACE/28-117-----------------------------------------------------------------------------AQ-
R6ELK1_9FIRM/40-141-----------------------------------------------------------------------------AD-
R6EMC8_9FIRM/45-140-----------------------------------------------------------------------------AE-
R6F505_9FIRM/119-211-----------------------------------------------------------------------------.E-
R6LVU3_9FIRM/39-143-----------------------------------------------------------------------------.D-
R6PF09_9FIRM/42-138-----------------------------------------------------------------------------AK-
R6UW08_9FIRM/46-137-----------------------------------------------------------------------------AL-
W0EZS0_9SPHI/30-115-----------------------------------------------------------------------------AD-

PF16156

G2KS29_MICAA/81-180-----------------------------------------------------------------------------IR-
F2IZS6_POLGS/37-137-----------------------------------------------------------------------------FR-
Q1GEC2_RUEST/29-128-----------------------------------------------------------------------------IT-
A8LR20_DINSH/25-124-----------------------------------------------------------------------------IE-
Q5LW85_RUEPO/25-124-----------------------------------------------------------------------------IK-
Q28L79_JANSC/39-138-----------------------------------------------------------------------------IE-
Q7NLT4_GLOVI/45-142-----------------------------------------------------------------------------LE-
Q6MA17_PARUW/75-172-----------------------------------------------------------------------------V.-
B2J495_NOSP7/11-111-----------------------------------------------------------------------------IR-
Q8YXC7_NOSS1/11-111-----------------------------------------------------------------------------IR-
D7BFD2_MEISD/33-133-----------------------------------------------------------------------------IR-
A1VLU3_POLNA/45-145-----------------------------------------------------------------------------VR-
F5Y526_RAMTT/37-137-----------------------------------------------------------------------------VR-
B1M6C1_METRJ/27-128-----------------------------------------------------------------------------AR-
B9JFB3_AGRRK/27-129-----------------------------------------------------------------------------AQ-
C3MD33_RHISN/28-126-----------------------------------------------------------------------------.R-
E4PHZ6_MARAH/39-138-----------------------------------------------------------------------------IR-
K9VG60_9CYAN/11-111-----------------------------------------------------------------------------IR-
Q16AU9_ROSDO/25-124-----------------------------------------------------------------------------MR-
Q98M58_RHILO/71-171-----------------------------------------------------------------------------.Q-

PF07961

YD3B_SCHPO/40-266AISQRALKPMDIPFLQCYIEPIDNTSF..FLHPFKKIRFWWRYLFYGWWNLKKNQFLIK..RTFPDRDFSIAEIIQNAL-
Q6BRJ5_DEBHA/41-283KTQQADISQIPIKSIGIIADFYVPPKY..LKSPVTS...WHKLLFRRMGLFAINTYSIVKFKRETGLKLHFNQWKDTAV-
Q74ZJ7_ASHGO/28-263GSGTKQQSGFNKRYLGVTDKIYVPTMYRNLPSVFRSPLVVANSLIRRIYMLGLNTVHVALFRVQSGYKPKFLLWKNKAI-
Q6CM11_KLULA/30-266DGVVKKPAPFNPRHMGVANQVYIAPSKKNMPNPITSPVAYFNVLVRKIYTLGMNTIQVALFRYQSGLKPNFLLWKNKAI-
Q6FJG9_CANGA/40-276KQDTKKIQDFNPRHLGVASELYVPASLSRLPSVITSPKLWFDNVIRRIYMLGLNTVQIGIFRFQTGIKPAFLLWKNKAI-
Q6CE08_YARLI/32-266SNNASKSQRLELKHIGIMNEPIIPLSH....APWTNPKGLVKHFYRRMYAFVVNTFNVAQYRLKTKKKPRFTEWKNDAI-
MBA1_YEAST/42-278KKDKSKQQDFNPRHLGVAAEIFIPSAYKNLPNVFAHPLIVANALIRRLYTFGLNSVQVALFRFQSGIKPSFLLWKNKAI-

PF04280

Q29AN0_DROPS/288-437---------------------------------------LSETM.TELVKI--------------DPAFDQKQFLRDCE-
TI441_ARATH/315-467---------------------------------------SASTY.KEIRSR--------------DPSFSLPDFAAEIE-
Q74E73_GEOSL/170-314---------------------------------------ADSGL.AHVRQM--------------DGSFSEEQFRQLAQ-
Q4WTB9_ASPFU/363-517---------------------------------------TAQVI.KKFREM--------------DPNFQMESFLREMR-
A7HSI5_PARL1/99-245---------------------------------------LAGAL.DAIADA--------------DRTFDTESFLSGAR-
Q2LX56_SYNAS/191-336---------------------------------------GGGGL.DAIRQM--------------DYQFDERRFKDSVL-
A1AM45_PELPD/168-313---------------------------------------ADGGL.DHIRQM--------------DPGFDENRFNDMAM-
A5G6N4_GEOUR/172-317---------------------------------------VDTGM.AHIRQM--------------DPSFDESRFNDSVM-
Q92K63_RHIME/130-273---------------------------------------SAAAP.ASGNGD--------------EITVGQEDL.DRFE-
Q6BV22_DEBHA/267-421---------------------------------------QAKVI.KQFKQM--------------DPAFRVTDFTKTLT-
Q2N800_ERYLH/68-214---------------------------------------VEQGV.RAIAAA--------------DRGFDVSSFLEGAK-
Q6C8B1_YARLI/257-411---------------------------------------AGKVI.RMFKLM--------------DPSFNQDQFMKTTR-
RM45_XENTR/118-265---------------------------------------SQLAI.RKVKEY--------------DSEFTTKTFPEKAQ-
Q29BD6_DROPS/140-288---------------------------------------SLIAV.RKIRSY--------------DESFSSDQFGAEAQ-
RM45_BOVIN/118-266---------------------------------------SQLSI.RRIKES--------------DPNFKVKDFPEKAQ-
Q4XQ84_PLACH/208-360---------------------------------------LAAAL.RVMKME--------------DKNFKLSELMYLFE-
Q89I32_BRADU/189-331---------------------------------------LGGFG.FGANNA--------------PLEIKPVDY.EAFE-
Q2YAC8_NITMU/160-293---------------------------------------SAVAPVSGTGNI--------------PADFQVEPFLRNAK-
E0TF66_PARBH/73-216---------------------------------------WAE....TVRAD--------------YADFDPDEFVTGAK-
Q69V11_ORYSJ/315-468---------------------------------------TAVSF.REIRQR--------------DPSFSLPDFAGDVQ-
Q8GXP7_ARATH/157-312---------------------------------------LRSAY.AIAKLR--------------KTGYSKNTFYIEAL-
Q3SWG6_NITWN/86-232---------------------------------------LALGL.DAIAAQ--------------DSSFDPAHFLSGAR-
A8XG07_CAEBR/268-418---------------------------------------VSEVL.TEIHKI--------------DANFDKQEWLKFCE-
Q3IYG4_RHOS4/71-219---------------------------------------SAKAL.AGMKMA--------------EPGFSVSEFLTGAR-
A1VKC3_POLNA/193-328---------------------------------------SGLSG.SQSWGV--------------PAGFDADGFLKACK-
Q0AKD2_MARMM/59-205---------------------------------------AAAGL.EAIAAV--------------DTRFDPTAVKEGAQ-
Q1GRJ5_SPHAL/74-220---------------------------------------AEAGL.RQLLAN--------------DRNFDAGRFMEGAR-
Q4N770_THEPA/227-378---------------------------------------LASAL.REMKRL--------------DPSFNLPDLVELVE-
Q39UB8_GEOMG/177-321---------------------------------------TSFGL.AHVRQM--------------DGSFDENRFKETAQ-
TIM44_HUMAN/296-445---------------------------------------MSEVL.TEILRV--------------DPAFDKDRFLKQCE-
Q7Q8M7_ANOGA/261-411---------------------------------------LSAAL.TEVCRI--------------DPSFEAKQFLQFCE-
B5EIY6_GEOBB/173-317---------------------------------------VATGL.SHLRQM--------------DPGFDEGRFNDLVM-
Q11CL9_CHESB/87-233---------------------------------------LNRGL.RAIKDA--------------DPSFDPNTFVDGAK-
Q2KE94_RHIEC/85-231---------------------------------------LNESL.RALNKA--------------DPSFSPKEFLNGAR-
C5AZH9_METEA/91-237---------------------------------------VARGL.EQVVQL--------------EPAFEPRAFLEGAK-
Q5NM00_ZYMMO/68-215---------------------------------------AWDGI.RRIVSR--------------DAHFDLTGFIEGAK-
TI442_ARATH/310-462---------------------------------------SASTY.KEIRRR--------------DPSFSLPDFVSEIQ-
Q218U8_RHOPB/188-330---------------------------------------GSGFG.IGATAA--------------PLEIGPADY.EAFE-
Q9A225_CAUCR/90-231---------------------------------------QAEGV.ATLRAR--------------QPDFDPARFLMGVR-
Q0C6A2_HYPNA/70-202---------------------------------------AAGAL.EDIYNA--------------DRSFSTEEFMRGAK-
Q0BPM0_GRABC/85-230---------------------------------------TGQVL.ARMKEV--------------DRSFDAVRFLNNAE-
B0T6F5_CAUSK/55-196---------------------------------------ALSGL.AALRAR--------------QADFDIGHFLSGAR-
Q7D2D0_AGRT5/69-215---------------------------------------LNASL.RDVMTK--------------DPSFRPKEFLNGAR-
A9BP44_DELAS/201-336---------------------------------------SALAG.SQNWGV--------------PEGFDTEGFLTAAK-
Q73IP9_WOLPM/62-205---------------------------------------IKVTY.KQILKK--------------NKDFSISHFIEGSS-
Q7CT45_AGRT5/71-213---------------------------------------HANA...VSEGD--------------EIGITQGDL.ETFQ-
Q5KEX5_CRYNJ/294-447---------------------------------------TAQVI.RAMKAL--------------DPNFRMDRWTGELR-
Q5LLN6_RUEPO/70-218---------------------------------------QAQAL.AAMKRI--------------EPAFSVSEFVQGAR-
Q21YX7_ALBFT/181-316---------------------------------------SGLAG.SQSWGV--------------PDGFDAEGFLTSAK-
Q4P5L9_USTMA/407-560---------------------------------------FARVT.RQMKML--------------DPSFTMESFQRDLR-
Q2RN93_RHORT/70-216---------------------------------------LAGGL.TQIQLT--------------DPSFSPEGFLIGAK-
Q92TE6_RHIME/85-231---------------------------------------LNAQL.RAMTDA--------------DPNFNPAEFLNGAK-
A0CBB5_PARTE/242-397---------------------------------------VARAI.KQMRMI--------------DPDFDLYELEKEAK-
TIM44_SCHPO/266-420---------------------------------------ASQVM.RRFKEI--------------DPSFNTEHFLQYLR-
A7IGZ9_XANP2/102-248---------------------------------------TAAAL.DEIARI--------------EPDFDARHFLTGAR-
Q6G538_BARHE/82-228---------------------------------------LNKGL.RALHQN--------------DPHFSPQFFIKGAQ-
Q82S83_NITEU/166-298---------------------------------------RQSTS.TDAPDI--------------PADFDVESFLKQAK-
A5FUT4_ACICJ/75-220---------------------------------------VGQTL.ARIAQA--------------ERGFDPARFLDGAE-
Q16CY5_ROSDO/72-220---------------------------------------AAEAL.ANMKRL--------------EPGFNVTEFLGGAR-
A0LJ73_SYNFM/187-332---------------------------------------VERGF.QELRRF--------------DPGFNEESFKETVQ-
Q16KX3_AEDAE/277-426---------------------------------------LSETL.TEICKI--------------DPNFDQKQFLRDCE-
A5VD09_SPHWW/78-224---------------------------------------AEAGV.RAIQSA--------------DGGFDAAQFLEGAR-
Q1GCM9_RUEST/70-218---------------------------------------QSKAL.SDMKRS--------------DSSFQVAEFVQGAR-
Q75AP0_ASHGO/257-411---------------------------------------SARVF.AQFKLL--------------DPTFNTEEFTKHLR-
A0L4W4_MAGSM/183-329---------------------------------------RQQTL.DRLLAE--------------DSNFDEFTFIDGAK-
Q28W04_JANSC/87-235---------------------------------------SAKAL.AAMKMA--------------EPGFRVGEFLGGAR-
Q2VYH8_MAGSA/132-278---------------------------------------MGQGL.AAIRAA--------------DRGFDLDGFLGGAK-
Q7QC22_ANOGA/140-288---------------------------------------SMMAI.RKIRNY--------------DEDFEPPEFATLAQ-
B0UJF2_METS4/90-236---------------------------------------AARGL.DLVLQQ--------------EPGFDPRAFTDGAK-
Q986Y4_RHILO/184-327---------------------------------------SGGAS.LAADSE--------------EIRLAQTDL.DAFQ-
A7ARK8_BABBO/236-388---------------------------------------LAKAV.KEMKRL--------------DSSFDLPEFIESVE-
Q2GAU2_NOVAD/100-246---------------------------------------AEAGV.RAIIAA--------------DRRFDVAQFLAGAK-
B9KHK8_ANAMF/74-217---------------------------------------.SSVF.EAIKER--------------NKGFSVKHFIEGSA-
D5AKF4_RHOCB/72-217---------------------------------------.AVAL.AQMKRV--------------EPTFNVGAFLQGSK-
E4WZD3_OIKDI/234-385---------------------------------------.NDTI.KAIRQV--------------DKKFDQEAFVQFLE-
E7F889_DANRE/126-271---------------------------------------.QLAI.RKIKDY--------------DSTFTSKEFPGIGQ-
E7QG67_YEASZ/271-422---------------------------------------.SRVY.SQFKLM--------------DPTFSNESFTRHLR-
Q2YQZ9_BRUA2/88-232---------------------------------------.NEGL.RAIYAV--------------DPTFEPARFVDGVK-
V6F5J3_9PROT/82-226---------------------------------------.ARGE.AAIRAR--------------DPSFSNTGFLSGAR-

PF07366

F6EAE0_SINMK/6-127---------------------------------------------------------------------------ADIY-
C2T9T5_BACCE/57-169---------------------------------------------------------------------------KMVV-
Q82GA1_STRAW/11-139---------------------------------------------------------------------------ATLN-
E2MBY8_PSEUB/4-125---------------------------------------------------------------------------TDHY-
Q7P1G6_CHRVO/10-136---------------------------------------------------------------------------AVIQ-
Q7NU92_CHRVO/45-170---------------------------------------------------------------------------KLAA-
Q98IW1_RHILO/4-125---------------------------------------------------------------------------TDLY-
Q8TQG8_METAC/22-156---------------------------------------------------------------------------LQLM-
Q8E9W0_SHEON/78-203---------------------------------------------------------------------------ARAA-
Q7CRD4_AGRT5/5-126---------------------------------------------------------------------------NDIY-
Q82DI4_STRAW/115-241---------------------------------------------------------------------------GTVR-
Q7NP31_GLOVI/43-169---------------------------------------------------------------------------ALVR-
O30617_MYXXA/36-152---------------------------------------------------------------------------QRVR-
Q8YNM4_NOSS1/8-132---------------------------------------------------------------------------FIVL-
Q8YQT8_NOSS1/6-132---------------------------------------------------------------------------TELL-
A0A038IJI4_BORBO/18-131---------------------------------------------------------------------------HLMD-
Q8GPW3_PSEAI/8-133---------------------------------------------------------------------------KIAQ-
Q6LKM5_PHOPR/2-132---------------------------------------------------------------------------SLTI-
Q7NYY8_CHRVO/8-137---------------------------------------------------------------------------RVVQ-
Q63FG7_BACCZ/60-176---------------------------------------------------------------------------VHAA-
Q9RN64_STRNO/8-132---------------------------------------------------------------------------ERCL-
Q8KY43_STRCU/149-275---------------------------------------------------------------------------ELVL-
DNRD_STRPE/5-133---------------------------------------------------------------------------IDLV-
A0A030SG61_PSEAI/7-128---------------------------------------------------------------------------AERY-
DNRD_STRGJ/5-132---------------------------------------------------------------------------IAAV-
Q98JP4_RHILO/22-156---------------------------------------------------------------------------AVVV-
Q7NGE5_GLOVI/21-149---------------------------------------------------------------------------VVAL-
A3NUH9_BURP0/56-181---------------------------------------------------------------------------ILAA-
Q82M76_STRAW/10-135---------------------------------------------------------------------------ALLR-

PF12680

B5I6W1_9ACTO/1-115-----------------------------------------------------------------------------MD-
B5HJN5_STRPR/117-228-----------------------------------------------------------------------------AR-
B5H8J2_STRPR/32-138-----------------------------------------------------------------------------VR-
C5CZF1_VARPS/22-124-----------------------------------------------------------------------------VR-
C5CZF1_VARPS/148-250-----------------------------------------------------------------------------IR-
B2J517_NOSP7/10-126-----------------------------------------------------------------------------VR-
B2J517_NOSP7/165-276-----------------------------------------------------------------------------VS-
B5HLE5_9ACTO/167-263-----------------------------------------------------------------------------VA-
D3ECJ4_GEOS4/142-239-----------------------------------------------------------------------------VK-
Q5LLC2_RUEPO/32-126-----------------------------------------------------------------------------AV-
Q5LLC2_RUEPO/163-259-----------------------------------------------------------------------------VT-
C1D3J7_DEIDV/182-279-----------------------------------------------------------------------------VA-
D2SCU4_GEOOG/6-119-----------------------------------------------------------------------------AQ-
B5HLM0_9ACTO/9-102-----------------------------------------------------------------------------LT-
B5HLM0_9ACTO/139-235-----------------------------------------------------------------------------VA-
A5V525_SPHWW/7-105-----------------------------------------------------------------------------VL-
B9L3S7_THERP/14-118-----------------------------------------------------------------------------VR-
B4RFR1_PHEZH/28-128-----------------------------------------------------------------------------IR-
A7HS76_PARL1/16-117-----------------------------------------------------------------------------VA-
A6X4Q6_OCHA4/11-117-----------------------------------------------------------------------------FS-
C7PVH3_CATAD/11-120-----------------------------------------------------------------------------VV-
B0C0J0_ACAM1/35-144-----------------------------------------------------------------------------VE-
B0C0J0_ACAM1/185-295-----------------------------------------------------------------------------VL-
Q1D9P4_MYXXD/10-115-----------------------------------------------------------------------------AR-
A5VCT4_SPHWW/11-120-----------------------------------------------------------------------------VK-
C7Q8T1_CATAD/8-117-----------------------------------------------------------------------------VL-
B0T3P4_CAUSK/9-118-----------------------------------------------------------------------------VQ-
C5CRN6_VARPS/10-123-----------------------------------------------------------------------------IA-
B7KBU4_CYAP7/7-120-----------------------------------------------------------------------------AE-
C4ZJ89_THASP/28-128-----------------------------------------------------------------------------LA-
A5VDX7_SPHWW/10-121-----------------------------------------------------------------------------VE-
D2B1F4_STRRD/9-111-----------------------------------------------------------------------------VE-
B8ES54_METSB/10-116-----------------------------------------------------------------------------VK-
Q0S9H2_RHOSR/9-118-----------------------------------------------------------------------------VR-
B9LPI7_HALLT/13-109-----------------------------------------------------------------------------VR-
C7Q9Y2_CATAD/16-124-----------------------------------------------------------------------------AR-
A5VBH5_SPHWW/11-110-----------------------------------------------------------------------------VQ-
B1MD21_MYCA9/14-115-----------------------------------------------------------------------------IE-
Q82GA1_STRAW/13-126-----------------------------------------------------------------------------LN-
D1CA95_SPHTD/7-116-----------------------------------------------------------------------------AG-
Q88PF6_PSEPK/7-118-----------------------------------------------------------------------------VN-
Q5QV19_IDILO/10-113-----------------------------------------------------------------------------LK-
C5BYA4_BEUC1/11-106-----------------------------------------------------------------------------IE-
A5VCU3_SPHWW/39-148-----------------------------------------------------------------------------VH-
E4NSQ6_HALBP/19-128-----------------------------------------------------------------------------IR-
Q7NE84_GLOVI/10-111-----------------------------------------------------------------------------VE-
Q5Z059_NOCFA/9-111-----------------------------------------------------------------------------IE-
A8LIY8_DINSH/16-139-----------------------------------------------------------------------------VR-
A8LIY8_DINSH/193-315-----------------------------------------------------------------------------VE-
A5VFS9_SPHWW/9-116-----------------------------------------------------------------------------VG-
B5HJE1_STRPR/10-115-----------------------------------------------------------------------------FH-
B5HVP3_9ACTO/16-111-----------------------------------------------------------------------------VE-
D2Q2I7_KRIFD/11-105-----------------------------------------------------------------------------AR-
Q1R0D2_CHRSD/10-113-----------------------------------------------------------------------------FC-
D0L730_GORB4/10-111-----------------------------------------------------------------------------TT-
Q0BQA1_GRABC/9-124-----------------------------------------------------------------------------IR-
Q31QW3_SYNE7/11-117-----------------------------------------------------------------------------VR-
Q0RE76_FRAAA/8-122-----------------------------------------------------------------------------VK-
A2SCA2_METPP/13-116-----------------------------------------------------------------------------VI-
C5CK59_VARPS/9-108-----------------------------------------------------------------------------LA-
D2B0D7_STRRD/15-117-----------------------------------------------------------------------------IR-
A1VLA0_POLNA/8-116-----------------------------------------------------------------------------VQ-
Q1CVT2_MYXXD/62-168-----------------------------------------------------------------------------AQ-
Q9EWM1_STRCO/9-118-----------------------------------------------------------------------------FR-
D2BAU3_STRRD/10-116-----------------------------------------------------------------------------AR-
B0C619_ACAM1/7-113-----------------------------------------------------------------------------LQ-
D7AYQ5_NOCDD/12-122-----------------------------------------------------------------------------AE-
A1SCF9_NOCSJ/9-115-----------------------------------------------------------------------------VR-
D5UVL3_TSUPD/13-113-----------------------------------------------------------------------------AE-
D3QAD1_STANL/13-107-----------------------------------------------------------------------------AL-
D3STL0_NATMM/24-125-----------------------------------------------------------------------------VH-
A9CHA2_AGRT5/13-121-----------------------------------------------------------------------------VQ-
B5HLL8_9ACTO/11-108-----------------------------------------------------------------------------AQ-
C6VS31_DYAFD/7-118-----------------------------------------------------------------------------VQ-
Q01YM1_SOLUE/9-121-----------------------------------------------------------------------------VR-
Q7NU42_CHRVO/10-117-----------------------------------------------------------------------------VR-
Q0S852_RHOSR/10-121-----------------------------------------------------------------------------IR-
Q0SDB9_RHOSR/13-126-----------------------------------------------------------------------------IQ-
A8I8X5_CHLRE/91-196-----------------------------------------------------------------------------IV-
Q89WH5_BRADU/12-118-----------------------------------------------------------------------------LR-
Q7NFQ8_GLOVI/11-120-----------------------------------------------------------------------------VR-
A4FI35_SACEN/11-114-----------------------------------------------------------------------------AI-
Q1IJ26_KORVE/10-115-----------------------------------------------------------------------------AT-
A5V9B3_SPHWW/11-114-----------------------------------------------------------------------------VR-
Q7NT36_CHRVO/13-113-----------------------------------------------------------------------------LL-
C1A2X0_RHOE4/8-108-----------------------------------------------------------------------------VN-
B5HZI5_9ACTO/16-126-----------------------------------------------------------------------------MN-
Q89DK6_BRADU/65-174-----------------------------------------------------------------------------VV-
B0C5C3_ACAM1/11-121-----------------------------------------------------------------------------VQ-
A4XEU5_NOVAD/14-116-----------------------------------------------------------------------------LQ-
Q0RK85_FRAAA/9-111-----------------------------------------------------------------------------VS-
B1LXB4_METRJ/10-119-----------------------------------------------------------------------------TE-
Q1IJH6_KORVE/7-113-----------------------------------------------------------------------------VQ-
B5HUL8_9ACTO/35-145-----------------------------------------------------------------------------VT-
Q8XW86_RALSO/8-113-----------------------------------------------------------------------------VT-
C7PJ94_CHIPD/8-108-----------------------------------------------------------------------------VT-
B8HNZ9_CYAP4/16-120-----------------------------------------------------------------------------IQ-
Q8ETH3_OCEIH/11-113-----------------------------------------------------------------------------LQ-
B4EGT8_BURCJ/14-120-----------------------------------------------------------------------------LA-
C5CTR3_VARPS/11-118-----------------------------------------------------------------------------VQ-
A1SE82_NOCSJ/305-416-----------------------------------------------------------------------------FR-
Q8YQT8_NOSS1/9-119-----------------------------------------------------------------------------LL-
Q7P1G6_CHRVO/12-123-----------------------------------------------------------------------------IQ-
A1T7R4_MYCVP/21-154-----------------------------------------------------------------------------VR-
Q0ATM8_MARMM/33-142-----------------------------------------------------------------------------AQ-
A4VYE6_STRSY/19-125-----------------------------------------------------------------------------FN-
Q0AK67_MARMM/68-179-----------------------------------------------------------------------------AE-
Q7NP31_GLOVI/45-156-----------------------------------------------------------------------------VR-
D1A779_THECD/12-112-----------------------------------------------------------------------------VR-
B9M2F6_GEODF/33-141-----------------------------------------------------------------------------IG-
B0RBH4_CLAMS/76-179-----------------------------------------------------------------------------IS-
B0RBH4_CLAMS/225-319-----------------------------------------------------------------------------AV-
Q82NK0_STRAW/12-119-----------------------------------------------------------------------------AR-
B5I3N5_9ACTO/17-126-----------------------------------------------------------------------------YR-
C5CWJ6_VARPS/7-113-----------------------------------------------------------------------------AK-
B8HUP3_CYAP4/10-119-----------------------------------------------------------------------------VL-
YESE_BACSU/13-122-----------------------------------------------------------------------------LR-
Q0RZ59_RHOSR/13-116-----------------------------------------------------------------------------LR-
C0ZMD1_RHOE4/13-113-----------------------------------------------------------------------------AR-
E4NS77_HALBP/17-126-----------------------------------------------------------------------------AR-
A0LVM2_ACIC1/13-121-----------------------------------------------------------------------------VR-
A9B4R1_HERA2/9-105-----------------------------------------------------------------------------VT-
B1MKK2_MYCA9/12-112-----------------------------------------------------------------------------VQ-
A1AMJ6_PELPD/11-123-----------------------------------------------------------------------------VR-
Q0RKU0_FRAAA/7-102-----------------------------------------------------------------------------ID-
D1A9D6_THECD/22-131-----------------------------------------------------------------------------AR-
Q6KYU6_PICTO/7-107-----------------------------------------------------------------------------CL-
Q1CVW7_MYXXD/8-109-----------------------------------------------------------------------------IT-
D3Q1G6_STANL/8-116-----------------------------------------------------------------------------VE-
C1D0F3_DEIDV/8-109-----------------------------------------------------------------------------MQ-
Q1IMY1_KORVE/8-111-----------------------------------------------------------------------------IE-
Q2GAG8_NOVAD/26-123-----------------------------------------------------------------------------VE-
A4RY41_OSTLU/26-129-----------------------------------------------------------------------------VR-
B6IUF4_RHOCS/9-114-----------------------------------------------------------------------------VL-
Q0RWK4_RHOSR/10-112-----------------------------------------------------------------------------VR-
Q6D2X2_PECAS/50-158-----------------------------------------------------------------------------VE-
Q82M76_STRAW/12-122-----------------------------------------------------------------------------LR-
A1SQ29_NOCSJ/22-134-----------------------------------------------------------------------------SQ-
B8GR64_THISH/14-117-----------------------------------------------------------------------------YA-
A5V474_SPHWW/7-117-----------------------------------------------------------------------------FD-
Q28KZ3_JANSC/183-305-----------------------------------------------------------------------------VE-
Q98HZ7_RHILO/7-115-----------------------------------------------------------------------------VK-
D3SXC1_NATMM/13-124-----------------------------------------------------------------------------VR-
B4RCM5_PHEZH/40-139-----------------------------------------------------------------------------VQ-
Q7NIX2_GLOVI/6-112-----------------------------------------------------------------------------VE-
Q7NCT6_GLOVI/10-113-----------------------------------------------------------------------------VT-
C7QIA1_CATAD/12-123-----------------------------------------------------------------------------VE-
D2PU42_KRIFD/7-118-----------------------------------------------------------------------------FL-
Q11RX8_CYTH3/10-111-----------------------------------------------------------------------------LE-
Q15W82_PSEA6/7-110-----------------------------------------------------------------------------FV-
D5URT3_TSUPD/13-113-----------------------------------------------------------------------------VR-
C7PY66_CATAD/14-115-----------------------------------------------------------------------------VL-
D1AZA9_SULD5/9-119-----------------------------------------------------------------------------IE-
Q0RHL1_FRAAA/31-134-----------------------------------------------------------------------------IA-
Q0REI6_FRAAA/9-118-----------------------------------------------------------------------------VR-
Q0ALT6_MARMM/8-104-----------------------------------------------------------------------------TA-
Q9RUP4_DEIRA/10-111-----------------------------------------------------------------------------IT-
Q5NW43_AROAE/11-116-----------------------------------------------------------------------------VT-
B5I914_9ACTO/103-211-----------------------------------------------------------------------------SR-
D7BB21_MEISD/9-120-----------------------------------------------------------------------------FR-
Q7CY40_AGRT5/43-140-----------------------------------------------------------------------------VI-
A1SDP9_NOCSJ/7-110-----------------------------------------------------------------------------VR-
C7PD65_CHIPD/5-107-----------------------------------------------------------------------------AR-
Q0W0Z9_UNCMA/28-139-----------------------------------------------------------------------------VR-
Q0AK68_MARMM/36-153-----------------------------------------------------------------------------AR-
A1T3J1_MYCVP/7-115-----------------------------------------------------------------------------VR-
B2J333_NOSP7/11-117-----------------------------------------------------------------------------AR-
Q161D9_ROSDO/27-138-----------------------------------------------------------------------------IE-
Q1D054_MYXXD/25-142-----------------------------------------------------------------------------VR-
D2Q4E8_KRIFD/10-119-----------------------------------------------------------------------------VR-
A6W6K1_KINRD/24-129-----------------------------------------------------------------------------YE-
D0LM99_HALO1/203-300-----------------------------------------------------------------------------LE-
Q8YNM4_NOSS1/10-119-----------------------------------------------------------------------------VL-
A0JTQ5_ARTS2/14-118-----------------------------------------------------------------------------VR-
C6W364_DYAFD/12-123-----------------------------------------------------------------------------VR-
C1N6Y5_MICPC/11-117-----------------------------------------------------------------------------VD-
A8EWB0_ARCB4/10-120-----------------------------------------------------------------------------VK-
Q5YQ81_NOCFA/15-114-----------------------------------------------------------------------------VR-
C1F799_ACIC5/9-124-----------------------------------------------------------------------------LA-
D2QMN3_SPILD/5-118-----------------------------------------------------------------------------IQ-
A7HKH6_FERNB/25-126-----------------------------------------------------------------------------WE-
Q5DZG2_VIBF1/16-125-----------------------------------------------------------------------------IQ-
A1S3V2_SHEAM/29-141-----------------------------------------------------------------------------AV-
A0R0F0_MYCS2/85-194-----------------------------------------------------------------------------LE-
Q2G4A7_NOVAD/14-111-----------------------------------------------------------------------------VI-
Q6D526_PECAS/26-129-----------------------------------------------------------------------------IR-
A5FVD4_ACICJ/16-117-----------------------------------------------------------------------------AA-
Q0U711_PHANO/9-119-----------------------------------------------------------------------------LQ-
Q9AK31_STRCO/210-307-----------------------------------------------------------------------------LE-
C7PMQ6_CHIPD/9-116-----------------------------------------------------------------------------VT-
D2PQZ2_KRIFD/10-123-----------------------------------------------------------------------------AR-
Q2SB33_HAHCH/8-108-----------------------------------------------------------------------------VT-
Q2G9Q6_NOVAD/31-145-----------------------------------------------------------------------------VR-
C8XK42_NAKMY/10-121-----------------------------------------------------------------------------LR-
D2SBX0_GEOOG/5-109-----------------------------------------------------------------------------IA-
Q39TG5_GEOMG/5-106-----------------------------------------------------------------------------IK-
B6IS60_RHOCS/17-111-----------------------------------------------------------------------------VT-
B0T5N4_CAUSK/9-117-----------------------------------------------------------------------------VR-
C6XZD6_PEDHD/13-122-----------------------------------------------------------------------------VR-
D0LWT7_HALO1/7-120-----------------------------------------------------------------------------VT-
Q0SJC1_RHOSR/11-111-----------------------------------------------------------------------------TR-
D0LQY4_HALO1/7-114-----------------------------------------------------------------------------LT-
Q82RJ4_STRAW/12-109-----------------------------------------------------------------------------IA-
A4XCF3_SALTO/8-104-----------------------------------------------------------------------------VE-
B1VLR8_STRGG/5-111-----------------------------------------------------------------------------VD-
Q0C649_HYPNA/6-119-----------------------------------------------------------------------------IR-
D3EBN8_GEOS4/13-118-----------------------------------------------------------------------------VS-
C5BR99_TERTT/13-114-----------------------------------------------------------------------------FK-
Q1LC18_RALME/11-130-----------------------------------------------------------------------------VG-
A9F1N2_SORC5/10-120-----------------------------------------------------------------------------YR-
Q7NX64_CHRVO/8-108-----------------------------------------------------------------------------VQ-
A6Q8S5_SULNB/27-140-----------------------------------------------------------------------------LN-
Q7NYY8_CHRVO/10-124-----------------------------------------------------------------------------VQ-
Q0RTS8_FRAAA/10-121-----------------------------------------------------------------------------AR-
B2HF34_MYCMM/13-118-----------------------------------------------------------------------------VE-
Q5LS60_RUEPO/15-118-----------------------------------------------------------------------------LK-
C7NL72_KYTSD/199-297-----------------------------------------------------------------------------VR-
Q0RWC3_RHOSR/94-208-----------------------------------------------------------------------------VD-
A4X2J9_SALTO/11-126-----------------------------------------------------------------------------LR-
A9FU94_SORC5/4-110-----------------------------------------------------------------------------AS-
D5UXD3_TSUPD/41-136-----------------------------------------------------------------------------VT-
C3AHZ7_BACMY/74-174-----------------------------------------------------------------------------AQ-
B7G1I9_PHATC/141-251-----------------------------------------------------------------------------VK-
Q144S2_BURXL/14-123-----------------------------------------------------------------------------IE-
Q0K1J6_CUPNH/7-120-----------------------------------------------------------------------------VK-
Q096A5_STIAD/35-145-----------------------------------------------------------------------------VQ-
Q6DAK4_PECAS/16-123-----------------------------------------------------------------------------VY-
Q8XQ60_RALSO/19-124-----------------------------------------------------------------------------VD-
Q00XN2_OSTTA/55-161-----------------------------------------------------------------------------VR-
A0JX05_ARTS2/16-130-----------------------------------------------------------------------------VL-
Q8TQG8_METAC/25-143-----------------------------------------------------------------------------MT-
A1TNK1_ACIAC/52-157-----------------------------------------------------------------------------VY-
Q01R35_SOLUE/14-114-----------------------------------------------------------------------------FQ-
D2AXD2_STRRD/7-110-----------------------------------------------------------------------------AQ-
Q0APW6_MARMM/28-136-----------------------------------------------------------------------------LD-
Y3332_PSEAE/7-115-----------------------------------------------------------------------------LV-
Q7NP00_GLOVI/24-117-----------------------------------------------------------------------------IE-
A9U6M7_PHYPA/10-103-----------------------------------------------------------------------------VK-
B6QL61_PENMQ/29-132-----------------------------------------------------------------------------IR-
Q2KTK8_BORA1/35-133-----------------------------------------------------------------------------VQ-
B2HI14_MYCMM/11-120-----------------------------------------------------------------------------GR-
Q7P1D6_CHRVO/11-112-----------------------------------------------------------------------------AR-
Q1INA8_KORVE/18-129-----------------------------------------------------------------------------VD-
B6IRE4_RHOCS/14-115-----------------------------------------------------------------------------YV-
A8L6M7_FRASN/9-119-----------------------------------------------------------------------------VE-
C5CYM4_VARPS/7-110-----------------------------------------------------------------------------LE-
B0C5C2_ACAM1/10-116-----------------------------------------------------------------------------AR-
Q5YR20_NOCFA/14-119-----------------------------------------------------------------------------VQ-
Q89SK5_BRADU/7-110-----------------------------------------------------------------------------VE-
B9JZV5_AGRVS/9-119-----------------------------------------------------------------------------VR-
C5CZ61_VARPS/13-119-----------------------------------------------------------------------------IR-
B7KLH5_CYAP7/9-116-----------------------------------------------------------------------------VE-
D7DZ07_NOSA0/16-121-----------------------------------------------------------------------------FE-
Q5YYT4_NOCFA/5-107-----------------------------------------------------------------------------VA-
Q4K710_PSEF5/11-111-----------------------------------------------------------------------------VE-
Q11GL1_CHESB/10-122-----------------------------------------------------------------------------IA-
B8FA80_DESAA/11-124-----------------------------------------------------------------------------IE-
C7PKK5_CHIPD/8-113-----------------------------------------------------------------------------YL-
C7PVH9_CATAD/7-110-----------------------------------------------------------------------------VT-
Q023S0_SOLUE/22-116-----------------------------------------------------------------------------LD-
B0T2P8_CAUSK/7-113-----------------------------------------------------------------------------AA-
A4FLI3_SACEN/9-124-----------------------------------------------------------------------------YR-
Q1GVF6_SPHAL/12-129-----------------------------------------------------------------------------VR-
A5VGC4_SPHWW/32-139-----------------------------------------------------------------------------VT-
Q67LR1_SYMTH/49-143-----------------------------------------------------------------------------VT-
Q1GGN5_RUEST/7-110-----------------------------------------------------------------------------LK-
Q7N5H3_PHOLL/10-114-----------------------------------------------------------------------------VR-
C5ANY4_BURGB/9-119-----------------------------------------------------------------------------VR-
A0JTF8_ARTS2/8-119-----------------------------------------------------------------------------LR-
B0UQZ5_METS4/10-111-----------------------------------------------------------------------------IR-
B2FKH0_STRMK/10-123-----------------------------------------------------------------------------IE-
Q28P04_JANSC/192-309-----------------------------------------------------------------------------VL-
D0LQN7_HALO1/43-156-----------------------------------------------------------------------------VQ-
C6WH72_ACTMD/42-148-----------------------------------------------------------------------------FD-
A4VFV4_PSEU5/16-125-----------------------------------------------------------------------------HD-
B9JGC5_AGRRK/8-110-----------------------------------------------------------------------------AE-
Q28SU5_JANSC/41-153-----------------------------------------------------------------------------VL-
A5FDF3_FLAJ1/20-129-----------------------------------------------------------------------------IE-
D2QKG8_SPILD/51-161-----------------------------------------------------------------------------LT-
Q2RYS6_SALRD/468-568-----------------------------------------------------------------------------VF-
Q7U6B9_SYNPX/19-120-----------------------------------------------------------------------------AR-
A1T202_MYCVP/12-136-----------------------------------------------------------------------------AA-
C0Z8U2_BREBN/10-123-----------------------------------------------------------------------------IE-
Q5WJ97_BACSK/7-113-----------------------------------------------------------------------------LE-
Q4K7Y4_PSEF5/14-123-----------------------------------------------------------------------------ID-
B9K0R3_AGRVS/19-126-----------------------------------------------------------------------------VR-
A2SP57_METPP/26-134-----------------------------------------------------------------------------VS-
D7B2K3_NOCDD/208-308-----------------------------------------------------------------------------LD-
Q2G5Y7_NOVAD/7-112-----------------------------------------------------------------------------AK-
A9WET4_CHLAA/10-121-----------------------------------------------------------------------------IR-
B4RFA6_PHEZH/12-124-----------------------------------------------------------------------------ID-
B1YHC8_EXIS2/7-115-----------------------------------------------------------------------------LD-
Q01XW8_SOLUE/26-133-----------------------------------------------------------------------------DA-
A5FF04_FLAJ1/226-327-----------------------------------------------------------------------------VE-
Q7N5R6_PHOLL/8-109-----------------------------------------------------------------------------TA-
D2SF32_GEOOG/10-120-----------------------------------------------------------------------------VE-
D2QKG9_SPILD/49-156-----------------------------------------------------------------------------VG-
D3SG09_THISK/73-180-----------------------------------------------------------------------------FD-
Q6MQX3_BDEBA/10-106-----------------------------------------------------------------------------VQ-
A9F1I8_SORC5/106-215-----------------------------------------------------------------------------LL-
D3PMI5_MEIRD/6-117-----------------------------------------------------------------------------YD-
A8I8N5_CHLRE/87-201-----------------------------------------------------------------------------AV-
Q5NR56_ZYMMO/9-110-----------------------------------------------------------------------------VR-
Q0C1I4_HYPNA/38-144-----------------------------------------------------------------------------VD-
B5HCB5_STRPR/12-122-----------------------------------------------------------------------------IE-
B2HE10_MYCMM/16-127-----------------------------------------------------------------------------VR-
B7G7G0_PHATC/222-327-----------------------------------------------------------------------------FH-
A8GD70_SERP5/44-162-----------------------------------------------------------------------------AE-
C7QAG6_CATAD/10-122-----------------------------------------------------------------------------VE-
Q7CRD4_AGRT5/8-113-----------------------------------------------------------------------------YL-
A5FAS7_FLAJ1/7-104-----------------------------------------------------------------------------AQ-
Q21ST0_ALBFT/17-124-----------------------------------------------------------------------------LR-
Q5FU45_GLUOX/16-117-----------------------------------------------------------------------------IR-
D7B8A1_NOCDD/24-135-----------------------------------------------------------------------------VE-
A8J8F4_CHLRE/267-381-----------------------------------------------------------------------------VE-
Q7UYI8_RHOBA/149-257-----------------------------------------------------------------------------IH-
Q0RQ61_FRAAA/35-150-----------------------------------------------------------------------------AV-
Q2W516_MAGSA/7-130-----------------------------------------------------------------------------MQ-
A5G225_ACICJ/10-127-----------------------------------------------------------------------------WE-
Q7KPV8_CAEEL/16-120-----------------------------------------------------------------------------FE-
A6WAE9_KINRD/9-131-----------------------------------------------------------------------------AV-
A4VGJ2_PSEU5/10-121-----------------------------------------------------------------------------VR-
C8X7I4_NAKMY/10-121-----------------------------------------------------------------------------IA-
B8CQ65_SHEPW/9-116-----------------------------------------------------------------------------IN-
B5HVQ1_9ACTO/52-162-----------------------------------------------------------------------------FT-
B6QRJ3_PENMQ/14-121-----------------------------------------------------------------------------LE-
B2FS27_STRMK/53-161-----------------------------------------------------------------------------AE-
Q89CA0_BRADU/26-125-----------------------------------------------------------------------------NR-
Q82PT2_STRAW/13-123-----------------------------------------------------------------------------AD-
B0UAU1_METS4/29-133-----------------------------------------------------------------------------NA-
A8N708_COPC7/26-128-----------------------------------------------------------------------------VI-
C6WNT0_ACTMD/15-117-----------------------------------------------------------------------------VL-
Q74BD7_GEOSL/66-172-----------------------------------------------------------------------------LG-
B1MAG0_MYCA9/29-157-----------------------------------------------------------------------------AS-
B1W484_STRGG/11-119-----------------------------------------------------------------------------VL-
B2HT68_MYCMM/15-114-----------------------------------------------------------------------------VN-
B4ELH6_BURCJ/39-136-----------------------------------------------------------------------------VL-
B4EM94_BURCJ/9-110-----------------------------------------------------------------------------IQ-
C0ZSH3_RHOE4/57-155-----------------------------------------------------------------------------VT-
C0ZUW8_RHOE4/11-107-----------------------------------------------------------------------------VE-
C1A207_RHOE4/8-107-----------------------------------------------------------------------------.T-
C3KP75_RHISN/30-139-----------------------------------------------------------------------------..-
D0J389_COMT2/5-105-----------------------------------------------------------------------------VQ-
D4ZDV5_SHEVD/27-130-----------------------------------------------------------------------------VE-
D7BSM4_STRBB/12-130-----------------------------------------------------------------------------.R-
G2NZK4_STRVO/13-110-----------------------------------------------------------------------------..-
G2NZK5_STRVO/16-131-----------------------------------------------------------------------------..-
G8PMR8_PSEUV/42-153-----------------------------------------------------------------------------.A-
G8PNR5_PSEUV/31-139-----------------------------------------------------------------------------..-
M1FFV3_9ALTE/24-124-----------------------------------------------------------------------------.R-
O06820_MYCTU/10-109-----------------------------------------------------------------------------VE-
Q0RMU9_FRAAA/11-107-----------------------------------------------------------------------------..-
Q0S498_RHOSR/22-121-----------------------------------------------------------------------------VR-
Q0SA13_RHOSR/47-144-----------------------------------------------------------------------------.T-
Q0SAM4_RHOSR/12-111-----------------------------------------------------------------------------VE-
Q63P16_BURPS/8-114-----------------------------------------------------------------------------VR-
Q63TL7_BURPS/59-168-----------------------------------------------------------------------------AR-
Q67TV4_ORYSJ/71-167-----------------------------------------------------------------------------VR-
Q73X32_MYCPA/11-110-----------------------------------------------------------------------------VN-
Q7MG68_VIBVY/11-132-----------------------------------------------------------------------------VR-
Q7SFH5_NEUCR/300-405-----------------------------------------------------------------------------..-
Q81HA2_BACCR/62-156-----------------------------------------------------------------------------..-
Q88EB0_PSEPK/13-117-----------------------------------------------------------------------------IE-
Q8F037_LEPIN/9-109-----------------------------------------------------------------------------.K-
Q8PDF7_XANCP/13-124-----------------------------------------------------------------------------VQ-
Q9A482_CAUCR/12-113-----------------------------------------------------------------------------VR-
Q9A5Z0_CAUCR/10-110-----------------------------------------------------------------------------AQ-
Q9A6F0_CAUCR/10-117-----------------------------------------------------------------------------IR-
Q9A8Y8_CAUCR/11-113-----------------------------------------------------------------------------.T-
Q9CCC2_MYCLE/38-133-----------------------------------------------------------------------------..-
Q9HS78_HALSA/7-104-----------------------------------------------------------------------------VT-
Q9I3U3_PSEAE/11-113-----------------------------------------------------------------------------.R-
Q9KSY8_VIBCH/9-112-----------------------------------------------------------------------------VA-
R5F452_9CLOT/94-205-----------------------------------------------------------------------------.R-

PF07858

Q8XW85_RALSO/2-128-----------------------------------------------------------------------PTPLETVS-
Q9A482_CAUCR/6-128-----------------------------------------------------------------------PSPAQVVR-
Q8XW86_RALSO/2-128-----------------------------------------------------------------------STPIEIVT-
EPHG_MYCTU/15-135-----------------------------------------------------------------------TEAIRAVE-
Q73W09_MYCPA/9-129-----------------------------------------------------------------------VANTRTVE-
Q9CCC2_MYCLE/30-150-----------------------------------------------------------------------.ENIRTVE-

PF10184

A0ZAJ9_NODSP/1-107-----------------------------------------------------------------------MDIIEILK-
A0ZEU7_NODSP/8-120-----------------------------------------------------------------------EQVIKTLE-
A3KPX0_DANRE/247-372-----------------------------------------------------------------------ALMHEKLR-
A4RYB4_OSTLU/40-152-----------------------------------------------------------------------ARMRKALA-
A7RV61_NEMVE/173-295-----------------------------------------------------------------------ATVFLALR-
O82347_ARATH/89-201-----------------------------------------------------------------------GHAVRSIR-
P74420_SYNY3/15-121-----------------------------------------------------------------------DRILTILQ-
Q017W4_OSTTA/52-164-----------------------------------------------------------------------KELCALLA-
Q019E6_OSTTA/22-131-----------------------------------------------------------------------KEAIEAIR-
Q0DJX6_ORYSJ/116-228-----------------------------------------------------------------------GDAIRALR-
Q10VR9_TRIEI/4-116-----------------------------------------------------------------------QQVIERLK-
Q11AD5_TRIEI/1-107-----------------------------------------------------------------------MDIISRLK-
Q2JJ41_SYNJB/11-117-----------------------------------------------------------------------ADLVAILR-
CF136_HUMAN/149-274-----------------------------------------------------------------------SVMYERLR-
Q69VD1_ORYSJ/67-177-----------------------------------------------------------------------ERLAEFLR-
Q7NHQ0_GLOVI/5-111-----------------------------------------------------------------------MDILEILK-
Q7PFX4_ANOGA/132-264-----------------------------------------------------------------------HRVYHVLS-
Q8VZ90_ARATH/62-172-----------------------------------------------------------------------EELVGFLY-
Q8YTL6_NOSS1/1-107-----------------------------------------------------------------------MKIIEILK-
Q94K63_ARATH/78-191-----------------------------------------------------------------------DDVMGILR-
Q9SA31_ARATH/87-199-----------------------------------------------------------------------GVAVRTLR-
B1WUH0_CYAA5/2-107-----------------------------------------------------------------------.KLLETIK-
B8JJ69_MOUSE/150-274-----------------------------------------------------------------------.VMHERLR-
Q31NT1_SYNE7/7-112-----------------------------------------------------------------------.DLLETLR-
Q7XLD2_ORYSJ/92-203-----------------------------------------------------------------------.TAVRTLR-
Q9W1F2_DROME/84-215-----------------------------------------------------------------------.RAYEVLR-

PF07080

B1LSK3_METRJ/3-144------------------------------------------------RPP--------------LPPFD.EQSAITKV-
B8ERM2_METSB/7-147------------------------------------------------.LP--------------LPPFT.AESAVEKI-
D7C7X3_STRBB/6-147------------------------------------------------RPP--------------FPPFT.RESAIEKV-
A8HSN6_AZOC5/11-152------------------------------------------------RPP--------------LPPFT.AETASLKA-
G7DX40_MIXOS/2-131------------------------------------------------...--------------...FT.HSSAQAKV-
B2ILG8_BEII9/4-143------------------------------------------------..L--------------VPPFT.FETATAKV-
A9HBR6_GLUDA/3-144------------------------------------------------RPP--------------LPPFD.AETAALKT-
S3BYH4_OPHP1/13-151------------------------------------------------RPP--------------VPPFT.QETAHKKV-
Q7ULD7_RHOBA/9-146------------------------------------------------...--------------.PPFT.SESAIQKV-
Q7V2T4_PROMP/4-145------------------------------------------------KPP--------------IPPFN.FETAIKKV-
B2IKS1_BEII9/5-145------------------------------------------------.LP--------------LPPFD.TASAAAKV-
B8GEL7_METPE/7-147------------------------------------------------.LP--------------LPPFS.FETAVEKV-
J4G7Y6_FIBRA/6-142------------------------------------------------...--------------KPPFT.AATAEQKV-
R4LE54_9ACTO/2-140------------------------------------------------RPP--------------VPPFT.RESALAKV-
D2VSI5_NAEGR/4-136------------------------------------------------..I--------------LPPFT.LETAQKKV-
E2LUP3_MONPE/4-137------------------------------------------------...--------------RPPFT.LGSAIDKV-
L8GCZ6_PSED2/11-144------------------------------------------------RPP--------------YPPFT.LETAKQTV-
Q5NPJ1_ZYMMO/5-147------------------------------------------------RPP--------------FPPFLKKEAAAEKV-
U4L3Z6_PYROM/5-144------------------------------------------------...--------------FPPFT.AETAKAKV-
Q5LKF9_RUEPO/3-144------------------------------------------------RPP--------------LPPFT.AETAAEKV-
F6IE59_9SPHN/9-150------------------------------------------------RPP--------------LPPFS.AASAADKV-
A4SXK9_POLSQ/6-145------------------------------------------------..P--------------LPPFT.KETAIQKI-
B0C3H8_ACAM1/7-148------------------------------------------------KPP--------------LPPFD.IESATAKV-
K9VV28_9CYAN/4-139------------------------------------------------KPP--------------LPPFT.LETAKAKV-
G8TDI0_NIAKG/7-136------------------------------------------------...--------------.PPFT.RETALAKV-
G8S011_ACTS5/13-151------------------------------------------------RHP--------------LPPFT.VDTARAKV-
A7IEF3_XANP2/4-145------------------------------------------------RPP--------------LPPFT.VETAAQKA-
S5T289_9CORY/4-145------------------------------------------------RPP--------------FPPFT.AETAAQKA-
Q885A5_PSESM/6-147------------------------------------------------RPP--------------LPPFT.LETAIQKV-
C5CRQ3_VARPS/4-139------------------------------------------------RPP--------------LPPFT.LETATKKV-
A8GGW9_SERP5/4-145------------------------------------------------KPP--------------LPPFT.RESAIEKV-
H1VKH9_COLHI/8-137------------------------------------------------RPP--------------FPPFT.EATAKAKV-
C9SC71_VERA1/6-139------------------------------------------------KPP--------------CPPFT.AETARIKV-
A4AWU7_MARSH/5-136------------------------------------------------...--------------TPPFN.NESAAAKV-
G0S1P6_CHATD/5-138------------------------------------------------KPP--------------FPPFT.WEEAHQKV-
A6TFT2_KLEP7/5-146------------------------------------------------RPP--------------LPPFT.RDSAIQKV-
I3TTF4_TISMK/2-143------------------------------------------------RPP--------------IPPFT.AEAAALKV-
F0XKI1_GROCL/3-145------------------------------------------------.PP--------------VPPFT.LETAEKKV-
H5WUV2_9BURK/4-145------------------------------------------------KPP--------------LPPFT.AESAAQKV-
B2J4W5_NOSP7/43-183------------------------------------------------.LP--------------LPPFD.NESAIQKV-
I1XFA4_METNJ/7-148------------------------------------------------KPP--------------FPPFT.LETAKQKV-
Q22CF4_TETTS/39-179------------------------------------------------..L--------------VPPFT.LETAIKKV-
L0D9F8_SINAD/3-142------------------------------------------------...--------------VPPFT.RESAIQKV-
Q13SF9_BURXL/8-149------------------------------------------------RPP--------------LPPFT.RETAIQKV-
B0SVP8_CAUSK/2-143------------------------------------------------RPP--------------LPPFT.QDTARLKV-
J9ZA59_LEPFM/171-312------------------------------------------------RPP--------------FPPFT.QETAKLKV-
B2HLU4_MYCMM/8-145------------------------------------------------RPP--------------FPPFT.FETATQKV-
B6JDE8_OLICO/4-144------------------------------------------------.PL--------------VPPFT.FDTATAKV-
Q0SDQ5_RHOSR/4-146------------------------------------------------RPP--------------VPPFT.RDTAIAKV-
K9P7V3_CYAGP/12-153------------------------------------------------RPP--------------FPPFD.AESAATKV-
E8UXY2_TERSS/9-148------------------------------------------------..L--------------VPPFT.RETAIAKV-
A1TEA6_MYCVP/5-143------------------------------------------------RPP--------------FPPFD.LTTALQKV-
H3G8D3_PHYRM/7-149------------------------------------------------RPP--------------VPPFT.RESAALKV-
B5HC01_STRPR/5-139------------------------------------------------RPP--------------FPPFD.LDSALAKV-
D8J274_HERSS/4-146------------------------------------------------RPP--------------LPPFT.RETAIEKV-
A9CLA1_AGRT5/3-144------------------------------------------------RPP--------------VPPFT.CKTAIEKV-
U9U4M7_RHIID/3-136------------------------------------------------QPI--------------VPPFT.KETANLKV-
R7YWN8_CONA1/3-136------------------------------------------------..L--------------IPPFS.AGTAQAKV-
D5SQM6_PLAL2/13-153------------------------------------------------..L--------------VPPFT.QETALRKV-
B2VFK9_ERWT9/4-145------------------------------------------------RPP--------------LPPFT.RESAIEKV-
G2XW21_BOTF4/6-139------------------------------------------------KPP--------------VPPFT.EETARIKV-
G0QZB1_ICHMG/9-148------------------------------------------------K..--------------.PPFT.LETAIKKV-
B2GL83_KOCRD/106-244------------------------------------------------RNP--------------IPPFT.AKTAARKV-
Q5YSZ9_NOCFA/2-140------------------------------------------------RPP--------------LPPFD.RTAALAKV-
C1D428_DEIDV/3-144------------------------------------------------RPP--------------LPPFT.IHTARDKV-
Q54IV5_DICDI/7-149------------------------------------------------..P--------------VPPFNNIEDAIKKV-
V5X9V4_MYCNE/4-146------------------------------------------------KPP--------------VPPFT.DESAALKV-
K0CAH5_ALCDB/6-147------------------------------------------------RPP--------------LPPFT.RDSAIEKV-
Q7N4C4_PHOLL/8-149------------------------------------------------RQP--------------VPPFT.RETAIQKV-
G2I426_GLUMN/10-151------------------------------------------------RSP--------------FPPFG.VGTATLKV-
H5X2U0_9PSEU/4-142------------------------------------------------RPP--------------FPPFD.ETTAAQKV-
D8PXS5_SCHCM/5-141------------------------------------------------.PL--------------VPPFT.EETARAKV-
Q9EWS6_STRCO/6-144------------------------------------------------RPP--------------LPPFT.RETAERKV-
D7A7G0_STAND/5-147------------------------------------------------RPP--------------LPPFT.RETAIQKV-
Q89E77_BRADU/3-145------------------------------------------------RPP--------------LPPFT.RETAAQKA-
W5TP00_9NOCA/5-143------------------------------------------------RPP--------------LPPFT.PETAPVKV-
D4Z2H4_SPHJU/1-139------------------------------------------------...--------------MPPFT.RESAIEKI-
G0JRN5_9GAMM/7-145------------------------------------------------...--------------TPPFS.EESALLKV-
U7PTH1_SPOS1/14-164------------------------------------------------RPP--------------FPPFT.RETAEKKV-
Q98G19_RHILO/5-146------------------------------------------------RPP--------------LPPFT.AETAAQKA-
D2R1I3_PIRSD/5-144------------------------------------------------R..--------------.PPFT.LETATAKV-
E8WVZ4_ACISM/7-146------------------------------------------------..L--------------VPPFT.METAKAKV-
X5DM97_9CORY/10-144------------------------------------------------RPP--------------LPPFT.RENAVAKV-
F0YBN4_AURAN/19-160------------------------------------------------RPP--------------LPPFT.LESAVQKV-
W0AHH8_9SPHN/3-144------------------------------------------------RPP--------------LPPFT.HDSAVQKV-
G4QL15_GLANF/4-145------------------------------------------------RPP--------------VPPFD.HASATQKV-
Q0BTU2_GRABC/10-152------------------------------------------------RPP--------------LPPFS.WEDAVKKV-
G0A5W1_METMM/4-145------------------------------------------------KPP--------------LPPFT.EETAAQKV-
E3RSR6_PYRTT/4-136------------------------------------------------...--------------SPPFT.EEIAHTKV-
B9JD81_AGRRK/3-144------------------------------------------------TPL--------------IPPFT.RETAIAKV-
F4CJE3_PSEUX/3-141------------------------------------------------RPP--------------FPPFD.AAGAAKKV-
S8EP88_FOMPI/6-139------------------------------------------------...--------------.PPFT.LETAREKV-
U5VZT1_9ACTO/7-144------------------------------------------------RPP--------------LPPFD.EAGARAKV-
G8MBF7_9BURK/4-145------------------------------------------------KPP--------------FPPFD.EESAKLKV-
M5BXI4_THACB/11-144------------------------------------------------..L--------------VPPFT.EETARAKV-
C7JB99_ACEP3/3-144------------------------------------------------RPP--------------FPPFD.IESATRKV-
H6R3X0_NOCCG/2-140------------------------------------------------RPP--------------LPPFD.RSSAEAKV-
M5ED51_MALS4/5-143------------------------------------------------...--------------APPFT.LESATQKV-
G9N5Z7_HYPVG/7-140------------------------------------------------RPP--------------YPPFT.AETAQKKV-
E2Q788_STRC2/27-168------------------------------------------------KPP--------------VPPFT.RETAAEKA-
B1ZPU1_OPITP/4-139------------------------------------------------RPP--------------LPPFT.EATARQKV-
Q15WT6_PSEA6/4-145------------------------------------------------RPP--------------LPPFN.EQSAMEKV-
K3X756_PYTUL/14-156------------------------------------------------RGP--------------LPPFT.RESAAIKV-
Q7U6B9_SYNPX/4-145------------------------------------------------KPP--------------FPPFT.LETAQQKA-
D0L163_HALNC/4-145------------------------------------------------KPP--------------VPPFD.VESATQKV-
A2SLJ7_METPP/6-147------------------------------------------------RPP--------------VPPFT.VESASRKV-
A1R1Y4_ARTAT/3-145------------------------------------------------RPP--------------FPPYT.EATAIQKV-
Q9HTG9_PSEAE/5-146------------------------------------------------RPP--------------LPPFT.AETAAQKV-
I0IPS3_LEPFC/8-149------------------------------------------------RPP--------------FPPFT.KETALQKV-
B0UGB1_METS4/5-146------------------------------------------------RPP--------------LPPFT.AETASRKA-
E3J6U8_FRASU/6-147------------------------------------------------RPP--------------LPPFT.AQSAREKV-
M7T297_EUTLA/9-142------------------------------------------------KPP--------------YPPFT.AETAQIKV-
C7Z2B0_NECH7/5-138------------------------------------------------KPP--------------LPPFT.RETAQIKV-
H5WPP8_9BURK/3-144------------------------------------------------RPP--------------LPPYS.LEAAIQKV-
G8PVW6_PSEUV/16-157------------------------------------------------RPP--------------LPPFT.RETASAKI-
A0QXH1_MYCS2/44-186------------------------------------------------TPL--------------VPPFA.SATAIAKV-
M2MCV5_BAUCO/3-135------------------------------------------------...--------------APPFN.AETAQQRV-
F0ZYB6_DICPU/10-150------------------------------------------------..P--------------VPPFS.LESAIEKV-
B7FPL0_PHATC/7-147------------------------------------------------.AP--------------FPPFT.RETAIQKI-
M9R4P9_9RHOB/4-146------------------------------------------------RPP--------------IPPFS.YSDAVQKV-
K9Z981_CYAAP/4-141------------------------------------------------KPP--------------FPPFN.LETAQQKV-
K5W331_PHACS/5-139------------------------------------------------...--------------YPPFT.RETAIRKV-
Q55953_SYNY3/3-145------------------------------------------------TPL--------------VPPFT.KEIAIAKV-
D3VFP0_XENNA/15-155------------------------------------------------.AP--------------FPPFT.YETAIQKV-
X4ZP44_9BORD/5-146------------------------------------------------RPP--------------LPPFS.HESAVLKV-
J7Q4K9_METSZ/3-144------------------------------------------------RPP--------------LPPFT.LETATQKV-
G8NNR6_GRAMM/8-147------------------------------------------------..L--------------VPPFD.RDTAAQKV-
F5Z8Z6_ALTSS/2-143------------------------------------------------RPP--------------LPPFT.KETAIEKI-
A1SY21_PSYIN/11-152------------------------------------------------RKP--------------LPIFS.KEEAILKA-
Q21GU9_SACD2/13-154------------------------------------------------RSP--------------LPPFT.REDALQKV-
Q21F42_SACD2/3-144------------------------------------------------RPP--------------LPPFN.EETAKRKI-
V9VX09_9RHOB/6-147------------------------------------------------RPP--------------LPPFT.RETAIAKV-
Q5KH63_CRYNJ/33-166------------------------------------------------.PP--------------LPPFN.DETAHKSV-
Q1GQL6_SPHAL/3-142------------------------------------------------RPP--------------LPPFD.AVSAARKV-
C0ZND5_RHOE4/4-146------------------------------------------------RAP--------------IPPFT.HETAVQKV-
C5BRE0_TERTT/11-152------------------------------------------------REP--------------LPPFT.RDTAIKKI-
B1MD11_MYCA9/3-141------------------------------------------------RPP--------------LPPFD.IETAHQKV-
M2QHK1_CERS8/5-140------------------------------------------------...--------------APPFT.RETALQKV-
E4N6H5_KITSK/5-143------------------------------------------------RPP--------------HPPFT.RATALAKV-
Q47FW0_DECAR/5-146------------------------------------------------KPP--------------LPPFT.AETATQKV-
C3AVR5_BACMY/6-137------------------------------------------------...--------------RPPFT.HESALAKV-
Q2S7F5_HAHCH/11-143------------------------------------------------..P--------------VPPFT.EASARAKV-
B0CZ00_LACBS/4-135------------------------------------------------..I--------------LPPFC.ADTAHKKV-
K9WB99_9CYAN/25-158------------------------------------------------RPP--------------LPPFT.LETAKAKV-
D3B3X0_POLPA/7-146------------------------------------------------..P--------------IPPFD.DVTAREKV-
H6RTK1_BLASD/3-141------------------------------------------------RPP--------------FPPFT.LETARQKV-
I4F4V6_MODMB/4-137------------------------------------------------RPP--------------LPPFT.AETAAQKV-
C6WWQ1_METML/8-149------------------------------------------------KPP--------------LPPFT.RETAAQKV-
K2SA46_MACPH/4-136------------------------------------------------...--------------APPFT.RETAHAKV-
N0BCT9_9RHIZ/4-145------------------------------------------------RPP--------------LPPFT.RETAAQKV-
G9AXF7_PANAN/5-147------------------------------------------------RQP--------------LPPFNDVQDAIKKV-
G3JBC0_CORMM/6-139------------------------------------------------KPP--------------FPPFT.LETAKIKV-
F5YW52_MYCSD/4-135------------------------------------------------..P--------------CPPFD.AESARRKV-
A0R5M4_MYCS2/6-147------------------------------------------------RPP--------------LPPFT.TETAAQKV-
Q7NUJ9_CHRVO/4-145------------------------------------------------RPP--------------LPPFT.RETAIEKI-
K7SXB6_GLUOY/4-145------------------------------------------------RPP--------------LPPFT.REAAIQKV-
E6WG68_PANSA/2-141------------------------------------------------..L--------------IPPFD.EQSATQKV-
R4STA4_AMYOR/5-143------------------------------------------------RPP--------------YPPFT.RETALRKV-

PF02136

NTF2_ARATH/9-123------------------------------------------------------------------------VSKAFVE-
Q9M2S5_ARATH/166-285------------------------------------------------------------------------ESAGFVK-
Q9AK31_STRCO/205-316------------------------------------------------------------------------EQQKLLE-
O53486_MYCTU/8-130------------------------------------------------------------------------ELLAAVE-
Q9LDI9_ARATH/13-128------------------------------------------------------------------------IAAEFVR-
Q9FND0_ARATH/11-125------------------------------------------------------------------------VGSYFVG-
Q9LMX6_ARATH/15-131------------------------------------------------------------------------IGNSFVE-
NTF2_ORYSJ/6-119------------------------------------------------------------------------VAKAFVE-
NTF2_YEAST/8-121------------------------------------------------------------------------LAQNFTQ-
G3BP2_MOUSE/11-133------------------------------------------------------------------------VGREFVR-
NTF2_RAT/10-121------------------------------------------------------------------------IGSSFIQ-
OCP_SYNY3/193-308------------------------------------------------------------------------VTNATVL-
Q9A8Y8_CAUCR/127-234------------------------------------------------------------------------GVDRLLR-
NTF2_CAEEL/10-128------------------------------------------------------------------------VAKAFIQ-
NXT1_MOUSE/16-135------------------------------------------------------------------------AAEEFVN-
G3BP_SCHPO/18-134------------------------------------------------------------------------IGWMFVQ-
NTF2_NEUCR/8-121------------------------------------------------------------------------IATQFVA-
NXT2_HUMAN/17-136------------------------------------------------------------------------AAEEFVN-
Q9M2S5_ARATH/32-154------------------------------------------------------------------------LANCFLQ-
G3BP1_MOUSE/11-133------------------------------------------------------------------------VGREFVR-
Q21351_CAEEL/36-143------------------------------------------------------------------------VGGAFCH-
Q9ZPR2_ARATH/15-131------------------------------------------------------------------------VGNGFVQ-
NXF1_RAT/385-535------------------------------------------------------------------------LVLHFLQ-
Q9C9I5_ARATH/70-192------------------------------------------------------------------------SASEVVS-
NXT1_CAEEL/19-135------------------------------------------------------------------------ESKKFMD-
NTF2_SCHPO/7-120------------------------------------------------------------------------LATQFTQ-
NTF2_YARLI/8-121------------------------------------------------------------------------LAKQFCE-
Q9VRD6_DROME/10-124------------------------------------------------------------------------IGKGFVQ-
BRE5_YEAST/8-140------------------------------------------------------------------------ICFAFLQ-
NXT1_DROME/15-130------------------------------------------------------------------------TADTFTR-
Q9FME2_ARATH/15-131------------------------------------------------------------------------VGRAFVE-
B4R173_DROSI/16-129------------------------------------------------------------------------VGREFVR-
D0J389_COMT2/2-115------------------------------------------------------------------------..TAVVQ-
F4JED3_ARATH/281-394------------------------------------------------------------------------VGDEFAR-
F4JED3_ARATH/948-1060------------------------------------------------------------------------....FSE-
I6WZD7_MYCTU/11-135------------------------------------------------------------------------...IASQ-
Q84JH2_ARATH/16-133------------------------------------------------------------------------VGSAFVN-
Q8VYJ4_ARATH/19-135------------------------------------------------------------------------VGNAFVP-

PF03284

PHZA2_PSEAE/1-162------------------------------------------------MRE--------------YQRLKGFTDNLELR-
C5AHF3_BURGB/12-165------------------------------------------------E..--------------......NHAHAAVR-
PHZB2_PSEAE/1-162------------------------------------------------MLD--------------NAIPQGFEDAVELR-
M4RPB3_9BIFI/2-155------------------------------------------------T..--------------......FEDDQTRR-

PF10429

Q6CF15_YARLI/5-151---------------------------------------------NGPTQQ--------------QVTHTVTNTESFLR-
Q6CWP0_KLULA/2-178---------------------------------------------NRQPQI--------------........VETFVK-
MTR2_YEAST/13-184---------------------------------------------ANQAQI--------------........TATFTK-
Q757C4_ASHGO/6-167---------------------------------------------AGHSQA--------------........AETFVK-
Q6BMR4_DEBHA/2-178---------------------------------------------SNIQRD--------------........PKPYLK-
Q6FWG2_CANGA/8-183---------------------------------------------NSQYHL--------------........IDIFVK-

PF07107

WUN1_SOLTU/1-105-----------------------------------------------------------------------------MQ-
Q9LZX2_ARATH/59-162-----------------------------------------------------------------------------MR-
I1PUL3_ORYGL/142-253-----------------------------------------------------------------------------MR-
Q0DSM5_ORYSJ/106-228-----------------------------------------------------------------------------MR-
Q94AK6_ARATH/1-110-----------------------------------------------------------------------------MR-

PF04335

A7ICW5_XANP2/23-226----------------------------------------------------------------------------RAA-
Q89B84_BRADU/23-226----------------------------------------------------------------------------RAA-
Q6N7N1_RHOPA/23-226----------------------------------------------------------------------------RAA-
Q98P55_RHILO/23-226----------------------------------------------------------------------------KAE-
Q210W3_RHOPB/21-224----------------------------------------------------------------------------KAA-
Q2GBL4_NOVAD/21-224----------------------------------------------------------------------------RAA-
A5V2M3_SPHWW/23-226----------------------------------------------------------------------------RAQ-
B0T8Q8_CAUSK/22-225----------------------------------------------------------------------------RAG-
A7HU75_PARL1/22-225----------------------------------------------------------------------------KAA-
Q989I9_RHILO/22-225----------------------------------------------------------------------------KAA-
Q9A4Y5_CAUCR/22-225----------------------------------------------------------------------------KAG-
B0T6U6_CAUSK/22-225----------------------------------------------------------------------------AAG-
E0TGX7_PARBH/22-225----------------------------------------------------------------------------KAG-
E0TDN5_PARBH/22-225----------------------------------------------------------------------------RAA-
B0T9G1_CAUSK/24-227----------------------------------------------------------------------------RAA-
B0T9T9_CAUSK/23-226----------------------------------------------------------------------------RAS-
B4S3J2_PROA2/22-230----------------------------------------------------------------------------RAR-
B4S9L7_PROA2/20-228----------------------------------------------------------------------------RAQ-
TRBF_RHISN/13-219----------------------------------------------------------------------------AAR-
A1VQ85_POLNA/9-215----------------------------------------------------------------------------NAR-
Q6LGW6_PHOPR/15-221----------------------------------------------------------------------------RGR-
Q6AIG6_DESPS/13-218----------------------------------------------------------------------------IGR-
B2JXV8_BURP8/50-259----------------------------------------------------------------------------QAR-
A5VH54_SPHWW/19-226----------------------------------------------------------------------------HAR-
Q9PHJ3_XYLFA/16-224----------------------------------------------------------------------------EAR-
Q1QFH3_NITHX/19-226----------------------------------------------------------------------------DGA-
Q981S1_RHILO/24-232----------------------------------------------------------------------------DAA-
Q11N51_CHESB/15-223----------------------------------------------------------------------------QGD-
Q6D6R5_PECAS/10-223----------------------------------------------------------------------------ASR-
A7HZU3_CAMHC/9-222----------------------------------------------------------------------------TAI-
Q07GT5_ROSDO/6-215----------------------------------------------------------------------------TDY-
A5FU44_ACICJ/23-231----------------------------------------------------------------------------DVE-
Q2GI57_EHRCR/27-235----------------------------------------------------------------------------TTY-
Q2GD27_NEOSM/14-223----------------------------------------------------------------------------KVA-
Q120E6_POLSJ/33-240----------------------------------------------------------------------------DGA-
A1VV42_POLNA/4-211----------------------------------------------------------------------------AAM-
A1WP55_VEREI/21-227----------------------------------------------------------------------------AAA-
Q7WWY4_CUPNH/6-214----------------------------------------------------------------------------RPE-
B2UCL3_RALPJ/26-235----------------------------------------------------------------------------SIA-
B2UKI9_RALPJ/22-233----------------------------------------------------------------------------QGV-
Q21QK4_ALBFT/33-246----------------------------------------------------------------------------KAR-
A1WDP4_ACISJ/46-258----------------------------------------------------------------------------AAR-
A8AEX8_CITK8/10-222----------------------------------------------------------------------------.SR-
A8LT11_DINSH/7-212----------------------------------------------------------------------------..E-
A9BTR6_DELAS/23-225----------------------------------------------------------------------------.AA-
B2FJH7_STRMK/20-240----------------------------------------------------------------------------.AV-
B4EIS2_BURCJ/10-220----------------------------------------------------------------------------.AL-
B9KHB0_ANAMF/20-227----------------------------------------------------------------------------..D-
C4YUX8_9RICK/37-241----------------------------------------------------------------------------..Q-
G4RA85_PELHB/22-225----------------------------------------------------------------------------KAA-
N0BBW1_9RHIZ/21-224----------------------------------------------------------------------------KAG-
O24879_HELPY/40-239----------------------------------------------------------------------------...-
VIRB8_AGRT5/23-227----------------------------------------------------------------------------..E-
Q13XJ1_BURXL/12-220----------------------------------------------------------------------------...-
VIRB8_BRUA2/26-234----------------------------------------------------------------------------.AL-
Q73IY8_WOLPM/19-224----------------------------------------------------------------------------...-
Q7D3R5_AGRT5/13-220----------------------------------------------------------------------------KAR-
PTLE_BORPE/21-229----------------------------------------------------------------------------.AV-
Q9PBT6_XYLFA/26-237----------------------------------------------------------------------------.AR-

PF14729

Q2G174_STAA8/25-118--------------------------------------------------------------------------------
YDDJ_BACSU/24-118--------------------------------------------------------------------------------
Q2FVL6_STAA8/19-113--------------------------------------------------------------------------------
Q5HQP4_STAEQ/24-116--------------------------------------------------------------------------------
Q5HLI7_STAEQ/24-118--------------------------------------------------------------------------------

PF13474

B2UGF3_RALPJ/11-131-------DILE-A---YR-D-A.L-----K-----------R--R-DA-------D--------G----A-L-KL----W
A5GCV2_GEOUR/9-131-------QLFD-D---YL-R-M.Y-----S-----------S--R-D.-------D--------R----L-T-TY----F
C0QA63_DESAH/9-131-------SLFD-E---YI-E-M.Y-----A-----------S--R-D.-------D--------R----L-T-SR----F
D3SFX3_THISK/13-133-------DYLD-T---W.-.-..L-----R-----------R--R-DT-------D--------R----L-L-AL----H
Q0A9T2_ALKEH/13-139-------QAFL-R---YL-D-TWL-----R-----------K--R-DA-------A--------A----L-H-DL----N
D6XWI0_BACIE/11-137-------QALD-H---YY-D-VYF-----R-----------R--G-DI-------R--------E----T-L-AL----V
D2PT47_KRIFD/6-126-------TLIE-R---WA-D-A.V-----H-----------T--G-NL-------A--------G----V-L-AD----H
Q92KR9_RHIME/14-134-------EVIG-D---WA-E-A.L-----R-----------R--K-DA-------A--------R----V-L-AH----G
C3MEI6_RHISN/13-133-------AAIE-D---WA-G-A.L-----R-----------R--K-DA-------G--------R----V-L-SH----G
D0LTP7_HALO1/11-135-------AINQ-A---FY-R-A.F-----E-----------Q--C-DI-------E--------Q----M-D-QI----W
B5GPB4_STRC2/9-136-------QANT-A---FY-E-A.L-----E-----------R--G-DF-------E--------A----L-S-AL----W
B5HIA9_STRPR/9-137-------QANT-A---FY-E-T.M-----E-----------R--G-DF-------D--------E----L-S-DL----W
D7B847_NOCDD/11-139-------EANA-Q---FY-S-A.I-----E-----------N--G-DI-------D--------L----M-R-SV----W
D1A544_THECD/9-137-------EANA-E---FY-A-A.F-----E-----------N--G-DL-------D--------R----M-S-AV----W
A4YP86_BRASO/20-133-------AANA-A---FY-A-A.F-----A-----------A--G-DF-------A--------N----L-A-AL----W
Q89F64_BRADU/7-119-------AANA-A---FY-A-A.F-----S-----------T--G-DF-------A--------G----M-E-QM----W
B2IHF2_BEII9/4-117-------AANA-L---YY-A-A.F-----S-----------S--G-DF-------A--------K----M-S-AL----W
B9GXK0_POPTR/174-290-------NVNT-E---FF-N-I.I-----R-----------E--R-SL-------Q--------A----M-S-QL----W
B1ZXW2_OPITP/468-592-------HCIE-Q---AI-G-W.A-----I-----------E--K-DF-------D--------A----M-F-HL----W
Q01ZK2_SOLUE/25-147-------EVNA-Q---MT-Q-A.A-----E-----------A--R-DI-------D--------R----L-F-GF----M
B1ZMY8_OPITP/43-165-------ATNT-Q---MI-A-A.A-----N-----------R--L-DV-------D--------A----F-F-AY----I
C6X4B7_FLAB3/29-152-------QINS-A---YD-K-A.T-----L-----------S--G-DV-------S--------Y----F-E-RV----L
C4XSI3_DESMR/466-578-------AAVE-S---WR-A-A.W-----E-----------R--G-RI-------E--------D----Y-L-AH----Y
Q1DE35_MYXXD/42-156-------AVLD-D---WH-Q-A.A-----A-----------A--A-DE-------A--------R----Y-F-GH----F
Q487W3_COLP3/33-147-------KVLN-S---FH-Q-A.A-----A-----------D--A-QA-------T--------P----Y-F-NL----L
A3U720_CROAH/41-154-------SRLD-A---WH-K-A.A-----A-----------E--T-NF-------D--------I----Y-F-NI----M
A5FK93_FLAJ1/24-137-------QTLD-A---WH-K-A.A-----G-----------E--V-KF-------D--------A----Y-F-NV----L
A6GVS5_FLAPJ/25-138-------SVLD-N---WH-K-A.A-----S-----------Q--A-NY-------D--------N----Y-M-HA----M
C6X3L7_FLAB3/38-151-------KVLD-D---LN-M-Y.A-----A-----------K--T-DF-------K--------N----Y-F-DL----F
A4CH66_ROBBH/18-131-------SLLT-A---WH-Q-A.A-----S-----------D--A-DF-------D--------A----Y-F-GL----M
A0M5Z5_GRAFK/38-151-------KTIG-S---WH-K-A.A-----A-----------S--A-KF-------E--------D----Y-F-EL----M
A2TYG4_9FLAO/37-150-------TFMD-N---WH-L-A.A-----T-----------E--A-NY-------E--------N----Y-F-SK----L
A3QCF0_SHELP/31-139-------QTLD-K---LH-G-Y.A-----A-----------S--A-DW-------D--------N----Y-F-AL----Y
Q12PU2_SHEDO/77-185-------SLLN-Q---LH-E-S.A-----M-----------S--A-DW-------D--------T----Y-F-DL----Y
Q085V8_SHEFN/80-188-------ALLN-L---LH-E-S.A-----A-----------A--A-DW-------T--------T----Y-F-SL----Y
A1S876_SHEAM/27-135-------QVLD-A---LH-Q-H.A-----A-----------N--A-NW-------D--------A----Y-F-SL----Y
D9QI29_BRESC/22-140-------AVLD-S---LN-A-A.S-----T-----------A--A-DG-------E--------A----Y-F-AL----F
Q15XC4_PSEA6/38-153-------NVLD-G---LH-E-A.A-----S-----------Q--A-DL-------S--------K----Y-L-GS----F
B9TH82_RICCO/29-143-------AFVD-G---WH-D-D.A-----A-----------H--A-RM-------.--------R----Y-F-DK----M
D4LV59_9FIRM/8-130-------RLTA-E---CL-T-R.Y-----W-----------K--R-DY-------T--------F----I-F-SH----C
B8FCE8_DESAA/7-126-------DLYV-K---IC-E-A.Q-----A-----------I--G-DY-------A--------F----F-Q-EM----F
Q5LP72_RUEPO/8-127-------AIVR-R---WT-T-L.I-----R-----------S--H-KV-------A--------D----L-P-HY----L
A3HV45_9BACT/11-133-------ALYQ-D---WL-Y-A.Y-----I-----------N--G-DI-------K--------T----Y-D-SY----F
B8GG61_METPE/21-142-------ATMD-A---YA-T-A.Y-----R-----------T--K-DF-------Q--------E----M-M-AI----F
B8CPV1_SHEPW/7-128-------STLE-D---YA-K-A.Y-----C-----------A--K-DI-------D--------S----L-M-HI----F
D4MSP2_9FIRM/78-205-------KLLE-Q---FF-D-ACL-----I-----------E--G-NV-------E--------K----A-L-TF----A
D9T710_MICAI/40-166-------QLLN-D---LQ-T-A.F-----A-----------E--K-NA-------D--------A----I-V-DS----L
Q13UI8_BURXL/13-130-------DTLN-A---YY-Q-A.V-----A-----------E--V-NI-------D--------S----L-M-GL----W
Q3ZAF4_DEHM1/11-133-------QVLD-A---MK-E-A.V-----E-----------A--K-NI-------E--------A----L-V-AQ----V
Q63WV1_BURPS/13-127-------DTLN-A---YY-Q-A.V-----A-----------D--A-NL-------D--------A----L-M-VL----W
Q8RYS9_ORYSJ/166-284-------NVNT-E---FY-N-I.I-----R-----------E--G-SL-------P--------A----M-S-HF----W
R5FDC6_9CLOT/10-131-------EIAR-R---IL-S-SYF-----C-----------E--N-DV-------E--------F----L-I-ST----F
R5TK35_9CLOT/9-131-------SLTR-K---IL-T-TYF-----C-----------D--S-DM-------E--------F----M-I-ST----F
R6QJ83_9FIRM/13-123-------...D-L---CR-C-W.F-----E-----------Q--R-DA-------E--------K----T-A-GY----L

PF14534

Q4KEE9_PSEF5/7-110-------MLER.Q...LQ.Q.A.E.....V------.----R..A-DR-------Q.----..-A----L.E-AL----L
A0JT09_ARTS2/213-310-------ALER.E...LL.S.P.D.....T------.----R..A-DI-------G.----..-R----T.G-VL----L
A1CFS1_ASPCL/12-120-------NCER.A...LW.T.A.L.....T------.----S..A-DP-------G.----.P-A----I.E-KL----S
A1R3I0_ARTAT/269-366-------ALER.E...LL.K.P.D.....V------.----R..A-DI-------G.----..-R----I.G-VL----L
A1U4T2_MARAV/6-114-------QVRE.N...WY.S.A.F.....F------.----A..R-DV-------A.----..-H----L.A-RV----Q
A2QV30_ASPNC/167-275-------GKER.R...LW.T.A.L.....T------.----S..A-DP-------G.----.P-E----I.K-KM----C
A3CS44_METMJ/8-106-------DIEK.R...AW.K.A.A.....D------.----V..R-DV-------E.----..-F----Y.R-EY----L
A3HWU2_9BACT/60-168-------AQET.A...WA.S.A.L.....V------.----A..D-DI-------S.----..-F----V.E-SI----M
A3HZW5_9BACT/30-137-------SLDA.K...WE.E.A.N.....L------.----H..P-NP-------E.----..-F----L.D-EL----L
A3I0D3_9BACT/31-149-------KMDS.I...YF.S.A.Q.....N------.----A..C-DL-------E.----..-K----Y.A-SY----L
A3QEM3_SHELP/29-149-------QFYK.Q...FS.V.A.F.....E------.----Q..L-DA-------A.----..-V----I.Q-DI----Y
A3QJ67_SHELP/5-108-------ELEL.A...LL.S.P.E.....V------.----R..C-DA-------N.----..-V----L.D-EL----I
A4AQI2_MARSH/45-155-------EMDR.I...YF.T.A.Y.....N------.----T..C-DM-------E.----..-T----Q.A-DL----Y
A4CNU2_ROBBH/46-156-------DLDQ.A...YF.T.A.Y.....N------.----E..C-DM-------A.----..-T----Q.E-KL----L
A4RV71_OSTLU/211-315-------AIHE.G...FY.R.A.L.....G------.----E..G-DE-------E.----..-A----M.A-AI----W
A5FMK8_FLAJ1/6-112-------TAEI.E...LL.T.A.I.....R------.----N..S-DI-------A.----..-V----L.E-KL----L
A5FMN4_FLAJ1/37-145-------KMDS.L...LF.DVA.F.....N------.----Q..C-DA-------G.----..-A----F.K-KI----I
A5G8N2_GEOUR/26-129-------SVAL.Q...RQ.Q.A.L.....R------.----N..K-DI-------N.----..-L----Y.L-TL----L
A5V3K3_SPHWW/11-125-------EIVE.Q...MF.E.A.INWSADK------.----A..P-DF-------T.----..-A----F.A-AA----V
A5V8Q2_SPHWW/64-171-------AAEQ.R...RG.E.A.L.....V------.----A..R-DF-------A.----..-T----L.R-TL----V
A5VGJ3_SPHWW/7-115-------HAEG.R...LR.A.A.M.....L------.----A..S-DV-------A.----..-T----L.D-AL----L
A5WEC7_PSYWF/5-111-------ELEQ.Q...RF.N.Y.L.....L------.----N..K-QY-------D.----..-E----F.A-AL----C
A6LYA2_CLOB8/8-113-------QLEQ.E...LL.K.S.E.....V------.----R..K-SA-------D.----..-K----I.N-GM----L
A6VR33_ACTSZ/42-148-------GIYR.R...IN.R.A.M.....L------.----D..K-DS-------E.----..-T----I.D-RL----T
A6WA45_KINRD/27-133-------QNFR.A...QL.E.A.M.....V------.----A..G-DT-------V.----..-Q----L.A-HL----L
A6WB55_KINRD/3-111-------ELER.T...RL.R.A.I.....V------.----D..V-DR-------H.----..-V----L.E-DL----H
A8GEK8_SERP5/4-112-------SLEV.K...LH.L.P.V.....T------.----R..N-NV-------A.----..-V----V.S-EL----L
A8LTG7_DINSH/19-134-------AVIA.R...ET.D.T.F.....V------.----V..R-DF-------D.----..-G----W.A-AC----W
A9C0J7_DELAS/26-133-------ALEV.R...LH.D.P.Q.....V------.----R..S-DA-------G.----..-Q----L.Q-AL----L
A9GA01_SORC5/28-134-------AVLI.A...YF.D.C.I.....S------.----K..K-DF-------T.----..-G----M.R-SL----I
B0SZM9_CAUSK/8-116-------ARRK.L...TN.K.L.I.....A------.----G..K-DA-------R.----..-R----L.A-PF----L
B0T7A9_CAUSK/166-269-------TAED.S...LA.K.V.A.....D------.----G..D-AP-------K.----..-A----Y.R-AV----L
B1M5Q7_METRJ/38-144-------QAVD.A...LT.R.A.L.....L------.----S..A-DG-------P.----..-A----L.D-AL----V
B1ZQQ6_OPITP/36-143-------AADA.E...RQ.A.A.F.....V------.----A..G-DR-------A.----..-Q----L.D-AI----L
B1ZZ14_OPITP/30-139-------HLEE.D...ER.K.A.V.....L------.----A..S-DT-------A.----..-K----L.E-EL----W
B2GBD5_LACF3/9-117-------EIYR.A...EN.R.A.M.....V------.----E..R-DQ-------A.----..-T----L.E-RI----L
B2JCD2_BURP8/9-116-------GLER.D...RF.R.A.M.....V------.----E..G-NG-------Q.----..-Q----L.H-AL----L
B2JPS0_BURP8/31-132-------QLEE.N...WV.Q.A.S.....M------.----H..R-DT-------D.----..-T----L.K-LL----L
B3PI44_CELJU/32-141-------KLDA.T...YE.E.A.L.....R------.----I..G-DV-------K.----..-L----L.D-SL----L
B4RBI8_PHEZH/167-269-------AAET.A...LH.E.T.A.....K------.----T..D-VP-------A.----..-A----F.L-AV----A
B4RHA1_PHEZH/45-153-------KVIA.D...ME.A.A.W.....N------.----R..G-DF-------R.----..-G----Y.M-DG----F
B5GTL4_STRC2/19-130-------AVVK.A...LE.E.A.F.....N------.----T..K-NP-------I.----..-A----L.G-EQ----F
B5I698_9ACTO/6-123-------VVTA.E...FF.D.A.FDNRGGK------.----A..A-DV-------A.----..-R----I.H-RL----V
B7JXD1_CYAP8/8-119-------KVFE.Q...TYPD.N.V.....R------.----S..R-DL-------E.----..-S----Y.G-QM----Y
B8GT08_THISH/17-126-------KRVN.D...LW.S.L.S.....M------.----E..R-NA-------E.----..-K----I.R-ST----L
B8MZS8_ASPFN/6-119-------ALEH.K...TW.D.A.L.....C------.----I..S-.G-------S.----..-T----L.I-PL----L
B9E8X8_MACCJ/8-114-------EIYR.T...LV.D.G.M.....I------.----E..K-DT-------H.----..-A----I.D-RV----M
C1A7K4_GEMAT/10-121-------LLRQ.Q...SN.E.A.I.....A------.----A..R-DA-------D.----..-R----V.V-SF----M
C1ABS4_GEMAT/430-537-------ALVT.Q...FL.T.A.L.....G------.----T..G-DS-------T.----..-T----A.L-RT----L
C1CZM8_DEIDV/15-112-------TLDD.L...WN.A.A.Y.....H------.----L..R-DP-------Q.----..-R----M.A-GV----L
C1F8H5_ACIC5/21-124-------GLEE.S...LL.Q.S.A.....V------.----R..K-NA-------A.----..-K----V.A-EL----L
C3AMI1_BACMY/20-132-------QTIT.E...IE.S.A.F.....N------.----A..H-DA-------D.----..-E----L.D-RY----F
C3ZF01_BRAFL/355-462-------AKNQ.K...YM.A.C.F.....K------.----A..N-DM-------K.----..-G----V.A-SL----Y
C4L6W4_EXISA/8-106-------TLEE.A...LL.T.T.E.....V------.----R..Q-ST-------E.----..-R----L.R-EL----L
C5BK93_TERTT/4-109-------ELEK.R...LL.E.P.A.....I------.----R..R-SR-------P.----..-L----H.E-SL----L
C5CWD6_VARPS/8-118-------ALEK.K...FW.Q.S.M.....V------.----D..S-DT-------N.----..-T----A.I-DL----L
C6XYF7_PEDHD/10-116-------EQEN.K...LH.S.A.I.....K------.----N..G-NI-------T.----..-A----L.D-QL----L
C6Y015_PEDHD/172-276-------TTEK.T...LN.A.S.L.....K------.----S..Y-GI-------A.----..-A----F.G-GF----L
C7M5E0_CAPOD/27-132-------QLSE.S...LW.K.A.M.....Q------.----Q..A-DK-------Q.----..-T----L.V-EN----I
C7NFY8_KYTSD/186-282-------ALER.S...LL.A.D.G.....T------.----R..T-DP-------A.----..-E----V.A-AL----L
C7NIZ7_KYTSD/228-329-------ELER.E...LQ.S.P.S.....A------.----R..G-DA-------H.----..-R----L.A-EL----L
C7RBL7_KANKD/30-150-------QQDA.E...FF.Q.RGF.....N------.----E..C-DI-------D.----..-Y----L.Q-QH----V
C9YUI3_STRSW/23-131-------EVVA.T...VE.R.T.Q.....R------.----A..R-DA-------E.----..-G----F.L-AL----F
D2ATH3_STRRD/10-114-------ALEE.Q...GW.A.A.I.....S------.----V..G-DG-------D.----..-F----Y.R-RL----I
D2PZL0_KRIFD/6-115-------RIER.A...RL.R.A.L.....V------.----E..K-DV-------V.----..-A----A.E-LV----H
D3F9E1_CONWI/19-126-------AAES.A...LQ.A.A.I.....A------.----A..N-DP-------D.----..-A----I.G-QQ----L
D3FXC8_BACPE/11-109-------LLEE.K...LL.Q.S.H.....T------.----R..T-SP-------E.----..-Q----L.E-EL----L
D3Q9C7_STANL/5-122-------AIHR.T...FA.E.Y.Q.....E------H----Q..T-EP-------E.----..-P----F.L-AM----H
D3S9F1_THISK/27-146-------RILE.A...KE.A.A.W.....E------.----A..G-DG-------D.----..-A----W.A-RD----Y
D5DIB8_BACMD/6-113-------EYEE.M...LR.S.A.M.....L------.----S..N-NI-------E.----..-L----L.E-EL----L
D5SSM1_PLAL2/48-156-------ASAA.G...FE.R.A.F.....N------.----A..G-DA-------K.----..-A----I.A-AQ----F
D5SZ41_PLAL2/16-126-------TVQY.R...WL.E.A.T.....R------.----K..F-DR-------Q.----..-V----L.S-SL----M
D5UXJ0_TSUPD/21-126-------DLIA.T...LQ.S.G.F.....D------.----S..G-DA-------D.----..-R----Y.D-AF----F
D5X2H8_THIK1/9-116-------AVEE.E...LR.L.A.M.....L------.----A..S-DV-------E.----..-S----L.D-AL----I
D5X508_THIK1/258-358-------EAVE.S...WA.D.A.W.....Q------.----N..K-NL-------P.----..-G----Y.F-AA----Y
D6YUD1_WADCW/33-146-------ELLQ.K...WP.K.D.F.....N------.----Q..K-NI-------P.----..-A----V.C-EL----F
D7DI86_METV0/10-122-------KARR.R...YN.D.A.I.....L------.----H..R-DV-------D.----..-A----I.C-RF----F
D7FUG0_ECTSI/213-343-------ETTL.A...WT.E.T.V.....T------.----R..G-TY-------DA----PK-R----T.A-EL----Y
D9SQZ0_CLOC7/8-113-------QLEN.Q...LL.K.S.E.....V------.----R..K-SS-------K.----..-R----I.N-EI----L
D9T1Z4_MICAI/21-128-------AAER.R...LQ.R.A.Q.....L------.----S..S-DV-------A.----..-E----L.D-RL----I
E0UKN5_CYAP2/8-124-------KVFEVD...YP.T.Y.V.....R------.----N..K-DR-------E.----..-N----Y.G-TM----Y
E1VXQ5_ARTAR/20-119-------DLEQ.E...LL.D.P.S.....R------.----R..S-SV-------E.----..-E----L.K-RL----L
E3EA41_PAEPS/6-112-------EYEE.K...LR.K.A.M.....L------.----A..S-DV-------Q.----..-I----L.N-EL----I
E3M5F2_CAERE/6-112-------KIHD.E...MR.A.L.K.....T------.----A..G-KH-------D.----..-E----F.A-KK----F
E3NA36_CAERE/13-119-------PQFD.V...YA.K.A.V.....D------.----D..E-KW-------D.----..-V----V.E-GF----Y
E3NA40_CAERE/13-119-------PQFE.A...YC.K.A.I.....D------.----N..L-EW-------D.----..-I----V.P-TY----Y
E3Q3Z8_COLGM/20-132-------EAET.L...LW.R.A.M.....C------.----D..S-KP-------K.----..-H----L.K-KY----L
E4TM42_MARTH/40-139-------RVLR.D...YE.T.H.W.....Q------.----N..S-DA-------A.----..-Q----L.A-SL----F
E6X731_CELAD/46-156-------AMDA.T...FF.E.A.Y.....N------.----Q..C-DL-------E.----..-K----Q.A-SI----Y
E8WVR2_ACISM/66-173-------AEDS.I...VG.R.A.I.....A------.----T..H-DF-------A.----..-I----L.Q-RY----W
E8WVR2_ACISM/212-319-------ANGR.A...VG.H.A.I.....A------.----T..M-DF-------A.----..-A----L.E-KL----W
E8WVR7_ACISM/60-181-------AFLQ.T...YD.E.A.W.....A------.----S..H-NP-------Q.----..-A----I.A-ML----H
E8WXR9_ACISM/62-172-------ELEG.R...FQ.E.A.V.....A------.----A..G-GG-------K.----..-V----F.S-EW----F
E8X558_ACISM/30-138-------SAGQ.A...LG.K.A.L.....A------.----T..H-DQ-------A.----..-A----L.E-KL----W
F2F0M6_SOLSS/9-106-------QLEE.S...HT.G.L.E.....V------.----R..R-SK-------E.----..-K----L.D-AI----L
F2F328_SOLSS/60-162-------SAFN.E...YI.A.A.F.....N------.----E..K-DL-------E.----..-R----Y.K-NI----I
F2RH14_STRVP/10-117-------EAIE.RELLLM.T.P.A.....V------.----R..S-SR-------E.----..-L----S.E-RY----L
Q03DA3_PEDPA/8-116-------QLYR.A...EN.E.A.M.....V------.----K..K-DI-------S.----..-R----L.D-MI----L
Q0RLC8_FRAAA/20-126-------ASER.R...LQ.A.A.Q.....L------.----A..S-DV-------E.----..-V----L.D-EP----I
Q11V67_CYTH3/7-113-------DCEK.K...LL.T.A.I.....Q------.----N..N-DV-------E.----..-S----L.E-VL----L
Q12Q38_SHEDO/8-111-------DLEE.C...LF.E.P.K.....V------.----R..G-SI-------A.----..-E----L.D-KL----L
Q13U88_BURXL/31-133-------SMEH.A...WV.D.A.A.....I------.----H..G-DR-------A.----..-T----L.D-QL----L
Q1GMQ9_RUEST/19-122-------AHEE.Q...VW.D.A.L.....V------.----R..G-DA-------D.----..-L----D.A-SL----L
Q1H132_METFK/13-128-------AIVS.R...WD.Q.G.W.....A------.----D..F-DA-------A.----..-L----A.S-RD----Y
Q1ISF5_KORVE/28-135-------QRSQ.E...LF.D.A.V.....A------.----V..G-NK-------D.----..-P----W.Q-KY----F
Q1ITS8_KORVE/8-111-------RVEE.R...LR.I.A.Q.....L------.----H..C-DP-------K.----..-V----L.D-QL----L
Q2G7A7_NOVAD/11-122-------LRRA.E...FN.R.A.L.....A------.----A..R-DL-------E.----..-A----I.G-GI----L
Q2LTB1_SYNAS/390-491-------SLIS.R...WA.R.S.W.....E------.----S..D-DM-------P.----..-A----Y.Q-DC----Y
Q5LLC5_RUEPO/46-153-------AKSR.R...FE.E.N.F.....A------.----R..G-DV-------P.----..-A----LVA-DY----Y
Q5YUX5_NOCFA/23-128-------AVER.A...GW.D.A.L.....C------.----A..S-TG-------A.----.R-F----Y.G-AV----M
Q6AE79_LEIXX/186-283-------RLER.E...LL.D.P.A.....V------.----R..A-DS-------S.----..-Q----V.A-AL----L
Q82AU3_STRAW/26-136-------ALWA.E...MA.R.G.W.....A------.----A..G-DA-------A.----..-L----F.A-AS----F
Q89JP5_BRADU/29-135-------AIAS.E...YA.A.S.F.....N------.----K..Q-DG-------A.----..-G----I.A-AL----F
Q89SG9_BRADU/39-147-------KKVE.A...FR.L.A.Q.....I------.----A..A-DP-------K.----..-A----L.G-AL----C
Q8YWM4_NOSS1/9-120-------SIFE.E...VYPD.N.V.....R------.----G..R-DL-------S.----..-A----Y.A-DM----Y
Q9RS70_DEIRA/32-140-------RSYQ.E...LM.R.A.T.....V------.----A..G-DS-------A.----..-T----I.L-RF----Y
B0SRG8_LEPBP/10-116-------SLEK.Q...LI.E.A.I.....K------.----K..S-DI-------P.----..-F----L.E-SV----I
B1HN37_LYSSC/64-167-------ASFD.E...YI.A.A.L.....N------.----A..E-EI-------D.----..-R----Y.M-KT----I
F9URX0_LACPL/18-126-------QLYR.D...EN.I.A.M.....V------.----Q..K-NL-------S.----..-R----L.N-EI----L
F9UT77_LACPL/12-117-------RVVH.Q...QV.Q.G.M.....L------.----E..K-NL-------E.----..-L----L.D-QV----I
Q5LTS8_RUEPO/9-110-------DCET.R...VW.Q.A.L.....V------.----D..G-DA-------A.----..-A----D.E-AA----L
Q8P937_XANCP/40-149-------.........FW.K.A.Y.....N------.----A..C-DL-------P.----..-A----A.G-KL----L
Q8PBX0_XANCP/2-100-------..EL.R...LL.D.P.Q.....V------.----R..G-SA-------A.----..-E----L.E-TL----L
Q8YRK0_NOSS1/10-115-------ANEK.N...LL.S.A.M.....K------.----T..N-NV-------K.----..-L----L.D-KL----L
Q8ZMH1_SALTY/11-112-------.AHA.A...IE.N.W.L.....S------.----KGVG-SL-------E.----..-A----L.I-AR----F
Q97G15_CLOAB/8-113-------KLEN.D...LL.K.P.E.....I------.----R..Q-CE-------A.----..-R----T.S-EL----L
Q9A9S2_CAUCR/46-158-------SLDK.A...LF.D.ASF.....V------.----T..C-DA-------A.----..-K----A.N-AI----F
Q9RJZ2_STRCO/30-137-------RVVA.T...VE.R.T.Q.....R------.----D..K-DA-------E.----..-G----F.L-TL----F

PF08332

KCC2D_CAEEL/587-711-------RVTQ-T---LL-D-A-I-----S-----------C--K-DF-------E--------T----Y-T-RL----C
Q8P5Y9_XANCP/36-159-------ALFD-T---WN-A-A-L-----A-----------T--G-NP-------H--------K----V-A-DL----Y
KCC2A_DROME/389-516-------KITE-Q---LI-E-A-I-----N-----------S--G-DF-------D--------G----Y-T-KI----C
Q5SIW7_THET8/3-128-------NFLE-R---HL-R-S-I-----Y-----------E--G-DW-------A--------T----Y-E-AT----T
F8WHB5_MOUSE/57-184-------KVTE-Q---LI-E-A-I-----S-----------N--G-DF-------E--------S----Y-T-KM----C

PF13577

D9QIN2_BRESC/9-135-------RAIK-R---LQ-H-A-W-----A------H----Y--A-QI....G..LW....D.-D----I.A.AL----F
D9QIN2_BRESC/195-322-------AAIV-R---LQ-N-S-W-----G------Y----Y--V-DR....R..QW....D.-D----V.A.DL----F
D9QIN2_BRESC/413-542-------DAVE-N---IA-T-A-Y-----G------Y----Y--I-DE....F..RW....A.-E----V.R.DL----F
D3Q8I0_STANL/19-151-------TEIA-D---AL-H-R-F-----A------L----G--Q-DL....K..DR....E.-L----F.A.SA----F
Q0SJ13_RHOSR/45-175-------ALIS-E---RV-I-K-Y-----A------M----A--V-DR....A..DW....E.-M----F.A.DC----F
A5V679_SPHWW/6-139-------RALD-E---MV-Y-K-C-----M------H----A--M-DT....H..QW....A.-L----Y.R.AN----I
B5HCB8_STRPR/23-148-------AEIA-D---LL-D-R-Y-----L------R----S--L-DE....GPLDE....E.-W----A.R.AF----H
E3IXY9_FRASU/16-146-------DAIV-D---LV-H-R-Y-----S------Y----C--V-DH....K..LN....D.-E----L.A.AL----F
D2RZV4_HALTV/8-134-------IAIQ-D---LR-S-N-Y-----C------Y----A--I-DD....R..DF....E.-S----L.P.HL----F
Q0UXA3_PHANO/19-158-------LAIS-N---VL-S-C-Y-----C------E----A--L-DT....K..NF....E.-L----L.E.EV----F
B1MBT8_MYCA9/7-136-------HEIT-E---LK-Y-R-Y-----A------R----T--L-DN....K..LW....D.-E----F.A.DT----L
A5V4W9_SPHWW/12-141-------AEIT-D---LV-A-R-Y-----A------R----G--A-DR....K.NDP....A.-I----L.G.PL----F
Q73Z53_MYCPA/11-137-------ESIK-Q---LK-A-R-Y-----C------R----Y--L-DT....K..DW....A.-A----W.R.TI----F
D0L747_GORB4/5-127-------LEIT-Q---VL-T-D-Y-----S------T----A--V-DA....G..RF....D.-D----L.D.RV----F
B4EDY3_BURCJ/5-132-------HDIR-E---RV-V-P-Y-----S------S----A--I-DS....C..DF....D.-A----L.D.TV----F
B0T6L6_CAUSK/8-137-------SDIH-D---MM-C-R-Y-----A------R----G--V-DR....M..DK....D.-L----V.L.TC----F
Q0UTX1_PHANO/50-179-------RNIK-N---IQ-K-Q-I-----S------H----L--A-QF....G..EW....R.-T----I.S.HL----F
Q0UTX1_PHANO/238-365-------DEVR-N---LV-H-A-R-----G------F----Y--V-DR....R..MW....G.-D----V.V.DL----H
Q0UTX1_PHANO/423-553-------DGSE-N---LS-H-A-Y-----G------Y----Y--A-DD....I..LG....P.-E----L.G.GL----F
A5VCU7_SPHWW/9-134-------QAIR-R---AA-T-L-Y-----A------I----G--A-DR....R..DP....A.-I----W.T.AI----M
B2A9N2_PODAN/33-173-------REIK-N---IQ-R-T-Y-----A------Q----L--A-QH....G..RW....K.-G----M.A.SL----F
B2A9N2_PODAN/248-379-------DEVR-N---LV-H-G-M-----G------Y----Y--V-DR....R..MW....P.-D----V.I.SL----F
A6VWC0_MARMS/15-150-------RAIR-A---CI-N-R-Y-----M------D----L--C-DH....L..NPATPLD.-E----L.G.DL----F
A0QWD2_MYCS2/19-160-------RDIA-R---LI-A-S-Y-----G------P----A--V-DA....A..DA....D.-T----A.A.GL----W
A1SDG2_NOCSJ/13-135-------DQIC-Q---LK-Y-R-Y-----L------R----T--L-DT....K..RW....D.-E----F.A.DC----F
A4XF70_NOVAD/24-149-------EEIR-E---LI-A-R-Y-----G------P----L--A-DS....G..DA....E.-A----L.S.EL----W
C5DP23_ZYGRC/32-161-------EAIE-D---AL-Y-R-C-----V------L----G--L-DT....A..DV....T.-L----F.E.SA----L
A5V734_SPHWW/6-140-------YRIR-R---LI-L-T-W-----L------D----G--I-DT....R..DP....E.-K----I.R.AA----W
E3IXP4_FRASU/19-145-------VEIM-Q---LV-A-Q-Y-----G------P----A--V-DS....G..SA....Q.-A----T.A.AL----W
E3IY46_FRASU/4-132-------EALK-Q---LK-A-R-Y-----L------R----L--V-DE....K..KW....D.-E----W.A.DV----F
D0J3B0_COMT2/9-135-------HALA-Q---TL-T-R-Y-----A------T----A--C-DT....R..NW....D.-L----L.Q.QV----F
A8LAB8_FRASN/18-148-------RAIY-R---LM-C-R-Y-----G------E----A--L-DY....G..LD....D.-Q----L.V.DL----F
A4XF68_NOVAD/127-253-------RAIR-D---GL-A-R-F-----A------R----V--L-DA....K..AW....D.-A----L.G.DV----F
Q0S5K6_RHOSR/13-140-------GKIE-R---VL-F-D-Y-----A------Y----N--L-DM....N..RP....D.-D----L.V.AL----F
C5AL89_BURGB/17-156-------REVR-H---AF-T-R-Y-----M------A----L--C-DVPVRPL..AG....E.-S----L.A.AL----F
D0IVW3_COMT2/14-141-------QSIQ-A---LK-A-R-Y-----L------R----A--C-DQ....K..QP....N.-A----M.R.EC----F
Q2G3D7_NOVAD/8-142-------EEIK-Q---LK-A-R-Y-----F------R----C--M-DT....K..DY....A.-G----L.R.QV----F
A5VH89_SPHWW/19-143-------ADIT-D---CV-Y-R-L-----A------R----A--G-DR....L..DR....A.-L----M.Q.SA----F
E3J7S9_FRASU/5-125-------DQIR-Q---LA-E-R-Y-----A------L----A--V-DG....K..DL....D.-S----L.A.AL----F
A5DD79_PICGU/8-137-------EAVA-D---AL-Y-R-A-----A------S----A--F-DD....N..DV....G.-L----F.N.SA----M
E3J7S1_FRASU/26-166-------RAIR-D---LL-A-H-Y-----G------Y----T--A-DT....C..KD....E.-E----F.V.EL----Y
D2QII9_SPILD/28-157-------MALK-A---LV-D-E-F-----S------I----L--A-DR....K..DV....A.-T----Q.V.LL----F
A5V526_SPHWW/11-135-------QAVS-E---VL-L-G-Y-----C------R----A--I-DR....R..DA....E.-L----M.R.RV----Y
E3IVD7_FRASU/14-137-------EAIR-R---LI-S-L-Y-----G------Q----L--L-DD....L..RL....E.-E----W.G.HL----F
Q0S5K7_RHOSR/9-131-------AELE-D---LA-V-R-Y-----F------L----A--S-DF....D..DF....D.-A----I.A.DV----F
D0LD89_GORB4/12-143-------EDIK-R---LK-H-R-Y-----W------R----A--C-DA....K..DP....K.-T----F.R.EC----F
B2AQ89_PODAN/30-160-------REIK-D---VT-S-T-F-----A------Q----L--A-QF....G..RY....A.-D----M.A.AL----F
B2AQ89_PODAN/220-360-------DEVR-N---LQ-H-A-W-----G------Y----Y--V-DR....R..LW....G.-E----V.G.EL----F
A5VBN9_SPHWW/10-129-------DAIR-Q---LA-A-K-Y-----S------L----A--L-DM....R..DA....D.-A----W.V.GL----F
E6WNE5_PANSA/4-133-------LALR-E---LV-D-T-F-----S------N----L--A-DE....K..DV....A.-A----Q.I.PL----F
B8MXL3_ASPFN/8-138-------EAIT-D---AL-Y-R-C-----V------T----G--F-DT....A..DT....A.-L----F.D.SA----F
C0ZQW7_RHOE4/8-149-------EEIK-R---VF-A-A-R-----L------R----C--M-DT....K..QW....H.-V----Y.P.TL----H
E3IWW1_FRASU/10-135-------EAIR-Q---QL-H-N-Y-----C------R----A--M-DR....R..DD....P.-L----G.Y.AV----W
D1ABN9_THECD/23-147-------REIT-R---LI-L-S-Y-----G------P----L--V-DS....G..CA....Q.-A----V.A.EL----W
C0ZMD8_RHOE4/24-149-------QEIY-E---VL-A-R-F-----L------R----A--A-DR....G..DV....E.-D----A.R.RC----Y
C0ZQN1_RHOE4/6-139-------SAIR-D---LL-C-E-Y-----T------H----L--I-DQ....G..RL....G.-E----V.A.AL----F
A4XEZ3_NOVAD/13-139-------EAIR-A---LK-A-R-Y-----L------R----A--C-DL....K..EV....E.-D----V.R.DC----F
Q13HM1_BURXL/10-142-------NAIQ-M---TK-A-R-Y-----C------R----F--V-DT....K..QW....D.-R----L.R.TL----F
B5HT20_9ACTO/43-171-------AEIS-T---LL-D-R-Y-----L------I----G--L-DD....D..KL...ND.-A----W.ASAL----F
B3E7N6_GEOLS/52-188-------EEIR-Y---KL-C-L-Y-----C------R----G--D-DR....Q..DA....E.-E----G.K.KM----F
Q65SQ7_MANSM/19-149-------QALK-D---LV-D-T-F-----S------N----L--A-DE....K..NV....A.-A----Q.M.PL----F
A5VBG5_SPHWW/5-140-------EGVK-R---CK-A-E-Y-----F------R----C--I-DE....Q..DW....D.-A----L.V.AN----F
C5E1P0_ZYGRC/8-136-------EAIK-D---TI-Y-R-C-----V------L----S--V-DT....A..DV....E.-L----F.D.SG----L
C7PBQ3_CHIPD/4-133-------IALK-E---LV-D-K-V-----S------I----L--A-DR....K..DV....H.-A----Q.V.QL----F
A5V782_SPHWW/7-132-------SAIM-R---LI-H-T-Y-----P------R----G--L-DR....L..DK....E.-L----L.L.SI----G
E3J9Q1_FRASU/15-143-------GAIG-R---LI-L-T-Y-----G------P----A--A-DA....G..LA....D.-L----A.A.SV----W
Q28SS5_JANSC/28-163-------TEMI-R---IA-D-A-L-----D------A----A--V-DA....Q..DW....P.-A----A.R.AL----F
Q5YUE7_NOCFA/24-150-------WQIL-E---LL-S-A-Y-----G------P----A--V-DS....G..SA....D.-V----A.A.DL----W
A5V765_SPHWW/9-128-------IALG-E---LV-A-R-Y-----A------W----L--V-GQ....G..RG....A.-E----V.P.AL----F
Q2G4I2_NOVAD/20-164-------NAIR-R---LQ-W-A-Y-----G------Y----Y--I-DY....N..RP....E.-E----V.A.GL----F
Q0RU80_FRAAA/13-137-------AKCV-E---LG-A-R-Y-----C------H----G--V-DR....A..DQ....E.-T----F.L.SI----W
C0ZY97_RHOE4/8-139-------EEIK-K---LK-H-G-Y-----W------R----A--C-DA....K..DP....V.-R----F.R.SS----F
C1GKF4_PARBD/8-153-------TNIH-D---VV-T-K-L-----N------F----Y--L-DT....Y..QW....DK-L----I.D.EV----F
B0T6Q3_CAUSK/13-141-------ESIR-T---LK-S-R-Y-----H------T----L--V-ND....T..DF....D.-Q----I.G.GL----F
Q2G896_NOVAD/9-133-------LSIQ-Q---AV-A-A-Y-----G------A----A--L-DG....A..EV....S.-L----F.E.RC----F
Q2G8B9_NOVAD/8-130-------AELN-D---LV-V-A-Y-----F------L----A--S-DG....D..DL....A.-T----V.G.NS----F
A0R741_MYCS2/12-151-------LAIY-A---LL-A-T-H-----P------I----S--A-DT....G..EP....E.-L----I.E.GI----Y
A2QQU7_ASPNC/9-142-------EAIV-D---PV-Y-R-A-----V------L----S--F-DG....N..DL....P.-L----F.E.SA----F
A5V496_SPHWW/15-154-------RAVR-A---VV-M-R-Y-----F------R----L--C-DTLGPDT..SL....D.-D----L.G.LC----F
D3F909_CONWI/11-132-------SEIA-D---LV-A-R-L-----G------A----W--L-DR....Q..RP....DD-D----P.R.TI----F
A5V4W4_SPHWW/9-135-------RAID-D---LI-A-D-L-----G------R----A--F-DA....G.PSA....A.-A----L.R.EL----F
A8LEQ5_FRASN/33-162-------LEIL-R---LL-N-S-Y-----G------P----L--V-DS....G..SA....E.-E----A.A.DL----W
Q5YMU1_NOCFA/9-129-------AELS-E---LV-A-R-H-----S------V----W--V-DE....G...F....A.-D----T.D.RL----F
B8MB56_TALSN/45-177-------TEIK-N---VQ-S-L-Y-----G------T----I--I-DA....K..TM....K.-D----L.S.RV----F
A7HVX6_PARL1/27-151-------TEIA-D---LV-N-N-W-----A------F----Y--R-DQ....E..AW....S.-K----L.G.AT----F
Q47PW3_THEFY/16-138-------EIAR-N---HL-H-R-Y-----A------A----T--L-DN....P..TP....E.-A----V.A.AL----F
Q0RKC5_FRAAA/4-127-------VGAA-H---LL-A-S-Y-----T------Y----F--A-DS....G..RL....G.-P----L.V.DL----F
C0ZPG5_RHOE4/7-136-------VAIH-Q---LY-G-H-Q-----S------H----C--I-DS....G..RQ....Q.-D----W.A.QT----F
Q2GA82_NOVAD/22-166-------LDVR-K---LQ-H-L-Y-----G------Y----L--I-DK....C..MY....N.-E----T.V.DL----F
D1A615_THECD/11-138-------VDIL-S---FY-A-R-Q-----M------H----L--L-DG....L..RL....E.-E----Y.A.DT----F
Q2J5F3_FRASC/12-141-------TQVL-Q---FY-A-H-Q-----M------G----L--L-DE....R..QA....D.-S----W.A.DT----F
Q13GK3_BURXL/16-154-------LNIL-N---LI-A-A-H-----P------P----C--V-DT....G..SA....E.-.----Y.A.EN----M
Q2HFF4_CHAGB/8-157-------ANIH-D---TV-T-K-V-----P------L----Y--Y-DT....I..NL....P.-A----LQA.EV----Y
B2AMA1_PODAN/20-165-------AEVR-K---TH-F-K-Y-----G------Y----Y--L-DK....C..LY....N.-E----V.V.DM----F
Q2J5F8_FRASC/12-144-------HEIL-Q---FY-A-A-Q-----M------S----L--L-DG....ADPDP....D.-G----W.V.RT----F
A4XER9_NOVAD/52-204-------GDIQ-N---LF-S-R-Y-----M------Y----L--H-NA....F..RD....P.-E----I.V.PL----W
B5HIV3_STRPR/14-145-------AQVQ-Q---FY-A-G-Q-----V------R----H--L-DT....M..RA....E.-E----F.A.AS----F
D4J4G2_9FIRM/14-173-------EEIK-K---LI-H-K-R-----V------I----Y--I-TN...EM..RK....E.-E----L.N.DL----W
D4J4F8_9FIRM/15-157-------EACR-N---LM-G-R-Y-----S------Y----Y--R-TA....F..QN....K.-E----M.V.EL----W
A2QCD6_ASPNC/23-149-------LCVT-E---LL-K-G-W-----P------V----Y--R-DA....S..EW....A.-H----Y.R.NC----F
Q0V2S9_PHANO/36-181-------EDVR-K---LQ-Y-T-Y-----G------Y----Y--L-DK....C..LY....K.-E----V.A.DL----Y
Q73XG8_MYCPA/12-127-------AAIL-N---LN-A-R-H-----N------R----A--Y-SD....G..DR....D.-G----W.I.AT----F
B2HNY2_MYCMM/12-134-------AAIQ-Q---VK-Y-R-Y-----L------R----A--L-DT....K..HW....D.-E----F.A.DT----L
B4EK49_BURCJ/8-131-------EQIR-Q---LK-Y-R-Y-----F------R----A--V-DT....H..DW....T.-L----L.A.AC----L
D4AUD6_ARTBC/51-174-------SEVG-Q---GV-S-L-F-----F------L----L--V-DE....H..RF....E.-E----M.N.KV----F
D4Z258_SPHJU/6-129-------AAIQ-D---LY-S-D-K-----L------I----A--V-DK....R..QE....G.-R----L.A.SI----W
F2RC28_STRVP/29-155-------AAIS-A---VC-D-R-Y-----A------M----H--L-DKD..RG..SD....D.-W----F.G.AV----F
F9UT75_LACPL/5-135-------LALK-Q---VV-D-L-F-----S------N----Y--S-DT....K..EN....E.-K----Q.V.QL----F
Q73VN5_MYCPA/6-129-------LEIQ-Q---LL-V-D-Y-----S------T----A--I-DN....R..RF....D.-D----L.D.DV----F
Q7API7_STRCO/4-133-------YAII-E---LC-T-R-M-----A------W----H--L-DH....C..EW....D.-Q----L.V.DL----F

PF12893

Q390L3_BURS3/2-118-------ALIDD.---YF-N-L-------A------Y----E--P.KS-------R--------D----F-D-TI----F
A4YKR3_BRASO/3-119-------SVVQG.---YF-D-A-------L------Y----E--G.DA-------D--------K----L-G-AV----F
A3SYD4_9RHOB/2-118-------SAIET.---YF-D-A-------I------H----E--C.DT-------D--------K----L-N-AV----F
A3N8A5_BURP6/1-117-------RALQI.---YF-D-V-------M------Y----E--C.DL-------E--------K----F-D-LV----F
Q6ARD2_DESPS/3-119-------DFLET.---YF-V-M-------L------Y----E--G.DA-------E--------T----M-E-KV----F
A3U1L9_9RHOB/8-121-------EALGT.---YA-T-A-------L------H----T--A.DA-------A--------A----L-D-TL----C
C0VIK1_9GAMM/4-120-------QQIEK.---YF-D-A-------L------Y----F--C.DL-------A--------L----L-K-QV----F
B8H2L6_CAUCN/2-118-------DVLRK.---YF-D-A-------L------Y----T--C.DV-------D--------L----L-A-EV----F
A0NVB1_9RHOB/3-119-------KVISN.---YF-D-A-------L------Y----H--C.DT-------D--------L----L-Q-QV----F
Q5LU66_RUEPO/8-124-------AVIGT.---YF-D-G-------L------H----H--A.DS-------A--------R----L-R-QV----F
A1TQB0_ACIAC/3-119-------ALLQA.---YF-D-G-------L------Y----H--S.DA-------E--------K----L-R-TV----F
A8TQD6_9PROT/3-119-------DTLSD.---YF-D-G-------L------Y----H--S.DA-------A--------K----L-A-TV----F
Q1GM60_RUEST/4-120-------DLMTR.---YF-E-G-------L------Y----H--S.DS-------D--------V----L-R-TV----F
Q16B55_ROSDO/5-121-------SLMKR.---YF-D-G-------L------Y----H--S.DS-------T--------V----L-R-SV----F
A4ESW6_9RHOB/4-120-------NLVET.---YF-E-G-------L------H----Q--A.DS-------T--------V----L-R-EV----F
A8TNA8_9PROT/3-119-------QAMDL.---YF-D-G-------F------Y----T--G.DV-------D--------T----L-K-KV----F
A1U866_MARAV/3-114-------AMVNE.---YF-Q-G-------L------H----T--G.DA-------N--------R----L-A-PL----F
Q2BPK3_NEPCE/9-120-------NIINS.---YF-T-G-------L------Y----Q--G.NS-------S--------Q----L-K-AI----F
A3YEG3_9GAMM/7-118-------SIINQ.---YC-E-G-------L------Y----L--G.DA-------K--------M----L-E-DL----F
Q480Y3_COLP3/13-124-------DILYS.---YF-D-G-------L------Y----H--G.DV-------A--------K----L-D-SI----F
Q12R73_SHEDO/9-120-------AVVQG.---YF-E-G-------L------Y----H--G.DV-------A--------K----L-S-GL----F
A1ZW12_9BACT/4-119-------HTIQN.---YF-E-G-------I------F----Y--G.DV-------S--------K----L-K-SS----F
D7VZN4_9FLAO/30-146-------NVIEHY---YF-K-G-------I------Y----K--G.DT-------E--------L----L-K-KA----F
A5FCS3_FLAJ1/29-145-------DAIENY---YF-K-G-------I------Y----E--G.DE-------I--------L----L-G-SV----F
C7PJE9_CHIPD/30-146-------GVLEND---YF-K-A-------I------Y----E--G.DT-------D--------R----L-G-NI----L
Q47ZG0_COLP3/35-153-------ETAYN.---YF-N-G-------A------A----N--G.DQ-------K--------L----L-S-KA----F
A4A731_9GAMM/38-147-------AAVFD.---YF-E-G-------I------N----E--V.SE-------V--------R----L-K-RA----F
B8KPV9_9GAMM/26-135-------ATVFD.---YF-D-G-------I------N----E--V.SL-------V--------R----L-E-RA----F
A9AXY9_HERA2/8-126-------QAALD.---YL-E-S-------Q------H----N--L.DP-------A--------Q----M-Q-RS----I
B8L8C5_9GAMM/32-148-------ATCHD.---YV-D-G-------Q------L----E--A.DP-------Q--------R----V-A-RS----L
Q9A9W5_CAUCR/33-150-------AVAFD.---YV-D-G-------Q------L----E--G.DT-------A--------R----V-T-RA----L
B4RCF3_PHEZH/43-158-------AVAYD.---YV-D-G-------Q------L----E--G.DP-------A--------R----V-A-RA----L
A1ZL32_9BACT/31-153-------QHILKS---YI-H-G-------A------F----N--ELNP-------E--------A----M-A-KG----F
A8UKV2_9FLAO/14-126-------SVLYD.---YI-E-G-------T------A----N--G.EP-------D--------R----L-K-RA----F
C1AE73_GEMAT/307-421-------EPLQA.---YL-D-G-------H------A----T--G.QE-------A--------H----F-R-RA----F
Q46X76_CUPPJ/10-124-------EPVEN.---YL-K-G-------H------A----T--G.NG-------E--------Y----I-R-KA----F
Q0JYS5_CUPNH/10-124-------APIED.---YL-Q-G-------H------I----T--G.KA-------E--------F----M-Y-KA----F
L2ENA4_9BURK/8-121-------EPIQH.---YL-E-A-------H------R----T--G.RA-------E--------Y----V-R-KA----F
B7WZC2_COMTE/10-123-------VPLEL.---YM-R-G-------H------A----E--D.KA-------E--------H----M-R-AA----F
Q9F3P6_STRCO/275-388-------DPLRA.---YV-R-G-------H------A----T--G.DP-------G--------H----F-R-DA----F
C7QIJ7_CATAD/267-380-------EPLRA.---YI-R-G-------H------A----T--G.DP-------A--------H----F-R-EA----F
A1ZP43_9BACT/24-134-------QTLNY.---YI-D-G-------G------T----N--G.DV-------A--------L----L-R-KA----F
A3HY18_9BACT/11-124-------ETIQL.---YF-D-G-------M------I----E--R.DK-------S--------K----L-E-KA----F
Q1H3V3_METFK/8-121-------EVLNV.---YM-N-A-------A------E----S--G.TG-------E--------E----M-S-AA----F
C3KBS1_PSEFS/33-147-------KVLNT.---YI-E-G-------C------K----Q--A.KS-------S--------I----M-K-PA----F
C3KBQ7_PSEFS/8-122-------TVLNH.---YN-E-G-------G------K----Q--A.KS-------S--------L----M-K-PA----F
A3D088_SHEB5/8-122-------EVLSK.---YN-E-G-------G------K----K--A.DS-------T--------I----M-R-PA----F
Q3KE19_PSEPF/8-121-------EVLSQ.---YN-E-G-------G------A----K--A.DS-------A--------L----M-K-PA----F
C5FTM8_ARTOC/16-127-------KAARY.---YV-D-G-------L------K----T--G.NI-------E--------H----S-R-QG----F
C3KBQ8_PSEFS/11-124-------AVAQQ.---YA-D-G-------L------R----A--G.SP-------E--------V----L-E-QA----F
C7PBA6_CHIPD/41-154-------AVIDG.---YV-E-G-------L------R----L--G.DV-------A--------K----L-K-KA----F
A5VE46_SPHWW/17-129-------RLIGR.---YV-D-G-------A------R----A--G.DS-------G--------P----M-R-EV----F
Q5LUH0_RUEPO/5-117-------ALVET.---YV-M-A-------M------T----R--G.DR-------P--------A----L-E-RI----F
Q2KDJ8_RHIEC/2-116-------QTVHL.---YV-E-G-------M------A----F--A.NA-------A--------A----L-K-KA----F
B9J7G6_AGRRK/2-116-------AVVHL.---YV-D-G-------M------A----F--A.NE-------P--------A----L-R-KA----L
A6UF76_SINMW/2-116-------AVVHL.---YV-D-G-------M------A----F--A.NE-------G--------A----L-R-KA----F
C3MCQ3_RHISN/2-116-------AVVHL.---YV-D-G-------M------A----F--A.NE-------A--------A----L-R-KA----F
B8FB72_DESAA/6-121-------ETVQN.---YF-D-G-------M------Y----Y--G.DV-------A--------R----L-E-KA----F
A0Z962_9GAMM/3-119-------SVIQV.---YF-N-C-------M------Y----E--S.SS-------E--------K----A-H-AA----F

PF11533

Q2KWZ9_BORA1/3-126-------HVLA-EVHLAF-S-R-Y-----E------A----ALVSNDI-------A--------V----L-D-EL----F
A4GA01_HERAR/3-127-------EVVA-EVTAAF-M-R-Y-----E------A----ALTGNDV-------A--------V----L-D-EL----F
Q2JJM3_SYNJB/2-130-------EVVA-ELTELY-H-Q-Y-----E------A----ALTSNDV-------P--------T----L-T-RL----F
B2JQX3_BURP8/4-129-------ETLA-AVEAAF-D-E-Y-----E------R----ALTTNDV-------A--------V----L-D-AL----F
B0T8S4_CAUSK/1-126-------DVVA-EVTAAV-D-A-Y-----E------T----ALMTNDV-------E--------A----L-D-GF----F
A7IPC9_XANP2/2-128-------QVKA-EVEDAF-A-R-Y-----E------A----ALVNNDV-------A--------T----L-E-AL----F
Q9A550_CAUCR/1-126-------AVLA-EVTALV-D-A-Y-----E------V----ALMANDV-------E--------A----L-D-AA----F
Q6D1E8_PECAS/4-128-------DVLA-DVTAAF-Y-R-Y-----E------K----ALTGNDV-------A--------V----L-D-EL----F
Q89VK3_BRADU/1-127-------EVIA-EVKAAF-D-R-Y-----E------Q----ALVTNDV-------T--------V----L-G-EL----F
Q01TH6_SOLUE/1-127-------ETIA-TIAALH-E-E-Y-----E------A----ALISNDV-------G--------K----L-T-GF----F
Q6N9S0_RHOPA/1-127-------EIVA-EVSEAF-A-R-Y-----E------A----ALVGNDV-------A--------T----L-N-EL----F
A2SDU4_METPP/5-130-------EVLA-EMQAVF-A-R-Y-----E------D----ALVHNRI-------E--------V----L-D-AL----F
Q5FP06_GLUOX/7-132-------DILR-DITALS-D-R-Y-----E------R----ALGENEL-------Q--------E----L-D-RL----F
A6T9D1_KLEP7/5-128-------AILA-EVTAAF-Y-Q-Y-----E------E----ALVSNNI-------E--------A----L-D-AL----F
A1WIE8_VEREI/2-125-------QVVA-QVEQAF-A-D-Y-----E------H----ALLIHDV-------P--------A----L-D-RW----F
A8GA93_SERP5/4-128-------AVLA-EVNAAF-Y-R-Y-----E------Q----ALTGNDI-------D--------V----L-D-EL----F
Q7CK76_YERPE/32-154-------AVLA-EVTAAF-Y-R-Y-----E------Q----ALIGNDI-------A--------V----L-D-AL----F
Q8PDQ4_XANCP/7-128-------EVIA-EVTAAF-H-A-Y-----E------H----ALMHDDI-------A--------A----M-D-AL----F

PF12870

B2TQV7_CLOBB/21-124TPS....NMVK-N---YL-E-E-------V------K----K--G-EN-------A--------D----F-S-KL----L
D1PEL1_9BACT/17-132DPGYLAGIAAK-G---YY-D-L-------L------L----E--G-KY-------K--------E----F-V-DG----Y
B3ZXI6_BACCE/23-125DPK....EIVT-A---YF-E-N-------A------K----D--G-KV-------D--------E----F-E-SL----F
C2Q545_BACCE/14-115DPE....EVAT-A---YF-E-D-------A------K----D--G-NV-------K--------D----F-G-EL----F
C2UNV5_BACCE/11-113NPE....EVAT-A---YF-E-D-------A------K----E--G-NV-------K--------D----F-G-EL----F
B9L7K8_NAUPA/17-130SPE....TAAK-E---FI-S-S-------F------M----T--G-DV-------E--------S----F-N-KY----A
A8ETE1_ARCB4/19-125TAA....DATE-N---FF-Y-S-------V------K----E--G-NV-------E--------D----Y-H-KY----S
B4EXW7_PROMH/19-133EAG....KAAV-E---FI-E-A-------V------A----S--G-DG-------D--------K----A-V-SL----M
B7X013_COMTE/26-141TPEQSQDELIR-R---FY-A-L-------V------A----A--G-DF-------D--------A----C-I-AL----V
A0A059GNW7_CAMJU/1-111NPE....DLAK-N---FT-K-D-------L------Y----S--G-DT-------K--------S----V-M-SY----I
Q7VHU7_HELHP/20-130SPK....DVAI-A---FT-K-D-------A------Y----K--G-NG-------D--------R----L-I-KY----I
C0DXX5_EIKCO/20-134TPE....KTAE-Q---FI-R-N-------A------Y----N--G-NG-------D--------A----V-V-AM----L
B3CFI0_9BACE/18-132SPG....DAMK-K---YS-N-Y-------L------I----K--G-DY-------E--------K----F-V-DG----I
B3JFG8_9BACE/19-131TPG....TALK-N---YM-S-A-------L------S----D--K-DY-------E--------K----F-I-DG----C
D3Q127_STANL/126-231GPS....SAVD-N---VV-N-A-------L------E----D--G-DY-------A--------A----F-K-EA----L
B1MHS8_MYCA9/118-217TAE....AAVK-G---YL-E-A-------L------S----K--G-DA-------E--------A----A-L-SY----S
B5D1Y3_BACPM/17-129TPT....NTVE-K---AF-D-A-------M------I----K--G-DY-------E--------T----Y-V-RS----F
C7PUV8_CHIPD/19-120TPQ....EVAL-N---FM-H-A-------I------Q----E--S-NF-------D--------L----A-R-DY----A
C2M310_CAPGI/17-114SPK....VVAE-K---FL-K-A-------I------N----K--A-DF-------K--------E----A-K-KY----C
B3QM74_CHLP8/19-124GPS....KVVK-N---FY-H-D-------V------E----A--G-KI-------E--------E----A-T-KL----F
Y142_AQUAE/19-135GAK....ETVG-E---FM-E-E-------I------A----E--G-EG-------R--------D----A-I-KY----L
A8UYQ1_9AQUI/18-134AAK....DVVD-E---FM-E-E-------I------Q----E--G-EG-------S--------E----A-I-GF----L
B4U8X6_HYDS0/35-135NPE....TVLK-N---FD-K-D-------I------E----N--G-DF-------K--------D----A-A-KL----L

PF00866

Q9I0W9_PSEAE/15-157-------AQDWDG---YL-A-.-------Q------F----D--E-QC----------------E----FHL-PQ----W
Q9I0W5_PSEAE/14-156-------DKDWDA---WL-A-.-------L------Y----A--A-DA----------------S----FWM-PS----W
Q53123_RHOSR/32-181-------DRRFQE---WF-D-.-------L------L----A--E-DI----------------H----YFM-PI----R
BENB_ACIAD/21-163-------DEQWDD---WL-E-.-------C------Y----A--P-QA----------------S----FWM-PA----W
ANTDB_ACIAD/15-157-------NYDWDA---YI-D-.-------L------Y----D--E-DS----------------E----YHI-PQ----W
HCAF_ECOLI/19-166-------DWKFRD---WL-A-.-------Q------L----D--E-EI----------------R----YTM-RT----T
Q9I230_PSEAE/22-162-------DRLLDT---WF-A-.-------L------F----E--R-AA----------------R----YRV-LP----L
A0AWN1_ARTS2/49-192-------AQDYDA---WM-S-.-------R------I----A--E-DV----------------H----YLM-PV----R
A1T2D2_MYCVP/20-161-------GGQFRE---WL-G-.-------L------L----D--P-DI----------------R----YVV-PV----R
A1WAE7_ACISJ/40-186-------IQAYKA---WL-E-H-------C------V----A--P-EI----------------K----YQV-IS----R
A4XDR9_NOVAD/19-159-------SKDMPG---WL-E-N-------Y------A----E--E-DQ----------------A----SYY-CR----A
A4XDS6_NOVAD/23-168-------NEDFEG---WL-A-.-------M------L----G--K-DV----------------S----YRL-EL----K
A4XDS8_NOVAD/30-176-------DEHYKA---WT-S-.-------M------L----A--E-DL----------------H----YHM-PG----I
A4XDU7_NOVAD/18-157-------DKDWDA---WL-A-.-------L------Y----H--E-EA----------------E----YWV-PA----W
A4XDY2_NOVAD/23-167-------NQQYRE---WF-D-T-------V------I----A--E-DI----------------H----YWM-PV----Y
A5V4P0_SPHWW/21-169-------SWEWGK---WF-E-.-------L------F----T--E-DV----------------R----YWM-PL----R
A5VGV9_SPHWW/24-171-------ERRFED---WY-A-.-------L------I----A--E-DI----------------H----YAV-PA----R
A9I2P3_BORPD/32-180-------DRRFEE---WF-A-.-------L------L----A--A-DI----------------H----YFM-PI----R
E7FJB3_9BURK/38-186-------HHNYNA---WF-D-.-------L------L----E--Q-DI----------------H----YWM-PI----R
G8ML34_9BURK/14-155-------DRQWDE---WL-G-.-------C------Y----A--E-DV----------------T----YWM-PA----W
K0C5V9_CYCSP/30-185-------NIKYED---WF-A-.-------L------L----D--D-DI----------------H----YYM-PI----R
BPHE_BURXL/33-181-------HRAYEA---WF-A-.-------L------L----D--K-DI----------------H----YFM-PL----R
S6AQB4_PSERE/15-156-------AQDWDT---YL-S-.-------M------F----S--D-DS----------------E----FHL-PQ----W
S6BQW5_PSERE/33-166-------ERRFWE---WD-R-.-------L------F----T--D-SG----------------M----YWA-PQ----Q

PF05223

Q8Y9T2_LISMO/44-163-------TFTS-N---IA-K------------------------E-KY-------D--------K----L-G-GS----V
Q97D06_CLOAB/26-144-------KYIN-A---WN-K------------------------N-DY-------K--------T----M-Y-SI----L
Q8NP18_CORGL/32-140-------EFLQ-A---WA-S------------------------Q-DF-------D--------T----I-A-DI----T
Q9F2L0_STRCO/54-166-------AFLA-D---WA-A------------------------G-RL-------P--------S----A-A-AR----T
Q9K7H2_BACHD/27-156-------TFAD-H---WK-N------------------------E-DY-------G--------Q----M-Y-HM----L
PBPC_BACSU/26-148-------AFVK-Q---WN-D------------------------Q-QF-------D--------D----M-Y-QS----L
Q9CBU6_MYCLE/35-143-------KFFD-A---LA-I------------------------G-DT-------A--------T----A-A-QL----S
B5GLC4_STRC2/58-167-------TFLG-A---WE-K------------------------G-DA-------P--------T----A-A-GL----T
H7C6V7_ENTFA/46-164-------TFLN-V---LS-K------------------------Q-EF-------D--------K----L-P-SV----V
I6TCQ1_ENTHA/44-162-------QFAE-R---LS-T------------------------G-DY-------K--------K----A-M-SY----T
Q3XZN6_ENTFC/44-162-------QFVQ-A---LN-K------------------------G-DY-------N--------K----A-A-EM----T
Q81E03_BACCR/24-142-------TYVK-A---WN-K------------------------Q-KF-------A--------D----M-Y-DQ----L
X1XHQ7_ACYPI/24-139-------DTLD-A---IE-D------------------------K-NV-------K--------Q----V-F-KN----S

PF02982

SCYD_ASPFU/9-168-------KVLF-D---WA-D---------S------Y----D--AKDW-------D--------R----L-R-SI----I
SCYD_MAGO7/10-169-------TCVY-E---WA-D---------S------Y----D--SKDW-------D--------R----L-R-KV----I
SCYD_COLOR/7-166-------AALF-E---WA-D---------S------Y----D--SKDW-------D--------R----L-R-KC----I

PF12707

Q46H33_PROMT/23-149-------ALIQ-S---FA-D-R-------S------Q----N--K-TF----------------L----L-A-NT----T
Q46KI2_PROMT/2-129-------SILE-A---FA-S-T-------E------R----M--G-SF----------------F----L-D-NA----T

PF12883

D9QJI7_BRESC/62-179-------ALYA-Q---YVAG---------G------P----K--G-E............QPAP-G....Q-E-PL----Y
H2IPN3_RAHAC/22-145-------EFYG-F---YL..---------T------T----F--A-G......DTPPPKYDSA-V....M-K-KY----I
I0K6B0_9BACT/55-189-------DFTD-D---NGPH---------L------T----L--N-QEKLERYLARFAASNFV-.....S-R-EF----I
B8HJZ2_CYAP4/26-146-------GFYQ-W---YVSN---------Q------D----R--L-R............QKLS-Q....Q-K-DL----F
A8AER7_CITK8/22-144-------DFYT-Y---YL..---------N------V----F--A-N......SEGKIKPAPE-K....M-D-EY----I
A8ADQ6_CITK8/22-144-------QFYL-S---WM..---------K------T----F--T-E......DQDTPHDKSA-L....M-Q-RY----V
A7MF41_CROS8/40-159-------QFYQ-H---RIEQ---------R------S----Q--G-L............TNLT-S....L-R-PY----L
A7MM23_CROS8/24-142-------SLYQ-S---YA..---------K------G----N--.-.........EPVDFASK-G....E-Q-QI----L
H2J156_RAHAC/32-164-------SFYT-Q---YM..---------Q------L----Y--F-K.........IVPPEAP-AFKKLM-Q-NN----I
YBJP_ECOLI/41-154-------QFYD-Y---RI..---------L------H----R--S-.............NDIT-A....L-R-PY----L
YQHG_ECOLI/25-143-------HIYQ-N---YK..---------S------D----A--T-A..........PYFGET-G....E-R-AI----T
Q8ZNB4_SALTY/23-142-------QFYT-S---WM..---------T------T----F--T-N......DVNTPDDTTA-L....M-Q-RY----V

PF13026

A4AWI0_MARSH/19-104-------KFQS-----KYNA------------------------S-NY-------E--------D----V.H-NM----L
A6LM34_THEM4/24-113-------DYLN-----ALIT------------------------E-NY-------Q--------K----A.L-EL----S
A8F7I3_THELT/24-115-------QFIT-----LLSS------------------------N-DF-------E--------N----A.Q-KM----V
A9KL18_CLOPH/74-163-------KLTH-----DLLT------------------------E-NF-------E--------E----V.Y-SY----L
B1I2Q6_DESAP/43-137-------NILQ-----AFND------------------------D-DY-------D--------R----F.F-KD----F
B8E211_DICTD/27-115-------KFIY-----LLVS------------------------G-RY-------E--------E----A.R-DF----F
C3AGG3_BACMY/39-163-------QKED-----MRVY------------------------R-DV-------H--------N----KYD-EK----M
C8WGP2_EGGLE/123-216-------KVAE-----VVGE------------------------G-DY-------D--------K----L.R-PM----L
D4JFI6_9FIRM/118-209-------EVIE-----YASN------------------------D-DY-------E--------A----I.A-NI----G
D6E741_9ACTN/49-139-------EVID-----LVNA------------------------R-DF-------D--------E----V.A-AR----W
D6E742_9ACTN/53-143-------DAID-----LFVA------------------------R-DY-------D--------G----L.A-AL----F
D7AW34_NOCDD/95-184-------SVIE-----DLAS------------------------G-RW-------S--------R----V.T-ER----F
E3GDE8_EUBLK/46-135-------KVID-----EWNS------------------------Q-EF-------D--------A----I.A-AE----V
E3GFD2_EUBLK/40-131-------SLVQ-----VLAE------------------------G-DY-------A--------K----A.A-DD----F
E6TQB5_BACCJ/33-124-------TIIG-----LMVN------------------------G-DL-------E--------E----V.V-HD----F
E6TQB6_BACCJ/58-147-------EYIS-----HLSQ------------------------G-DF-------E--------I----A.Y-DF----F
E6TY43_BACCJ/31-120-------EYLE-----QLKA------------------------E-NF-------D--------E----A.S-AM----F
F0S9L8_PEDSD/29-118-------QFFE-----TLNE------------------------N-KF-------K--------E----A.Q-LF----F
F4CEB4_SPHS2/28-116-------KFIS-----LMVD------------------------S-NY-------K--------E----A.L-DL----T
F6D290_METSW/13-102-------NFVD-----QFLQ------------------------A-DF-------A--------A----A.S-SR----F
F6GEE1_LACS5/30-117-------EFQE-----NYNQ------------------------Q-DY-------K--------A----I.Y-NM----L
G2MPX0_9ARCH/64-153-------DFLE-----ALIA------------------------E-SF-------D--------E----A.Y-DY----A
G8LXF0_CLOCD/44-138-------NVIS-----LINA------------------------R-DS-------E--------G----I.K-AL----C
H1XTG9_9BACT/36-125-------QFID-----LLEQ------------------------A-QF-------D--------S----A.V-GY----M
H1ZC72_MYROD/29-115-------IFME-----DYNT------------------------S-NY-------D--------K----F.Y-HR----F
Q73JX5_TREDE/37-132-------EIIF-----MIND------------------------K-DW-------E--------G----I.R-NL----S
Q8EMU8_OCEIH/26-113-------ELID-----NLIA------------------------G-NF-------E--------D----V.R-DS----Y
D4M3N3_9FIRM/40-132-------EYFN-----QMMD------------------------G-DF-------E--------T----F.F-NA----L
Q81P15_BACAN/37-125-------EIVS-----LLNE------------------------A-KY-------K--------E----V.H-EK----F
Q9WYH1_THEMA/26-112-------.FVQ-----HLTS------------------------E-NF-------E--------S----A.L-NM----C
R5HS05_9FIRM/71-164-------KIIG-----LLNA------------------------E-DF-------D--------S----L.Q-SL----V
R5QXD2_9FIRM/39-142-------FIVQ-----NFSM------------------------M-G.-------E--------A----D.F-QN----F
R5TTD3_9FIRM/55-147-------EDIE-----IAQS------------------------K-DY-------E--------S----W.K-SR----F
R5W2J2_9BACE/28-117-------QILQ-----WMKN------------------------A-QS-------D--------S----I.Y-AC----F
R6ELK1_9FIRM/40-141-------AIIM-----NFSN------------------------M-D.-------D--------E----A.M-DT----F
R6EMC8_9FIRM/45-140-------CVVG-----WFNE------------------------Q-EY-------G--------K----I.I-EA----G
R6F505_9FIRM/119-211-------LIIQ-----YLDE------------------------E-NY-------Q--------E----I.K-KL----S
R6LVU3_9FIRM/39-143-------AVFD-----IIES------------------------G-SI-------T--------S----D.Q-IT----E
R6PF09_9FIRM/42-138-------DIVT-----QVNE------------------------G-NV-------E--------S----VYN-DI----F
R6UW08_9FIRM/46-137-------QFVK-----DLTQ------------------------R-KY-------D--------K----L.Q-KD----Y
W0EZS0_9SPHI/30-115-------KVEK-----FYNA------------------------A-QF-------D--------S----I.F-AM----F

PF16156

G2KS29_MICAA/81-180-------MRNVTQCAAIMTR--------------------------DF-------R--------E----N..-.L----A
F2IZS6_POLGS/37-137-------RIVQDQMAAFRRN--------------------------DA-------A--------G----A.Y-AL----A
Q1GEC2_RUEST/29-128-------GVIGAQIEAFQAN--------------------------DM-------G--------T----A.F-GF----A
A8LR20_DINSH/25-124-------AVIGAQLEAFKAD--------------------------DF-------A--------Q----A.F-SY----A
Q5LW85_RUEPO/25-124-------AVIGNQIEAFLAD--------------------------DF-------A--------T----A.F-TF----A
Q28L79_JANSC/39-138-------AVIGNQFDAFREG--------------------------AL-------L--------D----A.W-QY----A
Q7NLT4_GLOVI/45-142-------AVIQSQLAAFRKG--------------------------DY-------A--------K----A.Y-TF----A
Q6MA17_PARUW/75-172-------DVIDKQLEALRNN--------------------------EI-------S--------K----AYY-EY----T
B2J495_NOSP7/11-111-------SLIENQLAAFKKD--------------------------DA-------Q--------G----A.F-AF----A
Q8YXC7_NOSS1/11-111-------SVIESQLAAFQQD--------------------------DA-------P--------S----A.F-AC----A
D7BFD2_MEISD/33-133-------AVIEAQLAAFQQD--------------------------DA-------V--------R----A.F-SF----A
A1VLU3_POLNA/45-145-------AVVEGQLAALARD--------------------------DA-------R--------A----A.F-SF----A
F5Y526_RAMTT/37-137-------QVIVTQLDALSQD--------------------------DA-------D--------R----A.F-AT----T
B1M6C1_METRJ/27-128-------AVIAKQAQALGRD--------------------------DA-------Q--------T----A.Y-EQ----A
B9JFB3_AGRRK/27-129-------TLIQGQIEAFLQN--------------------------DA-------A--------T----A.Y-SF----A
C3MD33_RHISN/28-126-------SVIRAQIKAFLDD--------------------------DP-------E--------T----A.Y-SF----A
E4PHZ6_MARAH/39-138-------DTILRQIEAFANN--------------------------DE-------E--------Q----A.W-AH----A
K9VG60_9CYAN/11-111-------SVVEQQLQAFQKD--------------------------DA-------A--------G----A.F-AF----A
Q16AU9_ROSDO/25-124-------DVIDSQLSAFQQD--------------------------DF-------A--------Q----A.M-EY----A
Q98M58_RHILO/71-171-------AVIDGQLKALLAD--------------------------DG-------A--------K----A.Y-SF----A

PF07961

YD3B_SCHPO/40-266-------KLHS-----G-VNKA-L-----A------N----H----DL...........QQ-L-E--------EL----C
Q6BRJ5_DEBHA/41-283-------EQLV-----K-TNKI-F-----A------A----S----CSISNAKREKYLKSQ-L-E--------GV----T
Q74ZJ7_ASHGO/28-263-------ETYV-----E-VNRA-F-----A------R----R----DL...........EA-A-Q--------PL----V
Q6CM11_KLULA/30-266-------ETYV-----Q-VNEA-F-----A------K----R----EL...........DT-I-K--------PQ----V
Q6FJG9_CANGA/40-276-------ETYV-----Q-VNAN-F-----A------S----K----SV...........EK-L-K--------PE----V
Q6CE08_YARLI/32-266-------LNYI-----A-VNKA-F-----A------A----R----EL...........ES-V-D--------DK----M
MBA1_YEAST/42-278-------ETYI-----N-VNTS-F-----A------H----K----NL...........SD-I-K--------GL----V

PF04280

Q29AN0_DROPS/288-437-------TDII-----PNVLEA-I-----V------R----G----DL-----------EI-L-K--------DW----C
TI441_ARATH/315-467-------EVIK-----P.VLNA-Y-----S------E----G----DV-----------ET-L-K--------KY----C
Q74E73_GEOSL/170-314-------DVFF-----R.VQGA-W-----T------R----R----DL-----------SS-A-R--------EV----L
Q4WTB9_ASPFU/363-517-------EYIL-----PEVLDA-Y-----V------K----G----DI-----------ET-L-K--------LW----L
A7HSI5_PARL1/99-245-------MAYE-----M.IVTA-F-----A------A----G----DR-----------AT-L-K--------PL----L
Q2LX56_SYNAS/191-336-------DHFF-----Q.IQGA-W-----A------G----R----DM-----------SG-V-R--------NL----L
A1AM45_PELPD/168-313-------DTFF-----K.IQGA-W-----M------N----R----DL-----------AP-V-S--------TL----L
A5G6N4_GEOUR/172-317-------DIFF-----K.IQGA-W-----M------N----R----DL-----------SS-V-S--------GL----L
Q92K63_RHIME/130-273-------AMLR-----D.VQAA-Y-----G------A----E----DY-----------AA-L-R--------RL----T
Q6BV22_DEBHA/267-421-------NYIV-----PELLDS-Y-----I------K----N----DE-----------KV-L-K--------HW----F
Q2N800_ERYLH/68-214-------GAYG-----M.VLEA-Y-----W------K----G----DK-----------ET-L-R--------EL----C
Q6C8B1_YARLI/257-411-------EYII-----PEVLEA-W-----V------T----G----DG-----------ET-L-K--------MW----L
RM45_XENTR/118-265-------ELFI-----A.AHQC-L-----T------K----F----DR-----------HE-L-H--------TL----V
Q29BD6_DROPS/140-288-------EIYV-----A.AHTL-M-----A------A----K----EK-----------YK-I-R--------EY----V
RM45_BOVIN/118-266-------DIFI-----E.AHLC-L-----N------N----S----DH-----------DR-L-H--------TL----V
Q4XQ84_PLACH/208-360-------FVIS-----KHIVES-Y-----L------I----G----DE-----------ET-L-R--------LH----C
Q89I32_BRADU/189-331-------RLLG-----D.VQTA-W-----S------N----E----DV-----------AK-L-H--------TL----A
Q2YAC8_NITMU/160-293-------TSFI-----R.LQAA-N-----D------A----R----DL-----------ND-I-R--------EY----T
E0TF66_PARBH/73-216-------AAYE-----M.IIEA-F-----A------N----G----RL-----------DD-V-R--------AY----V
Q69V11_ORYSJ/315-468-------EMIK-----P.VLTA-Y-----S------K----G----DV-----------KT-L-K--------KY----C
Q8GXP7_ARATH/157-312-------ELYK-----Q.INIQ-M-----A------N----G----EK-----------KT-I-R--------KN----V
Q3SWG6_NITWN/86-232-------SAYE-----M.IVLA-F-----A------N----G----DR-----------RT-L-K--------DL----L
A8XG07_CAEBR/268-418-------TKII-----PNILEA-F-----I------R----F----DL-----------EV-L-Q--------SW----C
Q3IYG4_RHOS4/71-219-------GAYE-----M.IVMA-F-----E------K----G----EL-----------EQ-I-R--------PF----L
A1VKC3_POLNA/193-328-------ANFV-----T.LQDA-W-----D------R----S----DI-----------QN-L-R--------SM----M
Q0AKD2_MARMM/59-205-------NAYV-----M.IVEA-F-----A------A----G----DR-----------KV-L-E--------PL----L
Q1GRJ5_SPHAL/74-220-------AAYR-----M.ILEA-F-----W------K----G----DR-----------ET-L-R--------DL----C
Q4N770_THEPA/227-378-------HVIA-----PHVVES-Y-----L------K----G----DG-----------EA-L-K--------LH----C
Q39UB8_GEOMG/177-321-------DIFF-----R.VQGA-W-----T------R----R----DL-----------SP-V-A--------DL----L
TIM44_HUMAN/296-445-------NDII-----PNVLEA-M-----I------S----G----EL-----------DI-L-K--------DW----C
Q7Q8M7_ANOGA/261-411-------RHVI-----PNVLES-I-----L------R----G----EL-----------DV-L-R--------DW----C
B5EIY6_GEOBB/173-317-------DNFF-----K.IQGG-W-----M------N----R----DL-----------AV-L-A--------PL----V
Q11CL9_CHESB/87-233-------LAYE-----M.IVMA-F-----A------D----G----DR-----------RT-L-K--------NL----L
Q2KE94_RHIEC/85-231-------MAYE-----M.VVMA-Y-----A------D----G----DR-----------KT-L-K--------SL----L
C5AZH9_METEA/91-237-------GAYE-----T.IVTA-F-----A------K----G----DR-----------KT-L-R--------AL----L
Q5NM00_ZYMMO/68-215-------SAYG-----K.ILEA-F-----W------Q----N----DR-----------SK-L-A--------DM----V
TI442_ARATH/310-462-------EAIR-----P.VLNA-Y-----S------K----G----DA-----------KT-L-K--------KY----C
Q218U8_RHOPB/188-330-------KLLS-----E.IQTT-W-----S------N----G----DV-----------GH-L-H--------TL----A
Q9A225_CAUCR/90-231-------AAYE-----Q.IVKA-Y-----A------E----G----DR-----------ET-L-T--------PL----L
Q0C6A2_HYPNA/70-202-------AAYQ-----L.IVGA-Y-----A------R----G----DR-----------NA-L-R--------PL----L
Q0BPM0_GRABC/85-230-------QAFR-----V.IVTA-Y-----A------Q----G----ER-----------EA-L-R--------PL----L
B0T6F5_CAUSK/55-196-------QAYE-----M.IVKA-F-----A------A----G----DR-----------ET-L-K--------PL----L
Q7D2D0_AGRT5/69-215-------MAYE-----M.IVMG-F-----A------D----G----DR-----------KT-L-K--------NL----L
A9BP44_DELAS/201-336-------RNFV-----T.LQSA-W-----D------R----S----DI-----------AS-L-R--------AM----M
Q73IP9_WOLPM/62-205-------IAFE-----L.IIKC-F-----N------Q----G----NL-----------SQ-L-K--------PL----L
Q7CT45_AGRT5/71-213-------KMLQ-----D.VQSA-Y-----G------A----E----DY-----------GT-L-R--------KL----T
Q5KEX5_CRYNJ/294-447-------EYIV-----PEVVDA-Y-----L------S----A----DR-----------ES-L-K--------AW----C
Q5LLN6_RUEPO/70-218-------GAYE-----M.IVMG-F-----E------R----G----NL-----------DE-I-E--------PF----L
Q21YX7_ALBFT/181-316-------ANFV-----S.LQAA-W-----D------K----S----DI-----------NA-L-R--------VM----M
Q4P5L9_USTMA/407-560-------EYVV-----PELIDA-Y-----H------G----A----AR-----------HL-L-R--------QW----C
Q2RN93_RHORT/70-216-------AAFE-----M.ILMA-Y-----A------K----G----DK-----------AV-L-K--------PL----L
Q92TE6_RHIME/85-231-------MAYE-----M.IVMA-F-----A------D----G----DR-----------KT-L-K--------GL----L
A0CBB5_PARTE/242-397-------VIFE-----Q.IYNL-Y-----L------L----G----DL-----------ES-L-Q--------KV----C
TIM44_SCHPO/266-420-------EYIV-----PEVTEA-Y-----V------K----G----DK-----------EV-L-K--------TW----L
A7IGZ9_XANP2/102-248-------AAYE-----M.IVTA-F-----A------A----G----DR-----------RA-L-K--------DL----L
Q6G538_BARHE/82-228-------VAYE-----M.IVTA-F-----A------K----G----DR-----------NQ-L-R--------RL----L
Q82S83_NITEU/166-298-------RSFI-----A.LQLA-H-----D------A----G----DL-----------EE-I-R--------AY----T
A5FUT4_ACICJ/75-220-------ASFR-----R.IVLA-F-----A------A----G----DL-----------AA-L-R--------PL----L
Q16CY5_ROSDO/72-220-------GAYE-----M.IVMG-Y-----E------N----G----EL-----------AD-I-Q--------PF----L
A0LJ73_SYNFM/187-332-------DLFF-----R.IQAG-W-----M------N----R----SL-----------DG-I-E--------GL----L
Q16KX3_AEDAE/277-426-------NDII-----PNILEA-M-----I------R----G----DL-----------EV-L-K--------DW----C
A5VD09_SPHWW/78-224-------SAYR-----M.ILEA-Y-----W------R----G----DE-----------EA-L-R--------RL----T
Q1GCM9_RUEST/70-218-------GAYE-----M.ILMG-F-----E------T----G----EL-----------DG-I-Q--------PF----I
Q75AP0_ASHGO/257-411-------EYII-----PEVLEA-Y-----V------K----G----DE-----------QV-L-K--------QW----F
A0L4W4_MAGSM/183-329-------RCFE-----M.LQTS-W-----S------T----F----DM-----------TT-L-Q--------GL----L
Q28W04_JANSC/87-235-------QAYE-----M.ILMA-F-----E------R----G----DV-----------DG-L-R--------PF----L
Q2VYH8_MAGSA/132-278-------AAFE-----M.IVIA-F-----A------H----G----DK-----------AT-L-Q--------PL----L
Q7QC22_ANOGA/140-288-------DIYI-----E.AHKT-L-----C------E----K----NK-----------YK-L-R--------EI----V
B0UJF2_METS4/90-236-------IAYE-----T.IVMA-F-----A------K----G----DR-----------RT-L-K--------SL----L
Q986Y4_RHILO/184-327-------QLLT-----D.IQEA-F-----G------R----E----DH-----------AA-L-R--------RA----T
A7ARK8_BABBO/236-388-------HVVA-----PHIVQC-Y-----L------D----G----DS-----------KS-L-E--------AH----C
Q2GAU2_NOVAD/100-246-------GAYG-----M.ILEA-F-----W------R----G----DK-----------EE-L-A--------QL----C
B9KHK8_ANAMF/74-217-------AAFE-----A.IVKA-L-----S------Q----G----NA-----------EF-L-S--------SL----L
D5AKF4_RHOCB/72-217-------VAYE-----M.ILMA-F-----E------R----G----DL-----------SA-V-R--------RF----L
E4WZD3_OIKDI/234-385-------SEMI-----PIILEA-K-----A------I----N----DV-----------AV-I-E--------DW----C
E7F889_DANRE/126-271-------QIFI-----D.AHAA-L-----T------E----F----NK-----------EK-L-H--------SL----V
E7QG67_YEASZ/271-422-------EYIV-----PEILEA-Y-----V------K----G----DV-----------KV-L-K--------KW----F
Q2YQZ9_BRUA2/88-232-------IAYE-----M.IVMS-F-----A------D----G----DR-----------EV-L-K--------NL----L
V6F5J3_9PROT/82-226-------MAFE-----M.IVGA-F-----A------A----G----DK-----------KA-L-R--------PL----L

PF07366

F6EAE0_SINMK/6-127-------RAY------L----D-CL....N------R----Q----A---W....D----E-L-G--------HF----V
C2T9T5_BACCE/57-169-------DFY------N----E-VF....N------K----H----N---I....D----I-I-P--------KY----V
Q82GA1_STRAW/11-139-------RFH------S----A-V.....N------S----G----D---LDIISK----A-I-D--------EF----V
E2MBY8_PSEUB/4-125-------RAY------I----A-CL....N------D----R----S---W....H----Q-L-G--------NF----V
Q7P1G6_CHRVO/10-136-------RFN------R----E-VI....E------N----G----D---M....A----A-F-A--------EL----V
Q7NU92_CHRVO/45-170-------LRY------A----A-FW....N------T----G----D---P....R----Y-A-E--------LA----L
Q98IW1_RHILO/4-125-------RGY------I----D-CL....N------N----Q----D---W....Q----R-L-H--------RF----V
Q8TQG8_METAC/22-156-------TTL------D----D-AW....N------S----Q----D---W....D----T-F-E--------KR----H
Q8E9W0_SHEON/78-203-------LLY------A----S-FW....D------T----G----D---P....R----F-A-H--------WA----L
Q7CRD4_AGRT5/5-126-------LAY------L----D-SL....N------H----Q----A---F....D----E-L-G--------TF----V
Q82DI4_STRAW/115-241-------RFL------L----E-VA....T------E----G----E---L....P----P-L-N--------DV----M
Q7NP31_GLOVI/43-169-------KFY------E----E-VF....N------R----R----N---L....A----L-A-D--------EL----V
O30617_MYXXA/36-152-------QLT------E----E-LY....N------L----R----M---L....D----R-I-P--------EF----I
Q8YNM4_NOSS1/8-132-------QAY------E----A-F.....D------L----G----D---I....E----K-G-K--------TF----V
Q8YQT8_NOSS1/6-132-------LQW------A----N-LW....S------S----G----N---V....E----S-F-L--------SL----F
A0A038IJI4_BORBO/18-131-------EML------A----T-LA....D------E----.----.---.....N----P-V-R--------DE----V
Q8GPW3_PSEAI/8-133-------QFY------D----A-I.....N------A----A----K---F....D----A-L-Y--------DL----C
Q6LKM5_PHOPR/2-132-------TKY------E----Q-IWVDGLN------R----G----D---V....S----G-A-D--------EA----F
Q7NYY8_CHRVO/8-137-------GFL------D----E-VR....S------G----R----D---P....D----A-A-G--------RY----L
Q63FG7_BACCZ/60-176-------QRF------Y----A-FW....D------T----G----K---E....E----L-L-S--------QT----V
Q9RN64_STRNO/8-132-------EM.------V----A-AW....N------R----W----D---V....S----G-V-V--------AH----W
Q8KY43_STRCU/149-275-------GAY------R----D-VF....S------E----H----R---L....E----L-A-E--------RY----Y
DNRD_STRPE/5-133-------RRM------V----E-AY....N------T----G----K---T....D----D-V-A--------EF----I
A0A030SG61_PSEAI/7-128-------RAY------I----D-CL....N------R----Q----D---W....A----R-L-G--------DF----V
DNRD_STRGJ/5-132-------RRM------V----E-AY....N------T----G----K---T....D----D-V-A--------DY----I
Q98JP4_RHILO/22-156-------RWF------T----D-FW...GE------T----C----D---L....S----V-V-D--------DI----A
Q7NGE5_GLOVI/21-149-------RFA------Q----E-GWG..TN------P----G----W---E....K----I-W-D--------EL----I
A3NUH9_BURP0/56-181-------RRY------D----T-FW....H------N----G----D---P....A----L-A-R--------AA----L
Q82M76_STRAW/10-135-------TAY------Q----R-L.....Q------S----G----D---L....D----A-C-V--------EL----L

PF12680

B5I6W1_9ACTO/1-115-------RLT.-----E....A.V.----T......H----P...-D...L....K....V.I.A........DL....Y
B5HJN5_STRPR/117-228-------RFF.-----H...EI.A.----A......G----G...-N...L....N....A.I.D........EV....F
B5H8J2_STRPR/32-138-------RGY.-----T....A.F.----A......A----G...-D...M....N....T.L.S........EL....I
C5CZF1_VARPS/22-124-------RFM.-----A....A.F.----R......H----K...-D...A....A....A.I.R........EL....V
C5CZF1_VARPS/148-250-------RFN.-----E....V.F.----Q......R----H...-D...P....T....A.L.P........EL....I
B2J517_NOSP7/10-126-------RYFY-----E....V.F.----N......E----G...-N...I....T....T.L.E........EI....C
B2J517_NOSP7/165-276-------RYF.-----D...EV.M.----N......Q----G...-K...L....E....A.I.D........EI....M
B5HLE5_9ACTO/167-263-------AFD.-----Q....L.I.----V......K----K...-D...L....S....A.L.D........RY....W
D3ECJ4_GEOS4/142-239-------SYV.-----E....NIL.----L......G----K...-N...P....D....L.L.A........SY....F
Q5LLC2_RUEPO/32-126-------GLL.-----E...QG.L.----A......K----G...-D...R....D....F.I.M........TH....V
Q5LLC2_RUEPO/163-259-------GLVK-----D....V.L.----M......G----G...-K...I....D....R.I.D........DY....I
C1D3J7_DEIDV/182-279-------RFV.-----D...DI.L.----V......H----G...-R...M....D....K.L.T........AY....F
D2SCU4_GEOOG/6-119-------AYL.-----D....A.W.----N......A----H...-D...S....A....A.V.T........SF....W
B5HLM0_9ACTO/9-102-------AAG.-----E....L.F.----G......Q----K...-D...P....S....A.V.D........RW....V
B5HLM0_9ACTO/139-235-------EFA.-----Q...KV.L.----V......G----A...-D...Y....S....V.L.T........DY....I
A5V525_SPHWW/7-105-------AFI.-----E....A.W.----N......R----L...-D...E....D....R.I.Y........GL....M
B9L3S7_THERP/14-118-------AVL.-----A....A.L.----N......R----G...-D...L....E....T.A.L........GY....C
B4RFR1_PHEZH/28-128-------DFI.-----E....A.W.----S......R----L...-D...P....E....E.L.A........GF....F
A7HS76_PARL1/16-117-------DFL.-----G....A.W.----Q......K----R...-D...I....P....G.I.M........DC....F
A6X4Q6_OCHA4/11-117-------DLF.-----D....A.F.----N......R----H...-D...I....D....A.I.M........AF....F
C7PVH3_CATAD/11-120-------RYV.-----E....A.V.----R......D----G...-D...T....E....T.I.V........AS....F
B0C0J0_ACAM1/35-144-------SVA.-----T....L.A.----D......R----G...-E...F....S....A.L.E........HL....Y
B0C0J0_ACAM1/185-295-------NFL.-----T....A.L.----E......E----K...-D...M....E....K.F.A........SV....W
Q1D9P4_MYXXD/10-115-------AWL.-----D....A.F.----N......A----Y...-D...V....D....A.L.V........AL....Y
A5VCT4_SPHWW/11-120-------RFF.-----D....A.F.----N......A----G...-D...I....A....A.A.F........AT....L
C7Q8T1_CATAD/8-117-------RYF.-----T....A.L.----A......E----G...-D...Q....Q....T.I.R........DC....W
B0T3P4_CAUSK/9-118-------RGY.-----D....C.F.----V......K----G...-D...L....D....G.L.F........ST....M
C5CRN6_VARPS/10-123-------DAW.-----K....A.F.----A......S----R...-D...P....Q....R.I.A........SW....F
B7KBU4_CYAP7/7-120-------KFF.-----D....A.L.----N......A----H...-D...L....D....T.V.V........SM....I
C4ZJ89_THASP/28-128-------RFY.-----E....T.F.----T......P----A...-A...L....P....G.L.D........QL....Y
A5VDX7_SPHWW/10-121-------RVI.-----G....A.W.----E......T----R...-D...S....Q....A.F.F........EL....F
D2B1F4_STRRD/9-111-------RYV.-----E....A.L.----N......R----H...-D...P....G....E.I.A........AC....V
B8ES54_METSB/10-116-------DFF.-----A....A.I.----G......R----G...-D...R....E....A.L.L........AL....V
Q0S9H2_RHOSR/9-118-------RFY.-----E....E.M.----N......N----D...-R...K...NE....I.A.E........EL....F
B9LPI7_HALLT/13-109-------AYY.-----D....A.L.----D......T----G...-D...Y....D....R.L.A........TL....L
C7Q9Y2_CATAD/16-124-------AFF.-----R....L.L.----S......A----K...-D...I....A....A.W.A........DL....W
A5VBH5_SPHWW/11-110-------SYV.-----E....A.F.----D......K----G...-D...P....E....M.V.V........AL....F
B1MD21_MYCA9/14-115-------GFW.-----D....A.M.----R......R----S...-D...L....A....A.L.D........AL....L
Q82GA1_STRAW/13-126-------RFH.-----S....A.V.----N......S----G...-D...L....DIISKA.I.D........EF....V
D1CA95_SPHTD/7-116-------QYF.-----D....A.W.----N......R----R...-D...P....D....A.I.M........AT....F
Q88PF6_PSEPK/7-118-------AYY.-----A....A.F.----N......A----G...-D...M....P....A.F.L........AL....L
Q5QV19_IDILO/10-113-------EFY.-----D....E.L.----K......T----E...-N...L....D....D.L.D........EL....Y
C5BYA4_BEUC1/11-106-------RLW.-----A....R.M.----S......A----R...-D...W....T....G.L.G........EL....I
A5VCU3_SPHWW/39-148-------ELY.-----E....A.F.----E......R----G...-D...M....A....A.L.E........RL....I
E4NSQ6_HALBP/19-128-------RYH.-----E......I.----T......E----G...-G...L....A....A.A.D........EV....L
Q7NE84_GLOVI/10-111-------QAR.-----Q....A.W.----L......A----A...-D...G....E....A.F.A........NL....F
Q5Z059_NOCFA/9-111-------RYV.-----E....L.V.----G......S----G...-P...T....Q....G.I.V........DL....Y
A8LIY8_DINSH/16-139-------ALN.-----A....A.L.----EGA..MAA----D...-K...A....A....A.L.A........DH....V
A8LIY8_DINSH/193-315-------RMV.-----AD.LSA.L.----NRS.GNDR----A...-G...I....E....M.L.R........AS....W
A5VFS9_SPHWW/9-116-------AFF.-----A....A.F.----G......A----G...-D...V....P....G.A.M........AL....L
B5HJE1_STRPR/10-115-------RAL.-----E....A.F.----S......A----G...-D...M....E....A.L.A........EV....F
B5HVP3_9ACTO/16-111-------RFW.-----A....L.A.----E......A----R...-D...W....T....A.F.A........DT....L
D2Q2I7_KRIFD/11-105-------KYF.-----D....T.L.----N......G----R...-A...W....E....E.F.A........AL....L
Q1R0D2_CHRSD/10-113-------RVF.-----E....K.L.----D......K----R...-C...T....R....S.L.E........NL....Y
D0L730_GORB4/10-111-------AYL.-----D....A.L.----A......R----D...-D...I....D....A.A.M........AN....L
Q0BQA1_GRABC/9-124-------AYY.-----E....A.F.----N......A----G...-D...E....A....A.F.L........AL....L
Q31QW3_SYNE7/11-117-------NYV.-----E....A.F.----N......R----G...-D...L....A....A.L.K........AL....L
Q0RE76_FRAAA/8-122-------RAL.-----D....A.F.----D......A----G...-D...E....A....A.V.H........AL....L
A2SCA2_METPP/13-116-------ARF.-----E....H.L.----T......R----A...-D...L....P....R.L.G........EI....Y
C5CK59_VARPS/9-108-------TAN.-----A....A.I.----M......D----G...-D...F....E....G.F.L........KF....C
D2B0D7_STRRD/15-117-------TFY.-----D....A.F.----G......R----R...-D...A....D....A.M.E........RC....Y
A1VLA0_POLNA/8-116-------QAY.-----E....A.F.----G......R----G...-D...V....P....A.M.L........NL....V
Q1CVT2_MYXXD/62-168-------RFV.-----D....A.L.----AKL..EKE----G...-D...L....E....A.L.V........SL....F
Q9EWM1_STRCO/9-118-------RMI.-----D....L.L.----L......A----K...-D...M....N....A.V.A........DL....W
D2BAU3_STRRD/10-116-------DSY.-----D....A.L.----A......K----G...-D...L....D....H.V.R.......DNL....L
B0C619_ACAM1/7-113-------EYS.-----D....A.W.----N......E----H...-D...I....D....K.I.M........KF....M
D7AYQ5_NOCDD/12-122-------KFV.-----E....R.L.----G......R----Q...-D...P....D....G.I.Q........EL....F
A1SCF9_NOCSJ/9-115-------RYY.-----D....L.V.----N......A----G...-S...P....E....R.F.D........EV....C
D5UVL3_TSUPD/13-113-------RFV.-----E....A.L.----G......S----G...-D...F....E....I.A.E........QL....L
D3QAD1_STANL/13-107-------AYY.-----E....A.W.----S......G----G...-D...F....D....K.A.M........TH....L
D3STL0_NATMM/24-125-------DYY.-----D....T.V.----D......D----E...-R...Y....D....D.L.V........EL....F
A9CHA2_AGRT5/13-121-------HYL.-----E....T.F.----F......K----K...-D...V....E....K.T.L........QC....L
B5HLL8_9ACTO/11-108-------AFY.-----D...LM.F.----N......Q----C...-R...P....A....E.A.I........HQ....Y
C6VS31_DYAFD/7-118-------QYY.-----E....A.F.----N......A----K...-N...W....K....G.M.L........AL....L
Q01YM1_SOLUE/9-121-------RWF.-----E...EV.W.----N......Q----G...-R...E....A....A.V.D........EL....F
Q7NU42_CHRVO/10-117-------ATY.-----E....G.K.----S......E----D...-N...G....R....N.L.L........AA....L
Q0S852_RHOSR/10-121-------RFY.-----T....E.I.----D......A----G...-N...I....D....A.L.D........EL....V
Q0SDB9_RHOSR/13-126-------RFF.-----A....S.V.----D......A----H...-D...F....D....R.V.E........SM....L
A8I8X5_CHLRE/91-196-------RYY.-----E....A.Y.----N......A----G...-D...I....D....T.I.A........GL....L
Q89WH5_BRADU/12-118-------AFC.-----D....A.V.----E......Q----R...-N...G....R....A.F.A........DL....F
Q7NFQ8_GLOVI/11-120-------RFY.-----E...EA.Y.----N......Q----K...-R...E....A....V.L.D........EI....I
A4FI35_SACEN/11-114-------AYC.-----E....R.V.----T......A----G...-D...V....E....G.I.L........EL....F
Q1IJ26_KORVE/10-115-------QWA.-----A....A.W.----N......R----R...-D...V....E....A.V.L........AH....F
A5V9B3_SPHWW/11-114-------RFW.-----D....A.I.----G......S----G...-D...V....D....A.Y.L........AT....F
Q7NT36_CHRVO/13-113-------DWY.-----Q....T.L.----T......P----D...-T...L....P....D.I.G........RY....Y
C1A2X0_RHOE4/8-108-------AMF.-----A....A.L.----T......D----F...-D...V....D....A.A.A........EL....M
B5HZI5_9ACTO/16-126-------RFV.-----E....F.I.----N......T----G...-N...E....D....L.A.R........EV....I
Q89DK6_BRADU/65-174-------HLL.-----D....A.F.----A......R----G...-D...I....E....A.A.L........SC....C
B0C5C3_ACAM1/11-121-------RFF.-----K....A.L.----E......A----E...-N...P....E....Q.V.A........TF....F
A4XEU5_NOVAD/14-116-------AYV.-----D....R.I.----N......A----G...-D...A....A....G.V.T........AL....F
Q0RK85_FRAAA/9-111-------QFL.-----D....R.L.----V......E----R...-D...Y....D....A.A.A........SY....V
B1LXB4_METRJ/10-119-------KFG.-----E....L.V.----N......G----G...-Q...F....D....A.F.P........EV....V
Q1IJH6_KORVE/7-113-------QLFH-----D....G.F.----N......A----K...-N...P....A....A.I.Q........QV....V
B5HUL8_9ACTO/35-145-------AFI.-----D....ALF.----T......R----G...-D...L....S....A.V.D........VY....L
Q8XW86_RALSO/8-113-------AFC.-----A....T.F.----P......E----D...-D...G...KA....A.I.R........RY....F
C7PJ94_CHIPD/8-108-------RYM.-----E....G.F.----R......K----K...-D...H....E....M.V.M........SC....L
B8HNZ9_CYAP4/16-120-------QYF.-----A....A.S.----R......G----S...-N...L...VE....D.M.V........AC....F
Q8ETH3_OCEIH/11-113-------KYL.-----E....G.F.----N......E----G...-N...S....E....K.V.I........SL....F
B4EGT8_BURCJ/14-120-------AFS.-----D....A.F.----N......R----H...-D...A....H....A.L.M........GF....M
C5CTR3_VARPS/11-118-------RIH.-----S....E.L.----D......Q----G...-N...G....Q....F.F.I........DS....L
A1SE82_NOCSJ/305-416-------RLV.-----A....A.W.----A......S----S...-D...F....D....T.L.L........DC....F
Q8YQT8_NOSS1/9-119-------QWA.-----N....L.W.----S......S----G...-N...V....E....S.F.L........SL....F
Q7P1G6_CHRVO/12-123-------RFN.-----R...EV.I.----E......N----G...-D...M....A....A.F.A........EL....V
A1T7R4_MYCVP/21-154-------KFL.-----F....A.L.----A......E----Q...-D...F....D....T.F.E........SL....A
Q0ATM8_MARMM/33-142-------AIY.-----D....A.F.----A......V----G...-D...V....P....A.F.T........AL....L
A4VYE6_STRSY/19-125-------AYN.-----N....A.L.----I......A----G...-D...F....A....A.L.F........ET....M
Q0AK67_MARMM/68-179-------AWL.-----D....A.Y.----A......R----Q...-D...F....D....R.M.R........SL....M
Q7NP31_GLOVI/45-156-------KFY.-----E...EV.F.----N......R----R...-N...L....A....L.A.D........EL....V
D1A779_THECD/12-112-------SYY.-----E....H.V.----D......A----H...-R...L....E....E.M.L........AL....F
B9M2F6_GEODF/33-141-------RFA.-----E...EV.F.----V......K----K...-D...L....S....E.V.E........RY....V
B0RBH4_CLAMS/76-179-------TLF.-----T...AA.F.----PDP..ASA----G...-A...Q....A....A.V.L........AA....V
B0RBH4_CLAMS/225-319-------GAY.-----D...TL.F.----R......D----H...-D...A....S....V.L.D........RS....F
Q82NK0_STRAW/12-119-------RFV.-----AVWERA.W.----A......A----H...-D...V....D....A.I.V........GL....Y
B5I3N5_9ACTO/17-126-------HSL.-----R....L.L.----L......D----K...-N...I....P....A.W.V........DL....W
C5CWJ6_VARPS/7-113-------NYI.-----H....A.A.----Q......S----G...-D...Q....A....L.L.A........SL....I
B8HUP3_CYAP4/10-119-------QFY.-----R....A.F.----D......D----R...-Q...L....E....R.A.M........EL....L
YESE_BACSU/13-122-------KFM.-----A....Y.M.----L......E----K...-D...M....K....S.W.T........EL....W
Q0RZ59_RHOSR/13-116-------RLE.-----N....A.V.----N......A----H...-D...L....D....A.V.V........DC....F
C0ZMD1_RHOE4/13-113-------EMF.-----Q....A.W.----D......V----M...-D...W....A....R.V.V........DL....F
E4NS77_HALBP/17-126-------RIP.-----E...DV.F.----G......D----G...-G...L....D....V.L.G........DL....Y
A0LVM2_ACIC1/13-121-------RFY.-----E....A.L.----T......T----G...-D...S....I....L.V.D........QA....L
A9B4R1_HERA2/9-105-------QFW.-----Q....L.M.----Q......T----N...-D...F....V....A.V.G........SV....L
B1MKK2_MYCA9/12-112-------SYC.-----D....L.L.----T......S----G...-T...A....A....Q.I.A........DL....Y
A1AMJ6_PELPD/11-123-------AGL.-----E....A.L.----N......R----R...-D...V....S....T.F.L........SS....W
Q0RKU0_FRAAA/7-102-------DYF.-----A....G.W.----N......K----Q...-D...T....D....A.I.L........AT....L
D1A9D6_THECD/22-131-------RSM.-----A....A.A.----A......A----G...-R...K....D....E.W.L........AL....F
Q6KYU6_PICTO/7-107-------DYY.-----N....A.V.----D......S----R...-D...L....K....T.L.F........SI....F
Q1CVW7_MYXXD/8-109-------DFY.-----S....A.F.----Q......R----R...-D...A....Q....A.M.A........AC....Y
D3Q1G6_STANL/8-116-------AFF.-----G....F.R.----A......K----N...-D...I....D....G.L.L........TL....I
C1D0F3_DEIDV/8-109-------ALQ.-----Q....A.E.----Q......T----G...-N...V....D....A.L.V........AL....H
Q1IMY1_KORVE/8-111-------QAY.-----S....A.F.----N......Q----R...-D...I....D....G.V.L........AL....M
Q2GAG8_NOVAD/26-123-------DFA.-----R....L.FY----V......E----R...-D...V...KK....A.F.E........AY....V
A4RY41_OSTLU/26-129-------EMY.-----E....R.I.----N......A----R...-D...V....D....G.A.L........AC....V
B6IUF4_RHOCS/9-114-------TLH.-----A....A.L.----A......R----K...-D...M....D....T.I.R........AL....V
Q0RWK4_RHOSR/10-112-------GAI.-----D....A.I.----T......R----G...-D...W....D....A.L.G........EF....I
Q6D2X2_PECAS/50-158-------AYL.-----A....A.F.----A......E----G...-K...L....D....D.I.V........SL....L
Q82M76_STRAW/12-122-------TAY.-----Q....R.L.----Q......S----G...-D...L....D....A.C.V........EL....L
A1SQ29_NOCSJ/22-134-------RSY.-----S....A.V.----A......K----G...-D...L....A....E.W.L........TV....Y
B8GR64_THISH/14-117-------EFF.-----A....T.L.----T......P----Q...-S...L....D....R.L.D........EL....F
A5V474_SPHWW/7-117-------DLE.-----Q....A.W.----S......D----K...-D...I....D....R.L.V........SL....F
Q28KZ3_JANSC/183-305-------AML.-----S....A.L.----H......V----Y...-D...P....D....S.F.GSDGQVGAGGT....W
Q98HZ7_RHILO/7-115-------NLY.-----D....A.Y.----S......K----R...-D...I....V....G.A.L........GH....C
D3SXC1_NATMM/13-124-------REI.-----E...TV.W.----N......D----D...-N...L....D....M.I.D........DL....V
B4RCM5_PHEZH/40-139-------GQL.-----D....A.Y.----N......A----Q...-D...L....D....A.F.C........AF....Y
Q7NIX2_GLOVI/6-112-------RFM.-----Q....T.L.----QHT..EQS----G...-D...V....E....S.L.V........NL....F
Q7NCT6_GLOVI/10-113-------TYF.-----D....N.M.----A......A----M...-N...V....D....E.W.L........TV....F
C7QIA1_CATAD/12-123-------LLL.-----R....T.V.----V......E----G...-S...R....D....E.L.A........DL....Y
D2PU42_KRIFD/7-118-------RLV.-----H....G.V.----A......D----R...-D...F....A....A.L.P........GL....Y
Q11RX8_CYTH3/10-111-------HFY.-----H....C.F.----K......Y----K...-D...A....E....G.M.V........SC....Y
Q15W82_PSEA6/7-110-------NFY.-----K....S.L.----D......T----Q...-S...L....S....E.L.K........NI....Y
D5URT3_TSUPD/13-113-------KFL.-----A....D.L.----A......D----A...-R...V....E....D.A.L........AA....F
C7PY66_CATAD/14-115-------EAV.-----S....R.F.----G......A----G...-D...I....A....G.F.T........EL....L
D1AZA9_SULD5/9-119-------EYY.-----E...VV.W.----N......E----Q...-K...L....D....Q.A.H........HF....L
Q0RHL1_FRAAA/31-134-------AYY.-----A....S.Y.----A......A----G...-D...V....A....G.R.E........AL....F
Q0REI6_FRAAA/9-118-------ELL.-----R....L.F.----D......E----G...-D...FVGNMD....R.L.L........AQ....F
Q0ALT6_MARMM/8-104-------AYV.-----A....A.F.----D......A----R...-D...L....D....K.V.S........RF....F
Q9RUP4_DEIRA/10-111-------RLF.-----T....I.I.----D......S----A...-D...Y....D....R.L.G........DV....F
Q5NW43_AROAE/11-116-------RLF.-----T....A.F.----G......N----A...-D...I....A....Q.I.V........DL....L
B5I914_9ACTO/103-211-------EFF.-----E....R.A.----G......R----A...-G...T....A....E.L.F........AR....F
D7BB21_MEISD/9-120-------RFV.-----D...EV.I.----N......R----G...-D...L....G....A.V.D........EL....L
Q7CY40_AGRT5/43-140-------DFY.-----D...TV.F.----N......K----H...-E...V....A....K.G.A........AV....I
A1SDP9_NOCSJ/7-110-------AFL.-----E....H.L.----S......R----A...-E...S....E....A.A.L........AL....L
C7PD65_CHIPD/5-107-------EWL.-----H....A.W.----N......T----H...-D...L....E....A.I.M........AH....Y
Q0W0Z9_UNCMA/28-139-------RYY.-----E....E.FY----D......R----R...-N...L....A....V.I.D........EL....V
Q0AK68_MARMM/36-153-------AYM.-----A....L.Y.----S......A----V...-D...W....D....G.M.E........AL....L
A1T3J1_MYCVP/7-115-------AFL.-----K....G.M.----EQ...PIS----K...-V...P....E....H.L.R........ES....M
B2J333_NOSP7/11-117-------RWV.-----E....L.I.----S......E----H...-R...I....E....D.I.C........EM....T
Q161D9_ROSDO/27-138-------GMV.-----D....G.L.----N......D----H...-R...I....D....D.I.G........AF....F
Q1D054_MYXXD/25-142-------AFT.-----D....A.F.----N......R----D...-D...L....D....A.V.M........AY....F
D2Q4E8_KRIFD/10-119-------KAF.-----A....E.I.----S......A----G...-N...W....E....A.M.V........QG....M
A6W6K1_KINRD/24-129-------RYL.-----A....C.C.----N......E----H...-R...F....D....D.L.G........EF....V
D0LM99_HALO1/203-300-------RYV.-----D....A.F.----R......R----Y...-D...V....A....A.L.T........SL....L
Q8YNM4_NOSS1/10-119-------QAY.-----E....A.F.----D......L----G...-D...I....E....K.G.K........TF....V
A0JTQ5_ARTS2/14-118-------RML.-----A....A.A.----A......R----Y...-D...L....E....A.M.V........SQ....F
C6W364_DYAFD/12-123-------RFN.-----E...EV.I.----A......E----G...-N...L....E....S.F.K........EL....M
C1N6Y5_MICPC/11-117-------AYF.-----S....A.W.----N......A----Q...-D...A....A....K.L.R........EC....F
A8EWB0_ARCB4/10-120-------LYY.-----D...EL.W.----N......K----H...-K...K....E....Y.I.D........IV....F
Q5YQ81_NOCFA/15-114-------EFF.-----A....A.M.----E......L----G...-A...V....G....E.A.L........EL....L
C1F799_ACIC5/9-124-------QFIR-----Q....V.W.----D......E----G...-N...A....D....A.V.D........AY....L
D2QMN3_SPILD/5-118-------AYI.-----D....A.Y.----N......A----K...-D...I....P....A.M.L........AL....L
A7HKH6_FERNB/25-126-------KTY.-----N....E.Q.----G......K----L...-D...W....S....H.L.L........PY....Y
Q5DZG2_VIBF1/16-125-------KFI.-----AL.YGG.L.----N......K----H...-T...L....H....H.L.S........EI....Y
A1S3V2_SHEAM/29-141-------NYI.-----Q....A.L.----T......E----H...-D...Y....S....A.L.A........RY....Y
A0R0F0_MYCS2/85-194-------DVF.-----A...TT.S.----Q......T----G...-F...G....E....T.F.L........DR....L
Q2G4A7_NOVAD/14-111-------EMY.-----N...KV.L.----I......A----M...-D...S....S....A.V.D........RY....I
Q6D526_PECAS/26-129-------EFY.-----R....E.L.----T......T----E...-G...L....A....E.L.G........EI....Y
A5FVD4_ACICJ/16-117-------KVF.-----A....A.I.----D......R----Q...-D...A....A....A.F.A........SL....F
Q0U711_PHANO/9-119-------RFI.-----E....F.I.----N......S----G...-D...T....K....I.G.Q........EV....V
Q9AK31_STRCO/210-307-------RYV.-----A....A.F.----E......G----Y...-D...M....T....A.L.T........AL....L
C7PMQ6_CHIPD/9-116-------QFL.-----T....A.V.----Q......Q----G...-D...N....Q....T.L.A........AL....L
D2PQZ2_KRIFD/10-123-------RFF.-----E...EV.F.----T......A----G...-R...L....D....V.M.D........EI....A
Q2SB33_HAHCH/8-108-------RFY.-----D....A.F.----K......D----K...-D...Y....R....T.M.Q........AC....Y
Q2G9Q6_NOVAD/31-145-------GFL.-----D....E.V.----R......S----G...-R..AP....E....K.T.V........NY....L
C8XK42_NAKMY/10-121-------RMF.-----D...EG.F.----A......T----G...-N...D....A....I.V.D........EL....C
D2SBX0_GEOOG/5-109-------RLR.-----D....A.V.----N......A----H...-N...V....D....A.M.V........EL....I
Q39TG5_GEOMG/5-106-------KYF.-----E....L.V.----N......S----D...-S...V....D....G.L.L........EL....W
B6IS60_RHOCS/17-111-------ALW.-----E....G.M.----A......A----R...-H...W....D....T.V.R........RL....V
B0T5N4_CAUSK/9-117-------DFL.-----D....A.W.----S......A----G...-P...EP.LEQ....A.I.R........DL....F
C6XZD6_PEDHD/13-122-------QFY.-----E....A.L.----A......N----R...-E...L....E....K.L.L........LL....F
D0LWT7_HALO1/7-120-------SYF.-----R....A.V.----E......S----H...-D...F....D....Q.V.A........RW....L
Q0SJC1_RHOSR/11-111-------KLL.-----Q....A.A.----D.......----T...-D...I....A....E.F.F........DY....F
D0LQY4_HALO1/7-114-------AHL.-----E....H.V.----T......R----D...-D........A....R.W.L........AL....F
Q82RJ4_STRAW/12-109-------RWR.-----S....A.E.----E......R----G...-D...V....D....A.A.V........AC....L
A4XCF3_SALTO/8-104-------RQL.-----D....A.Y.----N......T----H...-N...L....E....A.F.V........NT....Y
B1VLR8_STRGG/5-111-------RFR.-----A....A.V.----D......R----R...-D...L....D....A.L.D........DL....F
Q0C649_HYPNA/6-119-------KYI.-----A....A.Y.----N......E----R...-D...I....D....A.M.L........TY....V
D3EBN8_GEOS4/13-118-------AFI.-----E...SF.W.----N......Q----S...-D...M....D....S.T.D........QF....L
C5BR99_TERTT/13-114-------EFY.-----R....D.L.----N......G----T...-R...L....D....S.L.P........NV....Y
Q1LC18_RALME/11-130-------RWF.-----T....E.F.----WG....KN----P...-N...L....A....V.I.D........EI....A
A9F1N2_SORC5/10-120-------EYV.-----E....AVW.----H......R----R...-N...V....A....A.A.D........DY....F
Q7NX64_CHRVO/8-108-------AQL.-----D....A.Y.----N......A----R...-N...L....D....A.F.A........AC....Y
A6Q8S5_SULNB/27-140-------GYM.-----N....A.W.----A......E----H...-N...I....S....K.I.D........SY....Y
Q7NYY8_CHRVO/10-124-------GFL.-----D....E.V.----R.....SG----R...-D...P....D....A.A.G........RY....L
Q0RTS8_FRAAA/10-121-------RLY.-----E...EV.V.----N......Y----G...-K...A....E....L.L.E........TF....V
B2HF34_MYCMM/13-118-------RSP.-----R....A.A.----A......A----H...-D...R....A....G.W.V........SL....F
Q5LS60_RUEPO/15-118-------EWY.-----A...RV.W.----E......Q----G...-D...V....E....A.I.D........QF....F
C7NL72_KYTSD/199-297-------AYL.-----E....A.H.----G......R----G...-D...I....T....A.V.V........EL....F
Q0RWC3_RHOSR/94-208-------GFW.-----G....D.L.----DSG.PPTG----K...-E...L....A....A.W.K........DW....F
A4X2J9_SALTO/11-126-------ALY.-----R....N.F.----N......E----N...-N...L....D....G.A.M........AL....L
A9FU94_SORC5/4-110-------EFI.-----E....A.L.----RRI..EES----G...-D...V....E....P.M.A........RL....F
D5UXD3_TSUPD/41-136-------AFY.-----T...EG.F.----V......N----K...-D...L....A....G.A.A.......HRY....I
C3AHZ7_BACMY/74-174-------RFY.-----A....F.W.----D......T----G...-N...E....E....L.I.P........QT....V
B7G1I9_PHATC/141-251-------KFI.-----A...DI.W.----N......R----G...-E...I....D....L.I.P........EV....C
Q144S2_BURXL/14-123-------GFY.-----R....A.I.----E......Q----K...-S...V....A....L.L.R........QV....V
Q0K1J6_CUPNH/7-120-------AFF.-----A....R.Y.----R......E----H...-D...I....N....G.M.L........AM....F
Q096A5_STIAD/35-145-------AFA.-----E...EV.Y.----A......Q----H...-R...L....D....R.I.P........VY....V
Q6DAK4_PECAS/16-123-------RIL.-----R...EL.L.----D......A----G...-H...W....E....K.A.D........EL....L
Q8XQ60_RALSO/19-124-------HIV.-----E....V.F.----N......T----L...-D...I....D....A.I.V........AL....F
Q00XN2_OSTTA/55-161-------RLY.-----R...EV.W.----N......A----H...-D...VRTADT....A.A.K........QY....V
A0JX05_ARTS2/16-130-------GFV.-----R....A.I.----E......A----G...-G..GA....A....E.V.D........GF....L
Q8TQG8_METAC/25-143-------TLD.-----D....A.W.----N......S----Q...-D...W....D....T.F.E........KR....H
A1TNK1_ACIAC/52-157-------DFW.-----R...EV.F.----E......S----G...-Q...V....E....L.A.D........RY....M
Q01R35_SOLUE/14-114-------QFV.-----A....A.I.----N......R----H...-D...V....E....A.L.A........AL....M
D2AXD2_STRRD/7-110-------KYI.-----E....I.W.----N......E----R...-D...AGRRRS....A.I.D........AV....L
Q0APW6_MARMM/28-136-------AFI.-----T....A.I.----S......S----E...-D...A....S....A.L.A........QL....Y
Y3332_PSEAE/7-115-------HSL.-----R....L.L.----E......N----G...-D...A....R....G.W.C........DL....F
Q7NP00_GLOVI/24-117-------SYV.-----D....T.F.----N......R----H...-D...L....T....A.L.G........KL....F
A9U6M7_PHYPA/10-103-------SYL.-----K....M.W.----N......T----G...-D...V....T....I.A.D........EV....L
B6QL61_PENMQ/29-132-------RFYK-----D....L.W.----D......K----Q...-D...T....S....L.I.P........AL....I
Q2KTK8_BORA1/35-133-------AFF.-----R...LM.F.----E......E----H...-Q...V....E...EA.V.S........RY....V
B2HI14_MYCMM/11-120-------RSR.-----E....A.V.----T......A----R...-D...K....Q....A.W.L........AV....F
Q7P1D6_CHRVO/11-112-------EWI.-----D....A.W.----N......S----H...-D...L....A....R.I.L........AH....Y
Q1INA8_KORVE/18-129-------EHV.-----R....C.E.----N......A----H...-D...L....D....G.V.I........AT....F
B6IRE4_RHOCS/14-115-------RYF.-----E....A.L.----T......P----D...-T...L....D....R.L.D........RL....A
A8L6M7_FRASN/9-119-------QVR.-----R....M.V.----.......A----G...-E...G....V....V.F.A........DL....F
C5CYM4_VARPS/7-110-------AFI.-----A....A.V.----E......S----G..A-H...A....Q....A.I.E........DY....Y
B0C5C2_ACAM1/10-116-------RFF.-----T....A.V.----D......A----Q...-N...A....D....G.L.R........PF....L
Q5YR20_NOCFA/14-119-------ASP.-----R....A.V.----L......A----H...-D...K....T....A.W.V........RL....F
Q89SK5_BRADU/7-110-------AFA.-----K....R.L.----E......D----G...-D...F...VG....A.I.E........QF....Y
B9JZV5_AGRVS/9-119-------KLI.-----E....E.V.----Q.....VG----G...-N...Y....A....V.F.D........AL....M
C5CZ61_VARPS/13-119-------ALY.-----E....D.WL----S......H----G...-R...F....E....E.L.Q........DS....I
B7KLH5_CYAP7/9-116-------MFF.-----Y....A.L.----E......T----G...-Q...F....E....M.L.K........EI....F
D7DZ07_NOSA0/16-121-------YFT.-----N....G.L.----E......N----G...-N...W....Q....D.F.I........DM....L
Q5YYT4_NOCFA/5-107-------QYL.-----E....I.W.----N......T----T...-D...AAARRA....A.I.A........RV....F
Q4K710_PSEF5/11-111-------AQL.-----Q....A.Y.----N......R----K...-D...L....E....A.W.L........AT....Y
Q11GL1_CHESB/10-122-------RAL.-----A....S.F.----N......A----R...-D...V....E....A.M.M........AC....L
B8FA80_DESAA/11-124-------KYI.-----A....A.Y.----N......A----F...-D...L....E....S.M.E........SL....L
C7PKK5_CHIPD/8-113-------NYL.-----G....C.L.----N......D----K...-D...W....R....Q.L.A........DF....V
C7PVH9_CATAD/7-110-------AWA.-----A....A.W.----T......G----T...-N...P....N....A.L.G........TL....F
Q023S0_SOLUE/22-116-------QHW.-----A....A.S.----D......A----N...-D...F....E....T.E.H........RI....Y
B0T2P8_CAUSK/7-113-------DLV.-----A....L.C.----K......A----G...-K...F....D....E.AGE........KY....W
A4FLI3_SACEN/9-124-------RWL.-----P....G.L.----W......N----A...-P...P....E....E.M.AGI....AEGI....F
Q1GVF6_SPHAL/12-129-------RHM.-----A....L.E.----I......A----H...-D...W....D....G.V.I........AT....F
A5VGC4_SPHWW/32-139-------AFL.-----A....Q.C.----G......N----G...-KNEMM....D....A.F.R........TY....F
Q67LR1_SYMTH/49-143-------RFF.-----H....M.C.----N......S----H...-C...P....G....N.V.A........PL....L
Q1GGN5_RUEST/7-110-------YWF.-----E...EV.W.----N......K----D...-N...L....S....V.I.D........EL....L
Q7N5H3_PHOLL/10-114-------RFY.-----D........----S......T----G...-D...I....D....V.L.R........QI....M
C5ANY4_BURGB/9-119-------EFY.-----E...QV.W.----D......R----Q...-V...V....Q....L.L.P........SM....F
A0JTF8_ARTS2/8-119-------RFY.-----E...EV.L.----V......G----G...-N...L....A....L.I.D........EF....V
B0UQZ5_METS4/10-111-------AMF.-----E....A.F.----C......D----L...-DR.PV....E....E.I.A........AY....F
B2FKH0_STRMK/10-123-------HYL.-----Q....A.Y.----N......R----F...-D...I....D....A.M.L........AV....L
Q28P04_JANSC/192-309-------DMH.-----N....A.L.----N......T----HVGA-D...V....S....G.LTM........AH....W
D0LQN7_HALO1/43-156-------NFY.-----D....L.L.----S......D----P...-T...TSEADA....R.T.A........EF....M
C6WH72_ACTMD/42-148-------RWN.-----T....S.L.----A......A----G...-D...L....D....G.V.V........DQ....Y
A4VFV4_PSEU5/16-125-------AFE.-----Q....A.I.----G......A----K...-D...L....D....R.I.M........AQ....Y
B9JGC5_AGRRK/8-110-------RYI.-----A....V.W.----N......E----T...-D...A....E....R.R.R........ALITEAW
Q28SU5_JANSC/41-153-------RLF.-----D...EG.W.----G......A----Q...-D...GW..RD....V.W.R........ET....M
A5FDF3_FLAJ1/20-129-------RFY.-----A....A.W.----N......L----K...-K...P....E....V.L.D........EI....C
D2QKG8_SPILD/51-161-------DFV.-----G....A.L.----T......A----A...-D...W....E....K.T.R........SL....A
Q2RYS6_SALRD/468-568-------QLH.-----N....A.Y.----N......T----H...-D...P....D....A.F.L........DA....L
Q7U6B9_SYNPX/19-120-------MAE.-----N....A.W.----N......S----K...-D...P....D....K.V.S........LA....Y
A1T202_MYCVP/12-136-------RWA.-----N....A.L.----.......S----S...-D...T....D....A.A.V........AL....Y
C0Z8U2_BREBN/10-123-------NYV.-----Q....A.Y.----N......S----F...-D...V....E....G.M.A........RL....L
Q5WJ97_BACSK/7-113-------AYI.-----N....A.T.----N......T----H...-D...F....N....E.V.K........KI....L
Q4K7Y4_PSEF5/14-123-------NWQ.-----Q....A.V.----M......D----R...-D...I....Q....R.I.V........SY....Y
B9K0R3_AGRVS/19-126-------EFY.-----R...RV.F.----D......G----Q...-N...P....A....A.V.K........DF....V
A2SP57_METPP/26-134-------GYA.-----L....G.W.----D......R----H...-D...V....N....L.L.L........SV....F
D7B2K3_NOCDD/208-308-------RYV.-----D....A.F.----E......S----Y...-D...I....S....A.I.T........EV....F
Q2G5Y7_NOVAD/7-112-------AMI.-----A....A.Y.----N......A----Q...-D...V....D....T.Y.V........SY....M
A9WET4_CHLAA/10-121-------RFVK-----E....V.L.----N......D----K...-N...L....A....V.I.D........EI....C
B4RFA6_PHEZH/12-124-------EHF.-----A....F.E.----A......N----D...-D...V....E....G.V.L........AT....L
B1YHC8_EXIS2/7-115-------RYF.-----D....L.F.----DAS.RTDE----K...-A...F....D....D.L.I........SL....F
Q01XW8_SOLUE/26-133-------QWS.-----K....A.A.----S......A----N...-D...L....D....A.T.V........SF....Y
A5FF04_FLAJ1/226-327-------NHL.-----K....I.W.----N......E----K...-D...E....T....K.R.K........AL....L
Q7N5R6_PHOLL/8-109-------ELL.-----S....S.M.----N......Q----Y...-D...L....K....R.L.D........NI....F
D2SF32_GEOOG/10-120-------EML.-----R....R.Q.----Q......A----G...-D...D....T....F.L.D........EL....V
D2QKG9_SPILD/49-156-------DLL.-----D....A.L.----L......T----E...-K...L....D....K.A.R........SL....M
D3SG09_THISK/73-180-------AWN.-----D....A.L.----Q......T----G...-D...A....R....R.V.T........AL....Y
Q6MQX3_BDEBA/10-106-------GQL.-----E....A.Y.----N......A----R...-D...I....E....K.F.C........SF....Y
A9F1I8_SORC5/106-215-------TFY.-----R....A.F.----S......E----R...-R...P....E....L.I.D........EA....V
D3PMI5_MEIRD/6-117-------EYI.-----R....R.F.----N......A----Q...-D...P....T....V.F.E........EF....L
A8I8N5_CHLRE/87-201-------KFY.-----H....L.S.----E......T----N...-D...F....K....D.F.A........SI....V
Q5NR56_ZYMMO/9-110-------QVF.-----E....T.L.----SD....FN----R...-P...A....E....E.M.L........AF....F
Q0C1I4_HYPNA/38-144-------AFA.-----A....A.L.----D......A----G...-D...T....A....A.L.S........AL....M
B5HCB5_STRPR/12-122-------RWA.-----D....A.V.----H......R----G...-D...L....P....D.V.L........AD....H
B2HE10_MYCMM/16-127-------HYT.-----TVVEGC.S.----A......S----G...-D...W....R....P.F.A........DL....F
B7G7G0_PHATC/222-327-------LWN.-----D....A.L.----A......T----G...-D...S....R....V.V.A........DR....Y
A8GD70_SERP5/44-162-------FYW.-----R....S.L.----NG....WS----E...-K...P....A....N.V.A........KY....F
C7QAG6_CATAD/10-122-------KAI.-----G....I.L.----S......G----Q...-T...P....E....D.F.A.......QEA....F
Q7CRD4_AGRT5/8-113-------AYL.-----D....S.L.----N......H----Q...-A...F....D....E.L.G........TF....V
A5FAS7_FLAJ1/7-104-------NFL.-----K...LA.A.----S......G----H...-S...H....E....G.F.K........LY....V
Q21ST0_ALBFT/17-124-------ALN.-----D....A.W.----T......Q----G...-D...P....D....D.L.V........NY....F
Q5FU45_GLUOX/16-117-------DMF.-----T....M.F.----AD....FG----S...-D...L....D....A.L.T........AF....M
D7B8A1_NOCDD/24-135-------TYM.-----N....T.R.----G......Q----D...-R...L....K....R.H.L.........L....F
A8J8F4_CHLRE/267-381-------LYF.-----H....T.Y.----N......T----G...-H...Y....G....V.L.D........HI....V
Q7UYI8_RHOBA/149-257-------QWS.-----T....A.L.----E......A----R...-D...Y....D....G.L.V........AN....Y
Q0RQ61_FRAAA/35-150-------QWL.-----K....A.F.----R.......----E...-S...A....E....K.V.C........AL....Y
Q2W516_MAGSA/7-130-------GYK.-----A....A.W.----E......Q----R...-D...P....S....M.F.A........AL....F
A5G225_ACICJ/10-127-------AHC.-----R...YE.F.----E......T----R...-D...V....D....ATM.A........TM....V
Q7KPV8_CAEEL/16-120-------AYS.-----K....A.V.----N......N----A...-D...W....D....T.V.A........SF....Y
A6WAE9_KINRD/9-131-------RLF.-----E....V.L.----E......H----G...-D...D....V....L.A.S........YL....V
A4VGJ2_PSEU5/10-121-------QHI.-----D...LT.W.----N......R----G...-H...L....A....L.A.E........HL....H
C8X7I4_NAKMY/10-121-------R.I.-----D....A.L.----G......N----GD.A-D...L....A....E.L.D........EL....C
B8CQ65_SHEPW/9-116-------RYA.-----Q....V.L.----N......N----A...-D...T....R....I.L.R........EV....F
B5HVQ1_9ACTO/52-162-------TWN.-----A....A.L.----K......T----G...-D...P....D....K.V.A........SL....Y
B6QRJ3_PENMQ/14-121-------DFH.-----K....H.M.----D......A----M...-D...P....N...LA.I.P........KF....Y
B2FS27_STRMK/53-161-------RFN.-----R....A.L.----S......S----G...-D...L....A....T.V.E........AL....L
Q89CA0_BRADU/26-125-------DYV.-----A....S.V.----Q......N----C...-D...V....K....R.F.D........QI....L
Q82PT2_STRAW/13-123-------ALV.-----A....A.F.----A......E----G...-R...L....D....D.Y.F........GA....F
B0UAU1_METS4/29-133-------EFE.-----S....A.F.----R......S----G...-N...F....S....A.V.A........NM....Y
A8N708_COPC7/26-128-------NYY.-----T....A.F.----D......T----N...-D...P....S....F.A.S........TF....Y
C6WNT0_ACTMD/15-117-------EHL.-----E....A.E.----N......E----R...-D...F....V....T.T.I........AA....F
Q74BD7_GEOSL/66-172-------EFD.-----H....A.F.----Q......S----R...-N...V....D....A.L.K........QL....F
B1MAG0_MYCA9/29-157-------TWF.-----D....A.W.----A......E----Q...-D...I....K....K.I.D........YC....I
B1W484_STRGG/11-119-------EYF.-----E....R.V.----N......A----K...-D...L....D....G.V.V........KL....F
B2HT68_MYCMM/15-114-------RYM.-----S....V.L.----A......D----G...-G...A....D....D.L.V........GF....Y
B4ELH6_BURCJ/39-136-------AFY.-----E...KG.L.----N......E----K...-D...A....D....A.A.L........AY....V
B4EM94_BURCJ/9-110-------RFY.-----T....A.F.----Q......Q----R...-D...I....D....T.M.L........AC....Y
C0ZSH3_RHOE4/57-155-------DFY.-----E...LA.F.----N......G----R...-Q...V....Q....Q.A.A........DR....Y
C0ZUW8_RHOE4/11-107-------DYV.-----K....Y.L.----G......S----H...-D...V....D....G.L.V........AL....F
C1A207_RHOE4/8-107-------DFC.-----A....L.W.----A......A----A...-D...V....A....K.I.V........DY....F
C3KP75_RHISN/30-139-------.FY.-----A....A.E.----TVYLAPGG----G...-D...F....G....P.I.A........ET....L
D0J389_COMT2/5-105-------RYV.-----A....A.L.----N......A----G...-D...L....D....G.I.V........AL....F
D4ZDV5_SHEVD/27-130-------GFI.-----A....A.Y.----N......S----H...-D...V....K....Q.M.V........QY....T
D7BSM4_STRBB/12-130-------EHS.-----R....R.L.----S......E----G...-D...I....D....G.L.L........DL....Y
G2NZK4_STRVO/13-110-------EYA.-----R....R.M.----N......A----G...-D...V....E....A.V.L........EL....F
G2NZK5_STRVO/16-131-------....-----R....R.M.----N......A----A...-D...I....D....G.L.L........EL....Y
G8PMR8_PSEUV/42-153-------AFY.-----E....V.A.----D......A----RP.F-D...R....E....T.F.V........SF....F
G8PNR5_PSEUV/31-139-------KFY.-----E....V.A.----D......S----RP.F-D...R....A....K.L.A........EF....Y
M1FFV3_9ALTE/24-124-------ELF.-----N....T.L.----D......K----G...-N...L....N....K.L.A........GV....Y
O06820_MYCTU/10-109-------GFA.-----D....F.W.----K......A----P...-S...P....D....R.L.T........DH....L
Q0RMU9_FRAAA/11-107-------....-----V....A.I.----N......S----H...-V...P....E....R.I.A........SC....F
Q0S498_RHOSR/22-121-------AFL.-----D....A.L.----V......A----G...-D...P....D....A.A.Q........QY....L
Q0SA13_RHOSR/47-144-------SWN.-----D....A.L.----E......S----G...-D...A....S....R.V.A........AL....Y
Q0SAM4_RHOSR/12-111-------RYI.-----E....A.V.----A......T----G...-T...T....D....D.V.V........AL....Y
Q63P16_BURPS/8-114-------ESY.-----E....A.F.----H......R----R...-D...L....P....G.V.L........AA....L
Q63TL7_BURPS/59-168-------RYD.-----T....F.W.----H......N----G...-D...P....A....L.A.R........AA....L
Q67TV4_ORYSJ/71-167-------AFY.-----D....G.V.----N......R----R...-D...L....A....A.V.E........PL....I
Q73X32_MYCPA/11-110-------RYL.-----A....L.V.----A......T----G...-T...A....D....D.I.V........TL....Y
Q7MG68_VIBVY/11-132-------EYF.-----S....A.M.----E......N----A...-T...Y....K....N.V.AEV....LKAH....T
Q7SFH5_NEUCR/300-405-------DYI.-----A....C.I.----N......G----K...-T...M...QQ....D.L.H........QY....C
Q81HA2_BACCR/62-156-------FYN.-----E....V.F.----N......K----H...-N...I....D....I.I.P........KY....V
Q88EB0_PSEPK/13-117-------RWM.-----Q....A.V.----R......D----R...-D...I....P....G.I.I........AP....Y
Q8F037_LEPIN/9-109-------EFY.-----E....A.F.----Q......K----K...-D...A....T....K.M.G........TL....Y
Q8PDF7_XANCP/13-124-------AYY.-----E....A.F.----N......R----G...-D...W....D....A.M.L........AF....L
Q9A482_CAUCR/12-113-------AFM.-----K....A.M.----E......R----L...-D...Y....D....A.A.V........QH....L
Q9A5Z0_CAUCR/10-110-------RFV.-----A....A.I.----Q......A----G...-D...A....E....A.V.R........AF....Y
Q9A6F0_CAUCR/10-117-------RVY.-----A....A.L.----E......T----G...-D...Q....S....V.F.G........DS....V
Q9A8Y8_CAUCR/11-113-------QLY.-----E....A.F.----N......R----R...-A...F....D....R.C.I........AM....L
Q9CCC2_MYCLE/38-133-------.FL.-----A....A.L.----Q......D----A...-G...L...RN....R.I.R........DV....G
Q9HS78_HALSA/7-104-------AYY.-----D....A.V.----D......E----G...-D...I....S....A.V.L........AL....F
Q9I3U3_PSEAE/11-113-------AYI.-----D....C.L.----N......R----Q...-D...W....A....R.L.G........DF....V
Q9KSY8_VIBCH/9-112-------QFY.-----Q....Q.L.----D......K----S...-Q...L....H....R.L.I........EI....Y
R5F452_9CLOT/94-205-------HTY.-----D....I.W.----D......D----K...-G...M....G....K.I.Y........DH....Y

PF07858

Q8XW85_RALSO/2-128-------HFC------A----A-F-----V------E----D----G---G----R----PAV-R--------RW----F
Q9A482_CAUCR/6-128-------AFM------K----A-M-----E------R----L----D---Y----D----AAV-Q--------HL----A
Q8XW86_RALSO/2-128-------AFC------A----T-F-----P------E----D----D---G----K----AAI-R--------RY----F
EPHG_MYCTU/15-135-------AFL------N----A-L-----Q------N----E----D---F----D----TVD-A--------AL----G
Q73W09_MYCPA/9-129-------GFL------N----A-L-----Q------D----A----D---Y----D----AAE-A--------AL----A
Q9CCC2_MYCLE/30-150-------VFL------A----A-L-----Q------D----A----G---L----R----NRI-R--------DV----G

PF10184

A0ZAJ9_NODSP/1-107-------QDY------Q----R.F-----P------L----NQ..-T---Y----S------I----------------Y
A0ZEU7_NODSP/8-120-------EDF------P----TLF-----E------K----DI..-S---Y----D------I----------------Y
A3KPX0_DANRE/247-372-------VEL------P----RFF-----R------K----NH..-D---Y----S------I----------------Y
A4RYB4_OSTLU/40-152-------EDL------T----HLF-----D------D----EG.I-D---P----S------L----------------Y
A7RV61_NEMVE/173-295-------DEL------P----LFF-----Q------N----GH..-G---Y----S------L----------------Y
O82347_ARATH/89-201-------EEF------P----LLF-----Y------K----EL..-N---F----D------I----------------Y
P74420_SYNY3/15-121-------QDY------A----N.F-----P------W----HQ..-T---F----S------I----------------Y
Q017W4_OSTTA/52-164-------EDL------T----HLF-----D------A----RG.I-D---A----A------L----------------Y
Q019E6_OSTTA/22-131-------EDY------D----ENY-----F------V----SGAG-K---M----R------A----------------Y
Q0DJX6_ORYSJ/116-228-------EEL------P----AAF-----Y------R----EP..-S---F----H------I----------------Y
Q10VR9_TRIEI/4-116-------LDL------P----TLF-----E------K----DI..-S---Y----D------I----------------Y
Q11AD5_TRIEI/1-107-------QDY------Q----K.F-----P------A----DQ..-T---Y----S------I----------------Y
Q2JJ41_SYNJB/11-117-------ADY------A----R.F-----P------R----DQ..-T---Y----A------I----------------Y
CF136_HUMAN/149-274-------QEL------P----KLF-----L------Q----SH..-D---Y----S------L----------------Y
Q69VD1_ORYSJ/67-177-------EDL------P----HLF-----D------D----VG.V-D---R----S------A----------------Y
Q7NHQ0_GLOVI/5-111-------ADY------Q----R.F-----P------E----DQ..-T---Y----A------I----------------Y
Q7PFX4_ANOGA/132-264-------QTL------P----KLF-----V------Q----PL..-D---Y----S------I----------------Y
Q8VZ90_ARATH/62-172-------EDL------P----HLF-----D------D----QG.I-D---K----T------A----------------Y
Q8YTL6_NOSS1/1-107-------QDY------Q----R.F-----P------V----NQ..-T---Y----S------I----------------Y
Q94K63_ARATH/78-191-------SDY------R----NFY-----F------V----TGVL-T---S----A------I----------------Y
Q9SA31_ARATH/87-199-------EDL------P----LLF-----T------R----DL..-N---Y----D------I----------------Y
B1WUH0_CYAA5/2-107-------NDY------Q----T.F-----P------K----NQ..-T---Y----S------V----------------Y
B8JJ69_MOUSE/150-274-------QEL------P----TLF-----L------R----SH..-D---Y----T------I----------------Y
Q31NT1_SYNE7/7-112-------QDY------A----R.F-----P------K----DQ..-S---F----E------V----------------Y
Q7XLD2_ORYSJ/92-203-------DDL------P----AVF-----V------R----EP..-N---Y----D------I----------------Y
Q9W1F2_DROME/84-215-------TTL------P----KLF-----V------E----PL..-D---Y----S------I----------------Y

PF07080

B1LSK3_METRJ/3-144-------RLAE-----D----G-W-----N------G----R----D---P----A----K-V-A--------LA----Y
B8ERM2_METSB/7-147-------RLAE-----N----G-W-----N------S----R----N---P----E----R-V-S--------LA----Y
D7C7X3_STRBB/6-147-------RAAE-----D----G-W-----N------T----R----D---P----E----K-V-A--------LA----Y
A8HSN6_AZOC5/11-152-------RMAE-----D----A-W-----N------T----Q----D---P----E----K-V-S--------LA----Y
G7DX40_MIXOS/2-131-------KAAQ-----R----L-W-----N------T----R----T---P----S----K-I-V--------KA----Y
B2ILG8_BEII9/4-143-------RFAE-----D----A-W-----N------S----Q----D---A----H----R-V-C--------LA----Y
A9HBR6_GLUDA/3-144-------RLAE-----D----A-W-----N------G----R----D---P----E----K-V-A--------LA----Y
S3BYH4_OPHP1/13-151-------KAAQ-----D----A-W-----N------T----M----D---P----V----V-I-V--------PA----Y
Q7ULD7_RHOBA/9-146-------RAAE-----D----A-W-----N------S----R----D---P----Q----R-V-S--------LA----Y
Q7V2T4_PROMP/4-145-------RLAE-----N----A-W-----N------T----K----D---P----V----T-V-S--------HA----Y
B2IKS1_BEII9/5-145-------RLAE-----D----A-W-----N------G----R----D---P----E----R-V-A--------LA----Y
B8GEL7_METPE/7-147-------RMAE-----D----G-W-----N------S----R----N---P----E----L-V-S--------LA----Y
J4G7Y6_FIBRA/6-142-------KLAQ-----N----L-W-----N------T----C----D---P----V----R-V-S--------LA----Y
R4LE54_9ACTO/2-140-------QAAE-----D----A-W-----N------T----C----D---P----G----R-V-A--------LA----Y
D2VSI5_NAEGR/4-136-------KLAQ-----D----N-W-----N------S----K----D---P----E----R-I-A--------LA----Y
E2LUP3_MONPE/4-137-------KIAQ-----K----L-W-----N------T----K----D---P----A----K-V-A--------MA----Y
L8GCZ6_PSED2/11-144-------KAAQ-----A----A-W-----N------T----K----D---P----K----R-I-A--------LA----Y
Q5NPJ1_ZYMMO/5-147-------RRAE-----D----A-W-----N------S----Q----N---P----E----K-I-A--------LS----Y
U4L3Z6_PYROM/5-144-------KAAQ-----N----L-W-----N------T----K----D---P----A----R-V-A--------LA----Y
Q5LKF9_RUEPO/3-144-------RLAE-----N----G-W-----N------N----R----S---A----D----V-V-T--------PA----Y
F6IE59_9SPHN/9-150-------QAAE-----D----G-W-----N------S----R----D---P----A----K-V-A--------LA----Y
A4SXK9_POLSQ/6-145-------RMAE-----D----A-W-----N------T----R----D---P----E----K-V-S--------LV----Y
B0C3H8_ACAM1/7-148-------RFAE-----D----A-W-----N------G----R----N---P----E----K-V-S--------LA----Y
K9VV28_9CYAN/4-139-------QAAE-----D----A-W-----N------T----R----D---P----A----R-V-A--------LA----Y
G8TDI0_NIAKG/7-136-------KLAE-----D----A-W-----N------T----R----N---P----E----K-V-A--------LA----Y
G8S011_ACTS5/13-151-------QAAE-----D----A-W-----N------T----R----D---P----R----R-V-A--------AA----Y
A7IEF3_XANP2/4-145-------RLAE-----D----A-W-----N------S----R----D---P----E----R-V-S--------LA----Y
S5T289_9CORY/4-145-------RGAE-----D----A-W-----N------T----R----D---P----E----K-V-S--------LA----Y
Q885A5_PSESM/6-147-------RGAE-----D----G-W-----N------S----R----D---A----A----K-V-A--------LA----Y
C5CRQ3_VARPS/4-139-------QAAE-----D----A-W-----N------T----R----D---P----V----R-V-S--------LA----Y
A8GGW9_SERP5/4-145-------RLAE-----D----A-W-----N------S----R----D---P----E----R-V-S--------QV----Y
H1VKH9_COLHI/8-137-------KAAQ-----D----A-.-----.------.----.----N---P----A----K-V-K--------LA----Y
C9SC71_VERA1/6-139-------KAAQ-----D----A-W-----N------T----K----D---P----E----T-V-K--------MA----Y
A4AWU7_MARSH/5-136-------QAAE-----D----A-W-----N------S----R----D---A----K----K-V-S--------MA----Y
G0S1P6_CHATD/5-138-------KAAQ-----A----A-W-----N------T----R----N---P----E----A-V-Q--------YA----Y
A6TFT2_KLEP7/5-146-------RAAE-----D----G-W-----N------S----R----D---A----E----K-V-A--------LA----Y
I3TTF4_TISMK/2-143-------RAAE-----D----G-W-----N------S----R----D---P----E----R-V-A--------GA----Y
F0XKI1_GROCL/3-145-------KAAQ-----D----A-W-----N------T----K----D---P----V----T-V-V--------PA----Y
H5WUV2_9BURK/4-145-------RGAE-----D----A-W-----N------T----R----D---P----E----V-C-A--------RV----Y
B2J4W5_NOSP7/43-183-------RIAE-----D----A-W-----N------T----H----N---P----E----L-V-S--------LA----Y
I1XFA4_METNJ/7-148-------RMAE-----D----G-W-----N------S----R----D---P----E----K-V-A--------LA----Y
Q22CF4_TETTS/39-179-------RLAE-----D----N-W-----N------G----Q----K---P----E----K-V-C--------LA----Y
L0D9F8_SINAD/3-142-------RMAE-----D----A-W-----N------S----R----D---P----E----R-V-S--------LA----Y
Q13SF9_BURXL/8-149-------RAAE-----D----G-W-----N------T----R----D---P----E----R-V-S--------LA----Y
B0SVP8_CAUSK/2-143-------QAAE-----D----G-W-----N------S----R----D---P----K----A-V-A--------QA----Y
J9ZA59_LEPFM/171-312-------RMAE-----D----A-W-----N------S----R----I---P----E----R-V-A--------MA----Y
B2HLU4_MYCMM/8-145-------QAAE-----D----A-W-----N------T----R----D---P----Q----R-V-S--------LA----Y
B6JDE8_OLICO/4-144-------RMAE-----D----G-W-----N------S----R----D---P----H----K-V-A--------LV----Y
Q0SDQ5_RHOSR/4-146-------RAAE-----D----G-W-----N------S----R----D---P----E----K-V-A--------QA----Y
K9P7V3_CYAGP/12-153-------RLAE-----D----A-W-----N------G----R----D---P----E----R-V-A--------LA----Y
E8UXY2_TERSS/9-148-------RKAE-----D----G-W-----N------S----R----D---P----E----R-V-S--------LA----Y
A1TEA6_MYCVP/5-143-------QAAE-----D----A-W-----N------T----C----D---P----H----R-V-S--------LA----Y
H3G8D3_PHYRM/7-149-------RAAE-----D----A-W-----N------S----R----D---P----S----R-V-A--------LA----Y
B5HC01_STRPR/5-139-------QAAE-----D----A-W-----N------T----R----D---P----H----K-V-A--------LA----Y
D8J274_HERSS/4-146-------RLAE-----N----G-W-----N------T----R----D---A----E----K-V-A--------LA----Y
A9CLA1_AGRT5/3-144-------RLAE-----D----G-W-----N------S----R----D---A----A----K-V-A--------LA----Y
U9U4M7_RHIID/3-136-------KNAQ-----N----L-W-----N------T----K----D---P----Y----K-V-V--------KA----Y
R7YWN8_CONA1/3-136-------KKAQ-----D----L-W-----N------T----K----D---P----Q----N-V-A--------KA----Y
D5SQM6_PLAL2/13-153-------RLAE-----D----S-W-----N------S----R----D---P----V----R-V-S--------LA----Y
B2VFK9_ERWT9/4-145-------RLAE-----D----G-W-----N------S----R----N---P----A----N-V-A--------LA----Y
G2XW21_BOTF4/6-139-------KAAQ-----D----V-W-----N------T----K----N---P----Q----V-V-K--------NA----Y
G0QZB1_ICHMG/9-148-------RIAE-----N----A-W-----N------S----R----D---P----E----K-V-S--------LA----Y
B2GL83_KOCRD/106-244-------QAAE-----D----A-W-----N------T----R----D---P----E----T-V-A--------QA----Y
Q5YSZ9_NOCFA/2-140-------RAAE-----H----A-W-----N------T----R----D---P----E----L-V-A--------AA----Y
C1D428_DEIDV/3-144-------RLAE-----D----A-W-----N------S----R----D---P----A----R-V-A--------QA----Y
Q54IV5_DICDI/7-149-------RMAE-----D----A-W-----N------S----R----N---A----E----T-V-S--------LA----Y
V5X9V4_MYCNE/4-146-------RLAE-----D----A-W-----N------S----R----D---P----Q----R-V-A--------EG----Y
K0CAH5_ALCDB/6-147-------RLAE-----D----G-W-----N------S----R----D---A----D----K-V-A--------MA----Y
Q7N4C4_PHOLL/8-149-------RLAE-----D----G-W-----N------S----R----D---P----E----K-V-S--------LA----Y
G2I426_GLUMN/10-151-------RLAE-----D----A-W-----N------T----R----N---P----E----Q-V-A--------LA----Y
H5X2U0_9PSEU/4-142-------QAAE-----D----A-W-----N------T----R----D---P----E----R-V-A--------LA----Y
D8PXS5_SCHCM/5-141-------KIAQ-----N----L-W-----N------T----R----D---P----H----T-V-A--------KA----Y
Q9EWS6_STRCO/6-144-------RAAE-----D----A-W-----N------T----R----D---P----H----Q-V-A--------LA----Y
D7A7G0_STAND/5-147-------RGAE-----D----G-W-----N------S----C----N---P----E----R-V-S--------LV----Y
Q89E77_BRADU/3-145-------RMAE-----D----A-W-----N------S----R----D---P----V----R-V-S--------LA----Y
W5TP00_9NOCA/5-143-------QAAE-----D----A-W-----N------T----R----D---P----E----R-V-A--------LA----Y
D4Z2H4_SPHJU/1-139-------RKAE-----D----A-W-----N------S----R----D---P----E----R-V-S--------LA----Y
G0JRN5_9GAMM/7-145-------RMAE-----D----L-W-----N------T----R----D---P----E----R-V-V--------QA----Y
U7PTH1_SPOS1/14-164-------KAAQ-----D----A-W-----N------T----K----N---P----S----I-V-A--------PA----Y
Q98G19_RHILO/5-146-------RMAE-----D----A-W-----N------S----R----D---P----A----R-V-A--------LA----Y
D2R1I3_PIRSD/5-144-------RAAE-----D----A-W-----N------S----R----D---P----Q----R-V-S--------LA----Y
E8WVZ4_ACISM/7-146-------RKAE-----D----G-W-----N------S----R----N---P----A----Q-V-S--------LA----Y
X5DM97_9CORY/10-144-------QAAE-----D----A-W-----N------S----R----D---P----E----R-V-A--------LA----Y
F0YBN4_AURAN/19-160-------RAAE-----D----A-W-----N------N----R----D---P----T----K-V-P--------LA----Y
W0AHH8_9SPHN/3-144-------RLAE-----D----G-W-----N------S----R----N---P----Q----Q-V-A--------QA----Y
G4QL15_GLANF/4-145-------RLAE-----D----G-W-----N------N----R----N---P----E----A-V-S--------KA----Y
Q0BTU2_GRABC/10-152-------RAAE-----D----A-W-----N------G----R----N---P----A----R-I-A--------LA----Y
G0A5W1_METMM/4-145-------RMAE-----D----A-W-----N------S----R----D---P----D----R-V-V--------QV----Y
E3RSR6_PYRTT/4-136-------KKAQ-----D----L-W-----N------S----Q----N---P----T----E-I-A--------KA----Y
B9JD81_AGRRK/3-144-------RMAE-----D----G-W-----N------S----R----D---P----E----R-V-S--------KV----Y
F4CJE3_PSEUX/3-141-------QAAE-----D----A-W-----N------T----R----D---P----E----K-V-S--------LA----Y
S8EP88_FOMPI/6-139-------KIAQ-----R----L-W-----N------T----R----D---P----Q----K-V-C--------LA----Y
U5VZT1_9ACTO/7-144-------QAAE-----D----A-W-----N------S----R----D---P----E----R-V-A--------AA----Y
G8MBF7_9BURK/4-145-------RLAE-----D----A-W-----N------T----R----E---P----E----R-V-S--------LA----Y
M5BXI4_THACB/11-144-------KTAQ-----H----L-W-----N------G----Q----D---P----E----K-I-A--------LA----Y
C7JB99_ACEP3/3-144-------RLAE-----D----A-W-----N------S----Q----N---P----E----Q-V-A--------QA----Y
H6R3X0_NOCCG/2-140-------RAAE-----D----A-W-----N------T----R----E---P----E----R-V-A--------AA----Y
M5ED51_MALS4/5-143-------REYE-----N----Y-W-----N------T----R----N---V----D----G-L-L--------QS----Y
G9N5Z7_HYPVG/7-140-------KAAQ-----D----A-W-----N------T----R----N---P----D----G-V-K--------MA----Y
E2Q788_STRC2/27-168-------RLAE-----D----A-W-----N------S----R----T---P----D----R-V-A--------LA----Y
B1ZPU1_OPITP/4-139-------QAAE-----D----A-W-----N------S----R----D---P----E----R-V-A--------LA----Y
Q15WT6_PSEA6/4-145-------RLAE-----D----G-W-----N------S----R----N---P----A----K-V-S--------LA----Y
K3X756_PYTUL/14-156-------RAAE-----D----A-W-----N------S----R----D---P----K----R-V-A--------QA----Y
Q7U6B9_SYNPX/4-145-------RMAE-----N----A-W-----N------S----K----D---P----D----K-V-S--------LA----Y
D0L163_HALNC/4-145-------RLAE-----D----A-W-----N------S----R----D---P----E----R-V-A--------LV----Y
A2SLJ7_METPP/6-147-------RLAE-----D----A-W-----N------T----R----D---P----D----V-V-V--------RV----Y
A1R1Y4_ARTAT/3-145-------RAAE-----D----G-W-----N------T----R----D---P----E----R-I-S--------LA----Y
Q9HTG9_PSEAE/5-146-------RAAE-----D----G-W-----N------S----R----D---P----Q----R-V-S--------LA----Y
I0IPS3_LEPFC/8-149-------RMAE-----D----G-W-----N------S----R----I---P----E----K-V-A--------LA----Y
B0UGB1_METS4/5-146-------RAAE-----D----A-W-----N------H----R----D---P----V----R-V-S--------LA----Y
E3J6U8_FRASU/6-147-------RKAE-----D----A-W-----N------S----R----D---P----G----A-V-A--------LA----Y
M7T297_EUTLA/9-142-------KTAQ-----D----A-W-----N------T----K----N---P----D----H-V-K--------LA----Y
C7Z2B0_NECH7/5-138-------KAAQ-----D----A-W-----N------T----M----T---P----S----K-V-K--------MA----Y
H5WPP8_9BURK/3-144-------RLAE-----D----A-W-----N------G----R----N---P----A----R-V-A--------LA----Y
G8PVW6_PSEUV/16-157-------RAAE-----D----G-W-----N------S----R----D---P----Q----K-V-A--------LA----Y
A0QXH1_MYCS2/44-186-------RAAE-----N----L-W-----N------T----R----E---P----E----R-V-A--------RG----Y
M2MCV5_BAUCO/3-135-------KKAQ-----D----L-W-----N------T----Q----D---P----E----K-V-S--------KA----Y
F0ZYB6_DICPU/10-150-------RKAE-----D----A-W-----N------S----R----D---P----E----L-V-S--------KA----Y
B7FPL0_PHATC/7-147-------RLAE-----D----A-W-----N------S----Q----D---P----D----R-V-K--------MA----Y
M9R4P9_9RHOB/4-146-------RMAE-----N----A-W-----N------S----R----D---P----A----S-V-A--------MA----Y
K9Z981_CYAAP/4-141-------QMAE-----D----A-W-----N------T----R----D---P----E----K-V-V--------LA----Y
K5W331_PHACS/5-139-------KAGQ-----D----L-W-----N------T----Q----D---P----H----K-V-A--------QA----Y
Q55953_SYNY3/3-145-------RMAE-----N----A-W-----N------G----R----N---P----D----K-V-C--------MA----Y
D3VFP0_XENNA/15-155-------RMAE-----D----A-W-----N------T----R----D---A----S----K-V-A--------LA----Y
X4ZP44_9BORD/5-146-------RAAE-----D----A-W-----N------G----R----D---P----V----K-V-S--------LA----Y
J7Q4K9_METSZ/3-144-------RMAE-----D----A-W-----N------T----R----D---P----E----R-V-S--------LA----Y
G8NNR6_GRAMM/8-147-------RKAE-----D----G-W-----N------S----R----D---P----E----K-V-S--------LV----Y
F5Z8Z6_ALTSS/2-143-------RLAE-----D----A-W-----N------S----R----S---P----V----R-V-A--------AA----Y
A1SY21_PSYIN/11-152-------RLAE-----D----A-W-----N------N----Q----D---P----T----K-I-A--------TA----Y
Q21GU9_SACD2/13-154-------RMAE-----N----A-W-----N------N----K----D---P----H----K-V-A--------TA----Y
Q21F42_SACD2/3-144-------RLAE-----D----G-W-----N------S----R----D---P----H----K-V-A--------LA----Y
V9VX09_9RHOB/6-147-------RAAE-----D----G-W-----N------S----R----N---P----E----A-V-A--------QA----Y
Q5KH63_CRYNJ/33-166-------..AS-----T----Y-P-----Y------T----K----N---P----S----L-I-S--------PA----Y
Q1GQL6_SPHAL/3-142-------RLAE-----D----G-W-----N------S----R----D---P----A----R-V-A--------LA----Y
C0ZND5_RHOE4/4-146-------RLAE-----D----G-W-----N------S----R----D---P----H----K-V-S--------LA----Y
C5BRE0_TERTT/11-152-------RLAE-----D----A-W-----N------L----K----N---A----E----K-I-A--------TA----Y
B1MD11_MYCA9/3-141-------RAAE-----N----A-W-----N------T----R----D---P----E----G-V-A--------AA----Y
M2QHK1_CERS8/5-140-------KAAQ-----R----L-W-----N------T----R----D---A----H----K-V-S--------LA----Y
E4N6H5_KITSK/5-143-------QAAE-----D----A-W-----N------T----R----D---P----E----R-V-A--------LA----Y
Q47FW0_DECAR/5-146-------RLAE-----D----A-W-----N------S----R----D---P----D----R-V-V--------LV----Y
C3AVR5_BACMY/6-137-------KFAE-----D----A-W-----N------S----Q----D---P----E----R-I-S--------MG----Y
Q2S7F5_HAHCH/11-143-------KMAE-----D----A-W-----N------T----C----N---P----E----V-V-A--------LG----Y
B0CZ00_LACBS/4-135-------KAAQ-----A----L-W-----N------T----R----D---P----Q----K-V-S--------LA----Y
K9WB99_9CYAN/25-158-------QAAE-----D----A-W-----N------T----R----D---P----E----R-V-S--------LA----Y
D3B3X0_POLPA/7-146-------RLAE-----D----A-W-----N------S----R----D---P----T----R-V-S--------QA----Y
H6RTK1_BLASD/3-141-------QAAE-----D----G-W-----N------T----R----D---P----E----K-V-A--------LA----Y
I4F4V6_MODMB/4-137-------QAAE-----D----A-W-----N------S----R----D---P----H----R-V-S--------LA----Y
C6WWQ1_METML/8-149-------RLAE-----D----G-W-----N------S----R----D---P----Q----R-V-S--------LV----Y
K2SA46_MACPH/4-136-------KKAQ-----D----L-W-----N------T----Q----K---P----E----D-V-V--------KA----Y
N0BCT9_9RHIZ/4-145-------RGAE-----D----A-W-----N------M----R----D---P----E----R-V-A--------LA----Y
G9AXF7_PANAN/5-147-------RLAE-----D----A-W-----N------S----R----D---P----E----R-V-S--------LA----Y
G3JBC0_CORMM/6-139-------KAAQ-----D----A-W-----N------T----K----T---P----D----T-V-K--------MA----Y
F5YW52_MYCSD/4-135-------RAAE-----D----A-W-----N------T----R----D---P----E----R-V-A--------QA----Y
A0R5M4_MYCS2/6-147-------RLAE-----D----A-W-----N------S----R----D---P----Q----R-V-S--------LA----Y
Q7NUJ9_CHRVO/4-145-------RLAE-----D----G-W-----N------S----R----D---P----A----R-V-A--------QA----Y
K7SXB6_GLUOY/4-145-------RAAE-----D----A-W-----N------G----Q----C---S----E----H-V-A--------LA----Y
E6WG68_PANSA/2-141-------RMAE-----D----A-W-----N------S----R----D---A----Q----R-V-S--------QV----Y
R4STA4_AMYOR/5-143-------QAAE-----D----A-W-----N------T----R----D---P----R----K-V-S--------SA----Y

PF02136

NTF2_ARATH/9-123-------HYY------S----T-F-----D------T....N----R---V----G----.-L-A--------GL----Y
Q9M2S5_ARATH/166-285-------VYY------E----L-P-----M------R.....----.---.----E----E-L-G--------LM----Y
Q9AK31_STRCO/205-316-------RYV------A----A-F-----E------G....Y----D---M----T----A-L-T--------AL----L
O53486_MYCTU/8-130-------RSP------Q----A-A-----A------A....H----D---R----A----G-W-V--------GL----F
Q9LDI9_ARATH/13-128-------QYY------H----V-L-----G------Q.....----L---P----H----E-A-R--------RL----.
Q9FND0_ARATH/11-125-------QYY------Q----V-L-----Q------Q.....----Q---P----D----L-I-H--------QF----Y
Q9LMX6_ARATH/15-131-------KYY------N----L-L-----Y------K.....----S---P----S----Q-V-H--------QF----.
NTF2_ORYSJ/6-119-------HYY------R----T-F-----D------T....N----R---P----A----.-L-V--------SL----Y
NTF2_YEAST/8-121-------FYY------N----Q-F-----D------T....D----R---S----Q----.-L-G--------NL----Y
G3BP2_MOUSE/11-133-------QYY------T----L-L-----N------K.....----A---P----E----Y-L-H--------RF----.
NTF2_RAT/10-121-------HYY------Q----L-F-----D------N....D----R---T----Q----.-L-G--------AI----Y
OCP_SYNY3/193-308-------NYM------D----N-L-----N------A....N----D---F----D----T-L-I--------EL----F
Q9A8Y8_CAUCR/127-234-------RLY------D----A-I-----N------A....G----D---V----D----G-A-A--------AC----F
NTF2_CAEEL/10-128-------HYY------S----K-F-----D------VGDGMS----R---A----Q----G-L-S--------DL----Y
NXT1_MOUSE/16-135-------VYY------T----T-M-----D------K.....----R---R----R----L-L-S--------RL----Y
G3BP_SCHPO/18-134-------EYY------T----Y-L-----N------K.....----E---P----N----R-L-H--------CF----.
NTF2_NEUCR/8-121-------HYY------S----T-F-----D------S....D----R---K----N----.-L-A--------GL----Y
NXT2_HUMAN/17-136-------IYY------E----T-M-----D------K.....----R---R----R----A-L-T--------RL----Y
Q9M2S5_ARATH/32-154-------SYF------L----N-L-----G------V.....----Y---P----E----V-V-Q--------MM----W
G3BP1_MOUSE/11-133-------QYY------T----L-L-----N------Q.....----A---P----D----M-L-H--------RF----.
Q21351_CAEEL/36-143-------QFY------I----T-V-----S------E.....----N---R----K----A-I-T--------KF----Y
Q9ZPR2_ARATH/15-131-------EYY------N----H-L-----Y------D.....----S---T----S----E-V-H--------KF----.
NXF1_RAT/385-535-------QYY------A----I-Y-----D------S....G----D---R----Q----G-L-L--------DA----Y
Q9C9I5_ARATH/70-192-------SFY------A----A-V-----N------V....H----D---L----S----S-V-T--------DL----I
NXT1_CAEEL/19-135-------VYY------D----V-M-----D------R.....----K---R----E----K-I-G--------FL----Y
NTF2_SCHPO/7-120-------FYY------Q----T-F-----D------S....D----R---S----Q----.-L-S--------SL----Y
NTF2_YARLI/8-121-------FYY------Q----T-F-----D------T.....----D---R----S----Q-L-G--------NL----Y
Q9VRD6_DROME/10-124-------QYY------A----I-F-----D------DP..AN----R---A----N----.-V-V--------NF----Y
BRE5_YEAST/8-140-------NYY------E----R-M-----R------T.....----D---P----S----K-L-A--------YF----Y
NXT1_DROME/15-130-------LYY------A----S-V-----D------N.....----R---R----Q----Q-I-G--------RL----Y
Q9FME2_ARATH/15-131-------QYY------H----I-L-----H------Q.....----S---P----G----L-V-H--------RF----.
B4R173_DROSI/16-129-------QYY------T----L-L-----N------K.....----A---P----N----H-L-H--------RF----Y
D0J389_COMT2/2-115-------RYV------A----A-L-----N------A....G----D---L----D----G-I-V--------AL----F
F4JED3_ARATH/281-394-------QYY------N----T-L-----Q------N.....----A---P----E----N-L-Y--------KL----Y
F4JED3_ARATH/948-1060-------HYY------N----N-L-----Q------N.....----S---P----E----I-L-P--------GY----Y
I6WZD7_MYCTU/11-135-------SSW------R----C-V-----Q------A....H----D---R----E----G-W-L--------AL----M
Q84JH2_ARATH/16-133-------QYY------Y----I-F-----C------N.....----M---P----E----H-L-P--------RF----Y
Q8VYJ4_ARATH/19-135-------QYY------H----I-L-----H------Q.....----S---P----E----H-V-H--------RF----Y

PF03284

PHZA2_PSEAE/1-162-------RRNR-----A----T-V-----EHYMRM.K----G----A--------E----RLQRH--------SL----F
C5AHF3_BURGB/12-165-------QHNR-----K----I-V-----EQYMHT.R----G----E--------A----RLKRH--------LL----F
PHZB2_PSEAE/1-162-------RKNR-----E----T-V-----VKYMNT.K----G----Q--------D----RLRRH--------EL----F
M4RPB3_9BIFI/2-155-------EHNR-----A----V-V-----DKYLHSGH----G----D--------A----LLHRH--------EL----F

PF10429

Q6CF15_YARLI/5-151-------QFF------K----A-L-----D.......----....-D---H----R----Q-N-L--------PQ----F
Q6CWP0_KLULA/2-178-------KVL------A----H-L-----D......E----PDPA-K---L----E----Q-F-L--------QL----F
MTR2_YEAST/13-184-------KIL------A----H-L-----D......D----PDSN-K---L----A----Q-F-V--------QL----F
Q757C4_ASHGO/6-167-------KLL------A----H-L-----D......E----CDVD-R---L----Q----Q-A-L--------PL----F
Q6BMR4_DEBHA/2-178-------KIL------S----S-L-----DIQYQGPS----QQFP-N---V----E----S-Y-A--------TQ----F
Q6FWG2_CANGA/8-183-------KVL------A----H-L-----D......E----QDPN-K---L----M----N-F-L--------QL----F

PF07107

WUN1_SOLTU/1-105-------ILTG-----T----A-------K------F----D----N--------A----S-F-Q--------------F
Q9LZX2_ARATH/59-162-------LLTG-----.----E-------P------P----R----Q--------V----S-F-R--------------F
I1PUL3_ORYGL/142-253-------LLTG-----.----G-------G------G----G----A--------A----G-L-P--------------F
Q0DSM5_ORYSJ/106-228-------LLTG-----.----A-------D------H----G----E--------S----R-F-L--------------F
Q94AK6_ARATH/1-110-------VLTG-----G----V-------S------P----S----S--------S----S-F-E--------------F

PF04335

A7ICW5_XANP2/23-226-------QVWD-----DRIGSARV-----Q------A----K----N---W----RLMAFGCLAL--------SA----G
Q89B84_BRADU/23-226-------QVWD-----ERIGSARV-----Q------A----R----N---W----RLMAFGSLML--------SC----G
Q6N7N1_RHOPA/23-226-------QAWD-----DRIGSARI-----Q------A----R----N---W----RLMAFGSLFL--------SA----G
Q98P55_RHILO/23-226-------QIWD-----ERIGSARV-----Q------A----R----N---W----RAMALGSLIL--------SA----G
Q210W3_RHOPB/21-224-------QVWD-----ERIGSARV-----Q------A----K----N---W----RLMAFGSLML--------SA----G
Q2GBL4_NOVAD/21-224-------QVWD-----DRIGSARV-----Q------A----R----S---W----RLAFFGALGL--------ST----C
A5V2M3_SPHWW/23-226-------QAWD-----DRIGSARA-----Q------A----Y----S---W----RLMAFGAIAV--------.L----G
B0T8Q8_CAUSK/22-225-------QAWD-----ERIGSARV-----Q------A----A----N---W----RLIALGLLAS--------NI----V
A7HU75_PARL1/22-225-------QLWD-----ERIGAARV-----Q------A----R----N---W----RLMAFGSLAL--------SA----G
Q989I9_RHILO/22-225-------QLWD-----ERIGSSRV-----Q------A----R----N---W----RFMALGCLTL--------AA----G
Q9A4Y5_CAUCR/22-225-------QLWD-----DRIGAARA-----Q------A----H----N---W----RLAFFGSLTL--------AS----V
B0T6U6_CAUSK/22-225-------QLWD-----QRIGSARV-----Q------A----H----N---W----RLAFFGMFAL--------SC----G
E0TGX7_PARBH/22-225-------QIWD-----DRIGSARV-----Q------A----K----N---W----RLMALGCLGL--------CF----V
E0TDN5_PARBH/22-225-------QVWD-----DRIGSARV-----Q------A----E----N---W----RLTALVALAL--------AF----V
B0T9G1_CAUSK/24-227-------QVWD-----DRIGAARV-----Q------A----R----N---W----RLMALACAGL--------AA----L
B0T9T9_CAUSK/23-226-------REWD-----NRIGSAVV-----Q------A----K----N---W----RMAAFGCMGL--------AA----L
B4S3J2_PROA2/22-230-------QEWD-----NRMGSAVI-----Q------A----K----N---W----RLATFATLLL--------VA----F
B4S9L7_PROA2/20-228-------KEWD-----DRMGSAIV-----Q------A----K----N---W----RLATFATICF--------IA----L
TRBF_RHISN/13-219-------QEWT-----ERYGSYVR-----A------A----A----A---W----RTVGILGLAM--------AV----I
A1VQ85_POLNA/9-215-------REWD-----ERYGGLIS-----R------A----R----N---W----QLIAAGSLAV--------AV----V
Q6LGW6_PHOPR/15-221-------HEWD-----ERMGSVTH-----Q------A----H----V---W----KLAFFAALAI--------TA----L
Q6AIG6_DESPS/13-218-------QAWA-----EENGSIIN-----S------R----N----N---W----RSCGFIALAL--------LS----F
B2JXV8_BURP8/50-259-------EFER-----SKMEMAEE-----K------A----R----V---A----DRRSVLSGGI--------AL----A
A5VH54_SPHWW/19-226-------SWDQ-----DRQRKSLR-----S------E----R----I---A----WVVAGLGLLA--------AT----A
Q9PHJ3_XYLFA/16-224-------TWET-----DKVHDLLK-----S------R----K----T---A----WWVAGASAAI--------AF----V
Q1QFH3_NITHX/19-226-------TWER-----DIARRNRN-----S------R----A----L---A----WIVAAVMTIV--------AV----G
Q981S1_RHILO/24-232-------IWEK-----DIARRNRW-----S------R----S----L---A----WCVASVASVI--------AV----A
Q11N51_CHESB/15-223-------IWEQ-----EIIKRAKR-----S------A----R----V---A----WFFSIVFAGI--------AL----L
Q6D6R5_PECAS/10-223-------SFES-----IMLEKEER-----T------R----K----T---A----WAMAAVGFTL--------AG----L
A7HZU3_CAMHC/9-222-------SYEA-----SIRYLVEK-----S------N----R----R---A----WLIAFLSIFI--------SI----I
Q07GT5_ROSDO/6-215-------TFQD-----EVFFQLRR-----Q------R----N----I---A----VWTSALSLSI--------AL----T
A5FU44_ACICJ/23-231-------SFQA-----TEKRTARR-----W------G----R----V---G----WVVAGVSLAV--------NV----T
Q2GI57_EHRCR/27-235-------SWHV-----SRYNSVVI-----Q------R----N----M---L----LFFTMLALSA--------VG----I
Q2GD27_NEOSM/14-223-------HWYE-----EHVGRVTL-----Q------R----N----F---L----VVLNLGVIVA--------LM----L
Q120E6_POLSJ/33-240-------NKFA-----EIYGSAMV-----N------S----G----R---L----FAITVVALLL--------AI----T
A1VV42_POLNA/4-211-------QVYF-----ERGSLEAI-----Q------T----H----R---W----RLISISMIVV--------TV----L
A1WP55_VEREI/21-227-------QAYF-----ERGSSQAM-----G------A----L----Y---W----RMTAIVCLLI--------VL----V
Q7WWY4_CUPNH/6-214-------QVIF-----DRTTRITV-----D------R----N----H---W----KLA....TVG--------AA----C
B2UCL3_RALPJ/26-235-------QAVF-----DQTTAVKV-----D------R----N----H---W----KIA....FLI--------AS----L
B2UKI9_RALPJ/22-233-------RGWF-----AAFQKPIL-----D------K----H----L---A----TKVAIVFAAI--------SI----G
Q21QK4_ALBFT/33-246-------NEYY-----DSVGQPVV-----D------R----A----R---L----FVI.CILLLV--------IV----V
A1WDP4_ACISJ/46-258-------RTWN-----DHVGGVVS-----Q------R----Q----T---W----QVIGILSLLI--------AL----A
A8AEX8_CITK8/10-222-------TFEQ-----QMIERDKR-----A------T----K----A---G----FVVGGMGLLI--------AV----L
A8LT11_DINSH/7-212-------IIEE-----ELVYGALR-----R------E----R----L---W----QRLGLMGLVF--------GI----I
A9BTR6_DELAS/23-225-------QVWD-----ERIGSARV-----Q------A----R----N---W----RFMAFGCLTL--------AV----L
B2FJH7_STRMK/20-240-------SYEI-----TVADMARR-----S------E----R----R---A----WWVATGSLLM--------SL----A
B4EIS2_BURCJ/10-220-------DFEA-----SLTALQAC-----S------E----R----R---A----WQVAFAAVIV--------AI----G
B9KHB0_ANAMF/20-227-------DWYH-----DRYSSVVV-----Q------R----N----V---L----LLLVVLSVFC--------IA----V
C4YUX8_9RICK/37-241-------NWYE-----ERYDKLIV-----Q------R----N----L---L----IILIILLTIF--------MV----I
G4RA85_PELHB/22-225-------QAWD-----ERIGSARV-----Q------A----R----N---W----RLMAFGSLLL--------SA----G
N0BBW1_9RHIZ/21-224-------QVWD-----ERIGSARV-----Q------A----K----S---W----RLAFFGALAL--------SG----G
O24879_HELPY/40-239-------....-----..QSVFRL-----E------R----N----R---L----KIAYKLLGLM--------SF----I
VIRB8_AGRT5/23-227-------AFQT-----ARAKSARR-----L------S----K----V---I----AAVATIAVLG--------NV----A
Q13XJ1_BURXL/12-220-------DIEA-----SLTYLQER-----S------E----R----R---A----WHVAYAAVGV--------AV----L
VIRB8_BRUA2/26-234-------NWEA-----AHVRLVEK-----S------E----R----R---A----WKIAGAFGTI--------TV----L
Q73IY8_WOLPM/19-224-------NWNS-----NRYSTVIA-----Q------R----N----I---L----LLFALILLAT--------IS----I
Q7D3R5_AGRT5/13-220-------RFDQ-----DRMIQVER-----S------K----R----I---A----WSIAIVSGIV--------AA----V
PTLE_BORPE/21-229-------DWEA-----SRLYRLAQ-----S------E----R----R---A----WTVAWAALAV--------TA----L
Q9PBT6_XYLFA/26-237-------RSWN-----SHVGQVMQ-----H------S----Q----V---G----IFVGLLGMLI--------AL----A

PF14729

Q2G174_STAA8/25-118-----------------------Y-----Q----------------K--------D------I-D--------KV----Y
YDDJ_BACSU/24-118-----------------------Y-----D----------------D--------A------I-D--------DV----I
Q2FVL6_STAA8/19-113-----------------------Y-----V----------------K--------E------I-D--------EA----V
Q5HQP4_STAEQ/24-116-----------------------Y-----H----------------D--------E------I-K--------KI----L
Q5HLI7_STAEQ/24-118-----------------------Y-----A----------------D--------K------I-D--------KA----V

PF13474

B2UGF3_RALPJ/11-131-----------LD...ED------SV--S---F--I-----L-...--------PDG--Q..RL...HG----H------
A5GCV2_GEOUR/9-131-----------S.....E------DF--S---G--F-----T-.GG--------GDF--L..VK....D----R------
C0QA63_DESAH/9-131-----------S.....D------NF--S---G--Y-----A-.GS--------SDV--L..VT....S----K------
D3SFX3_THISK/13-133-----------S.....A------EV--C---G--F-----G-.TG--------VDE--A..AF....S----P------
Q0A9T2_ALKEH/13-139-----------G.....P------LV--H---G--F-----G-.TG--------ANE--S..VY....D----P------
D6XWI0_BACIE/11-137-----------D.....G------DS--T---G--A-----G-.TG--------AGE--M..AY....T----Y------
D2PT47_KRIFD/6-126-----------S.....A------DV--L---M--F-----D-VPP--------PYE--G..LR....G----L------
Q92KR9_RHIME/14-134-----------T.....E------DC--L---V--F-----S-.LA--------PPL--K..AS....D----A------
C3MEI6_RHISN/13-133-----------T.....Q------DC--V---I--Y-----S-.LA--------PPL--K..AS....D----A------
D0LTP7_HALO1/11-135-----------SH...GA------HV--R---C--V-----H-.PG--------W.E--M..LE....G----W------
B5GPB4_STRC2/9-136-----------L....DD------EI--S---C--I-----H-.PG--------W.P--V..LS....G----R------
B5HIA9_STRPR/9-137-----------L....DD------DI--S---C--I-----H-.PG--------W.P--V..LS....G----R------
D7B847_NOCDD/11-139-----------AEEHEAP------DL--V---C--V-----N-.PG--------WPL--L...R....G----R------
D1A544_THECD/9-137-----------AD...GP------YA--A---A--V-----G-.CV--------HPG--WPLLR....G----R------
A4YP86_BRASO/20-133-----------AD...RD------GI--S---C--I-----H-.PG--------W.P--A..IV....G----R------
Q89F64_BRADU/7-119-----------AD...DD------AI--S---C--I-----H-.PG--------W.P--A..II....G----R------
B2IHF2_BEII9/4-117-----------A....PE------DI--S---C--V-----H-.PG--------W.P--V..LI....G----R------
B9GXK0_POPTR/174-290-----------LN...SD------YV--K---C--.-----T-.HA--------SGE--N..FS....G----Y------
B1ZXW2_OPITP/468-592-----------G.....D------DL--F---H--F-----W-.VF--------SNS--T..VI....G----L------
Q01ZK2_SOLUE/25-147-----------LP...ND------RG--S---I--A-----Q-...--------SGF--L..FL....T----R------
B1ZMY8_OPITP/43-165-----------VD...TD------KG--M---I--V-----Q-.NG--------T..--I..FR....T----R------
C6X4B7_FLAB3/29-152-----------A.....P------NF--V---G--Y-----H-...--------PDG--S..VG....T----R------
C4XSI3_DESMR/466-578-----------A.....D------NA--V---Q--.-----.-...--------..G--S..LK....G----K------
Q1DE35_MYXXD/42-156-----------T.....D------DA--V---Y--L-----G-.TD--------ATE--R..WT.....----R------
Q487W3_COLP3/33-147-----------S.....Q------DA--I---F--L-----G-.TD--------ASE--R..W.....S----K------
A3U720_CROAH/41-154-----------T.....D------DG--V---F--I-----G-.TD--------ATE--N..WQ.....----N------
A5FK93_FLAJ1/24-137-----------A.....D------DA--V---Y--I-----G-.TD--------ATE--N..WT.....----K------
A6GVS5_FLAPJ/25-138-----------T.....N------DA--V---F--I-----G-.TD--------PTE--N..W.....N----K------
C6X3L7_FLAB3/38-151-----------A.....E------ES--T---F--I-----G-.TD--------ATE--V..W.....N----K------
A4CH66_ROBBH/18-131-----------A.....P------GG--V---F--I-----G-.TD--------ASE--N..W.....D----R------
A0M5Z5_GRAFK/38-151-----------T.....E------DA--I---F--I-----G-.TD--------ATE--N..WT.....----L------
A2TYG4_9FLAO/37-150-----------D.....S------TS--I---F--I-----G-.TD--------ASE--N..WT.....----K------
A3QCF0_SHELP/31-139-----------T.....E------DA--H---F--I-----G-.TD--------ATE--N..W.....N----M------
Q12PU2_SHEDO/77-185-----------H.....P------DA--A---F--I-----G-.TD--------ATE--R..WN.....----M------
Q085V8_SHEFN/80-188-----------H.....P------QA--V---F--I-----G-.TD--------DSE--R...W....N----M------
A1S876_SHEAM/27-135-----------T.....Q------DA--V---F--L-----G-.TD--------ASE--R...W....G----M------
D9QI29_BRESC/22-140-----------S.....P------DA--R---F--V-----G-.TD--------AGE--H..WT.....----M------
Q15XC4_PSEA6/38-153-----------T.....D------TG--V---F--M-----G-.TD--------DWE--R..WS....R----P------
B9TH82_RICCO/29-143-----------A.....P------DG--V---Y--I-----G-.TD--------RTE--L..W.....Q----R------
D4LV59_9FIRM/8-130-----------A.....P------QI--V---W--I-----S-.AR--------QDE--Y..LL....T----L------
B8FCE8_DESAA/7-126-----------SQ...ED------GV--L---A--I-----G-.TD--------PSE--W..WI....G----Y------
Q5LP72_RUEPO/8-127-----------SQ...SD------AL--V---Y--I-----G-.TA--------DGE--L..WR....G----Q------
A3HV45_9BACT/11-133-----------S.....D------DY--H---F--I-----G-.ST--------DNE--E..YL....S----R------
B8GG61_METPE/21-142-----------S.....P------EI--S---G--F-----G-.SG--------PDE--V..IE....N----R------
B8CPV1_SHEPW/7-128-----------ED...SD------DI--S---I--I-----G-.TG--------ADE--L..CI....G----R------
D4MSP2_9FIRM/78-205-----------S.....E------KI--M---S--F-----G-.TE--------EQE--I..AR....N----K------
D9T710_MICAI/40-166-----------A.....E------EF--T---T--Y-----E-.LT--------SAE--G..HAVTITE----K------
Q13UI8_BURXL/13-130-----------ID...EE------FV--S---C--I-----C-..A--------DGS--H..LH....G----L------
Q3ZAF4_DEHM1/11-133-----------DS...EP------NI--L---T--V-----G-.PC--------PDN--V..GL....G----Q------
Q63WV1_BURPS/13-127-----------ID...ED------FA--S---C--I-----W-.SD--------GT.--H..LH....G----L------
Q8RYS9_ORYSJ/166-284-----------LN...AD------YV--K---C--I-----H-..A--------TGE--L..FT....G----Y------
R5FDC6_9CLOT/10-131-----------A.....D------DI--I---W--L-----G-.GG--------KRQ--K..AE....G----R------
R5TK35_9CLOT/9-131-----------A.....D------DI--I---W--L-----G-.GG--------EHQ--K..AE....G----K------
R6QJ83_9FIRM/13-123-----------S.....E------DI--S---F--I-----G-.TG--------ERE--Y..AF....G----R------

PF14534

Q4KEE9_PSEF5/7-110-----------A----.D-----.DF..L---E--F.....G--VS........GGR..W--..----D....K------
A0JT09_ARTS2/213-310-----------H----.P-----.EF..T---E--I.....G--SS........GRL..W--..----T....R------
A1CFS1_ASPCL/12-120-----------S----.P-----.EV..N---M--M.....F--PK........TPV..L--..----TL.EGE------
A1R3I0_ARTAT/269-366-----------H----.P-----.DF..A---E--I.....G--SS........GRF..W--..----T....R------
A1U4T2_MARAV/6-114-----------A----.D-----.NF..M---V--T.....T--ER........G.V..Q--..----S....K------
A2QV30_ASPNC/167-275-----------N----.E-----.EA..N---L--L.....F--PQR.....EILHL..H--..----S....K------
A3CS44_METMJ/8-106-----------A----.P-----.EA..L---V--V.....T--LC.........AV..L--..----D....R------
A3HWU2_9BACT/60-168-----------H----.D-----.DF..R---L--I.....R--TY........GDVPPI--..----S....K------
A3HZW5_9BACT/30-137-----------G----.S-----.EF..V---W--V.....H--NH........GSM..V--.D----T....K------
A3I0D3_9BACT/31-149-----------S----.E-----.DF..E---F--F.....H--DK........GGF..T--.A----S....K------
A3QEM3_SHELP/29-149-----------A----.E-----.NA..C---Y--IP...EQ--QN........KEI..T--.M----G....R------
A3QJ67_SHELP/5-108-----------H----.A-----.DF..L---E--V.....G--AT........GMS..F--..----G....K------
A4AQI2_MARSH/45-155-----------D----.E-----.DI..E---F--Y.....H--DK........GGL.AT--..----S....K------
A4CNU2_ROBBH/46-156-----------S----.D-----.SL..E---F--Y.....H--DQ........GGL.ST--..----S....K------
A4RV71_OSTLU/211-315-----------S----.K-----.SK..T---R--Q.....S--AL........APL..V--..----D....K------
A5FMK8_FLAJ1/6-112-----------H----.D-----.DL..L---F--N.....M--PD........GQT..I--..----T....K------
A5FMN4_FLAJ1/37-145-----------A----.D-----.DV..E---F--Y.....D--DR.......SGLN..I--..----S....K------
A5G8N2_GEOUR/26-129-----------S----.H-----.DY...---.--L.....D--KG........QDF..T--..----A....K------
A5V3K3_SPHWW/11-125-----------R----.K-----.DA..L---L--A.....P--SA........RPV..S--PT----D....I------
A5V8Q2_SPHWW/64-171-----------A----.P-----.DI..T---H--T.....H--TR........GVT..D--..----D....F------
A5VGJ3_SPHWW/7-115-----------S----.P-----.DL..I---F--T.....N--QV........GVR..L--..----D....K------
A5WEC7_PSYWF/5-111-----------D----.A-----.DL..R---Y--V.....H--SS........GAI..D--..----D....L------
A6LYA2_CLOB8/8-113-----------S----.N-----.DF..I---E--F.....T--SS........GSE..Y--..----HY..KN------
A6VR33_ACTSZ/42-148-----------A----.D-----.GF..T---L--T.....H--IT........GYK..Q--..----S....K------
A6WA45_KINRD/27-133-----------T----.G-----.AF..T---L--T.....H--TS........GYV..Q--..----A....K------
A6WB55_KINRD/3-111-----------H----.A-----.DF..V---L--C.....T--PS........GDL..W--..----D....R------
A8GEK8_SERP5/4-112-----------H----.D-----.DF..E---E--I.....G--RS........GHY..Y--..----D....K------
A8LTG7_DINSH/19-134-----------V----.Q-----.DARTR---L--I.....S--ASAA....FGVTV..Q--..----D....G------
A9C0J7_DELAS/26-133-----------H----.E-----.DF..L---E--F.....G--RS........GGV..H--..----D....R------
A9GA01_SORC5/28-134-----------T----.P-----.DF..V---I--Y.....E--.N........GKV..I--..----N....N------
B0SZM9_CAUSK/8-116-----------A----.P-----.DI..K---V--I....VG--DG........SLI..L--..----G....A------
B0T7A9_CAUSK/166-269-----------T----.A-----.DA..W---L--T.....G--PS........GTE..G--..----L....A------
B1M5Q7_METRJ/38-144-----------L----.D-----.GL..S---Y--G.....H--SS........GQV..Q--..----D....K------
B1ZQQ6_OPITP/36-143-----------S----.D-----.SL..R---Y--A.....H--SN........GKI..D--..----T....K------
B1ZZ14_OPITP/30-139-----------S----.P-----.MM..I---V--N.....N--PQ........STI..T--.P----D....R------
B2GBD5_LACF3/9-117-----------A----.E-----.TM..T---L--T.....H--MT........GYV..Q--..----P....R------
B2JCD2_BURP8/9-116-----------S----.D-----.NV..I---Y--V.....H--TN........GKR..E--..----S....K------
B2JPS0_BURP8/31-132-----------D----.D-----.SY..R---E--I.....T--PS........GKA..R--..----S....K------
B3PI44_CELJU/32-141-----------A----.P-----.EY..S---W--V.....H--NL.......ASLT..E--..----D....K------
B4RBI8_PHEZH/167-269-----------A----.E-----.DA..R---I--T.....G--SK.......ARPP..A--..----T....R------
B4RHA1_PHEZH/45-153-----------L----.N-----.PG..V---V--F.....V--SK........GRF..Q--.D----GWQGTL------
B5GTL4_STRC2/19-130-----------A----.T-----.EA..S---W--S.....N--AM........GTR..L--.D----G....R------
B5I698_9ACTO/6-123-----------L----.P-----.GG..V---I--VK...TG--PE........FTV..Y--..----T....V------
B7JXD1_CYAP8/8-119-----------T----.E-----.NA..L---W--M.....A--PN.......VIDR..C--..----G....I------
B8GT08_THISH/17-126-----------H----.P-----.RY..M---G--W.....D--MN........SPV.PH--..----D....R------
B8MZS8_ASPFN/6-119-----------S----.D-----.DC..I---M--V.....F--PG........GMK..L--..----S....K------
B9E8X8_MACCJ/8-114-----------M----.D-----.GS..Y---L--T.....H--IT........GYK..Q--..----K....K------
C1A7K4_GEMAT/10-121-----------D----.A-----.SI..E---V--A.....V--AG........GPA..L--.R----GIPANR------
C1ABS4_GEMAT/430-537-----------G----.N-----VQI..L---E--R.....G--TA........EPL..A--..----E....Y------
C1CZM8_DEIDV/15-112-----------A----.D-----.DW..M---A--F.....F--PD........GTV..V--..----F....K------
C1F8H5_ACIC5/21-124-----------A----.E-----.DF..R---E--F.....G--SS........GRV..F--..----S....K------
C3AMI1_BACMY/20-132-----------T----.L-----.NA..T---W--V.....N--VF........GKR..L--..----S....G------
C3ZF01_BRAFL/355-462-----------T----.V-----.DC..K---I--M.....V--TG........MDT..Q--.Y----G....R------
C4L6W4_EXISA/8-106-----------T----.D-----.DF..F---E--I.....G--SS........GRL..L--..----Y....Q------
C5BK93_TERTT/4-109-----------H----.P-----.EF..V---E--I.....G--YS........GTE..Y--..----T....R------
C5CWD6_VARPS/8-118-----------C----.E-----.PA..F---M--V.....S--SH........GSM.KF--..----D....H------
C6XYF7_PEDHD/10-116-----------H----.D-----.DL..L---F--I.....L--PS........GET..I--..----T....K------
C6Y015_PEDHD/172-276-----------N----.P-----.DA..R---L--L.....F--PG.......YEPI..V--..----G....K------
C7M5E0_CAPOD/27-132-----------A----.P-----.EA..V---F--V.....H--MG........A.T..L--..----V....R------
C7NFY8_KYTSD/186-282-----------H----.A-----.DW..Y---E--V.....G--AS........GRV..W--..----T....R------
C7NIZ7_KYTSD/228-329-----------S----.P-----.EF..V---E--I.....G--AS........GRR..W--..----D....R------
C7RBL7_KANKD/30-150-----------S----.K-----.DL..V---F--Y.....H--DQ........GGI..Q--..----H....K------
C9YUI3_STRSW/23-131-----------H----.P-----.DA..L---W--T.....T--AH........GKV..L--.I----GL.PAI------
D2ATH3_STRRD/10-114-----------T----.D-----.RT..L---C--V.....E--PD........G.L..Q--..----T....G------
D2PZL0_KRIFD/6-115-----------A----.D-----.DF..R---L--V.....T--PS........GLV..W--..----S....K------
D3F9E1_CONWI/19-126-----------H----.E-----.HV..V---Y--V.....G--PD........GSE..L--..----D....R------
D3FXC8_BACPE/11-109-----------A----.D-----.DF..L---E--F.....A--SS........GQV..W--..----V....R------
D3Q9C7_STANL/5-122-----------R----.D-----.ET..I---V--V.....N--IA........GRR.VL--..----G....K------
D3S9F1_THISK/27-146-----------Q----.D-----.DA..G---L--I.....N--LF........GMR..F--.D----D....R------
D5DIB8_BACMD/6-113-----------S----.D-----.EL..I---F--V.....N--HL........GQW..L--..----S....K------
D5SSM1_PLAL2/48-156-----------T----.E-----.LA..E---T--V.....D--EE........GNI..L--..----E....G------
D5SZ41_PLAL2/16-126-----------T----.D-----.DV..V---F--L.....T--PG........RLP..F--..----G....K------
D5UXJ0_TSUPD/21-126-----------A----.A-----.DI..L---W--G.....T--PK........GQW..V--..----S....G------
D5X2H8_THIK1/9-116-----------S----.P-----.SL..I---F--T.....T--HF........GSS..I--..----S....K------
D5X508_THIK1/258-358-----------A----.P-----.NF...---.--......K--PD.......KGMS..L--..----S....A------
D6YUD1_WADCW/33-146-----------S----.P-----.SL..V---A--S.....Y--PG........APD..R--..----D....F------
D7DI86_METV0/10-122-----------A----.P-----.DY..F---V--M....TG--RG........VQS..R--..----G....I------
D7FUG0_ECTSI/213-343-----------A----.P-----.DA..I---L--WGTEVCG--PDDDLWGTVSETV..R--..----D....T------
D9SQZ0_CLOC7/8-113-----------T----.N-----.NF..V---E--F.....T--SS........GTE..Y--..----H...YK------
D9T1Z4_MICAI/21-128-----------D----.D-----.RL..V---F--T.....G--PD........GCL..Y--..----S....K------
E0UKN5_CYAP2/8-124-----------T----.E-----.NA..L---W--M.....P--PN........APD..R--.C----G....I------
E1VXQ5_ARTAR/20-119-----------H----.P-----.WF..R---E--V.....G--AS........GRN..Y--..----D....R------
E3EA41_PAEPS/6-112-----------H----.D-----.DL..I---F--V.....N--HF........GQV..I--..----N....K------
E3M5F2_CAERE/6-112-----------A----AK-----.DA..I---F--M.....G--PL........HDP..C--..----NA.ADA------
E3NA36_CAERE/13-119-----------H----.P-----.NG..V---L--V.....H--KD........KEC..T--..----F....G------
E3NA40_CAERE/13-119-----------H----.P-----.NG..V---I--V.....Q--KG.......KEAT..F--..----G....K------
E3Q3Z8_COLGM/20-132-----------D----.K-----.EA..V---L--A.....H--PG.......FK.P..Y--..----SP.KSK------
E4TM42_MARTH/40-139-----------T----.E-----.DG..Y---I--L.....R--PN........KPI..T--.K----G....R------
E6X731_CELAD/46-156-----------S----.D-----.TI..E---F--Y.....H--DK........GGL.MT--..----S....K------
E8WVR2_ACISM/66-173-----------S----.P-----.SL..V---V--N.....G--PT........NKI..V--..----N....R------
E8WVR2_ACISM/212-319-----------S----.P-----.AM..V---V--N.....S--PG........NNI..L--..----T....R------
E8WVR7_ACISM/60-181-----------A----.E-----.DV..L---V--V.....N--RF........GSM..L--..----E....G------
E8WXR9_ACISM/62-172-----------A----.D-----.DA..V---V--L.....N--NG.......KPAI..L--..----G....R------
E8X558_ACISM/30-138-----------S----.P-----.QM..I---V--N.....G--PN........DTV..L--..----T....R------
F2F0M6_SOLSS/9-106-----------A----.D-----.DF..F---E--I.....G--SS........GYI..Y--..----D....K------
F2F328_SOLSS/60-162-----------S----.K-----.NA..T---G--F.....N--YD........EDI..K--..----A....V------
F2RH14_STRVP/10-117-----------D----.P-----.EF..V---E--V.....G--AS........GRR..W--..----D....R------
Q03DA3_PEDPA/8-116-----------G----.D-----.RM..T---L--T.....H--MT........GYV..Q--..----P....K------
Q0RLC8_FRAAA/20-126-----------D----.E-----.RL..V---F--T.....G--PD........GAL..H--..----T....K------
Q11V67_CYTH3/7-113-----------H----.D-----.DL..L---F--I.....I--PS........GET..V--..----T....K------
Q12Q38_SHEDO/8-111-----------G----.D-----.DF..I---E--I.....T--AA........GSQ..F--..----D....K------
Q13U88_BURXL/31-133-----------A----.D-----.SF..V---E--T.....M--PN........SAR..R--..----T....K------
Q1GMQ9_RUEST/19-122-----------C----.Q-----.SF..L---G--V.....Y--GD........G.F..A--..----D....K------
Q1H132_METFK/13-128-----------A----.E-----.DA..D---W--I.....N--AF........GVF.KH--..----G....R------
Q1ISF5_KORVE/28-135-----------A----.D-----.DV..L---Y--F.....D--EK........GRA..M--..----D....K------
Q1ITS8_KORVE/8-111-----------D----.E-----.RM..L---L--L.....S--DG........QPY..F--..----A....K------
Q2G7A7_NOVAD/11-122-----------S----.P-----.SV..I---M--V....TG--SD........SAV..I--.N----G....R------
Q2LTB1_SYNAS/390-491-----------A----.E-----.DF..R---S--R.....N--MD.......LKSW.IR--..----Y....K------
Q5LLC5_RUEPO/46-153-----------N----.N-----.DP..V---V--I.....G--QG........VAT..F--..----T....G------
Q5YUX5_NOCFA/23-128-----------T----.D-----.DA..V---M--V.....L--AN........GMI..L--..----D....R------
Q6AE79_LEIXX/186-283-----------H----.S-----.GF..E---E--I.....G--RS........GRL..W--..----G....R------
Q82AU3_STRAW/26-136-----------A----.E-----.DC..D---F--T.....T--VR........GDK.PS--..----GR.TGI------
Q89JP5_BRADU/29-135-----------A----.A-----.GG..I---H--V.....N--PA........GPR..S--..----D....I------
Q89SG9_BRADU/39-147-----------W----.D-----.DL..S---Y--S.....H--SS........GKV..E--..----D....K------
Q8YWM4_NOSS1/9-120-----------T----.E-----.DA..L---W--M.....P--PN........GPD..R--.C----G....I------
Q9RS70_DEIRA/32-140-----------A----.P-----.KF..S---G--Y.....G--PR........YEP..I--..----T....R------
B0SRG8_LEPBP/10-116-----------H----.E-----.DL..R---F--I.....A--PN........GLI..V--..----T....K------
B1HN37_LYSSC/64-167-----------S----.K-----.NP..K---G--F.....K--YD........EEK..T--..----Y....A------
F9URX0_LACPL/18-126-----------A----.P-----.TM..K---L--T.....H--MT........GYV..Q--..----S....K------
F9UT77_LACPL/12-117-----------A----.P-----.NA..K---L--V.....H--IT........GTV..Q--..----S....K------
Q5LTS8_RUEPO/9-110-----------D----.P-----.GF..L---G--V.....Y--SD........G.F..S--..----G....R------
Q8P937_XANCP/40-149-----------S----.A-----.DV..E---F--Y.....H--DR.......TGLT..R--..----T....R------
Q8PBX0_XANCP/2-100-----------D----.P-----.AF..V---E--F.....G--AS........GRC..Y--..----T....R------
Q8YRK0_NOSS1/10-115-----------H----.D-----.EL..L---F--N.....G--PS........GET..A--..----T....K------
Q8ZMH1_SALTY/11-112-----------A----.A-----.DF..T---M--I.....T--PG........GVC..L--..----D....Y------
Q97G15_CLOAB/8-113-----------A----.D-----.GF..T---E--F.....C--SS........GYI..Y--..----K....Y------
Q9A9S2_CAUCR/46-158-----------A----.D-----.DV..E---F--F.....H--DK........DGL..S--..----V....G------
Q9RJZ2_STRCO/30-137-----------R----.P-----.DA..L---W--T.....T--GH........GKV..L--.L----G....L------

PF08332

KCC2D_CAEEL/587-711-----------D-----T------SM--T---C--F-----E--PE--------ALGNLI--------E----G------
Q8P5Y9_XANCP/36-159-----------A-----P------D.--G---V--L-----L--PT--------VSNEVR--------A----S------
KCC2A_DROME/389-516-----------D-----P------HL--T---A--F-----E--PE--------ALGNLV--------E----G------
Q5SIW7_THET8/3-128-----------H-----E------EL--S---L--Y-----E--WF--------VTPHRL--------D----G------
F8WHB5_MOUSE/57-184-----------D-----P------GM--T---A--F-----E--PE--------ALGNLV--------E----G------

PF13577

D9QIN2_BRESC/9-135---------..A-----A..D..GVF--V---R--G...EL.-.............R--I--------T----G......
D9QIN2_BRESC/195-322---------..A-----E..D..GRL--V---L--A...G..-............GD--V--------V----G......
D9QIN2_BRESC/413-542---------..S-----T..H..GWK--E---L--S...YI.-............GT--Y--------V----G......
D3Q8I0_STANL/19-151---------..A-----T..E..AEL--D---F--R...PAA-AKW.....GSRPPV--M--------S----G......
Q0SJ13_RHOSR/45-175---------..T-----D..P..VHA--D---Y--S...E.N-G.........MPAA--D--------F----A......
A5V679_SPHWW/6-139---------..V-----E..D..ATF--D---F--T...DHG-VAT.....DDAAEP--M--------R----G......
B5HCB8_STRPR/23-148---------..T-----E..D..VTA--E---M--P....V.-............GT--V--------S----G......
E3IXY9_FRASU/16-146---------..T-----D..D..CVI--D---Y--G...P.G-..........SAPV--I--------H----G......
D2RZV4_HALTV/8-134---------..T-----E..D..VSL--D---Y--G...AL.-............GT--Y--------Q----G......
Q0UXA3_PHANO/19-158---------..V-----N..D..VVA--D---Y--P....F.-...........NSN--L--------E----G......
B1MBT8_MYCA9/7-136---------..T-----E..D..VQA--T---Y--G...TAV-H........GAPLE--F--------T----S......
A5V4W9_SPHWW/12-141---------..A-----E..D..ALW--S---A--E...GF.-............AA--L--------T----G......
Q73Z53_MYCPA/11-137---------..T-----D..D..FLS--D---T--S...EAG-...........GAV--I--------A----G......
D0L747_GORB4/5-127---------..V-----P..D..ARI--D---Y--S...VM.-...........GGI--V--------G----D......
B4EDY3_BURCJ/5-132---------..T-----P..D..AAI--D---C--R...AM.-...........GGI--A--------G----R......
B0T6L6_CAUSK/8-137---------..W-----P..E..ATC--V---Y--P...SSL-...........TTV--F--------K----G......
Q0UTX1_PHANO/50-179---------..T-----P..N..STF--T---W--A...N..-............TT--L--------H----G......
Q0UTX1_PHANO/238-365---------..T-----E..N..TTV--R---F--G...NG.-............SV--Y--------M----G......
Q0UTX1_PHANO/423-553---------..A-----K..Q..GH.--K---L--S...PFA-GF......FHTPAR--I--------T----G......
A5VCU7_SPHWW/9-134---------..A-----E..E..MVL--V---T--P...R..-............GR--I--------E----G......
B2A9N2_PODAN/33-173---------..A-----E..N..GIL--R---W--G...KGA-GDVL...STSDASS--I--------T----G......
B2A9N2_PODAN/248-379---------..T-----S..N..GTI--T---V--Q...NN.-...........T.S--P--------A----G......
A6VWC0_MARMS/15-150---------..T-----E..D..AKW--E---G--K...GAR-YA.......KSFGG--Y--------E----G......
A0QWD2_MYCS2/19-160---------..A-----Q..D..GVY--D---V--E...NW.-.............Q--M--------V----G......
A1SDG2_NOCSJ/13-135---------..L-----P..A..ATG--D---Y--D...GL.-.............V--F--------A----D......
A4XF70_NOVAD/24-149---------..V-----E..D..GEY--A---V--V...GF.-............AT--A--------K----G......
C5DP23_ZYGRC/32-161---------..I-----P..D..ATF--D---L--M...G..-............NV--M--------K----G......
A5V734_SPHWW/6-140---------..A-----E..E..MET--E---F--I...GFP-DMGD...GRIRPGR--H--------R----T......
E3IXP4_FRASU/19-145---------..T-----E..D..GTF--D---A--V...PH.-............LR--M--------R----G......
E3IY46_FRASU/4-132---------..T-----P..D..LDA--W---I--A...DVP-...........DER--F--------H----T......
D0J3B0_COMT2/9-135---------..T-----P..D..CTT--V---Y--G...GS.-............YI--C--------E----G......
A8LAB8_FRASN/18-148---------..T-----P..T..ATW--S---L--C...RGG-Q.........VVKS--V--------S----G......
A4XF68_NOVAD/127-253---------..A-----A..D..LTF--D---Y--G....L.-............GE--Q--------V----G......
Q0S5K6_RHOSR/13-140---------..T-----E..D..CYV--A---Y--G...PDF-...........G..--A--------D----G......
C5AL89_BURGB/17-156---------..T-----A..D..AIW--E---G--V.....G-RHY.....EHAFGR--H--------Q----G......
D0IVW3_COMT2/14-141---------..V-----E..H.GAVI--E---A--D...GF.-............PA--F--------T----D......
Q2G3D7_NOVAD/8-142---------..A-----D..D..AVF--D---A--SCSLSIE-PAA.....DAENWT--H--------S----G......
A5VH89_SPHWW/19-143---------..A-----P..G..ATV--D---Y--G...AL.-..............--F--------Q----G......
E3J7S9_FRASU/5-125---------..A-----D..D..VS.--N---G--R......-.............Y--G--------P----G......
A5DD79_PICGU/8-137---------..C-----E..D..VIF--K---M--N...E..-............NV--I--------T----G......
E3J7S1_FRASU/26-166---------..T-----E..D..GRI--K---V--A...ASA-KARAA.FGSGEWVL--Y--------E----T......
D2QII9_SPILD/28-157---------..T-----E..D..AKV--E---T--M...NNG-Q.........AVSA--L--------V----G......
A5V526_SPHWW/11-135---------..W-----P..E..AID--D---H--A...VF.-..............--R--------G----D......
E3IVD7_FRASU/14-137---------..T-----E..D..AIW--R---I--P...LV.-.............T--F--------E----G......
Q0S5K7_RHOSR/9-131---------..A-----E..N..GTF--S---A--G...GF.-...........PGA--T--------T----G......
D0LD89_GORB4/12-143---------..I-----A.SG..ARI--D---Y--G...RLG-..........AFDD--V--------E----P......
B2AQ89_PODAN/30-160---------..A-----P..E..GTL--L---W--G...NT.-.............S--I--------Q----G......
B2AQ89_PODAN/220-360---------..G-----S..HSWGVL--R---V--D...NV.-............GV--F--------E----G......
A5VBN9_SPHWW/10-129---------..P-----E..D..VKV--G---N--G...E..-..............--.--------T----G......
E6WNE5_PANSA/4-133---------..T-----A..D..AHI--N---V--V...MDG-K.........EVFD--L--------K----G......
B8MXL3_ASPFN/8-138---------..T-----K..D..ATF--D---L--N...GR.-.............L--L--------E----G......
C0ZQW7_RHOE4/8-149---------..T-----A..D..VVS--E---T--W...GGL-PTDKQPKTGDTSNQ--V--------V----G......
E3IWW1_FRASU/10-135---------..H-----D..D..GTA--D---Y--G...P..-............GI--F--------Q----G......
D1ABN9_THECD/23-147---------..E-----P..E..GVY--D---V--D...EL.-.............L--M--------N----G......
C0ZMD8_RHOE4/24-149---------..L-----P..G..ATE--D---H--G...GV.-.............F--T--------G----T......
C0ZQN1_RHOE4/6-139---------..A-----Q..S.....--D---Y--G...QCG-PDG.....VATTLI--S--------S----D......
A4XEZ3_NOVAD/13-139---------..A-----P.GK..IRI--A---Y--Q...NF.-............PE--F--------D----D......
Q13HM1_BURXL/10-142---------..T-----A..D..CRF--E---G--L...G.S-..........APDR--.--------A----D......
B5HT20_9ACTO/43-171---------..S-----D..D..ARV--E---F--P...MA.-.............R--H--------E----G......
B3E7N6_GEOLS/52-188---------..A-----E..D..SYV--D---F--G...TNP-D.........TGPV--F--------K----G......
Q65SQ7_MANSM/19-149---------..T-----E..D..AIV--N---T--Y....IG-G........ELVFE--M--------A----G......
A5VBG5_SPHWW/5-140---------..T-----P..D..AET--D---M--R...EAV-EP.......HNPDL--L--------S----H......
C5E1P0_ZYGRC/8-136---------..L-----P..N..ATL--N---F--N...NS.-.............E--L--------S----G......
C7PBQ3_CHIPD/4-133---------..T-----E..N..GIS--E---T--F...AGD-T.........AILK--L--------K----G......
A5V782_SPHWW/7-132---------..H-----A..D..ATV--D---F--P...GM.-.............F--S--------G----S......
E3J9Q1_FRASU/15-143---------..R-----E..D..GVY--D---W--D...AD.-...........GPP--H--------D----G......
Q28SS5_JANSC/28-163---------..T-----D..E..IYV--D---F--T...SLV-G........GEPAT--I--------.----P......
Q5YUE7_NOCFA/24-150---------..L-----D..D..GVY--D---V--D...S..-............GM--L--------R----G......
A5V765_SPHWW/9-128---------..T-----A..D..GAF--E---G--R...N..-............QQ--L--------R----G......
Q2G4I2_NOVAD/20-164---------..A-----K..D..GAV--V---F--L...SGE-YV.......GYEGV--M--------R----L......
Q0RU80_FRAAA/13-137---------..H-----S..R..GEY--V---I--G...RR.-...........SGR--F--------S----G......
C0ZY97_RHOE4/8-139---------..I-----R.SG..ASI--D---Y--G...RLG-A.........FD.D--A--------G----P......
C1GKF4_PARBD/8-153---------..I-----P.ND..LII--D---Y--T...PSL-A.........NEAV--V--------T----T......
B0T6Q3_CAUSK/13-141---------..A-----A..D..ASV--N---L--G...YLM-P.........DSQA--V--------V----G......
Q2G896_NOVAD/9-133---------..T-----Q..D..AEL--F---L--V...GF.-...........K..--.--------Q----T......
Q2G8B9_NOVAD/8-130---------..T-----D..T..ATF--S---T--S...GV.-...........L.A--G--------E----G......
A0R741_MYCS2/12-151---------..T-----E..D..FVF--D---R--G...PG.-...........LAG--A--------Q----G......
A2QQU7_ASPNC/9-142---------..F-----E..D..AAF--D---F--N...G..-............SV--M--------E----G......
A5V496_SPHWW/15-154---------..T-----R..D..ALW--E---G--R...GRY-R........KAFGR--H--------E----G......
D3F909_CONWI/11-132---------..D-----A..G..VAV--S---T--P......-...........GGT--A--------E----G......
A5V4W4_SPHWW/9-135---------..V-----D..D..AAF--L---I--D...RY.-............GE--L--------R----G......
A8LEQ5_FRASN/33-162---------..I-----S..G..GGY--E---F--G...VPA-G.........SAVR--V--------E----A......
Q5YMU1_NOCFA/9-129---------..T-----A..D..VEV--S---S--P...R..-............GE--A--------H----G......
B8MB56_TALSN/45-177---------..T-----E..D..AVA--N---Y--T...VLG-...........IGI--L--------T----G......
A7HVX6_PARL1/27-151---------..H-----D..E..GTI--S---L--S...WF.-...........DGP--H--------K----G......
Q47PW3_THEFY/16-138---------..T-----D..D..GIL--R---T--G...R..-............GT--A--------V----G......
Q0RKC5_FRAAA/4-127---------..L-----P..D..AVF--R---I--D...DD.-.............T--N--------V----G......
C0ZPG5_RHOE4/7-136---------..T-----D..N..GEF--H---S--A...S.Y-...........PEP--V--------V----G......
Q2GA82_NOVAD/22-166---------..T-----E..D..GEV--R---F--F...G..-............GV--W--------K----G......
D1A615_THECD/11-138---------..T-----P..D..GVV--D---H--A...HR.-...........GER--V--------A----G......
Q2J5F3_FRASC/12-141---------..A-----E..D..AVF--Q---E--A...AR.-...........MDP--L--------L----G......
Q13GK3_BURXL/16-154---------..S-----E..D..TVL--D---R--G....VG-...........LSG--A--------F----G......
Q2HFF4_CHAGB/8-157---------..G-----P..S..IEI--D---Y--T...SVL-G........GTPYT--I--------.----S......
B2AMA1_PODAN/20-165---------..S-----DHPD..AYV--E---F--L...G..-............GR--Y--------R----G......
Q2J5F8_FRASC/12-144---------..T-----A..D..AVL--D---S--N...LQD-APD.....IGHVAI--L--------G----S......
A4XER9_NOVAD/52-204---------..A-----K..K..GTP--G---I--R...A.Q-Y........SNNGV--Y--------T----S......
B5HIV3_STRPR/14-145---------..T-----G..D..GVF--D---H--R...PG.-...........ADP--L--------V----G......
D4J4G2_9FIRM/14-173---------..V-----Q..D..PNH--Q---K--T.....A-SF......GRNTGY--Y--------T----G......
D4J4F8_9FIRM/15-157---------..A-----KRDD..AKL--V---T--P....WG-S.........YQG.--H--------S----GIEACYL
A2QCD6_ASPNC/23-149---------..A-----E..Q..AYI--.---F--T...TW.-...........SGG--M--------.----P......
Q0V2S9_PHANO/36-181---------SNH-----P..D..TCV--E---F--L.....G-GRY.....NGKDGV--K--------R----L......
Q73XG8_MYCPA/12-127---------..R-----H..S..GA.--S---Y--T......-..............--.--------R----D......
B2HNY2_MYCMM/12-134---------..T-----E..D..VVG--D---Y--G...SSV-G.........TELH--F--------T----N......
B4EK49_BURCJ/8-131---------..T-----E..D..CEA--R---L--Y...GG.-...........RYA--Y--------D----G......
D4AUD6_ARTBC/51-174---------..T-----S.SN..VYI--D---L--P...EDG-...........FRN--L--------N----S......
D4Z258_SPHJU/6-129---------..W-----D..D..AEW--T---I--E...GI.-............GT--Y--------K----G......
F2RC28_STRVP/29-155---------..T-----D..D..VHL--V---F--P....M.-............GE--Y--------K----G......
F9UT75_LACPL/5-135---------..L-----P..N..GKV--N---I--I...NDG-K.........VTFT--L--------N----G......
Q73VN5_MYCPA/6-129---------..T-----P..D..AYI--D---Y--T...AL.-............GG--I--------E----G......
Q7API7_STRCO/4-133---------..T-----D..E..IRL--D---Y--T...SLN-G.........GEPV--T--------L----P......

PF12893

Q390L3_BURS3/2-118-----------H-----P------SC--L---I--Q-----W.VDEG......QLRT--L--------S----S------
A4YKR3_BRASO/3-119-----------H-----P------SA--D---L--R-----W.VENG......ELKV--L--------T----V------
A3SYD4_9RHOB/2-118-----------H-----P------DS--S---L--F-----D.GDNG......TVFV--E--------P----I------
A3N8A5_BURP6/1-117