Sequence alignment for CL0052

PF13522

Q319R2_PROM9/31-164PDHRDI..WI..NE..----------------------------------------------------------------
A2C1R3_PROM1/29-159PDNTGR..YL..DN..----------------------------------------------------------------
A6H137_FLAPJ/32-161PDDAGI..FI..EK..----------------------------------------------------------------
A1ZI98_9BACT/32-161PDGEGF..FV..EN..----------------------------------------------------------------
D1B558_SULD5/28-151PDAFGI..WK..EK..----------------------------------------------------------------
B6BGG4_9PROT/28-151PDYCGI..TQ..KT..----------------------------------------------------------------
Q15WL8_PSEA6/32-161PDAGRE..YI..DE..----------------------------------------------------------------
A1ZXW5_9BACT/31-157PDADGF..FF..GQ..----------------------------------------------------------------
C6C0L2_DESAD/29-158PDFQHI..HT..EE..----------------------------------------------------------------
B9UJ05_9ACTO/31-161PDGEGT..WVSPTG..----------------------------------------------------------------
D0LGD9_HALO1/33-165PDGEGE..LF..TS..----------------------------------------------------------------
D2AY63_STRRD/33-164VDDQGL..WV..RG..----------------------------------------------------------------
Q67SX7_SYMTH/33-163PDAGGI..WC..SG..----------------------------------------------------------------
D1PMI4_9FIRM/34-164PDQRGM..YI..SG..----------------------------------------------------------------
A8A8Q5_IGNH4/48-172PIWESLEPLP..RA..----------------------------------------------------------------
A3MVE4_PYRCJ/52-198RSEAPI..WE..DPTP----------------------------------------------------------------
A2BKU3_HYPBU/86-222WAAERLASLV..EG..----------------------------------------------------------------
A8MDJ1_CALMQ/76-219SSFNTMLELITQSK..----------------------------------------------------------------
C3MRQ6_SULIM/67-191PNFNYLIDIAKGEE..----------------------------------------------------------------
C4RDQ3_9ACTO/71-217VTLPGLAATT..TS..----------------------------------------------------------------
C1A341_RHOE4/69-214PTVDETLSHI..GS..----------------------------------------------------------------
B1VRV8_STRGG/70-217ETFADLARVV..RS..----------------------------------------------------------------
A8L8S4_FRASN/71-216ASYSSFAGAV..TS..----------------------------------------------------------------
B1MFS0_MYCA9/68-197ASFASVAPVL..RS..----------------------------------------------------------------
D1ACB4_THECD/68-206RSFREISGAV..TA..----------------------------------------------------------------
B8DT41_BIFA0/71-227TIAARYDSIF..GDLA----------------------------------------------------------------
B4CXP1_9BACT/50-172VNH..LIQQV..PG..----------------------------------------------------------------
D1A6E6_THECD/85-229GRFSRV..WR..PDLL----------------------------------------------------------------
B1YDA4_THENV/101-253PEALDELYGV..GG..----------------------------------------------------------------
Q313Y7_DESDG/69-208P.FQELLGQVDNET..----------------------------------------------------------------
A9J6W7_BPLUZ/64-191PETKEFLDKG..RA..----------------------------------------------------------------
Q2L1U1_BORA1/78-209RDQTGL..........----------------------------------------------------------------
C7RIV9_ACCPU/72-218ALSQGLTLAY..GS..----------------------------------------------------------------
A3SJ02_9RHOB/30-184RDSSGLVIARESGY..----------------------------------------------------------------
D0LWC5_HALO1/57-200PVDFGHAVSTLRTD..----------------------------------------------------------------
C7P6F6_METFA/31-174KDGSGL..LL..DD..----------------------------------------------------------------
A6UTH5_META3/46-188PDSSGL..MF..DD..----------------------------------------------------------------
Q67SU9_SYMTH/28-156PDGRGI..WTATAG..----------------------------------------------------------------
C0GFE8_9FIRM/28-153PDDRDIHTFN......----------------------------------------------------------------
B6EHL2_ALISL/33-161PDWSGI..YS..SD..----------------------------------------------------------------
A3WK96_9GAMM/33-166PDGYGY..HI..QS..----------------------------------------------------------------
B8IIU0_METNO/27-152PDGSGV..LS..AG..----------------------------------------------------------------
D4LAQ5_RUMC1/30-159PDAAGR..YV..DG..----------------------------------------------------------------
A8AA00_IGNH4/31-161PDGRGY..WI..SE..----------------------------------------------------------------
A1TKR9_ACIAC/32-162PDGDGL..YVHEEG..----------------------------------------------------------------
Q1MNZ8_LAWIP/32-161PDKANV..VV..DG..----------------------------------------------------------------
C7MBC0_BRAFD/30-167PDGEGL..FV..DD..----------------------------------------------------------------
C6A089_THESM/27-158PDDEDI..YV..DE..----------------------------------------------------------------
A1TKS1_ACIAC/32-165PDQQAYVRMQ..HG..----------------------------------------------------------------
A8TMT0_9PROT/32-161PDAEGL..FM..QS..----------------------------------------------------------------
A8M5J5_SALAI/32-161PDGTGH..WT..DS..----------------------------------------------------------------
A5CX28_VESOH/32-161PDSSGS..WI..DG..----------------------------------------------------------------
B8HUI9_CYAP4/34-167PDGGGA..WISADG..----------------------------------------------------------------
C7G790_9FIRM/29-159PDGYGL..WQ..ED..----------------------------------------------------------------
C5F126_9HELI/26-156PDFSGE..FS..DG..----------------------------------------------------------------
E8WTP4_GEOS8/31-159PDEAGI..YL..DP..----------------------------------------------------------------
Q92TY3_RHIME/30-158PDERGI..FT..AP..----------------------------------------------------------------
B8HND1_CYAP4/33-164PDDQGI..YI..SP..----------------------------------------------------------------
C9YDI6_9BURK/28-159PDDSGQ..YLSANG..----------------------------------------------------------------
A4TWE4_9PROT/27-157PDAQAI..WH..EN..----------------------------------------------------------------
Q7W1A1_BORPA/30-164PDSNGY..WEDAEA..----------------------------------------------------------------
A7BTD4_9GAMM/10-143PDDSGI..WINKES..----------------------------------------------------------------
B0RW09_XANCB/35-167PDDAGT..WCDAQA..----------------------------------------------------------------
Q988G2_RHILO/34-166PDGEAF..WMSREA..----------------------------------------------------------------
A6DK48_9BACT/33-162PDANGK..WF..GN..----------------------------------------------------------------
Q2IZV2_RHOP2/32-164PDGEGH..WLSEDG..----------------------------------------------------------------
A4IWP6_FRATW/32-164SDDSGY..WC..DN..----------------------------------------------------------------

PF13537

Q5ASH6_EMENI/53-172--------------------------------------------------------------------------------
B9PWN3_TOXGO/71-193--------------------------------------------------------------------------------
Q2LTR9_SYNAS/73-199--------------------------------------------------------------------------------
Q2YZN6_9DELT/73-201--------------------------------------------------------------------------------
Q5LFT8_BACFN/74-198--------------------------------------------------------------------------------
D1PAI4_9BACT/75-199--------------------------------------------------------------------------------
C9RMT9_FIBSS/74-201--------------------------------------------------------------------------------
C1DTA6_SULAA/82-202--------------------------------------------------------------------------------
D1PIW6_9FIRM/46-166--------------------------------------------------------------------------------
C5F101_9HELI/91-211--------------------------------------------------------------------------------
C6E3Y8_GEOSM/48-168--------------------------------------------------------------------------------
A6DEM6_9PROT/51-165--------------------------------------------------------------------------------
A5Z6H5_9FIRM/45-164--------------------------------------------------------------------------------
A1VAB5_DESVV/59-173--------------------------------------------------------------------------------
D4M4V2_9FIRM/52-165--------------------------------------------------------------------------------
C5KCG7_PERM5/48-170--------------------------------------------------------------------------------
C0GG67_9FIRM/53-166--------------------------------------------------------------------------------
A1ASZ8_PELPD/48-167--------------------------------------------------------------------------------
C7MKT6_CRYCD/71-192--------------------------------------------------------------------------------
E8WTP4_GEOS8/46-165--------------------------------------------------------------------------------
Q09SM5_BORPP/47-168--------------------------------------------------------------------------------
B3KYI2_PHAVU/48-166--------------------------------------------------------------------------------
B8HND1_CYAP4/57-170--------------------------------------------------------------------------------
B7AUG5_9FIRM/44-164--------------------------------------------------------------------------------
D1N3I7_9BACT/47-166--------------------------------------------------------------------------------
A6H137_FLAPJ/47-167--------------------------------------------------------------------------------
D3T763_THEIA/48-169--------------------------------------------------------------------------------
Q0AZ18_SYNWW/47-167--------------------------------------------------------------------------------
A4BSJ7_9GAMM/48-168--------------------------------------------------------------------------------
Q1MNZ8_LAWIP/47-167--------------------------------------------------------------------------------
A9GJ27_SORC5/48-167--------------------------------------------------------------------------------
C6J0Z3_9BACL/48-167--------------------------------------------------------------------------------
A3CX83_METMJ/47-167--------------------------------------------------------------------------------
A8ESL9_ARCB4/53-166--------------------------------------------------------------------------------
D3EKK9_GEOS4/48-169--------------------------------------------------------------------------------
C7LP19_DESBD/84-205--------------------------------------------------------------------------------
B1WQP9_CYAA5/45-160--------------------------------------------------------------------------------
C2VRM4_BACCE/48-169--------------------------------------------------------------------------------
C4FEA3_9BIFI/47-166--------------------------------------------------------------------------------
C1DDD8_LARHH/51-168--------------------------------------------------------------------------------
Q07U44_RHOP5/47-166--------------------------------------------------------------------------------
A7NGM6_ROSCS/48-167--------------------------------------------------------------------------------
F2G8Q8_ALTMD/54-167--------------------------------------------------------------------------------
E8WQK3_GEOS8/47-167--------------------------------------------------------------------------------
C0ZGQ1_BREBN/48-169--------------------------------------------------------------------------------
B7KM32_CYAP7/57-169--------------------------------------------------------------------------------
Q65FV9_BACLD/50-169--------------------------------------------------------------------------------
D1PIW9_9FIRM/48-167--------------------------------------------------------------------------------
Q216T1_RHOPB/47-166--------------------------------------------------------------------------------
D3SEV0_THISK/48-168--------------------------------------------------------------------------------
A8AA00_IGNH4/55-167--------------------------------------------------------------------------------
D6Z0B3_DESAT/43-160--------------------------------------------------------------------------------
A6CE28_9PLAN/47-166--------------------------------------------------------------------------------
Q12VP2_METBU/43-162--------------------------------------------------------------------------------
C5A2K1_THEGJ/42-164--------------------------------------------------------------------------------
D5SUU8_PLAL2/54-173--------------------------------------------------------------------------------
C9BZ32_ENTFC/45-164--------------------------------------------------------------------------------
Q60BD5_METCA/46-165--------------------------------------------------------------------------------
B1HXB0_LYSSC/54-169--------------------------------------------------------------------------------
A7IB45_METB6/47-167--------------------------------------------------------------------------------
C7P6F6_METFA/66-180--------------------------------------------------------------------------------
D7VX33_9FLAO/60-173--------------------------------------------------------------------------------
B0N4I8_9FIRM/45-164--------------------------------------------------------------------------------
C5BIB9_TERTT/48-165--------------------------------------------------------------------------------
C0BH32_9BACT/48-167--------------------------------------------------------------------------------
C3KLT2_RHISN/70-189--------------------------------------------------------------------------------
D0U2E2_STRPT/48-167--------------------------------------------------------------------------------
Q3SM07_THIDA/48-168--------------------------------------------------------------------------------
A4E9B2_9ACTN/52-166--------------------------------------------------------------------------------
A1ZI98_9BACT/47-167--------------------------------------------------------------------------------
C7RT03_ACCPU/48-168--------------------------------------------------------------------------------
E6VZL8_DESAO/47-168--------------------------------------------------------------------------------
D4KMF4_9FIRM/44-165--------------------------------------------------------------------------------
A4XLL9_CALS8/48-169--------------------------------------------------------------------------------
O87986_BORBO/51-167--------------------------------------------------------------------------------
B8GV93_THISH/47-166--------------------------------------------------------------------------------
Q1N7B0_9SPHN/48-168--------------------------------------------------------------------------------
B9JNF8_AGRRK/48-167--------------------------------------------------------------------------------
B3QUX4_CHLT3/58-171--------------------------------------------------------------------------------
A1TKR9_ACIAC/49-168--------------------------------------------------------------------------------
A1WX67_HALHL/50-170--------------------------------------------------------------------------------
A1VHY0_DESVV/74-190--------------------------------------------------------------------------------
C8VWD2_DESAS/48-169--------------------------------------------------------------------------------
Q26BI0_FLABB/48-167--------------------------------------------------------------------------------
B0BZG4_ACAM1/47-167--------------------------------------------------------------------------------
A9B763_HERA2/45-164--------------------------------------------------------------------------------
A8RHM4_9CLOT/52-173--------------------------------------------------------------------------------
A3WBV5_9SPHN/48-168--------------------------------------------------------------------------------
A6C8F5_9PLAN/48-167--------------------------------------------------------------------------------
C9YDI6_9BURK/45-165--------------------------------------------------------------------------------
C9P5X6_VIBME/48-167--------------------------------------------------------------------------------
A9AVN7_HERA2/53-166--------------------------------------------------------------------------------
D9TR59_THETC/48-169--------------------------------------------------------------------------------
D5SQH7_PLAL2/59-173--------------------------------------------------------------------------------
Q15WL8_PSEA6/47-167--------------------------------------------------------------------------------
Q3SMN0_THIDA/47-165--------------------------------------------------------------------------------
B8JFB6_ANAD2/49-168--------------------------------------------------------------------------------
Q30XB0_DESDG/46-165--------------------------------------------------------------------------------
A4AWP2_MARSH/48-167--------------------------------------------------------------------------------
B8GVB9_THISH/48-167--------------------------------------------------------------------------------
Q30W35_DESDG/52-171--------------------------------------------------------------------------------
Q11EB5_MESSB/46-165--------------------------------------------------------------------------------
B8LMV0_PICSI/48-166--------------------------------------------------------------------------------
C0GFE8_9FIRM/43-159--------------------------------------------------------------------------------
Q09SL0_BORPP/51-171--------------------------------------------------------------------------------
D4L906_9FIRM/48-169--------------------------------------------------------------------------------
B6BY61_9GAMM/48-168--------------------------------------------------------------------------------
D7VXP6_9FLAO/48-166--------------------------------------------------------------------------------
Q89GP7_BRAJA/53-172--------------------------------------------------------------------------------
D2ELX2_PEDAC/45-164--------------------------------------------------------------------------------
Q31I32_THICR/47-165--------------------------------------------------------------------------------
B6FJ58_9CLOT/52-165--------------------------------------------------------------------------------
C6C0L2_DESAD/44-164--------------------------------------------------------------------------------
A0YEF5_9GAMM/47-166--------------------------------------------------------------------------------
A8FUC6_SHESH/48-167--------------------------------------------------------------------------------
B5CZ45_9BACE/48-167--------------------------------------------------------------------------------
D3PM21_MEIRD/68-181--------------------------------------------------------------------------------
B5EA88_GEOBB/47-168--------------------------------------------------------------------------------
Q81GN9_BACCR/48-169--------------------------------------------------------------------------------
C7PT80_CHIPD/48-167--------------------------------------------------------------------------------
A6UTH5_META3/82-194--------------------------------------------------------------------------------
A9W815_METEP/53-166--------------------------------------------------------------------------------
A1HQU4_9FIRM/48-169--------------------------------------------------------------------------------
Q67SX7_SYMTH/48-169--------------------------------------------------------------------------------
A0L574_MAGSM/48-168--------------------------------------------------------------------------------
Q67SU9_SYMTH/44-162--------------------------------------------------------------------------------
A6TWB0_ALKMQ/48-169--------------------------------------------------------------------------------
A3QHF6_SHELP/46-166--------------------------------------------------------------------------------
D1KBT8_9GAMM/47-167--------------------------------------------------------------------------------
D3RU48_ALLVD/48-168--------------------------------------------------------------------------------
Q21PG9_SACD2/57-171--------------------------------------------------------------------------------
C1ATQ5_RHOOB/48-169--------------------------------------------------------------------------------
A0LYW1_GRAFK/45-164--------------------------------------------------------------------------------
A4U2W9_9PROT/51-171--------------------------------------------------------------------------------
D4L5M3_9FIRM/57-164--------------------------------------------------------------------------------
B0TFK1_HELMI/48-169--------------------------------------------------------------------------------
B9YZR4_9NEIS/45-165--------------------------------------------------------------------------------
A4A561_9GAMM/25-145--------------------------------------------------------------------------------
Q9KCR1_BACHD/48-169--------------------------------------------------------------------------------
B7FT50_PHATC/57-178--------------------------------------------------------------------------------
E6TYW0_BACCJ/46-165--------------------------------------------------------------------------------
Q1GRU1_SPHAL/48-168--------------------------------------------------------------------------------
A1TKS1_ACIAC/51-171--------------------------------------------------------------------------------
A3XJR6_LEEBM/48-167--------------------------------------------------------------------------------
D3MRS2_9FIRM/52-169--------------------------------------------------------------------------------
C0GHN0_9FIRM/48-169--------------------------------------------------------------------------------
A7BSS9_9GAMM/58-174--------------------------------------------------------------------------------
Q1I2K2_PSEE4/47-166--------------------------------------------------------------------------------
Q65LI2_BACLD/48-169--------------------------------------------------------------------------------
C2FYF7_9SPHI/48-166--------------------------------------------------------------------------------
A4W840_ENT38/48-167--------------------------------------------------------------------------------
A2SJD9_METPP/43-164--------------------------------------------------------------------------------
ASNS_DICDI/48-169--------------------------------------------------------------------------------
Q1YPR6_9GAMM/67-187--------------------------------------------------------------------------------
D3FZ77_BACPE/48-169--------------------------------------------------------------------------------
C4KBW1_THASP/51-171--------------------------------------------------------------------------------
Q319R2_PROM9/48-170--------------------------------------------------------------------------------
Q605Z5_METCA/46-165--------------------------------------------------------------------------------
A4CM46_ROBBH/48-167--------------------------------------------------------------------------------
D4LAQ5_RUMC1/45-165--------------------------------------------------------------------------------
A3EK19_VIBCL/50-168--------------------------------------------------------------------------------
Q81ZU7_NITEU/48-168--------------------------------------------------------------------------------
C3KRD5_RHISN/51-172--------------------------------------------------------------------------------
D3AFP1_9CLOT/57-178--------------------------------------------------------------------------------
A8LVP2_SALAI/46-166--------------------------------------------------------------------------------
Q7MSW6_WOLSU/42-160--------------------------------------------------------------------------------
C7HFF8_CLOTM/48-169--------------------------------------------------------------------------------
C6J1Y5_9BACL/48-169--------------------------------------------------------------------------------
Q2WB52_MAGSA/47-166--------------------------------------------------------------------------------
B2IYJ4_NOSP7/59-173--------------------------------------------------------------------------------
A9EDC0_9FLAO/48-167--------------------------------------------------------------------------------
A6CPY7_9BACI/48-169--------------------------------------------------------------------------------
Q15RM5_PSEA6/55-167--------------------------------------------------------------------------------
A5CX28_VESOH/47-167--------------------------------------------------------------------------------
D3SB42_THISK/47-167--------------------------------------------------------------------------------
Q11Z14_CYTH3/48-168--------------------------------------------------------------------------------
B2TNC6_CLOBB/48-169--------------------------------------------------------------------------------
C0QEN5_DESAH/70-189--------------------------------------------------------------------------------
Q3B1S8_PELLD/46-166--------------------------------------------------------------------------------
D6Z4G9_DESAT/48-167--------------------------------------------------------------------------------
A9I748_BORPD/47-170--------------------------------------------------------------------------------
Q5WH52_BACSK/48-169--------------------------------------------------------------------------------
C0ZBJ4_BREBN/48-169--------------------------------------------------------------------------------
C5Y2Y7_SORBI/48-174--------------------------------------------------------------------------------
E6TYI4_BACCJ/48-169--------------------------------------------------------------------------------
B6C089_9GAMM/57-171--------------------------------------------------------------------------------
Q2SJG4_HAHCH/57-171--------------------------------------------------------------------------------
B1VMY8_STRGG/48-173--------------------------------------------------------------------------------
Q9RJK2_STRCO/48-166--------------------------------------------------------------------------------
D3QAD7_STANL/49-169--------------------------------------------------------------------------------
Q9KJI6_DESGI/52-171--------------------------------------------------------------------------------
B5E8P8_GEOBB/54-171--------------------------------------------------------------------------------
C3IWN5_BACTU/45-164--------------------------------------------------------------------------------
C1A5T9_GEMAT/55-168--------------------------------------------------------------------------------
B4BIR0_9BACI/48-169--------------------------------------------------------------------------------
Q2NA36_ERYLH/48-168--------------------------------------------------------------------------------
A2TSH4_9FLAO/48-167--------------------------------------------------------------------------------
C2QBK6_BACCE/45-169--------------------------------------------------------------------------------
Q01XN2_SOLUE/46-165--------------------------------------------------------------------------------
B8KJD2_9GAMM/25-145--------------------------------------------------------------------------------
C2WMM0_BACCE/48-169--------------------------------------------------------------------------------
C4K7X1_HAMD5/55-167--------------------------------------------------------------------------------
A0Q7S4_FRATN/47-170--------------------------------------------------------------------------------
Q7MBG3_WOLSU/61-173--------------------------------------------------------------------------------
A7NLM8_ROSCS/43-157--------------------------------------------------------------------------------
C5T0U7_ACIDE/48-168--------------------------------------------------------------------------------
B1I0Y5_DESAP/48-169--------------------------------------------------------------------------------
B0NXA9_9CLOT/52-173--------------------------------------------------------------------------------
C8W452_DESAS/48-169--------------------------------------------------------------------------------
D5X1P1_THIK1/46-165--------------------------------------------------------------------------------
D3V2B7_XENBS/51-170--------------------------------------------------------------------------------
Q2WBC9_MAGSA/51-171--------------------------------------------------------------------------------
C7PAG8_CHIPD/57-168--------------------------------------------------------------------------------
B4SPR9_STRM5/59-173--------------------------------------------------------------------------------
D2SAR5_GEOOG/50-170--------------------------------------------------------------------------------
C1F7T8_ACIC5/52-172--------------------------------------------------------------------------------
B7GLW0_ANOFW/61-182--------------------------------------------------------------------------------
A4FX82_METM5/68-180--------------------------------------------------------------------------------
B1K8L8_BURCC/51-174--------------------------------------------------------------------------------
C8XKV4_NAKMY/46-165--------------------------------------------------------------------------------
E3I7S3_RHOVT/58-174--------------------------------------------------------------------------------
B6IXV0_RHOCS/58-172--------------------------------------------------------------------------------
Q86A01_DICDI/50-171--------------------------------------------------------------------------------
D5VTZ9_METIM/63-169--------------------------------------------------------------------------------
A8ZX58_DESOH/43-159--------------------------------------------------------------------------------
B8GLI4_THISH/54-167--------------------------------------------------------------------------------
A5Z4P6_9FIRM/78-197--------------------------------------------------------------------------------
B8BZR9_THAPS/57-178--------------------------------------------------------------------------------
B6IYJ4_RHOCS/51-171--------------------------------------------------------------------------------
Q12HN2_SHEDO/46-166--------------------------------------------------------------------------------
B5JNG8_9BACT/50-171--------------------------------------------------------------------------------
Q11FH2_MESSB/47-167--------------------------------------------------------------------------------
D1PRL7_9FIRM/57-170--------------------------------------------------------------------------------
A8PQZ5_MALGO/63-179--------------------------------------------------------------------------------
Q1QD48_PSYCK/55-169--------------------------------------------------------------------------------
Q220Y3_RHOFD/48-168--------------------------------------------------------------------------------
D0NLW5_PHYIT/50-171--------------------------------------------------------------------------------
Q2LWL8_SYNAS/62-175--------------------------------------------------------------------------------
A5AAI5_ASPNC/47-168--------------------------------------------------------------------------------
D2QWZ5_PIRSD/59-178--------------------------------------------------------------------------------
C5ZZB9_9HELI/41-162--------------------------------------------------------------------------------
B4UY04_9ACTO/48-169--------------------------------------------------------------------------------
Q988G2_RHILO/58-172--------------------------------------------------------------------------------
A6LS88_CLOB8/48-169--------------------------------------------------------------------------------
B5DPA2_DROPS/60-180--------------------------------------------------------------------------------
A7BY79_9GAMM/47-167--------------------------------------------------------------------------------
Q7N3E7_PHOLL/51-170--------------------------------------------------------------------------------
A1ZXW5_9BACT/46-163--------------------------------------------------------------------------------
C7C1Y2_9ACTO/48-169--------------------------------------------------------------------------------
D0TID9_9BACE/48-167--------------------------------------------------------------------------------
C1I2N8_9CLOT/50-171--------------------------------------------------------------------------------
Q5QU50_IDILO/50-172--------------------------------------------------------------------------------
B1Y730_LEPCP/47-166--------------------------------------------------------------------------------
F1TF15_9CLOT/46-165--------------------------------------------------------------------------------
B3QJY0_RHOPT/43-167--------------------------------------------------------------------------------
A4J8B3_DESRM/48-169--------------------------------------------------------------------------------
A4YLK3_BRASO/46-166--------------------------------------------------------------------------------
A7Z383_BACA2/48-169--------------------------------------------------------------------------------
Q9RA27_VIBMA/55-167--------------------------------------------------------------------------------
B9HNE0_POPTR/48-166--------------------------------------------------------------------------------
A4BL90_9GAMM/46-165--------------------------------------------------------------------------------
A4LI33_BURPE/58-174--------------------------------------------------------------------------------
Q7WR34_BORBR/41-162--------------------------------------------------------------------------------
C7MST2_SACVD/46-164--------------------------------------------------------------------------------
C3XDE6_9HELI/72-187--------------------------------------------------------------------------------
B8KQP7_9GAMM/45-164--------------------------------------------------------------------------------
A9B583_HERA2/48-167--------------------------------------------------------------------------------
Q89HI1_BRAJA/49-169--------------------------------------------------------------------------------
Q74BS3_GEOSL/54-166--------------------------------------------------------------------------------
B4LH96_DROVI/67-180--------------------------------------------------------------------------------
A5N6Y5_CLOK5/48-169--------------------------------------------------------------------------------
Q01UW3_SOLUE/48-167--------------------------------------------------------------------------------
A7ZF04_CAMC1/47-167--------------------------------------------------------------------------------
B1HS43_LYSSC/48-169--------------------------------------------------------------------------------
Q8EN79_OCEIH/48-169--------------------------------------------------------------------------------
A4FMI9_SACEN/48-169--------------------------------------------------------------------------------
Q2G5V9_NOVAD/48-168--------------------------------------------------------------------------------
C7XTT3_9LACO/50-170--------------------------------------------------------------------------------
A5D4J4_PELTS/48-170--------------------------------------------------------------------------------
B7AKA8_9BACE/48-167--------------------------------------------------------------------------------
D2JNW7_9NOSO/48-167--------------------------------------------------------------------------------
B6YQV5_AZOPC/48-166--------------------------------------------------------------------------------
C1DDD9_LARHH/48-169--------------------------------------------------------------------------------
B8J3E1_DESDA/50-169--------------------------------------------------------------------------------
A5VDL7_SPHWW/48-168--------------------------------------------------------------------------------
Q49BF3_STRHY/48-169--------------------------------------------------------------------------------
D6S3E6_9LACO/53-166--------------------------------------------------------------------------------
D1R677_9CHLA/51-167--------------------------------------------------------------------------------
C7MBC0_BRAFD/45-173--------------------------------------------------------------------------------
Q2RIX6_MOOTA/48-169--------------------------------------------------------------------------------
D2AY63_STRRD/48-170--------------------------------------------------------------------------------
A4BPQ6_9GAMM/34-148--------------------------------------------------------------------------------
Q23CU8_TETTS/60-177--------------------------------------------------------------------------------
C4XTN2_DESMR/52-171--------------------------------------------------------------------------------
B9R487_9RHOB/47-167--------------------------------------------------------------------------------
A8UK10_9FLAO/67-188--------------------------------------------------------------------------------
E6U4Y9_ETHHY/50-171--------------------------------------------------------------------------------
A8JG07_CHLRE/48-170--------------------------------------------------------------------------------
B3QY65_CHLT3/47-167--------------------------------------------------------------------------------
A0L450_MAGSM/47-167--------------------------------------------------------------------------------
Q97GX2_CLOAB/48-169--------------------------------------------------------------------------------
A5V1L8_ROSS1/55-168--------------------------------------------------------------------------------
Q2B953_9BACI/48-169--------------------------------------------------------------------------------
A7T4X2_NEMVE/47-165--------------------------------------------------------------------------------
B6WVV2_9DELT/50-170--------------------------------------------------------------------------------
B1ZBU4_METPB/46-166--------------------------------------------------------------------------------
Q1YFQ6_MOBAS/47-167--------------------------------------------------------------------------------
C3RLY9_9FIRM/51-170--------------------------------------------------------------------------------
A5GQB9_SYNR3/51-164--------------------------------------------------------------------------------
Q2SJH5_HAHCH/45-158--------------------------------------------------------------------------------
B9MJX9_ANATD/48-169--------------------------------------------------------------------------------
B4WJY6_9SYNE/57-172--------------------------------------------------------------------------------
D1PMI4_9FIRM/49-170--------------------------------------------------------------------------------
C7QF66_CATAD/44-168--------------------------------------------------------------------------------
A4KUB6_STRHI/48-167--------------------------------------------------------------------------------
Q094S0_STIAD/48-170--------------------------------------------------------------------------------
A0LCM5_MAGSM/57-173--------------------------------------------------------------------------------
A9WSE9_RENSM/44-167--------------------------------------------------------------------------------
B8GGE5_METPE/42-162--------------------------------------------------------------------------------
C4WQP2_9RHIZ/54-174--------------------------------------------------------------------------------
B3QPH1_CHLP8/47-167--------------------------------------------------------------------------------
A4X7Y5_SALTO/75-195--------------------------------------------------------------------------------
B0ML15_9FIRM/25-146--------------------------------------------------------------------------------
A4X9C7_SALTO/62-175--------------------------------------------------------------------------------
B4U6E2_HYDS0/59-178--------------------------------------------------------------------------------
Q47GK4_DECAR/53-176--------------------------------------------------------------------------------
Q9FAR2_STRAU/48-169--------------------------------------------------------------------------------
E3I873_RHOVT/48-171--------------------------------------------------------------------------------
D1RME1_LEGLO/47-168--------------------------------------------------------------------------------
B8HUI9_CYAP4/51-173--------------------------------------------------------------------------------
A4B944_9GAMM/61-173--------------------------------------------------------------------------------
A6UNP9_METVS/74-187--------------------------------------------------------------------------------
Q2RPM9_RHORT/48-168--------------------------------------------------------------------------------
A5EHY9_BRASB/48-167--------------------------------------------------------------------------------
D0KYR8_HALNC/47-171--------------------------------------------------------------------------------
D3U9Z6_9ACTO/48-170--------------------------------------------------------------------------------
D4JEU7_9FIRM/51-163--------------------------------------------------------------------------------
D0FNI9_ERWPE/48-169--------------------------------------------------------------------------------
Q3S8R1_STRRM/48-170--------------------------------------------------------------------------------
Q988H1_RHILO/49-168--------------------------------------------------------------------------------
B2W1S8_PYRTR/47-168--------------------------------------------------------------------------------
Q8DM85_THEEB/58-177--------------------------------------------------------------------------------
D0CMS6_9SYNE/50-172--------------------------------------------------------------------------------
A1VVT9_POLNA/47-167--------------------------------------------------------------------------------
C4Z9V1_EUBR3/52-173--------------------------------------------------------------------------------
Q6ACN3_LEIXX/48-169--------------------------------------------------------------------------------
Q21S99_RHOFD/47-167--------------------------------------------------------------------------------
A8UQ31_9FLAO/44-163--------------------------------------------------------------------------------
Q2LWN2_SYNAS/59-175--------------------------------------------------------------------------------
Q0IDQ7_SYNS3/54-169--------------------------------------------------------------------------------
B5VJ70_YEAS6/54-167--------------------------------------------------------------------------------
Q39TM3_GEOMG/59-172--------------------------------------------------------------------------------
Q7NXB4_CHRVO/48-170--------------------------------------------------------------------------------
Q6LYS0_METMP/74-187--------------------------------------------------------------------------------
A5KQS7_9FIRM/52-173--------------------------------------------------------------------------------
C2HRD9_VIBCL/52-164--------------------------------------------------------------------------------
A4BIU0_9GAMM/50-169--------------------------------------------------------------------------------
B8FYG6_DESHD/49-170--------------------------------------------------------------------------------
B2H132_BURPE/51-170--------------------------------------------------------------------------------
D3RUI4_ALLVD/47-167--------------------------------------------------------------------------------
A9KFJ4_COXBN/59-173--------------------------------------------------------------------------------
B9UJ05_9ACTO/48-167--------------------------------------------------------------------------------
B3L4A4_PLAKH/60-174--------------------------------------------------------------------------------
C0ZB16_BREBN/47-166--------------------------------------------------------------------------------
Q7USD1_RHOBA/65-177--------------------------------------------------------------------------------
C3K8M3_PSEFS/49-168--------------------------------------------------------------------------------
Q8PRB2_XANAC/57-170--------------------------------------------------------------------------------
A4VJI0_PSEU5/47-167--------------------------------------------------------------------------------
B7DPG1_9BACL/48-169--------------------------------------------------------------------------------
D2B1Z0_STRRD/45-164--------------------------------------------------------------------------------
Q02LN1_PSEAB/48-168--------------------------------------------------------------------------------
C7R704_KANKD/50-172--------------------------------------------------------------------------------
D3RQ21_ALLVD/47-166--------------------------------------------------------------------------------
C6WV73_METML/48-165--------------------------------------------------------------------------------
A8FBS7_BACP2/50-171--------------------------------------------------------------------------------
Q2RSV6_RHORT/47-167--------------------------------------------------------------------------------
Q20ZN3_RHOPB/48-168--------------------------------------------------------------------------------
D8JX32_HYPDA/59-177--------------------------------------------------------------------------------
Q2SLG5_HAHCH/47-167--------------------------------------------------------------------------------
B9P339_PROMR/61-175--------------------------------------------------------------------------------
A3HRD8_9BACT/47-167--------------------------------------------------------------------------------
C7Q560_CATAD/48-168--------------------------------------------------------------------------------
D5CRA4_SIDLE/47-167--------------------------------------------------------------------------------
D3PM19_MEIRD/52-172--------------------------------------------------------------------------------
E6VSF4_DESAO/52-176--------------------------------------------------------------------------------
C6PVS3_9CLOT/56-167--------------------------------------------------------------------------------
B7VAM4_PSEA8/58-174--------------------------------------------------------------------------------
Q6CH25_YARLI/47-167--------------------------------------------------------------------------------
D9SNK4_CLOC7/48-169--------------------------------------------------------------------------------
B4KUK4_DROMO/68-180--------------------------------------------------------------------------------
C5DQZ1_ZYGRC/47-167--------------------------------------------------------------------------------
F1TGG9_9CLOT/49-170--------------------------------------------------------------------------------
A9IE16_BORPD/48-171--------------------------------------------------------------------------------
D1B558_SULD5/43-157--------------------------------------------------------------------------------
C7QI69_CATAD/48-174--------------------------------------------------------------------------------
A3ZYU5_9PLAN/59-178--------------------------------------------------------------------------------
Q1IDC0_PSEE4/52-172--------------------------------------------------------------------------------
B1J8H6_PSEPW/48-170--------------------------------------------------------------------------------
Q0RHA1_FRAAA/20-140--------------------------------------------------------------------------------
Q5P2C5_AROAE/49-168--------------------------------------------------------------------------------
ASNH2_METJA/68-181--------------------------------------------------------------------------------
A0QVJ3_MYCS2/47-167--------------------------------------------------------------------------------
B4S380_PROA2/47-167--------------------------------------------------------------------------------
A3UKJ3_9RHOB/53-170--------------------------------------------------------------------------------
B6IX73_RHOCS/48-168--------------------------------------------------------------------------------
E8W5U4_STRFA/48-170--------------------------------------------------------------------------------
Q4FTY4_PSYA2/57-168--------------------------------------------------------------------------------
A4YY74_BRASO/59-175--------------------------------------------------------------------------------
D0LGD9_HALO1/48-171--------------------------------------------------------------------------------
D3FFB1_CONWI/46-165--------------------------------------------------------------------------------
Q4FTY1_PSYA2/56-172--------------------------------------------------------------------------------
B4WAP0_9CAUL/47-167--------------------------------------------------------------------------------
E8WR80_GEOS8/55-170--------------------------------------------------------------------------------
C6BTG8_DESAD/52-175--------------------------------------------------------------------------------
C3XKC4_9HELI/41-162--------------------------------------------------------------------------------
A8PKM5_9COXI/48-166--------------------------------------------------------------------------------
Q56619_VIBCL/54-169--------------------------------------------------------------------------------
D3RTP3_ALLVD/44-164--------------------------------------------------------------------------------
Q2MGB4_STRGR/49-171--------------------------------------------------------------------------------
C4I635_BURPE/48-173--------------------------------------------------------------------------------
B8IXH9_METNO/49-168--------------------------------------------------------------------------------
Q8ECG7_SHEON/56-171--------------------------------------------------------------------------------
D2S7W6_GEOOG/47-167--------------------------------------------------------------------------------
D5WZF9_THIK1/47-167--------------------------------------------------------------------------------
Q0A658_ALHEH/47-170--------------------------------------------------------------------------------
Q9FB19_9ACTO/51-170--------------------------------------------------------------------------------
Q2ILL8_ANADE/59-177--------------------------------------------------------------------------------
C6W7W6_ACTMD/51-172--------------------------------------------------------------------------------
A9FKC0_SORC5/48-170--------------------------------------------------------------------------------
C5UWI4_CLOBO/51-163--------------------------------------------------------------------------------
Q6ASA1_DESPS/50-173--------------------------------------------------------------------------------
Q7MSW7_WOLSU/49-158--------------------------------------------------------------------------------
Q220Y1_RHOFD/25-144--------------------------------------------------------------------------------
C7LT29_DESBD/46-162--------------------------------------------------------------------------------
Q2CH15_9RHOB/27-140--------------------------------------------------------------------------------
Q6U1H6_SHIDY/60-175--------------------------------------------------------------------------------
A8I1E3_AZOC5/46-166--------------------------------------------------------------------------------
Q6YPY1_ONYPE/48-167--------------------------------------------------------------------------------
Q11P23_CYTH3/44-161--------------------------------------------------------------------------------
Q0H2X8_9ACTO/48-170--------------------------------------------------------------------------------
A5WC05_PSYWF/51-174--------------------------------------------------------------------------------
D7VVT0_9FLAO/46-165--------------------------------------------------------------------------------
Q8TZ36_METKA/54-162--------------------------------------------------------------------------------
B5WKQ6_9BURK/48-170--------------------------------------------------------------------------------
C5M4U1_CANTT/47-167--------------------------------------------------------------------------------
A4YXC2_BRASO/59-177--------------------------------------------------------------------------------
Q5P0P7_AROAE/47-167--------------------------------------------------------------------------------
A1UEP1_MYCSK/47-167--------------------------------------------------------------------------------
Q30V26_DESDG/57-186--------------------------------------------------------------------------------
B0UMG8_METS4/47-167--------------------------------------------------------------------------------
A7HRA6_PARL1/47-167--------------------------------------------------------------------------------
A8TMT0_9PROT/47-167--------------------------------------------------------------------------------
A0ZBU8_NODSP/27-148--------------------------------------------------------------------------------
D9SCG7_GALCS/47-167--------------------------------------------------------------------------------
A4RU16_OSTLU/60-172--------------------------------------------------------------------------------
A7BTD4_9GAMM/34-149--------------------------------------------------------------------------------
C9NMI3_9VIBR/47-166--------------------------------------------------------------------------------
A4RXB8_OSTLU/49-169--------------------------------------------------------------------------------
B7J9F8_ACIF2/53-166--------------------------------------------------------------------------------
C6WBZ3_ACTMD/47-166--------------------------------------------------------------------------------
Q125B0_POLSJ/59-179--------------------------------------------------------------------------------
D0L316_GORB4/47-167--------------------------------------------------------------------------------
A1KKP3_MYCBP/68-182--------------------------------------------------------------------------------
Q30U87_SULDN/50-157--------------------------------------------------------------------------------
C8XB77_NAKMY/47-167--------------------------------------------------------------------------------
A0SZV7_9ACTO/48-170--------------------------------------------------------------------------------
C5ZZB1_9HELI/46-164--------------------------------------------------------------------------------
Q0YTU9_9CHLB/34-161--------------------------------------------------------------------------------
E0TGP5_PARBH/48-167--------------------------------------------------------------------------------
A8W7D4_9ACTO/48-173--------------------------------------------------------------------------------
D1PQ59_9FIRM/23-146--------------------------------------------------------------------------------
D5UY52_TSUPD/59-174--------------------------------------------------------------------------------
B6R111_9RHOB/41-164--------------------------------------------------------------------------------
A0CK03_PARTE/58-173--------------------------------------------------------------------------------
A6R1E0_AJECN/101-225--------------------------------------------------------------------------------
B6BKE4_9PROT/42-158--------------------------------------------------------------------------------
B5VUJ3_SPIMA/45-163--------------------------------------------------------------------------------
Q6CVM7_KLULA/47-167--------------------------------------------------------------------------------
Q6QW19_AZOBR/13-131--------------------------------------------------------------------------------
Q0W279_UNCMA/45-150--------------------------------------------------------------------------------
C0JRY2_STRLU/48-170--------------------------------------------------------------------------------
D5VU54_METIM/64-176--------------------------------------------------------------------------------
A6WDH3_KINRD/47-167--------------------------------------------------------------------------------
C4R588_PICPG/47-167--------------------------------------------------------------------------------
QUEC_SULAC/78-205--------------------------------------------------------------------------------
A4TXA1_9PROT/48-167--------------------------------------------------------------------------------
Q30U64_SULDN/41-156--------------------------------------------------------------------------------
O46196_AEDAE/70-187--------------------------------------------------------------------------------
A3SJ02_9RHOB/70-190--------------------------------------------------------------------------------
D0KR75_SULS9/78-205--------------------------------------------------------------------------------
C7BSC5_PHOAA/57-169--------------------------------------------------------------------------------
A4X3E4_SALTO/47-167--------------------------------------------------------------------------------
A6DK48_9BACT/48-168--------------------------------------------------------------------------------
QUEC2_SULTO/78-205--------------------------------------------------------------------------------
A0RRA8_CAMFF/43-159--------------------------------------------------------------------------------
C3RME3_9FIRM/51-164--------------------------------------------------------------------------------
C9YX81_STRSW/47-167--------------------------------------------------------------------------------
A0E625_PARTE/60-175--------------------------------------------------------------------------------
C0JRV7_9ACTO/48-170--------------------------------------------------------------------------------
D2SYZ2_MICEC/48-170--------------------------------------------------------------------------------
B2AEL9_PODAN/77-201--------------------------------------------------------------------------------
D2AQS0_STRRD/47-167--------------------------------------------------------------------------------
A6Q4Y9_NITSB/42-158--------------------------------------------------------------------------------
Q7UHC5_RHOBA/51-170--------------------------------------------------------------------------------
Q4Y1E6_PLACH/56-170--------------------------------------------------------------------------------
Q2W7V5_MAGSA/46-162--------------------------------------------------------------------------------
C5ZWC6_9HELI/53-161--------------------------------------------------------------------------------
Q7VEF5_PROMA/50-177--------------------------------------------------------------------------------
Q46Q66_CUPPJ/58-178--------------------------------------------------------------------------------
D3D0N6_9ACTO/47-163--------------------------------------------------------------------------------
ASNS_MIMIV/58-170--------------------------------------------------------------------------------
Q8KY35_STRCU/48-171--------------------------------------------------------------------------------
C3XLB4_9HELI/53-164--------------------------------------------------------------------------------
C4XQN6_DESMR/45-165--------------------------------------------------------------------------------
A3T3D5_9RHOB/31-153--------------------------------------------------------------------------------
A4YE70_METS5/78-205--------------------------------------------------------------------------------
Q1VVM8_9FLAO/52-161--------------------------------------------------------------------------------
A2R076_ASPNC/60-179--------------------------------------------------------------------------------
B8NXQ8_ASPFN/55-174--------------------------------------------------------------------------------
Q2W001_MAGSA/34-147--------------------------------------------------------------------------------
D1ALZ0_SEBTE/51-164--------------------------------------------------------------------------------
A8ZZB3_DESOH/53-170--------------------------------------------------------------------------------
Q1NS49_9DELT/43-160--------------------------------------------------------------------------------
A0RRB3_CAMFF/41-154--------------------------------------------------------------------------------
Q11NT7_CYTH3/50-168--------------------------------------------------------------------------------
Q2U6M1_ASPOR/59-178--------------------------------------------------------------------------------
Q8KSW7_9ACTO/48-172--------------------------------------------------------------------------------
D0DVH8_LACFE/51-164--------------------------------------------------------------------------------
O26514_METTH/65-169--------------------------------------------------------------------------------
Q7M7N7_WOLSU/41-156--------------------------------------------------------------------------------
A5FV61_ACICJ/47-161--------------------------------------------------------------------------------
Q0CLR1_ASPTN/62-174--------------------------------------------------------------------------------
B6HLP8_PENCW/58-177--------------------------------------------------------------------------------
B7V387_PSEA8/41-153--------------------------------------------------------------------------------
B1YDA4_THENV/121-259--------------------------------------------------------------------------------
D4C7W3_9CLOT/47-159--------------------------------------------------------------------------------
B0TYV0_FRAP2/51-161--------------------------------------------------------------------------------
C7RIV9_ACCPU/97-224--------------------------------------------------------------------------------
C1E3Q0_MICSR/60-172--------------------------------------------------------------------------------
Q2L1U1_BORA1/88-215--------------------------------------------------------------------------------
D1Z1D8_METPS/43-149--------------------------------------------------------------------------------
A1ZFN5_9BACT/52-169--------------------------------------------------------------------------------
B4RF38_PHEZH/47-166--------------------------------------------------------------------------------
C9PF78_VIBFU/43-158--------------------------------------------------------------------------------
Q0BQM1_GRABC/48-163--------------------------------------------------------------------------------
A8EQV6_ARCB4/41-156--------------------------------------------------------------------------------
A8G661_PROM2/51-168--------------------------------------------------------------------------------
Q5FPJ6_GLUOX/47-164--------------------------------------------------------------------------------
B4SIH4_STRM5/50-164--------------------------------------------------------------------------------
A1ZXW4_9BACT/46-164--------------------------------------------------------------------------------
Q313Y7_DESDG/87-214--------------------------------------------------------------------------------
B7RW46_9GAMM/47-167--------------------------------------------------------------------------------
A8ME82_CALMQ/83-211--------------------------------------------------------------------------------
Q8KRY7_PSESX/56-177--------------------------------------------------------------------------------
C7JBX0_ACEP3/48-163--------------------------------------------------------------------------------
C5K3E6_AJEDS/64-193--------------------------------------------------------------------------------
D1A6E6_THECD/109-235--------------------------------------------------------------------------------
A3WF90_9SPHN/49-165--------------------------------------------------------------------------------
B9P358_PROMR/59-169--------------------------------------------------------------------------------
D1P7K2_9ENTR/45-159--------------------------------------------------------------------------------
Q1V7N1_VIBAL/45-159--------------------------------------------------------------------------------
Q8H9W0_9CAUD/81-197--------------------------------------------------------------------------------
D0MHA3_RHOM4/51-167--------------------------------------------------------------------------------
B2A1P6_NATTJ/45-164--------------------------------------------------------------------------------
D1CB97_THET1/45-164--------------------------------------------------------------------------------
A5GA44_GEOUR/54-181--------------------------------------------------------------------------------
D1CIY9_THET1/47-165--------------------------------------------------------------------------------
Q2RW74_RHORT/56-169--------------------------------------------------------------------------------

PF00310

GLT1_ORYSJ/100-477CGV.GFVAELSGDYKR.ATVNDALEMLERMAHRGACGCEKNTGDGAGILV..ALPHNFF.REVTKDA.GFELPQP.GEYA
GLTB2_ARATH/108-480CGV.GFIANLENKATH.KIVNDALIALGCMEHRGGCGSDNTSGDGSGLMT..SIPWDLF.NEWAEKQ.GIASFDR.THTG
GLUT1_ARATH/117-494CGV.GFVAELSGETTR.KTVTDSLEMLIRMTHRGACGCESNTGDGAGILV..GLPHDFY.AEAATEL.GFVLPSA.GNYA
GLTA_BACSU/22-388CGI.GLYAHLKGKQTH.DIVKQGLKMLCQLDHRGGQGSDPDTGDGAGLLV..QIPDAFF.RKEC..K.NINLPEK.ERYG
PUR1_BACSU/12-206CGVFGIW......GHE.EAPQITYYGLHSLQHRGQ........EGAGIVA..TDGEK.......................
GFPT1_HUMAN/2-215CGIFAYLNYHVPRTRR.EILETLIKGLQRLEYRGY........DSAGVGF..DGGND...KDWEANACKIQLIKK.KG..
GLMS_ECOLI/2-194CGIVGAI......AQR.DVAEILLEGLRRLEYRGY........DSAGLAV..VDAEG.......................
ASNS_CRIGR/2-161CGIWALF......GSD.DCLSVQCLSAMKIAHRG....................PDAF......................
GFA1_YEAST/2-209CGIFGY.CNYLVERSRGEIIDTLVDGLQRLEYRGY........DSTGIAI..DGDEA.......................
GFA1_SCHPO/2-205CGIFGYINYLVERDRG.YILKTLVKGLKRLEYRGY........DSSGCAVDGDEGEDF...........IMFKE......
ASNB_ECOLI/2-162CSIFGVF.DIKTDA.V.ELRKKALELSRLMRHRGP........DWSGIYA..SDNAIL......................
PUR1_SHIFL/2-211CGIVGIA......GVM.PVNQSIYDALTVLQHRGQ........DAAGIIT..IDANN.......................
GLMS_HAEIN/2-194CGIVGAV......AQR.DVAEILINGLHRLEYRGY........DSAGVAV...INKQ.......................
PUR1_HAEIN/2-210CGIVGIV......SQS.PVNESIYAALTLLQHRGQ........DAAGIVT..VDDEN.......................
NODM_RHILV/2-193CGIVGIV......GHK.PVSERLIEALGRLEYRGY........DSSGVAT.IFEGEL.......................
ASNS1_PEA/2-161CGILAVL..GCSDDSQ.AKRVRILELSRRLKHRGP........DWSGLH...QHGDN.......................
GLMS_BACSU/2-193CGIVGYI......GQL.DAKEILLKGLEKLEYRGY........DSAGIAV..ANEQGI......................
GLT1_YEAST/54-428CGV.GFVANKHGEQSH.KIVTDARYLLVNMTHRGAVSSDGN.GDGAGILL..GIPHEFMKREFKLDL.DLDIPEM.GKYA
PUR1_YEAST/2-214CGILGIV...LANQTT.PVAPELCDGCIFLQHRGQ........DAAGIAT..CGSRG.......................
Q9R6W7_NOSS1/35-403CGV.GFIAHRQNLGSH.ELWLK.LCALTCLEHRGGCSADQDSGDGAGILT..AIPWELL.QQDYPQG.QIDFLSS.KNIA
O08339_RHOSH/34-404CGV.GLVVSISGTPSR.KVVESGIAALKAVWHRGAVDADGKTGDGAGIHV..QIPVKFF.YDQIRRT.GHEPTCT.KLVA
Q98H51_RHILO/54-428CGV.GFIVNMKGVKSH.QIVKDGLAVLENLTHRGAVGADPLVGDGAGVLV..QLPDQFF.REEMAAQ.GIELPPA.GQYG
Q9Z465_CORGT/16-380CGV.AFIADIHGRPSR.SIVDRALEALRNIDHRGAAGAEKNTGDGAGILM..QIPDGFY.REVS....GIELPEA.GEYA
Q97IG8_CLOAB/23-393CGI.GFITSIKGEKSH.DIVKKGIEILVNLTHRGAVGADTKTGDGAGIML..QIPDEFF.RINCDNL.GIELPES.GKYA
GLT1_SCHPO/69-442CGV.GFTCHIKGQVSH.KIVTDARLLLCNMTHRGATGADTRDGDGAGVMT..GMPYTFMQKEFGQ.I.GCTLPKS.GEYA
GLTB_ANTSP/27-400CGV.GFIANLNSKPSN.KIVTEALNALSCMEHRGGCGADNISGDGAGVTI..QIPWDIFISEGINFLPKLQSNQSILNYG
Q9VVA4_DROME/88-454CGV.GFIVAIDGKRSH.KILRDAQTLSERMNHRGACACDNDTGDGAGVLA..SIPHGLYSKALAKQ..GVTLPEL.GDYA
Q9CPJ9_PASMU/2-216CQLLGM........NC.NTPTDIVFSFEGFRRRAGLTDCHC..DGFGIAF..FEGKGI......................
GLTB_CYACA/37-408CGV.GFIAHLDNKFGH.KLMMNALEALATMEHRGACSADEESGDGAGILF..SIPWKFF.VEWSLRY.KQFKINI.SQAA
Q9KPY3_VIBCH/2-217CELLGM........SA.NVPTDICFSFTGLMQRGGKTGPHR..DGWGIAF..YEGKGF......................
Q9XDC9_CLOSA/21-385CGI.GTIVNIDGENHM.KFYQXCLTILEKLEHRGGTGADENTGDGAGILF..NIPHKFF.KEELQSK.GITLEEE.GDYA
Q9HUD5_PSEAE/15-378CGF.GLIAHMQGEPSH.QLLQTAIEALTCMTHRGGINADGKTGDGCGLLI..QKPDLFL.RAVAREAFSVDLPE...QYA
Q9CG24_LACLA/23-377CGM.GFIAQIDGKASH.LLVERALTMLTRMNHRGGTGAEPETGDGAGILL..ALPDEFF.RKIAKEH.DVELPKL.GDYA
GLTB_AZOBR/37-405CGV.GFIAAIDGKPRR.SVVEKGIEALKAVWHRGAVDADGKTGDGAGIHV..AVPQKFF.KDHVKVI.GHRAPDN.KL.A
Q9P540_NEUCS/54-436CGV.GFACHIKGKPSH.KIVSDARNLLCNMTHRGAVGSDARDGDGAGVMT..SIPHKFFVKNFARDV.GVTLPPL.GQYA
Q9JY00_NEIMB/2-216CQLLGM........NC.NTPTDIMFSFEGFRRRGGITDHHA..DGFGIGF..FEGKGV......................
Q9KPJ1_VIBCH/13-376CGF.GLIAHMEGQASH.KLVRTAISALDRMTHRGGIAADGKTGDGCGLLL..QKPDSYL.RLIAEEQ.HWKLSK...QYA
PUR1_SCHPO/2-213CGILALM...LADPHQ.QACPEIYEGLYSLQHRGQ........DAAGIVT..AGNKG.......................
GLTB_SYNY3/43-413CGV.GFIVQMKGKVSH.DIVEQGLQMLVNLEHRGACGCEPNTGDGAGILI..QVPHKFI.QKIAGAE.GITIPAP.GQYA
Q51579_PLEBO/39-409CGV.GFIVDQQGRASH.DLMSKALIALSCMEHRGGCSADQDSGDGAGVMA..EIPWEIL.NQWASDR.GVTL.KP.GYTG
O67512_AQUAE/8-365CGV.GFVCDIYGRKSH.DILKKGIQAVKNLTHRGAIGGDGKTGDGAGILT..EIPVKFF.MKEFKKL.GYEVSSP.ENLA
Q9I437_PSEAE/2-215CELLGM........SA.NVPTDIVFSFTGLMQRGGGTGPHR..DGWGIAF..YEGRGV......................
GLTS_SYNY3/37-404CGV.GFIANLRGKPDH.TLVEQALKALGCMEHRGGCSADNDSGDGAGVMT..AIPRELL.AQWFNTR.NLPMPDG.DRLG
Q9S2Y9_STRCO/20-378CGV.GFVATLTGEASH.TLVDQALTVLRNLEHRGATGSEPDSGDGAGILS..QVPDAFF.REVA....GFELPEA.GAYA
Q9RXX2_DEIRA/53-426CGV.GMVAHIGGQKSH.HIIAQGLKILENLDHRGAVGADPLMGDGAGILL..QIPDAFY.RAEMSLQ.GVTLPPP.GDYG
PUR1_CHICK/12-236CGVFGCIAAGVWPTEL.DVPHVITLGLVGLQHRGQ........ESAGIVT..SDGES.......................
Q9KC46_BACHD/22-392CGI.GFLAHMKGQKSH.KIVEDALHILCNLEHRGGQGDEVNTGDGAGILL..QLPHRFF.QKVTVSE.GISLPEE.GKYG
Q9RNZ7_ZYMMB/34-404CGV.GLVAATDGKASR.RVVTAAIDALKAVWHRGAVDADGKTGDGAGIHV..DLPASFF.DDAIAHA.GHAPLPN.RL.A
Q9PA10_XYLFA/24-386CGF.GMVAQLDDQPSR.ALLEIAIAALSRMTHRGGVAADGLTGDGCGLLI..RKPDAFL.RALAGEA.GIMLGP...RYA
Q9A2F8_CAUCR/30-396CGV.GLVCAIDGQPRR.EVVELAIKALKALWHRGAVDADGKTGDGAGVLV..SVPQDFF.IDQVRRT.GHALRQG.PI.A
Q9KPJ4_VIBCH/37-409CGI.GFVAHLKNRKSH.QVVTQALDMLARMEHRGGQGCDPCSGDGAGILL..QKPHEFL.LEEAVKL.GIKLPSF.EKYG
GLTB_PORPU/34-404CGV.GFIADVNNIANH.KIVVQALEALTCMEHRGACSADRDSGDGAGITT..AIPWNLF.QSGLKDK.GIIIQKN.ESIG
Q51583_PLEBO/24-394CGV.GFIVQMKGQPSH.SIVQQALTILANLEHRGACGAETNTGDGAGILM..QVPHGFF.QKVTATL.NITLPDA.GQYG
Q9CDD5_MYCLE/18-389CGV.AMVVDMYGRRTR.DIVDKAITALLNLEHRGAQGAEPRSGDGAGILI..QVPDAFL.RAVV....DFELPAA.SSYA
D8BYX0_ECOLX/43-406CGF.GLIAHIEGEPSH.KVVRTAIHALARMQHRGAILADGKTGDGCGLLL..QKPDRFF.RIVAQER.GWRLAK...NYA
O61143_PLAFA/21-537CGV.GVVADINGKFSR.NVIQKALQILLRLSHRGGV..QGNNGDGAGILV..GIPHEYFQMLSDTCQLPFLLPEK.GEYA
Q99WD1_STAAM/20-380CGI.GFYANMDNKRSH.DIIDKSLEMLRRLDHRGGVGADGITGDGAGIMT..EIPFAFFKQHVT....DFDIPGE.GEYA

PF12481

A8IXL5_BRACM/2-226LGIFSGAIVSLPEELVA.AGNRTP.SP.............................KT...............TGSVLVN
A9PEF3_POPTR/2-226LGVFSSAIVSPPDELVA.AGSRTP.SP.............................KI...............SADALVK
Q3HRW3_SOLTU/2-241LGVFSSSIVSPPEELVA.AGSRTP.SP.............................KI...............TSDALVN
Q2RAK8_ORYSJ/2-226LAVFSGAVVEVPAELVA.AGSRTP.SP.............................KT...............RASELVG
A9NKZ6_PICSI/2-228LAIFKSTVAYGPEELRF.PTGEISPSPDL...........................KK...............SSSALLR
A9NXH4_PICSI/2-226LAIFNNSVASGPEELRI.PGDRSPNYP.............................KK...............DSSDLLS
A9TLC6_PHYPA/2-227LAVVHKSVAKAPAELVA.PDGGSP.DS.............................RC...............HGSEILA
A9NP52_PICSI/2-226LTVLKRSVAQGPEELTS.PNGK...ADQR...........................KN...............GSD.VVQ
B7FHM6_MEDTR/2-224LAVFSKSVAKSPEGLQS.PESN.S.VSSL...........................KD...............AF..LAQ
C6T2Q6_SOYBN/2-226LAVFDKSVAKSPEGLQS.PHSD.S.VSAL...........................KD...............GF..IAE
B9HUQ8_POPTR/2-227LAVFDKTVAKCPDALQS.PHSAPA.ASVL...........................KD...............GF..LAN
A5AXQ8_VITVI/2-226LAVFHKSIAEAPEGLRT.PDSA.S.LPAL...........................KD...............GF..LPQ
Q9LIL3_ARATH/2-226LAIFDKNVAKTPEALQG.QEGG.S.VCAL...........................KD...............RF..LPN
A2XLW7_ORYSI/2-228LAVFDPTVAKCPEGLRS.PPVAG..GAVA...........................AG...............GAGALMK
B3TM05_ELAGV/2-228LAVFDRTVAKCPEGLRN..MDSGP.GEKG...........................VG...............GVASLVD
Q6F390_ORYSJ/2-226LAVFDRAVAPSPEGLRH.PGAAGD.................................................GAAGLAE
Q9FG81_ARATH/2-227LAVFEKTVANSPEALQS.PHSSES.AFAL...........................KD...............GS..LAT
A8IXL3_BRACM/2-239LAVFEKTVANSPDALQS.PHSDSP.SYAL...........................KE...............GY..LAS
A5BPK4_VITVI/2-230LAIFHKAFAHPPEELNS.PA.SRD.GSRK...........................PK...............LPEETLR
Q9FYX7_SOYBN/2-232LAIFHKAFAHPPEELNS.PA.SYK.GSKK...........................PK...............VPEETLK
A9PBW3_POPTR/2-230LAIFHKAFAHPPEELNS.PA.SQN.VTKK...........................PK...............LPEETLD
Q9LE80_ARATH/2-229LAIFQKAFAHPPEELNS.PA.SHF.SGKT...........................PK...............LPGETLS
C6T9Q0_SOYBN/2-229LGIFKQKLVNAPKELNS.PA.SLN.SCIK...........................PK...............LSHEILK
A9PK29_9ROSI/2-230LAIFNKGLVNPPQELYS.PA.SLC.SSRK...........................PK...............LPEEIVK
A6YGE8_CARPA/2-230LAVFNKGLVNPPEELRS.PA.SLG.SSKK...........................PK...............LPQEILN
B8YIB1_MIRJA/2-231LAIFNKGLVDPPKELNS.PTNNLQ.SNRK...........................PK...............SHEEIVR
Q40127_SOLLC/2-272LAIFKNGVVDPPKELQS.PA.SLQ.ASIKAANPEETMKNSAREKMLAIFKNGVVDPPKELQSPASLQASIKAANPEETMK
A2XZ07_ORYSI/2-231LAIFQKQVAHAPAELNS.PR.SSA...AK...........................PK...............NPDEILR
Q43378_ASPOF/2-233LAIFHKGFAHPPQELYS.PE...H.CRRQ...........................SK...............SPEEILR
Q05FE8_ELAGV/2-228LAIFHKAFAHPPQELNS.PG.GGR...RV...........................PK...............NPEEILR
B8LRD8_PICSI/3-230LAVFEKSIGQGPEELTS.PTSKRA.ANQK............................................SGMEIMN
Q307Z6_SOLTU/2-223LAVFEQSIGKPPSELST......QKKE.............................AK...............TEEEIAE
A9NZE6_PICSI/2-230LAAFNKSVVDAPQELVSLPVGADG.GSDM...........................RK...............TEKQLAD

PF13230

A4JBJ9_BURVG/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPIAEMVKRYP.I
B3CXI0_BURM1/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPIAEMVKRYP.I
A1V0D8_BURMS/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
B2UFJ6_RALPJ/1-272MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVAELVKRYP.I
Q0A7W5_ALHEH/1-270MCELLAMSANTPTDLCFSFTGLARRGGAAGPHKDGWGVAFYE..........GRGVRVFHDPQPSADSRIAEIVQTQP.I
Q3A260_PELCD/1-273MCQLLGMNCNVPTDICFSFTGFRQRGGSTDVHSDGWGIAFFE..........GKGVRLFVDPQASAESTIAELVRSYP.I
B0V907_ACIBY/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLIRNYP.I
B2SYL4_BURPP/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGVTDHHADGWGIAFFE..........DKACRLFIDHQSSATSPIAEMVKRYP.I
Q1BZ50_BURCA/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDHQASATSPIAEMVKRYP.I
A9LB76_BURML/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
C9YH78_9BURK/11-284MCQLLSMNCNNTASIQFSFTGFSERGGHTSDHVDGWGIAFYE..........PTGSRLFIDDKPAYESPLARFVKGYE.I
B0VTE1_ACIBS/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLIRNYP.I
C9YDF1_9BURK/1-277MCQLLGMNSHLPASLTLSFTGFSQRGGCTDHHSDGWGIAFFESEGDQP....GKAARHFVDKESASTSPIAKMLKSYP.I
Q2SZ73_BURTA/24-296MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSATSPIAEMVKRYP.I
A3MPF1_BURM7/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
Q6FDQ6_ACIAD/4-274MCQLLGMNCATPTDITFSFKGFSQRAGITSDHSDGFGIAFFE..........DKTCRLFIDNQSAVESPIAELVRNFP.I
C4KV44_BURPE/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
B9C0I0_9BURK/25-297MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPIAEMVKRYP.I
C6TY74_BURPE/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
Q2NG26_METST/1-246MCELFGVSSQQPVHINNYLKSFYRHCNM...HPHGWGLALMN..........NKQPHIEKEPIEATESRHLKEILKNP.I
Q13UA7_BURXL/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGVTDHHADGWGIAFFE..........DKACRLFIDHQSSATSPIAEMVKRYP.I
A0K4K0_BURCH/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDHQASATSPIAEMVKRYP.I
A2WCM9_9BURK/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPIAEMVKRYP.I
Q475U0_CUPPJ/1-272MCQLLGMNCATPTDVTFSFTGFAARGGLTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVADLIKRYP.I
B4AR53_FRANO/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
C6RPJ8_ACIRA/1-271MCQLLGMNCATPTDITFSFRGFSQRAGVTSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIAELIRNYP.I
D0LFZ1_HALO1/1-274MSHLLAMSFDMLASPSIQLRSWAD..ANANAAATGWGFAWYPGE........NLAAQVIKDPVSTGDTALTRVLRDWDRF
B1M0S3_METRJ/1-260MCELLGMSANVPTDIRFSFAGLARRGGETGPHADGWGISFYD..........GRTCRSFHEPEPSARSQLARLLRDMP.I
B2AH51_CUPTR/1-272MCQLLGMNCATPTDVTFSFTGFAARGGVTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVADLIKRYP.I
C6BC48_RALP1/1-272MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVAELVKRYP.I
D0C9S1_ACIBA/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLIRNYP.I
A7JMK2_FRANO/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
A7YT79_FRATU/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
B9BD23_9BURK/25-297MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPIAEMVKRYP.I
A9VWD5_METEP/29-300MCELLGMSANVPTDIRFSFAALARRGGETGPHADGWGITFYE..........GRGCRSFHDPEPSARSELAKLLRRYP.I
A3NDH4_BURP6/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A0Q741_FRATN/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
C4GG62_9NEIS/1-273MCQLLGMNCNTPTDIGFSFAGFSKRGGLTDHHTDGFGIGFFE..........GRGLRLFLDDKPSAQSPVAELVRNYH.I
D5WD47_BURSC/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGVTDHHADGWGIAFFE..........DKACRLFIDHQSSATSPIAEMVKRYP.I
Q63QV9_BURPS/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A2S5G7_BURM9/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
B5S8H8_RALSL/13-284MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVAELVKRYP.I
C7CMW0_METED/1-272MCELLGMSANVPTDIRFSFAALARRGGETGPHADGWGITFYE..........GRGCRSFHDPEPSARSELAKLLRRYP.I
B2HV32_ACIBC/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLIRNYP.I
Q1LRD7_RALME/1-272MCQLLGMNCATPTDVTFSFTGFAARGGVTDHHSDGFGVAFFE..........DKACRLFIDNQSAGTSPVADLIKRYP.I
B7KSM2_METC4/1-272MCELLGMSANVPTDIRFSFAALARRGGETGPHADGWGITFYE..........GRGCRSFHDPEPSARSELAKLLRRYP.I
C5AB16_BURGB/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........EKACRLFLDHQSSATSPIAEMVKRYP.I
Q0BI95_BURCM/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPLAEMVKRYP.I
B5SG66_RALSL/13-284MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVAELVKRYP.I
D0C3B3_9GAMM/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLIRNYP.I
Q0KEE5_CUPNH/1-272MCQLLGMNCATPTDVTFSFTGFAARGGLTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVADLIKRYP.I
D0SU94_ACILW/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHGDGFGIAFFE..........DKACRLFVDNQSAVESPIAELVRNYP.I
C5ASQ1_METEA/1-272MCELLGMSANVPTDIRFSFAALARRGGETGPHADGWGITFYE..........GRGCRSFHDPEPSARSELAKLLRRYP.I
A9ER87_SORC5/1-279MPNLLAMSFEGELAPCFDLTCLQPGRKL....PDGWGIGYYPGG........EPSASVLKEPAPPQGSIRSELVKAWEHL
B1N200_BURPE/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A8KUB1_BURPE/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
B2JGV6_BURP8/1-272MCQLLGMNCAAPTDVTFSFTGFAARGGVTDHHSDGWGIAFFE..........DKACRLFIDHQSSATSPIAEMVKRYP.I
A7JIF8_FRANO/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
A5J900_BURML/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A7NBB7_FRATF/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
Q47AN0_DECAR/1-267MCQLLGMNCNVPTDICFSFSGFQARGGATDVHSDGWGIAFFE..........GKGTRLFLDPQPSSTSPVAELVRQYP.I
A3RRN4_RALSL/13-284MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVAELVKRYP.I
B1FF86_9BURK/25-297MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPLAEMVKRYP.I
B9CJ55_9BURK/25-297MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPIAEMVKRYP.I
D0WIN3_9ACTN/1-249MCQLFAYSSLHPTTATAALAEFF...GNSVDNPHGWGVAWHE..........GDEVRMVKEPIPAYRSTLVRHTLDEA.I
A5XUZ1_BURML/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A4IYM1_FRATW/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
C5N7G0_BURML/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
C0VJ77_9GAMM/1-271MCQLLGMNCATPTDITFSFRGFSQRAGVTSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLVRNYP.I
Q5P4D2_AROAE/1-272MCQLLGMNCNVPTDICFSFAGFQARGGVTDHHRDGWGIAFFE..........GRGVRVFLDPQPSANSPVAELVRNYP.I
D0T4E4_ACIRA/1-271MCQLLGMNCATPTDITFSFRGFSQRAGVTSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIAELIRNYP.I
Q8Y251_RALSO/1-272MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFE..........DKACRLFIDNQSAGTSPVAELVKRYP.I
B0TY56_FRAP2/2-277FSNILAISSDCPISPRINFL....VDDTTTLQEFMWGIGWYHDN........HNAVSIMKDNHVENLEALRALFDGNPNF
Q3JNQ6_BURP1/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
D3E130_METRM/1-248MCEIFGFSSSREEELNDYLKTFFSHC...EEHPHGWGLAILD..........SDKYQIRKEPVKARSSVMLGNILLNP.I
A3M328_ACIBT/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLIRNYP.I
D0S0M3_ACICA/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHSDGFGIAFFE..........DKACRLFVDNQSAVESPIADLIRNYP.I
C4ANW9_BURML/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A2VSW5_9BURK/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDHQASATSPIAEMVKRYP.I
C6YWP7_9GAMM/2-277FSNILAISSDCPISPRINFL....VDDTTTLQEFMWGIGWYHDN........HNAVSIMKDNHVENLEALRALFDGNPNF
D0S8W3_ACIJO/1-271MCQLLGMNCATPTDITFSFRGFSQRAGITSDHCDGFGIAFFE..........DKACRLFVDNQSAVESPIAELIRNYP.I
Q62H44_BURMA/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A4KQS8_FRATU/2-279FSNILAISSDCPISPKVDLINDNVSSDTIRDFM..WGIGWYHSD........HNEATILKESHVESVDVLRSLFKDNSNF
B7CLH7_BURPE/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
B2H0I4_BURPE/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
A9G0L9_SORC5/1-275MCELLGMVSNVPTDIVFSFTGLALRGGQTGPHADGWGVSLYD..........GLFARTFLESHPAFSSPLARFIRENP.I
A8EIA4_BURPE/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
D3S2D4_FERPA/1-270MCELFGLCSNKIVGISFSWRGFVRRGAK...HRSGWGVGWYVENERG.....ERYAALVKEPRPSVSSPVAELLRR.G.I
C4ZMI2_THASP/1-272MCQLLGMNCNVPTDICFSFAGFRARGGLTDHHRDGWGIAFFE..........GRGVRVFLDPAPSAHSPVAELVNRYP.I
Q39JK4_BURS3/1-273MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDHQASATSPIAEMVKRYP.I
A1K1T1_AZOSB/1-272MCQLLGMNCNVPTDICFSFTGFRARGGLTDHHRDGWGIAFFE..........GKGVRLFLDPCASADSAVAELVRQYP.I
Q220N7_RHOFD/1-283MCQLLGMNSHLPASLTLSFTGFSQRGGCTAHHADGWGIAFFESESATPDQP.GKGVRYFVDKEGAATSPIAKMLRTYP.I
A4MF24_BURPE/13-285MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I
C8PUW8_9GAMM/1-285MCQLLGMNCNTPTDIHFSFAGFRQRGGQTDIHTDGFGIVFFEKNPDPSQGNRKAGLRQFHDDKPSFCSPVADLVNSYP.I
D0SKG0_ACIJU/1-271MCQLLGMNCATPTDITFSFRGFSQRAGVTSDHCDGFGIAFFE..........DKACRLFVDNQSAVESPIADLVRNYP.I
A9AH86_BURM1/25-297MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQASATSPIAEMVKRYP.I
A3NZ85_BURP0/1-273MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFE..........DKACRLFIDQQSSSTSPIAEMVKRYP.I

PF09147

Q8KM13_PHOLM/3-201SEFCFVKYGFDK--------------------------------------------------------------------
Q9XB61_ERWCA/3-203NSFCVVYKGSDT--------------------------------------------------------------------
Q2NVG4_SODGM/4-196NDFCIIHGNINK--------------------------------------------------------------------

PF00227

PSB2_CRYNJ/1-184--------------------------------------------------------------------------------
PSB_HALSA/45-226--------------------------------------------------------------------------------
PSA1_HALVD/33-217--------------------------------------------------------------------------------
PSB3A_ARATH/5-189--------------------------------------------------------------------------------
PSB6_DICDI/11-193--------------------------------------------------------------------------------
PSA3_DICDI/31-216--------------------------------------------------------------------------------
PSB4_MOUSE/50-237--------------------------------------------------------------------------------
PSB2_AERPE/22-203--------------------------------------------------------------------------------
PSA3_MOUSE/31-217--------------------------------------------------------------------------------
PSA2_CARAU/29-213--------------------------------------------------------------------------------
PSB2_ORYSJ/1-182--------------------------------------------------------------------------------
PSA3_CAEEL/31-216--------------------------------------------------------------------------------
PSB1_AERPE/2-185--------------------------------------------------------------------------------
Q8SSI0_ENCCU/6-190--------------------------------------------------------------------------------
HSLV_THEMA/2-176--------------------------------------------------------------------------------
PSB4_ARATH/28-213--------------------------------------------------------------------------------
O96780_TRYBR/26-207--------------------------------------------------------------------------------
PSA3_ENCCU/26-211--------------------------------------------------------------------------------
PSB3_GIAIN/6-191--------------------------------------------------------------------------------
Q98S57_GUITH/22-204--------------------------------------------------------------------------------
Q9VK14_DROME/29-214--------------------------------------------------------------------------------
HSLV_RICPR/6-181--------------------------------------------------------------------------------
Q8UUL9_ORYLA/13-196--------------------------------------------------------------------------------
PSB7_SCHPO/32-213--------------------------------------------------------------------------------
O12994_ORYLA/18-200--------------------------------------------------------------------------------
PSA_MYCS2/24-210--------------------------------------------------------------------------------
PSA5_CAEEL/31-219--------------------------------------------------------------------------------
PSA_AERPE/35-220--------------------------------------------------------------------------------
PSB_ARCFU/8-191--------------------------------------------------------------------------------
PSB6_SCHPO/21-203--------------------------------------------------------------------------------
Q98RW3_GUITH/25-209--------------------------------------------------------------------------------
PSA_METTH/32-216--------------------------------------------------------------------------------
PSA_SULSO/33-219--------------------------------------------------------------------------------
Q9AW13_GUITH/5-185--------------------------------------------------------------------------------
PSA1_DROME/29-216--------------------------------------------------------------------------------
PSA4_DICDI/28-217--------------------------------------------------------------------------------
PSA6_YEAST/40-228--------------------------------------------------------------------------------
PSA_METAC/30-214--------------------------------------------------------------------------------
PSB_STRCO/50-238--------------------------------------------------------------------------------
O18314_CIOIN/37-218--------------------------------------------------------------------------------
PSA6_CAEEL/35-220--------------------------------------------------------------------------------
Q9NDA3_9TRYP/29-214--------------------------------------------------------------------------------
PSA4_ENCCU/27-206--------------------------------------------------------------------------------
PSA71_DROVI/28-211--------------------------------------------------------------------------------
PSB_HALVD/46-226--------------------------------------------------------------------------------
PSA5A_ARATH/31-218--------------------------------------------------------------------------------
Q9W470_DROME/45-226--------------------------------------------------------------------------------
PSB3_DROME/6-190--------------------------------------------------------------------------------
PSA7_CAEEL/27-212--------------------------------------------------------------------------------
PSA_PYRAE/32-215--------------------------------------------------------------------------------
PSB5_SCHPO/58-240--------------------------------------------------------------------------------
HSLV_XYLFT/4-178--------------------------------------------------------------------------------
Q8T8V8_DROME/68-250--------------------------------------------------------------------------------
Q8UVV0_HETFR/67-249--------------------------------------------------------------------------------
HSLV_THETN/1-176--------------------------------------------------------------------------------
Q8SR95_ENCCU/28-203--------------------------------------------------------------------------------
PSB_METAC/6-189--------------------------------------------------------------------------------
O62102_CAEEL/43-224--------------------------------------------------------------------------------
PSA1B_ARATH/29-214--------------------------------------------------------------------------------
PSB1_SULTO/2-183--------------------------------------------------------------------------------
PSA1_DICDI/29-216--------------------------------------------------------------------------------
Q98S31_GUITH/31-212--------------------------------------------------------------------------------
PSB1_PYRFU/3-185--------------------------------------------------------------------------------
PSB1_YEAST/26-210--------------------------------------------------------------------------------
PSA4_CAEEL/28-213--------------------------------------------------------------------------------
PSB4_DROME/54-242--------------------------------------------------------------------------------
PSB3_CAEEL/5-189--------------------------------------------------------------------------------
PSA_METJA/32-215--------------------------------------------------------------------------------
PSA3_DROME/31-216--------------------------------------------------------------------------------
PSB1_PYRAE/1-181--------------------------------------------------------------------------------
HSLV_LISMO/2-179--------------------------------------------------------------------------------
PSA1_TRYBR/29-216--------------------------------------------------------------------------------
PSA7_CHICK/26-211--------------------------------------------------------------------------------
PSB_METKA/7-191--------------------------------------------------------------------------------
Q966I8_CAEEL/20-202--------------------------------------------------------------------------------
Q98RR2_GUITH/8-190--------------------------------------------------------------------------------
PSA6_SCHPO/30-219--------------------------------------------------------------------------------
PSA1_TRYCR/29-216--------------------------------------------------------------------------------
PSA6_DROME/35-218--------------------------------------------------------------------------------
Q8UVV5_HETFR/15-196--------------------------------------------------------------------------------
PSA2_NEUCR/28-213--------------------------------------------------------------------------------
Q8T915_DROME/46-228--------------------------------------------------------------------------------
PSA_SULTO/33-220--------------------------------------------------------------------------------
PSA72_DROME/28-213--------------------------------------------------------------------------------
PSB1_SULSO/2-183--------------------------------------------------------------------------------
PSB3_ONCMY/5-190--------------------------------------------------------------------------------
PSA7_DICDI/29-211--------------------------------------------------------------------------------
PSB2_PYRAE/5-187--------------------------------------------------------------------------------
PSA3_ARATH/31-216--------------------------------------------------------------------------------
HSLV_CHLTE/8-181--------------------------------------------------------------------------------
Q9NJV7_CRYPV/10-192--------------------------------------------------------------------------------
PSA4_DROME/28-219--------------------------------------------------------------------------------
PSA_HALSA/33-217--------------------------------------------------------------------------------
PSA7_SCHPO/27-211--------------------------------------------------------------------------------
Q9RAW7_9ACTO/49-237--------------------------------------------------------------------------------
PSB2_SULSO/11-192--------------------------------------------------------------------------------
PSB5_CHICK/52-234--------------------------------------------------------------------------------
Q8T759_BRAFL/68-250--------------------------------------------------------------------------------
Q9BMX8_9TRYP/1-187--------------------------------------------------------------------------------
PSA_THEAC/31-212--------------------------------------------------------------------------------
Q9AW25_GUITH/1-182--------------------------------------------------------------------------------
PSB6_ARATH/9-191--------------------------------------------------------------------------------
Q9GRG9_9TRYP/103-285--------------------------------------------------------------------------------
PSA_METKA/33-217--------------------------------------------------------------------------------
PSB2_ENCCU/1-181--------------------------------------------------------------------------------
PSA4_YEAST/29-216--------------------------------------------------------------------------------
PSA6_TOBAC/32-220--------------------------------------------------------------------------------
Q90ZQ5_ONCMY/42-229--------------------------------------------------------------------------------
PSB2_DROME/3-185--------------------------------------------------------------------------------
Q98S25_GUITH/3-186--------------------------------------------------------------------------------
PSA3_ACACA/29-214--------------------------------------------------------------------------------
PSB7_ENCCU/3-183--------------------------------------------------------------------------------
PSA2_DROME/29-213--------------------------------------------------------------------------------
HSLV_CAMJE/1-176--------------------------------------------------------------------------------
O12993_ORYLA/11-192--------------------------------------------------------------------------------
O77396_PLAF7/31-221--------------------------------------------------------------------------------
PSB1_MOUSE/33-212--------------------------------------------------------------------------------
PSB2_YEAST/1-184--------------------------------------------------------------------------------
PSA2_SCHPO/28-213--------------------------------------------------------------------------------
PSA2_YEAST/28-214--------------------------------------------------------------------------------
Q8UUL8_ORYLA/38-219--------------------------------------------------------------------------------
HSLV_STAAW/5-181--------------------------------------------------------------------------------
PSA4_SCHPO/28-215--------------------------------------------------------------------------------
PSA7L_MOUSE/28-213--------------------------------------------------------------------------------
PSB7_YEAST/26-207--------------------------------------------------------------------------------
PSA1_CAEEL/29-215--------------------------------------------------------------------------------
PSA1_RHOER/24-209--------------------------------------------------------------------------------
PSA1_SCHPO/29-215--------------------------------------------------------------------------------
PSA1_ENCCU/38-223--------------------------------------------------------------------------------
Q8SR59_ENCCU/27-210--------------------------------------------------------------------------------
PSB2_NEUCR/2-184--------------------------------------------------------------------------------
PSB6_ENCCU/7-186--------------------------------------------------------------------------------
PSB2A_ARATH/1-182--------------------------------------------------------------------------------
PSA1_CHICK/28-214--------------------------------------------------------------------------------
O12992_LAMJA/28-210--------------------------------------------------------------------------------
PSB5_YEAST/72-255--------------------------------------------------------------------------------
PSB3_YEAST/7-190--------------------------------------------------------------------------------
PSB2_PYRFU/7-188--------------------------------------------------------------------------------
O12999_XENLA/13-194--------------------------------------------------------------------------------
Q8UVY0_PAROL/68-248--------------------------------------------------------------------------------
PSB9_MUSMB/17-198--------------------------------------------------------------------------------
PSA7_TRYBB/26-209--------------------------------------------------------------------------------
PSB3_SCHPO/5-189--------------------------------------------------------------------------------
PSA7_YEAST/27-215--------------------------------------------------------------------------------
PSA1_ORYSJ/29-214--------------------------------------------------------------------------------
PSB_THEAC/5-186--------------------------------------------------------------------------------
Q9PUS1_DANRE/38-219--------------------------------------------------------------------------------
Q8SR88_ENCCU/28-210--------------------------------------------------------------------------------
Q9XG34_GUITH/25-205--------------------------------------------------------------------------------
PSA73_DROME/28-214--------------------------------------------------------------------------------
PSA3_SCHPO/30-215--------------------------------------------------------------------------------
Q94II8_ORYSJ/46-234--------------------------------------------------------------------------------
PSA_ARCFU/31-214--------------------------------------------------------------------------------
PSA2_CAEEL/28-211--------------------------------------------------------------------------------
PSA_PYRFU/33-215--------------------------------------------------------------------------------
PSA2_HALVD/32-215--------------------------------------------------------------------------------
PSB2_SCHPO/1-184--------------------------------------------------------------------------------
PSA2_TRYBB/27-211--------------------------------------------------------------------------------
PSB6_YEAST/16-197--------------------------------------------------------------------------------
PSA_MYCTU/26-206--------------------------------------------------------------------------------
Q8T8U1_DROME/1-183--------------------------------------------------------------------------------
PSB2_SULTO/10-191--------------------------------------------------------------------------------
Q9N9W9_GIAIN/29-210--------------------------------------------------------------------------------
PSB_METJA/3-187--------------------------------------------------------------------------------
Q9VJJ0_DROME/1-183--------------------------------------------------------------------------------
PSB_METTH/6-188--------------------------------------------------------------------------------
O76468_CRYPV/29-215--------------------------------------------------------------------------------
Q9LST5_ORYSJ/57-239--------------------------------------------------------------------------------
PSB3_TRYBB/6-190--------------------------------------------------------------------------------
HSLV_RALSO/3-177--------------------------------------------------------------------------------
PSB2_CAEEL/1-186--------------------------------------------------------------------------------
CLPQ_BACSU/3-180--------------------------------------------------------------------------------
HSLV_AQUAE/2-176--------------------------------------------------------------------------------
HSLV_BORBU/2-179--------------------------------------------------------------------------------

PF01112

ASPG_HUMAN/8-335----------------------PVLLVP.FLLC--------------------------------------QALVRCSSP
ASPG_ELIMR/24-340----------------------ATAAIA.INPL--------------------------------------EAKNLLDTS
ASGX_SYNY3/1-309----------------------MTPKLI.IHG.--------------------------------------.GASSLDD.
IAAA_ECOLI/2-317----------------------GKAVIA.IHG.--------------------------------------.GAGAISRA
ASPGA_ARATH/2-314----------------------VGWAIA.LHG.--------------------------------------.GAGDIPID
ASPG_LUPAL/2-324----------------------GGWSIA.LHG.--------------------------------------.GAGDIPFS
ASPG_CAEEL/7-348----------------------FLLLIPYING.--------------------------------------....TINDD

PF01019

GGT7_HUMAN/154-655IEVLSK..QGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESH.LI.----------------.DFRESAPGA
GGT5_HUMAN/58-581RAILQQ..QGSPVDATIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVE.VI.----------------.NARETVPAS
PAC1_PSES3/39-540AQILLA..GGNAIDAAVASLFALTVAEPMMVGILGGGLSHIRLADGRHV..VI.----------------.DNLSTAPGK
GGT1_HUMAN/55-564RDALRD..GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAE.VI.----------------.NAREVAPRL
CAPD_BACAN/63-522MKVLKN..GGSAVDAAIVVSYVLGVVELHASGIGGGGGMLIISKDKE..T.FI.----------------.DYRETTP..
Q9XTY7_CAEEL/52-571GEILRK..GGNSIDASIASMFCLGVVNPQSSGIGGGFLMTYFDQKSGDCY.SI.----------------.DARETAPAA
Q9C2D7_NEUCS/45-598IDILNA..GGNAADAAVAVAAGLNMTEPCSTGIGGDMFCLYYDASTGKVS.AL.----------------.NGSGRAGGK
Q9VWT3_DROME/55-566GEMLTD..GGSAVDAAIATLLCEGLLLPHSMGIGGGFVATIYTRSSRKVE.TV.----------------.IARESAPAA
Q9XZS5_DROME/54-560GSILDI..GGSAADAAIATMLCEGVMLPHSLGVGGGFVATIYSRETEFSE.VL.----------------.IARETAPAA
GGT5_RAT/58-567RVILQQ..QGSPVDAAIAALICTGVVNPQSMGLGGGVVFTIYNASTGKVE.VI.----------------.NARETVPAS
Q9VXA5_DROME/259-772SGILQK..NGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHAT.AI.----------------.DAREVAPYE
Q9VYR2_DROME/74-587KKVLEN..GGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSY.SI.----------------.LAREMAPLA
YWRD_BACSU/24-520NRILDK..GGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHQETKAVK.VY.----------------.NGSGRSGKN
Q987N3_RHILO/31-523IEMLRA..GGNAMDAAVCAAAVQGVVEPQSTGIGGDCFVLYCPKGQGDVL.AF.----------------.NGSGRAPAA
P71828_MYCTU/21-507LRMLAD..GGNAVDAAVATAITLTVVEPVSNGIGSDAFSIVWDGQKLHGL....----------------.NASGRSPSA
Q9I6W8_PSEAE/37-533LEILRR..GGNAIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGL....----------------.DASGRAPGL
Q9KEI5_BACHD/38-534LDILKA..GGNAIDAAIATATALTVLEPTSNGIGSDAFALVWTKGKLHGL....----------------.NGSGRAPMS
Q9RU70_DEIRA/37-530LSILQA..GGNAVDAAVATAAALTVVEPTSNGLGGDAFALVWAGGELHGL....----------------.NASGAAPAA
Q9R6V5_SYNE7/31-503IEALRA..GGNAIDAAIAAAITLTVVEPTGNGVGGDTLAQIWTGDRLYGL....----------------.NASGRSPKA
Q54353_STRLN/27-595MRILEN..GGNAFDAAVAAGFVLQVVEPHFNGPGGDVSIGRTARRAQDAA.EI.----------------.CGQGPMPRA
O54174_STRCO/42-600QSVLER..GGNAFDAAVAGAFVLHVAEPHLNGPGGDLVAVLATAADPSPR.VL.----------------.AGQGPAPRG
Q9EYI3_STRNO/28-615MAVLED..GGNAFDAAVAGAFVLHVVEPHLNGPAGEVPILLAPAGGAVR..VL.----------------.CGQGVAPAG
Q97A97_THEVO/25-500AKIIEK..GGNIFDAAIAVSSVLSVTQNNLCGLGGDAFALVRYNGRVKGY....----------------.NGSGKSSRN
Q9HJH4_THEAC/27-510RDILKR..GGNIFDAALAVSAMLCVTQNNLCGLGGDLFALIRDENGQ....IMD----------------LNGSGQASRA
Q97TX5_SULSO/22-473AKVLEE..GGNAFDAAIAISATLSVVIPHTSGLGGDGFLLAKTPEGLIAY....----------------.NASGWAPKE
Q9YFW3_AERPE/25-493AGILSS..GGNAVDAAVATSLALTVLIPHLGGVGGDFFMLYRSPEGR....VFF----------------VNGSGFAPRR
Q9KM31_VIBCH/18-514LDILRQ..SGTACEAMVAAAAMIAVQYPHMNSIGGDGFWLIAAKDKPPV..AI.----------------.DACGSSAQS
GGT_SYNY3/21-511KCMLEE..GGNAFDAAIASVLAACVVESSLTSLGGGGFLLAQTAAKKSYLFDFF----------------CQTPQVNPGE
P71750_MYCTU/94-636CRVLRD..GGTAADAVVAAQAVLGLVEPQSSGIGGGGYLVYFDARTGSVQ.AY.----------------.DGREVAPAA
Q9KVF2_VIBCH/67-583ASILRQ..GGNAIDAMVTTQLMLGLVEPQSSGIGGGSFLVYWDAKKKALT.TF.----------------.DGRETAPLN
GGT_BACSU/61-577ADVLKK..GGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTT.II.----------------.DSRERAPAG
Q9AAR5_CAUCR/64-579LRVLRD..GGSAVDAAVAIQAVLSLVEPQSSGLGGGAFLMAYDAKTGKIT.AY.----------------.DGRETAPSA
O69935_STRCO/61-590VEVLRK..GGNAVDAAVATAAALGVTEPYSAGVGGGGYFVYYDAESRTVR.TI.----------------.DGRETAPLT
Q99X13_STAAM/30-540KDVLDQ..GGNAMDAVIAIQLALNVVEPFASGIGGGGYLLYYEQSTGSIT.AF.----------------.DARETAPEH
Q9A9J6_CAUCR/62-572ADILRQ..GGNAVDAAVATAFALAVTLPRAGNIGGDGFMMVHLAKTNETV.FI.----------------.DYRGTAPKA
GGT_ECOLI/63-574VDILKE..GGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTT..AI.----------------.DFREMAPAK
O25743_HELPY/52-566QKVLEE..GGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENV..AL.----------------.DFREKAPLK
GGT_PSEUA/49-569VEVLKS..GGNAIDAAVAVGYALAVVYPAAGNIGGGGFMTIQLADGRKT..FL.----------------.DFREKAPLA
Q98B64_RHILO/52-573VEVLKK..GGNAVDAAVAVGYALAVVYPNAGNIGGGGFMTIRFADGKST..FL.----------------.DFRERAPLA
Q9ABW6_CAUCR/71-577QEVLKA..GGNAVDAAVATGFALAVTYPEAGNLGGGGFMTVYMDGKPYFL....----------------.DYRETAPAA
GGT_PSEAE/44-550AQILKA..GGNAVDAAVATAFTLAVTYPEAGNIGGGGFMTLYMDGKPYFL....----------------.DYREVAPKA
Q9I6D3_PSEAE/53-562LETLAN..GGNAFDAAAAIAAALAVAEPYGSGLGGGGFFLLRQAGAQPTYRFL.----------------.DARERAPKA
Q9PEP4_XYLFA/53-572LEILRQ..GGNAFDAAVAVSSTLSVVEPISSGLGGGGFFLLHDAKTGHDV.ML.----------------.DAREYAPAS
ECM38_YEAST/123-654NEVLLKFPGSNAADAAVTQALCKGMVNFFNSGIGGGGYVVFSGKDDEDHL.SI.----------------.DFREKAPMD
GGT2_SCHPO/96-606VSMLAD..GGNAVDAAIASTFCIGVVNFFSSGIGGGGFMLIKHPNETAQ..SL.----------------.TFREIAPGN
GGT1_SCHPO/114-625VGILKA..GGNAVDAAIASGICIGAVNSFSSGIGGGGFMLIRHPNGTAH..SL.----------------.NFRETAPAG
Q9P6C7_NEUCS/50-580IDALRK..GGSAADAMVATTLCVGTIGMYHSGIGGGGFMLVRDPDGNYH..TV.----------------.DYRETAPAA
O65652_ARATH/48-572MRVLRE..GGNAIDASVAAALCLGVVSPASSGIGGGAFTVVKIAGGKEI..AY.----------------.DSRETAPLR
Q9M0G0_ARATH/95-632ASVLRS..GGHAVDAAVAITLCVGVVNPMSSGIGGGSFLIVSSQKDSKAE.AF.----------------.DMRETAPLA
O18256_CAEEL/87-600RNVIIQ..GGNAVDAAIAATFCNGVVLPYATGIGGGDFIVIYLKEEKKCV.FL.----------------.NSRETAPSL
O97392_BRUMA/63-583RNILIR..GGNAIDASIASMFCLGITNPQSSGIGGGFIMTLYNRSEAKCT.VI.----------------.DARETAPKN
Q9N5V4_CAEEL/118-635RNILLK..GGNAVDSAIAALFCIGVMDTHSAGIGGGHFMTIYNATTKECT.VI.----------------.DAREIAPLA

PF02275

YXEI_BACSU/2-316---------CTSLTLETADRKH---VLARTMDFA......FQLGTEVI...LYP----------------RRYSWNS.EA
ASAH1_HUMAN/143-394---------CTSIVAEDKKGHL---IHGRNMDFGVFLGWNINNDTWVITEQLKP----------------LTVNLDF.QR
CBH_LACPL/2-312---------CTAITY..QSYNN---YFGRNFDYE......ISYNEMVT...ITP----------------RKYPLVF.RK
CBH_CLOPE/2-317---------CTGLALETKDGLH---LFGRNMDIE......YSFNQSII...FIP----------------RNFKCVN.KS
P72765_SYNY3/54-367---------CTRILWNNNKLAV---VVGRTMDWP......ESTEPELM...VFP----------------QGIKRNG.GM
P97038_LACJH/2-316---------CTGLRFTDDQGNL---YFGRNLDVG......QDYGEGVI...ITP----------------RNYPLPY.KF
PAC_LYSSH/4-320---------CSSLSIRTTDDKS---LFARTMDFT......MEPDSKVI...IVP----------------RNYGIRLLEK
ASAH1_MOUSE/142-393---------CTSIITEDEKGHL---LHGRNMDFG......IFLGWNI......N----------------NNTWVVT.EE

PF03417

Q99SW3_STAAM/102-313--------------FQGKD......FMVRNYD..-----------------YHP----------------ATYDGRY-LL
Q9W369_DROME/127-375--------------VNQKNCR....LLGHTED..-----------------ALT----------------ETLNHYY-FV
Q7VXA7_BORPE/103-331--------------WRGDEDTR...WIAHNED..-----------------GDP----------------FLYGRCH-MV
Q8ETF3_OCEIH/100-313--------------TNE........YYVRNYD..-----------------FTP----------------LLYDHLF-QL
Q981H5_RHILO/99-326--------------VQTRDGA....LIAQNWDGP-----------------LGS----------------DVEQALF-IH
Q8CVA0_OCEIH/100-312--------------VFTSSN.....YMIRNYD..-----------------YHP----------------KTYEGRL-VL
Q8CUR6_OCEIH/102-312--------------TEAD.......FLIRNYD..-----------------NAP----------------RSYEGRY-VI
Q7QEK0_ANOGA/123-370--------------VNEPDCV....VLGHTED..-----------------ALS----------------EVLNHFY-FV
Q896G2_CLOTE/101-321--------------RRRENGSF...IIGHNEDDE-----------------YRG----------------NPSYMTT-YI
Q8TP46_METAC/185-453--------------WAGGDGKL...IFGKNEDNF-----------------NMP----------------EQLSNRM-LV
Q8XYL6_RALSO/104-332--------------LPGKGRR....QIAHNED..-----------------GDP----------------GFAGHCA-LA
Q8RH78_FUSNN/95-316--------------LTNKNCL....VFARNSDFL-----------------VDI----------------KKVSDST-FY
Q7NWB3_CHRVO/36-263--------------SMEGS......LLAKNRD..-----------------WKP----------------DHAQSLR-LL
Q8CRS5_STAES/102-313--------------YKGRD......FLVRNYD..-----------------YHP----------------ATYDGRY-LL
Q92XD1_RHIME/155-360--------------WLGEGGP....ALIRNFD..-----------------YPP----------------SIVSDRF-EM
Q81DJ8_BACCR/98-334--------------VLPKKTDLEHTYVLRNYD..-----------------LSP----------------VIDDMRF-CS
AAAA_EMENI/108-335--------------CKTPNGA....LQGQNWD..-----------------FFT----------------ATKENLI-QL
AAAA_PENCH/108-335--------------CQLPNGA....LQGQNWD..-----------------FFS----------------ATKENLI-RL

PF03577

PEPDA_STRPQ/2-403--------ACTTILVGKKASYDGSTMVARTEDS...QNGDFTPKKMIV---VKP----------------...EDQPRH.
PEPD_BIFLO/2-428--------ACTTILVGKDASYDGSTIIARNEDS...ANGEFNPKRFIV---VKP----------------...EEQPRE.
Q8E6I4_STRA3/2-403--------ACTTILVGKKASYDGSTMIARTEDS...VNGDFTPKKLKV---MTS----------------...KDQPRH.
Q93TK2_STRGN/25-448--------ACCGFIFGRQLTADGSTMFGRTEDYPYYPNGGKHNKNYVV---VEG----------------KNY..KEGDQ
Q93F45_EDWTA/24-429--------ACTTILVGAGATSDGSRITARTED.....HGPSLSKVMLK---HQA----------------...KENSSDT
Q8A7H5_BACTN/21-440--------ACTNLIVGKNASTDGSTIVSYSADSYGLFGELY.......---...----------------..........
Q8G733_BIFLO/20-471--------SCTTILVGKNASYDGSTIIARDDDS...GSGRYDPKRFVA---VAP----------------...DDQPRH.
PEPDA_LACLA/2-401--------TCTTFLVGKKASLDGTTLIARNED....GGDKPNPQRFVV---INP----------------...ENQPKH.
Q8Z7Q9_SALTI/19-417--------ACTTLLVGNQASADGSFIIARNED.....GSANNAKHKVI---HPV----------------...AFHQQGE
PEPDB_LACLA/10-410--------SCTTVLVGRKASIDGSTMIARNDD....GHEALDPQRFIV---IQP----------------...EEQPRH.
Q8DTN0_STRMU/3-404--------TCTTILVGKKASYDGSTIIARTEDS...QNGVFCPKKFEV---IKS----------------...EAQPKH.
PEPDA_LACHE/5-408--------ECTTILVGKKASIDGSTMIARSED....GGRVIIPEGFKV---VNP----------------...EDQPKH.
PEPD_LACSK/9-407--------ACTSMMVGKNASIDGSTMISRNED....RFYAIHPKRFFV---QPA----------------...VHNRHET

PF01804

PAC2_PSES3/30-767--------APVRVQRDG.WGIPH--IKASGEADAYRALGFVHAQDRLFQMELTR----------------RKALGRAAEW
Q9I2K4_PSEAE/47-796--------HEGRIAWDA.AGVPH--IRAQSLEDGYFLLGYSHARDRLWQMEFAR----------------RYAGGTLSEV
QUIP_PSEAE/54-838--------QNVSIRRNA.LGMPL--IETGTFHDALFALGYVHASDRLSQMVSLR----------------LLAQGRLAEM
O86089_9PROT/45-712--------RSNEILWDG.YGVPH--IYGVDAPSAFYGYGWAQARSHGDNILRLY----------------GEARGKGAEY
PAC_ARTVI/30-794--------EGVKVVRDN.FGVPH--LYAKNKKDLYEAYGYVMAKDRLFQLEMFR----------------RGNEGTVSEI
O29763_ARCFU/48-774--------GWAEVYFDE.YGVPH--IVAENEKALAFAVGYVHAKDRLFQMDLHR----------------RMMKGQLSEV
AAC_ACTUT/37-776--------YAALIRRAS.YGVPH--ITADDFGSLGFGVGYVQAEDNICVIAESV----------------VTANGERSRW
Q9HKC5_THEAC/40-802--------HDVTIIQDR.YGVYH--IYAQDNHDLFLALGFIQAKNRLFELELFK----------------LTAMGELANM
PVDQ_PSEAE/31-755--------LAADIRWTA.YGVPH--IRAKDERGLGYGIGYAYARDNACLLAEEI----------------VTARGERARY
Q97XS1_SULSO/56-827--------GNVNIYIDS.NGIAH--IYANNLHDLFLAEGYYEASQRLFEIELFG----------------LLAMGNLSSW
Q9A9G3_CAUCR/35-682--------YDVRIRRDE.WGVPH--ILGRTDADAAFGLGYAQSEDDFDTLQDVV----------------LATRGVLARD
Q9AK68_STRCO/1-782--------MSAETYRDA.WGIPH--LRADTPHELARAQGRVTARDRAWQLEVER----------------HRAQGTSASF
Q55592_SYNY3/35-700--------GKTEIFWDS.WGVPH--IFAANETKLMEAFGWAQARGHGDLLLTLY----------------GEARGKGAEY
Q979D7_THEVO/70-856--------YTVLVFKQA.DGFIG--VASNNSNAVFYEQGYLEAQYRLEELDFLK----------------RTALGNLSAV
Q9RYQ4_DEIRA/36-778--------YQVQIQRTA.HGIPH--IQASDLGGIGYGVGYSYAQDNLCLLADQV----------------MTVRGERSKF
Q9HI83_THEAC/66-851--------ATVLVYRQA.DGFIG--IASNSTRAVYYEQGYLEAEYRLAQLDFLK----------------RTALGNLSAI
Q9S258_STRCO/103-886--------DDVTIVRDKKTGVPH--ITGTTRYGTEFGAGYAAAQDRLWLMDLFR----------------HVGRGQLTPF
O34142_ALCFA/29-806--------QSVEVMRDS.YGVPH--VFADSHYGLYYGYGYAVAQDRLFQMDMAR----------------RSFVGTTAAV
Q9I6I6_PSEAE/41-787--------APVDVRYDE.RGVPH--LYAQNQTDLYRALGYVHAQDRLFQMEMLR----------------RLARGELAEV
Q9A972_CAUCR/34-719--------AKVEITRDT.WGIAH--IHGKTDADAVFGMAYAQAEDDFNRVEANF----------------MTSLGRTAEA
PAC_KLUCI/31-836--------TEVKIVRDE.YGMPH--IYADDTYRLFYGYGYVVAQDRLFQMEMAR----------------RSTQGTVSEV

PF04916

PLBL1_MOUSE/8-549--------RSLRPPSPLLLLLPLLLQPPWAAGAAS...QSDPTGVHCATAYWSP................ESKKVEIKTV
PLBL2_CAEEL/31-578--------FEMNVFIGLLLATVVASQSSEGRDES......YTYKQLCIVDDKPQ...............VLDGFDCRNQ.
PLBL1_CAEEL/2-552--------NWIFIFLAAAVAIGCEARQERTYTVC.....QKPEGDLHYFKEGRK................TDEELCAKR.
PLBL3_CAEEL/2-570--------KLLFFLFGLIFAVEQEKPYLDNNRVP....VEQILNDHSSAKFDYTYVSVCVNSTDETLLDIVYAKECKNAA
PLBL_DROME/35-658--------..MERP...........EYDGTYCAT.....ALWTKQVGFQIENWKQQN.................DLVNI.
O76517_TRYBR/6-615--------TVMRTPSAVLCLLLAATLTLSTPVAVRGEVLKDATPTVVTVWYNAT................SGGFYATDGL

PF13522

Q319R2_PROM9/31-164--------------------------------------------------------------------------------
A2C1R3_PROM1/29-159--------------------------------------------------------------------------------
A6H137_FLAPJ/32-161--------------------------------------------------------------------------------
A1ZI98_9BACT/32-161--------------------------------------------------------------------------------
D1B558_SULD5/28-151--------------------------------------------------------------------------------
B6BGG4_9PROT/28-151--------------------------------------------------------------------------------
Q15WL8_PSEA6/32-161--------------------------------------------------------------------------------
A1ZXW5_9BACT/31-157--------------------------------------------------------------------------------
C6C0L2_DESAD/29-158--------------------------------------------------------------------------------
B9UJ05_9ACTO/31-161--------------------------------------------------------------------------------
D0LGD9_HALO1/33-165--------------------------------------------------------------------------------
D2AY63_STRRD/33-164--------------------------------------------------------------------------------
Q67SX7_SYMTH/33-163--------------------------------------------------------------------------------
D1PMI4_9FIRM/34-164--------------------------------------------------------------------------------
A8A8Q5_IGNH4/48-172--------------------------------------------------------------------------------
A3MVE4_PYRCJ/52-198--------------------------------------------------------------------------------
A2BKU3_HYPBU/86-222--------------------------------------------------------------------------------
A8MDJ1_CALMQ/76-219--------------------------------------------------------------------------------
C3MRQ6_SULIM/67-191--------------------------------------------------------------------------------
C4RDQ3_9ACTO/71-217--------------------------------------------------------------------------------
C1A341_RHOE4/69-214--------------------------------------------------------------------------------
B1VRV8_STRGG/70-217--------------------------------------------------------------------------------
A8L8S4_FRASN/71-216--------------------------------------------------------------------------------
B1MFS0_MYCA9/68-197--------------------------------------------------------------------------------
D1ACB4_THECD/68-206--------------------------------------------------------------------------------
B8DT41_BIFA0/71-227--------------------------------------------------------------------------------
B4CXP1_9BACT/50-172--------------------------------------------------------------------------------
D1A6E6_THECD/85-229--------------------------------------------------------------------------------
B1YDA4_THENV/101-253--------------------------------------------------------------------------------
Q313Y7_DESDG/69-208--------------------------------------------------------------------------------
A9J6W7_BPLUZ/64-191--------------------------------------------------------------------------------
Q2L1U1_BORA1/78-209--------------------------------------------------------------------------------
C7RIV9_ACCPU/72-218--------------------------------------------------------------------------------
A3SJ02_9RHOB/30-184--------------------------------------------------------------------------------
D0LWC5_HALO1/57-200--------------------------------------------------------------------------------
C7P6F6_METFA/31-174--------------------------------------------------------------------------------
A6UTH5_META3/46-188--------------------------------------------------------------------------------
Q67SU9_SYMTH/28-156--------------------------------------------------------------------------------
C0GFE8_9FIRM/28-153--------------------------------------------------------------------------------
B6EHL2_ALISL/33-161--------------------------------------------------------------------------------
A3WK96_9GAMM/33-166--------------------------------------------------------------------------------
B8IIU0_METNO/27-152--------------------------------------------------------------------------------
D4LAQ5_RUMC1/30-159--------------------------------------------------------------------------------
A8AA00_IGNH4/31-161--------------------------------------------------------------------------------
A1TKR9_ACIAC/32-162--------------------------------------------------------------------------------
Q1MNZ8_LAWIP/32-161--------------------------------------------------------------------------------
C7MBC0_BRAFD/30-167--------------------------------------------------------------------------------
C6A089_THESM/27-158--------------------------------------------------------------------------------
A1TKS1_ACIAC/32-165--------------------------------------------------------------------------------
A8TMT0_9PROT/32-161--------------------------------------------------------------------------------
A8M5J5_SALAI/32-161--------------------------------------------------------------------------------
A5CX28_VESOH/32-161--------------------------------------------------------------------------------
B8HUI9_CYAP4/34-167--------------------------------------------------------------------------------
C7G790_9FIRM/29-159--------------------------------------------------------------------------------
C5F126_9HELI/26-156--------------------------------------------------------------------------------
E8WTP4_GEOS8/31-159--------------------------------------------------------------------------------
Q92TY3_RHIME/30-158--------------------------------------------------------------------------------
B8HND1_CYAP4/33-164--------------------------------------------------------------------------------
C9YDI6_9BURK/28-159--------------------------------------------------------------------------------
A4TWE4_9PROT/27-157--------------------------------------------------------------------------------
Q7W1A1_BORPA/30-164--------------------------------------------------------------------------------
A7BTD4_9GAMM/10-143--------------------------------------------------------------------------------
B0RW09_XANCB/35-167--------------------------------------------------------------------------------
Q988G2_RHILO/34-166--------------------------------------------------------------------------------
A6DK48_9BACT/33-162--------------------------------------------------------------------------------
Q2IZV2_RHOP2/32-164--------------------------------------------------------------------------------
A4IWP6_FRATW/32-164--------------------------------------------------------------------------------

PF13537

Q5ASH6_EMENI/53-172--------------------------------------------------------------------------------
B9PWN3_TOXGO/71-193--------------------------------------------------------------------------------
Q2LTR9_SYNAS/73-199--------------------------------------------------------------------------------
Q2YZN6_9DELT/73-201--------------------------------------------------------------------------------
Q5LFT8_BACFN/74-198--------------------------------------------------------------------------------
D1PAI4_9BACT/75-199--------------------------------------------------------------------------------
C9RMT9_FIBSS/74-201--------------------------------------------------------------------------------
C1DTA6_SULAA/82-202--------------------------------------------------------------------------------
D1PIW6_9FIRM/46-166--------------------------------------------------------------------------------
C5F101_9HELI/91-211--------------------------------------------------------------------------------
C6E3Y8_GEOSM/48-168--------------------------------------------------------------------------------
A6DEM6_9PROT/51-165--------------------------------------------------------------------------------
A5Z6H5_9FIRM/45-164--------------------------------------------------------------------------------
A1VAB5_DESVV/59-173--------------------------------------------------------------------------------
D4M4V2_9FIRM/52-165--------------------------------------------------------------------------------
C5KCG7_PERM5/48-170--------------------------------------------------------------------------------
C0GG67_9FIRM/53-166--------------------------------------------------------------------------------
A1ASZ8_PELPD/48-167--------------------------------------------------------------------------------
C7MKT6_CRYCD/71-192--------------------------------------------------------------------------------
E8WTP4_GEOS8/46-165--------------------------------------------------------------------------------
Q09SM5_BORPP/47-168--------------------------------------------------------------------------------
B3KYI2_PHAVU/48-166--------------------------------------------------------------------------------
B8HND1_CYAP4/57-170--------------------------------------------------------------------------------
B7AUG5_9FIRM/44-164--------------------------------------------------------------------------------
D1N3I7_9BACT/47-166--------------------------------------------------------------------------------
A6H137_FLAPJ/47-167--------------------------------------------------------------------------------
D3T763_THEIA/48-169--------------------------------------------------------------------------------
Q0AZ18_SYNWW/47-167--------------------------------------------------------------------------------
A4BSJ7_9GAMM/48-168--------------------------------------------------------------------------------
Q1MNZ8_LAWIP/47-167--------------------------------------------------------------------------------
A9GJ27_SORC5/48-167--------------------------------------------------------------------------------
C6J0Z3_9BACL/48-167--------------------------------------------------------------------------------
A3CX83_METMJ/47-167--------------------------------------------------------------------------------
A8ESL9_ARCB4/53-166--------------------------------------------------------------------------------
D3EKK9_GEOS4/48-169--------------------------------------------------------------------------------
C7LP19_DESBD/84-205--------------------------------------------------------------------------------
B1WQP9_CYAA5/45-160--------------------------------------------------------------------------------
C2VRM4_BACCE/48-169--------------------------------------------------------------------------------
C4FEA3_9BIFI/47-166--------------------------------------------------------------------------------
C1DDD8_LARHH/51-168--------------------------------------------------------------------------------
Q07U44_RHOP5/47-166--------------------------------------------------------------------------------
A7NGM6_ROSCS/48-167--------------------------------------------------------------------------------
F2G8Q8_ALTMD/54-167--------------------------------------------------------------------------------
E8WQK3_GEOS8/47-167--------------------------------------------------------------------------------
C0ZGQ1_BREBN/48-169--------------------------------------------------------------------------------
B7KM32_CYAP7/57-169--------------------------------------------------------------------------------
Q65FV9_BACLD/50-169--------------------------------------------------------------------------------
D1PIW9_9FIRM/48-167--------------------------------------------------------------------------------
Q216T1_RHOPB/47-166--------------------------------------------------------------------------------
D3SEV0_THISK/48-168--------------------------------------------------------------------------------
A8AA00_IGNH4/55-167--------------------------------------------------------------------------------
D6Z0B3_DESAT/43-160--------------------------------------------------------------------------------
A6CE28_9PLAN/47-166--------------------------------------------------------------------------------
Q12VP2_METBU/43-162--------------------------------------------------------------------------------
C5A2K1_THEGJ/42-164--------------------------------------------------------------------------------
D5SUU8_PLAL2/54-173--------------------------------------------------------------------------------
C9BZ32_ENTFC/45-164--------------------------------------------------------------------------------
Q60BD5_METCA/46-165--------------------------------------------------------------------------------
B1HXB0_LYSSC/54-169--------------------------------------------------------------------------------
A7IB45_METB6/47-167--------------------------------------------------------------------------------
C7P6F6_METFA/66-180--------------------------------------------------------------------------------
D7VX33_9FLAO/60-173--------------------------------------------------------------------------------
B0N4I8_9FIRM/45-164--------------------------------------------------------------------------------
C5BIB9_TERTT/48-165--------------------------------------------------------------------------------
C0BH32_9BACT/48-167--------------------------------------------------------------------------------
C3KLT2_RHISN/70-189--------------------------------------------------------------------------------
D0U2E2_STRPT/48-167--------------------------------------------------------------------------------
Q3SM07_THIDA/48-168--------------------------------------------------------------------------------
A4E9B2_9ACTN/52-166--------------------------------------------------------------------------------
A1ZI98_9BACT/47-167--------------------------------------------------------------------------------
C7RT03_ACCPU/48-168--------------------------------------------------------------------------------
E6VZL8_DESAO/47-168--------------------------------------------------------------------------------
D4KMF4_9FIRM/44-165--------------------------------------------------------------------------------
A4XLL9_CALS8/48-169--------------------------------------------------------------------------------
O87986_BORBO/51-167--------------------------------------------------------------------------------
B8GV93_THISH/47-166--------------------------------------------------------------------------------
Q1N7B0_9SPHN/48-168--------------------------------------------------------------------------------
B9JNF8_AGRRK/48-167--------------------------------------------------------------------------------
B3QUX4_CHLT3/58-171--------------------------------------------------------------------------------
A1TKR9_ACIAC/49-168--------------------------------------------------------------------------------
A1WX67_HALHL/50-170--------------------------------------------------------------------------------
A1VHY0_DESVV/74-190--------------------------------------------------------------------------------
C8VWD2_DESAS/48-169--------------------------------------------------------------------------------
Q26BI0_FLABB/48-167--------------------------------------------------------------------------------
B0BZG4_ACAM1/47-167--------------------------------------------------------------------------------
A9B763_HERA2/45-164--------------------------------------------------------------------------------
A8RHM4_9CLOT/52-173--------------------------------------------------------------------------------
A3WBV5_9SPHN/48-168--------------------------------------------------------------------------------
A6C8F5_9PLAN/48-167--------------------------------------------------------------------------------
C9YDI6_9BURK/45-165--------------------------------------------------------------------------------
C9P5X6_VIBME/48-167--------------------------------------------------------------------------------
A9AVN7_HERA2/53-166--------------------------------------------------------------------------------
D9TR59_THETC/48-169--------------------------------------------------------------------------------
D5SQH7_PLAL2/59-173--------------------------------------------------------------------------------
Q15WL8_PSEA6/47-167--------------------------------------------------------------------------------
Q3SMN0_THIDA/47-165--------------------------------------------------------------------------------
B8JFB6_ANAD2/49-168--------------------------------------------------------------------------------
Q30XB0_DESDG/46-165--------------------------------------------------------------------------------
A4AWP2_MARSH/48-167--------------------------------------------------------------------------------
B8GVB9_THISH/48-167--------------------------------------------------------------------------------
Q30W35_DESDG/52-171--------------------------------------------------------------------------------
Q11EB5_MESSB/46-165--------------------------------------------------------------------------------
B8LMV0_PICSI/48-166--------------------------------------------------------------------------------
C0GFE8_9FIRM/43-159--------------------------------------------------------------------------------
Q09SL0_BORPP/51-171--------------------------------------------------------------------------------
D4L906_9FIRM/48-169--------------------------------------------------------------------------------
B6BY61_9GAMM/48-168--------------------------------------------------------------------------------
D7VXP6_9FLAO/48-166--------------------------------------------------------------------------------
Q89GP7_BRAJA/53-172--------------------------------------------------------------------------------
D2ELX2_PEDAC/45-164--------------------------------------------------------------------------------
Q31I32_THICR/47-165--------------------------------------------------------------------------------
B6FJ58_9CLOT/52-165--------------------------------------------------------------------------------
C6C0L2_DESAD/44-164--------------------------------------------------------------------------------
A0YEF5_9GAMM/47-166--------------------------------------------------------------------------------
A8FUC6_SHESH/48-167--------------------------------------------------------------------------------
B5CZ45_9BACE/48-167--------------------------------------------------------------------------------
D3PM21_MEIRD/68-181--------------------------------------------------------------------------------
B5EA88_GEOBB/47-168--------------------------------------------------------------------------------
Q81GN9_BACCR/48-169--------------------------------------------------------------------------------
C7PT80_CHIPD/48-167--------------------------------------------------------------------------------
A6UTH5_META3/82-194--------------------------------------------------------------------------------
A9W815_METEP/53-166--------------------------------------------------------------------------------
A1HQU4_9FIRM/48-169--------------------------------------------------------------------------------
Q67SX7_SYMTH/48-169--------------------------------------------------------------------------------
A0L574_MAGSM/48-168--------------------------------------------------------------------------------
Q67SU9_SYMTH/44-162--------------------------------------------------------------------------------
A6TWB0_ALKMQ/48-169--------------------------------------------------------------------------------
A3QHF6_SHELP/46-166--------------------------------------------------------------------------------
D1KBT8_9GAMM/47-167--------------------------------------------------------------------------------
D3RU48_ALLVD/48-168--------------------------------------------------------------------------------
Q21PG9_SACD2/57-171--------------------------------------------------------------------------------
C1ATQ5_RHOOB/48-169--------------------------------------------------------------------------------
A0LYW1_GRAFK/45-164--------------------------------------------------------------------------------
A4U2W9_9PROT/51-171--------------------------------------------------------------------------------
D4L5M3_9FIRM/57-164--------------------------------------------------------------------------------
B0TFK1_HELMI/48-169--------------------------------------------------------------------------------
B9YZR4_9NEIS/45-165--------------------------------------------------------------------------------
A4A561_9GAMM/25-145--------------------------------------------------------------------------------
Q9KCR1_BACHD/48-169--------------------------------------------------------------------------------
B7FT50_PHATC/57-178--------------------------------------------------------------------------------
E6TYW0_BACCJ/46-165--------------------------------------------------------------------------------
Q1GRU1_SPHAL/48-168--------------------------------------------------------------------------------
A1TKS1_ACIAC/51-171--------------------------------------------------------------------------------
A3XJR6_LEEBM/48-167--------------------------------------------------------------------------------
D3MRS2_9FIRM/52-169--------------------------------------------------------------------------------
C0GHN0_9FIRM/48-169--------------------------------------------------------------------------------
A7BSS9_9GAMM/58-174--------------------------------------------------------------------------------
Q1I2K2_PSEE4/47-166--------------------------------------------------------------------------------
Q65LI2_BACLD/48-169--------------------------------------------------------------------------------
C2FYF7_9SPHI/48-166--------------------------------------------------------------------------------
A4W840_ENT38/48-167--------------------------------------------------------------------------------
A2SJD9_METPP/43-164--------------------------------------------------------------------------------
ASNS_DICDI/48-169--------------------------------------------------------------------------------
Q1YPR6_9GAMM/67-187--------------------------------------------------------------------------------
D3FZ77_BACPE/48-169--------------------------------------------------------------------------------
C4KBW1_THASP/51-171--------------------------------------------------------------------------------
Q319R2_PROM9/48-170--------------------------------------------------------------------------------
Q605Z5_METCA/46-165--------------------------------------------------------------------------------
A4CM46_ROBBH/48-167--------------------------------------------------------------------------------
D4LAQ5_RUMC1/45-165--------------------------------------------------------------------------------
A3EK19_VIBCL/50-168--------------------------------------------------------------------------------
Q81ZU7_NITEU/48-168--------------------------------------------------------------------------------
C3KRD5_RHISN/51-172--------------------------------------------------------------------------------
D3AFP1_9CLOT/57-178--------------------------------------------------------------------------------
A8LVP2_SALAI/46-166--------------------------------------------------------------------------------
Q7MSW6_WOLSU/42-160--------------------------------------------------------------------------------
C7HFF8_CLOTM/48-169--------------------------------------------------------------------------------
C6J1Y5_9BACL/48-169--------------------------------------------------------------------------------
Q2WB52_MAGSA/47-166--------------------------------------------------------------------------------
B2IYJ4_NOSP7/59-173--------------------------------------------------------------------------------
A9EDC0_9FLAO/48-167--------------------------------------------------------------------------------
A6CPY7_9BACI/48-169--------------------------------------------------------------------------------
Q15RM5_PSEA6/55-167--------------------------------------------------------------------------------
A5CX28_VESOH/47-167--------------------------------------------------------------------------------
D3SB42_THISK/47-167--------------------------------------------------------------------------------
Q11Z14_CYTH3/48-168--------------------------------------------------------------------------------
B2TNC6_CLOBB/48-169--------------------------------------------------------------------------------
C0QEN5_DESAH/70-189--------------------------------------------------------------------------------
Q3B1S8_PELLD/46-166--------------------------------------------------------------------------------
D6Z4G9_DESAT/48-167--------------------------------------------------------------------------------
A9I748_BORPD/47-170--------------------------------------------------------------------------------
Q5WH52_BACSK/48-169--------------------------------------------------------------------------------
C0ZBJ4_BREBN/48-169--------------------------------------------------------------------------------
C5Y2Y7_SORBI/48-174--------------------------------------------------------------------------------
E6TYI4_BACCJ/48-169--------------------------------------------------------------------------------
B6C089_9GAMM/57-171--------------------------------------------------------------------------------
Q2SJG4_HAHCH/57-171--------------------------------------------------------------------------------
B1VMY8_STRGG/48-173--------------------------------------------------------------------------------
Q9RJK2_STRCO/48-166--------------------------------------------------------------------------------
D3QAD7_STANL/49-169--------------------------------------------------------------------------------
Q9KJI6_DESGI/52-171--------------------------------------------------------------------------------
B5E8P8_GEOBB/54-171--------------------------------------------------------------------------------
C3IWN5_BACTU/45-164--------------------------------------------------------------------------------
C1A5T9_GEMAT/55-168--------------------------------------------------------------------------------
B4BIR0_9BACI/48-169--------------------------------------------------------------------------------
Q2NA36_ERYLH/48-168--------------------------------------------------------------------------------
A2TSH4_9FLAO/48-167--------------------------------------------------------------------------------
C2QBK6_BACCE/45-169--------------------------------------------------------------------------------
Q01XN2_SOLUE/46-165--------------------------------------------------------------------------------
B8KJD2_9GAMM/25-145--------------------------------------------------------------------------------
C2WMM0_BACCE/48-169--------------------------------------------------------------------------------
C4K7X1_HAMD5/55-167--------------------------------------------------------------------------------
A0Q7S4_FRATN/47-170--------------------------------------------------------------------------------
Q7MBG3_WOLSU/61-173--------------------------------------------------------------------------------
A7NLM8_ROSCS/43-157--------------------------------------------------------------------------------
C5T0U7_ACIDE/48-168--------------------------------------------------------------------------------
B1I0Y5_DESAP/48-169--------------------------------------------------------------------------------
B0NXA9_9CLOT/52-173--------------------------------------------------------------------------------
C8W452_DESAS/48-169--------------------------------------------------------------------------------
D5X1P1_THIK1/46-165--------------------------------------------------------------------------------
D3V2B7_XENBS/51-170--------------------------------------------------------------------------------
Q2WBC9_MAGSA/51-171--------------------------------------------------------------------------------
C7PAG8_CHIPD/57-168--------------------------------------------------------------------------------
B4SPR9_STRM5/59-173--------------------------------------------------------------------------------
D2SAR5_GEOOG/50-170--------------------------------------------------------------------------------
C1F7T8_ACIC5/52-172--------------------------------------------------------------------------------
B7GLW0_ANOFW/61-182--------------------------------------------------------------------------------
A4FX82_METM5/68-180--------------------------------------------------------------------------------
B1K8L8_BURCC/51-174--------------------------------------------------------------------------------
C8XKV4_NAKMY/46-165--------------------------------------------------------------------------------
E3I7S3_RHOVT/58-174--------------------------------------------------------------------------------
B6IXV0_RHOCS/58-172--------------------------------------------------------------------------------
Q86A01_DICDI/50-171--------------------------------------------------------------------------------
D5VTZ9_METIM/63-169--------------------------------------------------------------------------------
A8ZX58_DESOH/43-159--------------------------------------------------------------------------------
B8GLI4_THISH/54-167--------------------------------------------------------------------------------
A5Z4P6_9FIRM/78-197--------------------------------------------------------------------------------
B8BZR9_THAPS/57-178--------------------------------------------------------------------------------
B6IYJ4_RHOCS/51-171--------------------------------------------------------------------------------
Q12HN2_SHEDO/46-166--------------------------------------------------------------------------------
B5JNG8_9BACT/50-171--------------------------------------------------------------------------------
Q11FH2_MESSB/47-167--------------------------------------------------------------------------------
D1PRL7_9FIRM/57-170--------------------------------------------------------------------------------
A8PQZ5_MALGO/63-179--------------------------------------------------------------------------------
Q1QD48_PSYCK/55-169--------------------------------------------------------------------------------
Q220Y3_RHOFD/48-168--------------------------------------------------------------------------------
D0NLW5_PHYIT/50-171--------------------------------------------------------------------------------
Q2LWL8_SYNAS/62-175--------------------------------------------------------------------------------
A5AAI5_ASPNC/47-168--------------------------------------------------------------------------------
D2QWZ5_PIRSD/59-178--------------------------------------------------------------------------------
C5ZZB9_9HELI/41-162--------------------------------------------------------------------------------
B4UY04_9ACTO/48-169--------------------------------------------------------------------------------
Q988G2_RHILO/58-172--------------------------------------------------------------------------------
A6LS88_CLOB8/48-169--------------------------------------------------------------------------------
B5DPA2_DROPS/60-180--------------------------------------------------------------------------------
A7BY79_9GAMM/47-167--------------------------------------------------------------------------------
Q7N3E7_PHOLL/51-170--------------------------------------------------------------------------------
A1ZXW5_9BACT/46-163--------------------------------------------------------------------------------
C7C1Y2_9ACTO/48-169--------------------------------------------------------------------------------
D0TID9_9BACE/48-167--------------------------------------------------------------------------------
C1I2N8_9CLOT/50-171--------------------------------------------------------------------------------
Q5QU50_IDILO/50-172--------------------------------------------------------------------------------
B1Y730_LEPCP/47-166--------------------------------------------------------------------------------
F1TF15_9CLOT/46-165--------------------------------------------------------------------------------
B3QJY0_RHOPT/43-167--------------------------------------------------------------------------------
A4J8B3_DESRM/48-169--------------------------------------------------------------------------------
A4YLK3_BRASO/46-166--------------------------------------------------------------------------------
A7Z383_BACA2/48-169--------------------------------------------------------------------------------
Q9RA27_VIBMA/55-167--------------------------------------------------------------------------------
B9HNE0_POPTR/48-166--------------------------------------------------------------------------------
A4BL90_9GAMM/46-165--------------------------------------------------------------------------------
A4LI33_BURPE/58-174--------------------------------------------------------------------------------
Q7WR34_BORBR/41-162--------------------------------------------------------------------------------
C7MST2_SACVD/46-164--------------------------------------------------------------------------------
C3XDE6_9HELI/72-187--------------------------------------------------------------------------------
B8KQP7_9GAMM/45-164--------------------------------------------------------------------------------
A9B583_HERA2/48-167--------------------------------------------------------------------------------
Q89HI1_BRAJA/49-169--------------------------------------------------------------------------------
Q74BS3_GEOSL/54-166--------------------------------------------------------------------------------
B4LH96_DROVI/67-180--------------------------------------------------------------------------------
A5N6Y5_CLOK5/48-169--------------------------------------------------------------------------------
Q01UW3_SOLUE/48-167--------------------------------------------------------------------------------
A7ZF04_CAMC1/47-167--------------------------------------------------------------------------------
B1HS43_LYSSC/48-169--------------------------------------------------------------------------------
Q8EN79_OCEIH/48-169--------------------------------------------------------------------------------
A4FMI9_SACEN/48-169--------------------------------------------------------------------------------
Q2G5V9_NOVAD/48-168--------------------------------------------------------------------------------
C7XTT3_9LACO/50-170--------------------------------------------------------------------------------
A5D4J4_PELTS/48-170--------------------------------------------------------------------------------
B7AKA8_9BACE/48-167--------------------------------------------------------------------------------
D2JNW7_9NOSO/48-167--------------------------------------------------------------------------------
B6YQV5_AZOPC/48-166--------------------------------------------------------------------------------
C1DDD9_LARHH/48-169--------------------------------------------------------------------------------
B8J3E1_DESDA/50-169--------------------------------------------------------------------------------
A5VDL7_SPHWW/48-168--------------------------------------------------------------------------------
Q49BF3_STRHY/48-169--------------------------------------------------------------------------------
D6S3E6_9LACO/53-166--------------------------------------------------------------------------------
D1R677_9CHLA/51-167--------------------------------------------------------------------------------
C7MBC0_BRAFD/45-173--------------------------------------------------------------------------------
Q2RIX6_MOOTA/48-169--------------------------------------------------------------------------------
D2AY63_STRRD/48-170--------------------------------------------------------------------------------
A4BPQ6_9GAMM/34-148--------------------------------------------------------------------------------
Q23CU8_TETTS/60-177--------------------------------------------------------------------------------
C4XTN2_DESMR/52-171--------------------------------------------------------------------------------
B9R487_9RHOB/47-167--------------------------------------------------------------------------------
A8UK10_9FLAO/67-188--------------------------------------------------------------------------------
E6U4Y9_ETHHY/50-171--------------------------------------------------------------------------------
A8JG07_CHLRE/48-170--------------------------------------------------------------------------------
B3QY65_CHLT3/47-167--------------------------------------------------------------------------------
A0L450_MAGSM/47-167--------------------------------------------------------------------------------
Q97GX2_CLOAB/48-169--------------------------------------------------------------------------------
A5V1L8_ROSS1/55-168--------------------------------------------------------------------------------
Q2B953_9BACI/48-169--------------------------------------------------------------------------------
A7T4X2_NEMVE/47-165--------------------------------------------------------------------------------
B6WVV2_9DELT/50-170--------------------------------------------------------------------------------
B1ZBU4_METPB/46-166--------------------------------------------------------------------------------
Q1YFQ6_MOBAS/47-167--------------------------------------------------------------------------------
C3RLY9_9FIRM/51-170--------------------------------------------------------------------------------
A5GQB9_SYNR3/51-164--------------------------------------------------------------------------------
Q2SJH5_HAHCH/45-158--------------------------------------------------------------------------------
B9MJX9_ANATD/48-169--------------------------------------------------------------------------------
B4WJY6_9SYNE/57-172--------------------------------------------------------------------------------
D1PMI4_9FIRM/49-170--------------------------------------------------------------------------------
C7QF66_CATAD/44-168--------------------------------------------------------------------------------
A4KUB6_STRHI/48-167--------------------------------------------------------------------------------
Q094S0_STIAD/48-170--------------------------------------------------------------------------------
A0LCM5_MAGSM/57-173--------------------------------------------------------------------------------
A9WSE9_RENSM/44-167--------------------------------------------------------------------------------
B8GGE5_METPE/42-162--------------------------------------------------------------------------------
C4WQP2_9RHIZ/54-174--------------------------------------------------------------------------------
B3QPH1_CHLP8/47-167--------------------------------------------------------------------------------
A4X7Y5_SALTO/75-195--------------------------------------------------------------------------------
B0ML15_9FIRM/25-146--------------------------------------------------------------------------------
A4X9C7_SALTO/62-175--------------------------------------------------------------------------------
B4U6E2_HYDS0/59-178--------------------------------------------------------------------------------
Q47GK4_DECAR/53-176--------------------------------------------------------------------------------
Q9FAR2_STRAU/48-169--------------------------------------------------------------------------------
E3I873_RHOVT/48-171--------------------------------------------------------------------------------
D1RME1_LEGLO/47-168--------------------------------------------------------------------------------
B8HUI9_CYAP4/51-173--------------------------------------------------------------------------------
A4B944_9GAMM/61-173--------------------------------------------------------------------------------
A6UNP9_METVS/74-187--------------------------------------------------------------------------------
Q2RPM9_RHORT/48-168--------------------------------------------------------------------------------
A5EHY9_BRASB/48-167--------------------------------------------------------------------------------
D0KYR8_HALNC/47-171--------------------------------------------------------------------------------
D3U9Z6_9ACTO/48-170--------------------------------------------------------------------------------
D4JEU7_9FIRM/51-163--------------------------------------------------------------------------------
D0FNI9_ERWPE/48-169--------------------------------------------------------------------------------
Q3S8R1_STRRM/48-170--------------------------------------------------------------------------------
Q988H1_RHILO/49-168--------------------------------------------------------------------------------
B2W1S8_PYRTR/47-168--------------------------------------------------------------------------------
Q8DM85_THEEB/58-177--------------------------------------------------------------------------------
D0CMS6_9SYNE/50-172--------------------------------------------------------------------------------
A1VVT9_POLNA/47-167--------------------------------------------------------------------------------
C4Z9V1_EUBR3/52-173--------------------------------------------------------------------------------
Q6ACN3_LEIXX/48-169--------------------------------------------------------------------------------
Q21S99_RHOFD/47-167--------------------------------------------------------------------------------
A8UQ31_9FLAO/44-163--------------------------------------------------------------------------------
Q2LWN2_SYNAS/59-175--------------------------------------------------------------------------------
Q0IDQ7_SYNS3/54-169--------------------------------------------------------------------------------
B5VJ70_YEAS6/54-167--------------------------------------------------------------------------------
Q39TM3_GEOMG/59-172--------------------------------------------------------------------------------
Q7NXB4_CHRVO/48-170--------------------------------------------------------------------------------
Q6LYS0_METMP/74-187--------------------------------------------------------------------------------
A5KQS7_9FIRM/52-173--------------------------------------------------------------------------------
C2HRD9_VIBCL/52-164--------------------------------------------------------------------------------
A4BIU0_9GAMM/50-169--------------------------------------------------------------------------------
B8FYG6_DESHD/49-170--------------------------------------------------------------------------------
B2H132_BURPE/51-170--------------------------------------------------------------------------------
D3RUI4_ALLVD/47-167--------------------------------------------------------------------------------
A9KFJ4_COXBN/59-173--------------------------------------------------------------------------------
B9UJ05_9ACTO/48-167--------------------------------------------------------------------------------
B3L4A4_PLAKH/60-174--------------------------------------------------------------------------------
C0ZB16_BREBN/47-166--------------------------------------------------------------------------------
Q7USD1_RHOBA/65-177--------------------------------------------------------------------------------
C3K8M3_PSEFS/49-168--------------------------------------------------------------------------------
Q8PRB2_XANAC/57-170--------------------------------------------------------------------------------
A4VJI0_PSEU5/47-167--------------------------------------------------------------------------------
B7DPG1_9BACL/48-169--------------------------------------------------------------------------------
D2B1Z0_STRRD/45-164--------------------------------------------------------------------------------
Q02LN1_PSEAB/48-168--------------------------------------------------------------------------------
C7R704_KANKD/50-172--------------------------------------------------------------------------------
D3RQ21_ALLVD/47-166--------------------------------------------------------------------------------
C6WV73_METML/48-165--------------------------------------------------------------------------------
A8FBS7_BACP2/50-171--------------------------------------------------------------------------------
Q2RSV6_RHORT/47-167--------------------------------------------------------------------------------
Q20ZN3_RHOPB/48-168--------------------------------------------------------------------------------
D8JX32_HYPDA/59-177--------------------------------------------------------------------------------
Q2SLG5_HAHCH/47-167--------------------------------------------------------------------------------
B9P339_PROMR/61-175--------------------------------------------------------------------------------
A3HRD8_9BACT/47-167--------------------------------------------------------------------------------
C7Q560_CATAD/48-168--------------------------------------------------------------------------------
D5CRA4_SIDLE/47-167--------------------------------------------------------------------------------
D3PM19_MEIRD/52-172--------------------------------------------------------------------------------
E6VSF4_DESAO/52-176--------------------------------------------------------------------------------
C6PVS3_9CLOT/56-167--------------------------------------------------------------------------------
B7VAM4_PSEA8/58-174--------------------------------------------------------------------------------
Q6CH25_YARLI/47-167--------------------------------------------------------------------------------
D9SNK4_CLOC7/48-169--------------------------------------------------------------------------------
B4KUK4_DROMO/68-180--------------------------------------------------------------------------------
C5DQZ1_ZYGRC/47-167--------------------------------------------------------------------------------
F1TGG9_9CLOT/49-170--------------------------------------------------------------------------------
A9IE16_BORPD/48-171--------------------------------------------------------------------------------
D1B558_SULD5/43-157--------------------------------------------------------------------------------
C7QI69_CATAD/48-174--------------------------------------------------------------------------------
A3ZYU5_9PLAN/59-178--------------------------------------------------------------------------------
Q1IDC0_PSEE4/52-172--------------------------------------------------------------------------------
B1J8H6_PSEPW/48-170--------------------------------------------------------------------------------
Q0RHA1_FRAAA/20-140--------------------------------------------------------------------------------
Q5P2C5_AROAE/49-168--------------------------------------------------------------------------------
ASNH2_METJA/68-181--------------------------------------------------------------------------------
A0QVJ3_MYCS2/47-167--------------------------------------------------------------------------------
B4S380_PROA2/47-167--------------------------------------------------------------------------------
A3UKJ3_9RHOB/53-170--------------------------------------------------------------------------------
B6IX73_RHOCS/48-168--------------------------------------------------------------------------------
E8W5U4_STRFA/48-170--------------------------------------------------------------------------------
Q4FTY4_PSYA2/57-168--------------------------------------------------------------------------------
A4YY74_BRASO/59-175--------------------------------------------------------------------------------
D0LGD9_HALO1/48-171--------------------------------------------------------------------------------
D3FFB1_CONWI/46-165--------------------------------------------------------------------------------
Q4FTY1_PSYA2/56-172--------------------------------------------------------------------------------
B4WAP0_9CAUL/47-167--------------------------------------------------------------------------------
E8WR80_GEOS8/55-170--------------------------------------------------------------------------------
C6BTG8_DESAD/52-175--------------------------------------------------------------------------------
C3XKC4_9HELI/41-162--------------------------------------------------------------------------------
A8PKM5_9COXI/48-166--------------------------------------------------------------------------------
Q56619_VIBCL/54-169--------------------------------------------------------------------------------
D3RTP3_ALLVD/44-164--------------------------------------------------------------------------------
Q2MGB4_STRGR/49-171--------------------------------------------------------------------------------
C4I635_BURPE/48-173--------------------------------------------------------------------------------
B8IXH9_METNO/49-168--------------------------------------------------------------------------------
Q8ECG7_SHEON/56-171--------------------------------------------------------------------------------
D2S7W6_GEOOG/47-167--------------------------------------------------------------------------------
D5WZF9_THIK1/47-167--------------------------------------------------------------------------------
Q0A658_ALHEH/47-170--------------------------------------------------------------------------------
Q9FB19_9ACTO/51-170--------------------------------------------------------------------------------
Q2ILL8_ANADE/59-177--------------------------------------------------------------------------------
C6W7W6_ACTMD/51-172--------------------------------------------------------------------------------
A9FKC0_SORC5/48-170--------------------------------------------------------------------------------
C5UWI4_CLOBO/51-163--------------------------------------------------------------------------------
Q6ASA1_DESPS/50-173--------------------------------------------------------------------------------
Q7MSW7_WOLSU/49-158--------------------------------------------------------------------------------
Q220Y1_RHOFD/25-144--------------------------------------------------------------------------------
C7LT29_DESBD/46-162--------------------------------------------------------------------------------
Q2CH15_9RHOB/27-140--------------------------------------------------------------------------------
Q6U1H6_SHIDY/60-175--------------------------------------------------------------------------------
A8I1E3_AZOC5/46-166--------------------------------------------------------------------------------
Q6YPY1_ONYPE/48-167--------------------------------------------------------------------------------
Q11P23_CYTH3/44-161--------------------------------------------------------------------------------
Q0H2X8_9ACTO/48-170--------------------------------------------------------------------------------
A5WC05_PSYWF/51-174--------------------------------------------------------------------------------
D7VVT0_9FLAO/46-165--------------------------------------------------------------------------------
Q8TZ36_METKA/54-162--------------------------------------------------------------------------------
B5WKQ6_9BURK/48-170--------------------------------------------------------------------------------
C5M4U1_CANTT/47-167--------------------------------------------------------------------------------
A4YXC2_BRASO/59-177--------------------------------------------------------------------------------
Q5P0P7_AROAE/47-167--------------------------------------------------------------------------------
A1UEP1_MYCSK/47-167--------------------------------------------------------------------------------
Q30V26_DESDG/57-186--------------------------------------------------------------------------------
B0UMG8_METS4/47-167--------------------------------------------------------------------------------
A7HRA6_PARL1/47-167--------------------------------------------------------------------------------
A8TMT0_9PROT/47-167--------------------------------------------------------------------------------
A0ZBU8_NODSP/27-148--------------------------------------------------------------------------------
D9SCG7_GALCS/47-167--------------------------------------------------------------------------------
A4RU16_OSTLU/60-172--------------------------------------------------------------------------------
A7BTD4_9GAMM/34-149--------------------------------------------------------------------------------
C9NMI3_9VIBR/47-166--------------------------------------------------------------------------------
A4RXB8_OSTLU/49-169--------------------------------------------------------------------------------
B7J9F8_ACIF2/53-166--------------------------------------------------------------------------------
C6WBZ3_ACTMD/47-166--------------------------------------------------------------------------------
Q125B0_POLSJ/59-179--------------------------------------------------------------------------------
D0L316_GORB4/47-167--------------------------------------------------------------------------------
A1KKP3_MYCBP/68-182--------------------------------------------------------------------------------
Q30U87_SULDN/50-157--------------------------------------------------------------------------------
C8XB77_NAKMY/47-167--------------------------------------------------------------------------------
A0SZV7_9ACTO/48-170--------------------------------------------------------------------------------
C5ZZB1_9HELI/46-164--------------------------------------------------------------------------------
Q0YTU9_9CHLB/34-161--------------------------------------------------------------------------------
E0TGP5_PARBH/48-167--------------------------------------------------------------------------------
A8W7D4_9ACTO/48-173--------------------------------------------------------------------------------
D1PQ59_9FIRM/23-146--------------------------------------------------------------------------------
D5UY52_TSUPD/59-174--------------------------------------------------------------------------------
B6R111_9RHOB/41-164--------------------------------------------------------------------------------
A0CK03_PARTE/58-173--------------------------------------------------------------------------------
A6R1E0_AJECN/101-225--------------------------------------------------------------------------------
B6BKE4_9PROT/42-158--------------------------------------------------------------------------------
B5VUJ3_SPIMA/45-163--------------------------------------------------------------------------------
Q6CVM7_KLULA/47-167--------------------------------------------------------------------------------
Q6QW19_AZOBR/13-131--------------------------------------------------------------------------------
Q0W279_UNCMA/45-150--------------------------------------------------------------------------------
C0JRY2_STRLU/48-170--------------------------------------------------------------------------------
D5VU54_METIM/64-176--------------------------------------------------------------------------------
A6WDH3_KINRD/47-167--------------------------------------------------------------------------------
C4R588_PICPG/47-167--------------------------------------------------------------------------------
QUEC_SULAC/78-205--------------------------------------------------------------------------------
A4TXA1_9PROT/48-167--------------------------------------------------------------------------------
Q30U64_SULDN/41-156--------------------------------------------------------------------------------
O46196_AEDAE/70-187--------------------------------------------------------------------------------
A3SJ02_9RHOB/70-190--------------------------------------------------------------------------------
D0KR75_SULS9/78-205--------------------------------------------------------------------------------
C7BSC5_PHOAA/57-169--------------------------------------------------------------------------------
A4X3E4_SALTO/47-167--------------------------------------------------------------------------------
A6DK48_9BACT/48-168--------------------------------------------------------------------------------
QUEC2_SULTO/78-205--------------------------------------------------------------------------------
A0RRA8_CAMFF/43-159--------------------------------------------------------------------------------
C3RME3_9FIRM/51-164--------------------------------------------------------------------------------
C9YX81_STRSW/47-167--------------------------------------------------------------------------------
A0E625_PARTE/60-175--------------------------------------------------------------------------------
C0JRV7_9ACTO/48-170--------------------------------------------------------------------------------
D2SYZ2_MICEC/48-170--------------------------------------------------------------------------------
B2AEL9_PODAN/77-201--------------------------------------------------------------------------------
D2AQS0_STRRD/47-167--------------------------------------------------------------------------------
A6Q4Y9_NITSB/42-158--------------------------------------------------------------------------------
Q7UHC5_RHOBA/51-170--------------------------------------------------------------------------------
Q4Y1E6_PLACH/56-170--------------------------------------------------------------------------------
Q2W7V5_MAGSA/46-162--------------------------------------------------------------------------------
C5ZWC6_9HELI/53-161--------------------------------------------------------------------------------
Q7VEF5_PROMA/50-177--------------------------------------------------------------------------------
Q46Q66_CUPPJ/58-178--------------------------------------------------------------------------------
D3D0N6_9ACTO/47-163--------------------------------------------------------------------------------
ASNS_MIMIV/58-170--------------------------------------------------------------------------------
Q8KY35_STRCU/48-171--------------------------------------------------------------------------------
C3XLB4_9HELI/53-164--------------------------------------------------------------------------------
C4XQN6_DESMR/45-165--------------------------------------------------------------------------------
A3T3D5_9RHOB/31-153--------------------------------------------------------------------------------
A4YE70_METS5/78-205--------------------------------------------------------------------------------
Q1VVM8_9FLAO/52-161--------------------------------------------------------------------------------
A2R076_ASPNC/60-179--------------------------------------------------------------------------------
B8NXQ8_ASPFN/55-174--------------------------------------------------------------------------------
Q2W001_MAGSA/34-147--------------------------------------------------------------------------------
D1ALZ0_SEBTE/51-164--------------------------------------------------------------------------------
A8ZZB3_DESOH/53-170--------------------------------------------------------------------------------
Q1NS49_9DELT/43-160--------------------------------------------------------------------------------
A0RRB3_CAMFF/41-154--------------------------------------------------------------------------------
Q11NT7_CYTH3/50-168--------------------------------------------------------------------------------
Q2U6M1_ASPOR/59-178--------------------------------------------------------------------------------
Q8KSW7_9ACTO/48-172--------------------------------------------------------------------------------
D0DVH8_LACFE/51-164--------------------------------------------------------------------------------
O26514_METTH/65-169--------------------------------------------------------------------------------
Q7M7N7_WOLSU/41-156--------------------------------------------------------------------------------
A5FV61_ACICJ/47-161--------------------------------------------------------------------------------
Q0CLR1_ASPTN/62-174--------------------------------------------------------------------------------
B6HLP8_PENCW/58-177--------------------------------------------------------------------------------
B7V387_PSEA8/41-153--------------------------------------------------------------------------------
B1YDA4_THENV/121-259--------------------------------------------------------------------------------
D4C7W3_9CLOT/47-159--------------------------------------------------------------------------------
B0TYV0_FRAP2/51-161--------------------------------------------------------------------------------
C7RIV9_ACCPU/97-224--------------------------------------------------------------------------------
C1E3Q0_MICSR/60-172--------------------------------------------------------------------------------
Q2L1U1_BORA1/88-215--------------------------------------------------------------------------------
D1Z1D8_METPS/43-149--------------------------------------------------------------------------------
A1ZFN5_9BACT/52-169--------------------------------------------------------------------------------
B4RF38_PHEZH/47-166--------------------------------------------------------------------------------
C9PF78_VIBFU/43-158--------------------------------------------------------------------------------
Q0BQM1_GRABC/48-163--------------------------------------------------------------------------------
A8EQV6_ARCB4/41-156--------------------------------------------------------------------------------
A8G661_PROM2/51-168--------------------------------------------------------------------------------
Q5FPJ6_GLUOX/47-164--------------------------------------------------------------------------------
B4SIH4_STRM5/50-164--------------------------------------------------------------------------------
A1ZXW4_9BACT/46-164--------------------------------------------------------------------------------
Q313Y7_DESDG/87-214--------------------------------------------------------------------------------
B7RW46_9GAMM/47-167--------------------------------------------------------------------------------
A8ME82_CALMQ/83-211--------------------------------------------------------------------------------
Q8KRY7_PSESX/56-177--------------------------------------------------------------------------------
C7JBX0_ACEP3/48-163--------------------------------------------------------------------------------
C5K3E6_AJEDS/64-193--------------------------------------------------------------------------------
D1A6E6_THECD/109-235--------------------------------------------------------------------------------
A3WF90_9SPHN/49-165--------------------------------------------------------------------------------
B9P358_PROMR/59-169--------------------------------------------------------------------------------
D1P7K2_9ENTR/45-159--------------------------------------------------------------------------------
Q1V7N1_VIBAL/45-159--------------------------------------------------------------------------------
Q8H9W0_9CAUD/81-197--------------------------------------------------------------------------------
D0MHA3_RHOM4/51-167--------------------------------------------------------------------------------
B2A1P6_NATTJ/45-164--------------------------------------------------------------------------------
D1CB97_THET1/45-164--------------------------------------------------------------------------------
A5GA44_GEOUR/54-181--------------------------------------------------------------------------------
D1CIY9_THET1/47-165--------------------------------------------------------------------------------
Q2RW74_RHORT/56-169--------------------------------------------------------------------------------

PF00310

GLT1_ORYSJ/100-477VGMVFLPIDEKRRER....SKAEFQKVAESLGHVILGWRR.VPTDNSDLGESA..LQTEPVIEQVFLTKSSS........
GLTB2_ARATH/108-480VGMLFLPRDDNIRKE....AKKVITSIFEKEGLEVLGWRD.VPVEASIVGHNA..KQTMPNTEQVFVRIVKD........
GLUT1_ARATH/117-494VGMFFLPTVESRREE....SKNVFTKVAESLGHSVLGWRL.VPTDNSGLGNSA..LQTEPIIAQVFLTPTTK........
GLTA_BACSU/22-388VGMVFFSQKEDERKK....IEKQINALIEQEGQVVLGWRT.VPVNVGKIGTVA..QKSCPFVRQVFIGASSD........
PUR1_BACSU/12-206................................................................................
GFPT1_HUMAN/2-215................................................................................
GLMS_ECOLI/2-194................................................................................
ASNS_CRIGR/2-161...................................................................RFENVN.......
GFA1_YEAST/2-209................................................................................
GFA1_SCHPO/2-205..................................................................VGNVS.........
ASNB_ECOLI/2-162................................................................................
PUR1_SHIFL/2-211................................................................................
GLMS_HAEIN/2-194................................................................................
PUR1_HAEIN/2-210................................................................................
NODM_RHILV/2-193................................................................................
ASNS1_PEA/2-161................................................................................
GLMS_BACSU/2-193................................................................................
GLT1_YEAST/54-428VGNVFFKKNEKNNKKNLIKCQKIFEDLAASFNLSVLGWRN.VPVDSTILGDVA..LSREPTILQPLLVPLYDE.......
PUR1_YEAST/2-214................................................................................
Q9R6W7_NOSS1/35-403VGMIFLPQDGEVARK....AKAIFEQIATEENLTVLGWRV.VPVQPDLFGDTG..KENQPRIEQVILSADNS........
O08339_RHOSH/34-404VGQVFLPRTDLSGQER...CRTIVESEVLRMGHYIYGWRH.VPVDTSVLGEKA..NATRPEIEQILIRCEKD........
Q98H51_RHILO/54-428VGHWFMPQDAALRAH....IEDIIAESAQSEGLPLIGFRD.VPVDNSSLSKAPDIVASEPFHRQVFIGRTSD........
Q9Z465_CORGT/16-380TGIAFLPRGRMAMMD....AQKEIERIAKQEGADVLGWRM.VPFDSRELGSMA..EEAMPSFAQIFLTVPGK........
Q97IG8_CLOAB/23-393VGMIFLPKETALSYQ....CEGILERAVEEQGQKVLGWRV.VPRDNRSIGETA..KGSEPVIKQIFIGSNCE........
GLT1_SCHPO/69-442IGNVFFSPEADVCRE....AMTAFTQVAEKLGLAILAWRS.VPCDNSILGPAA..LSREPTILQPCVVLKAAY.......
GLTB_ANTSP/27-400VRMILRSSDDLDKI......KKIFSWALDEYQLDLISWRN.VPVDKSILGEES..KFNQPLVVQCIVRSNNL........
Q9VVA4_DROME/88-454TGIFYLDEAQHAAAE......KEFDDLAKSLGLEVIAWRT.VPSNQSAIGVVA..RKSEPLSRQVFVRRPAG........
Q9CPJ9_PASMU/2-216................................................................................
GLTB_CYACA/37-408VAMLFLPCLSSDIQV....SKNIVEEIFQDEDFIVIGWRE.VPYVKEVLGPLA..LRNMPQIYQIVVQSKRY........
Q9KPY3_VIBCH/2-217................................................................................
Q9XDC9_CLOSA/21-385VAMMFLPQDEKARKE....AVSLFEDISKEEGLELIGWRE.VQTNPSILGKAS..LEAMPYIMQAFVKRPNG........
Q9HUD5_PSEAE/15-378VGMVFFNQDPVKAEA....ARENMNREIVAAGLELVGWRK.VPIDTSVLGRLA..LERLPQIEQVFIGGAGL........
Q9CG24_LACLA/23-377VGQFFLSRKENKKHQ....ELEAIKAAVKAQGYEVLFTRT.VPFNFEACGATA..QGIMPSFVQVFIEKKSSE.......
GLTB_AZOBR/37-405VGQVFLPRISLDAQEA...CRCIVETEILAFGYYIYGWRQ.VPINVDIIGEKA..NATRPEIEQIIVGNNKG........
Q9P540_NEUCS/54-436VGNLFFKPDPETLQE....SKRQLEEIAESLGLRVLGWRE.PPVDSTLLGPAA..LSREPSILQPFVVLASAYGP.....
Q9JY00_NEIMB/2-216................................................................................
Q9KPJ1_VIBCH/13-376IGMLFLSRDPHKAQL....AQQIVNQELAKETLSVAGWRK.VPTNPKVLGPIA..LDSLPDIQQVFISAPAG........
PUR1_SCHPO/2-213................................................................................
GLTB_SYNY3/43-413VGNIYGSPDPLARAE....ARQKFNDIVAQEGLKVLGWRD.IPTQNEPLGETA..IASEPFMQQVYIARPEG........
Q51579_PLEBO/39-409VGMVFLPQDSAIAAE....TKQVAEKIIAEEGLTLLGWRS.VPVQPEVLGVQA..RDNQPLIEQLIVQSEVA........
O67512_AQUAE/8-365VGMFFLYEPV..........EDKVEEAFISEGIKVIGWRE.VPVNTDAVGKVA..LKVMPQIKQLFLDMKNI........
Q9I437_PSEAE/2-215................................................................................
GLTS_SYNY3/37-404VGMVFLPQEPSAREV....ARAYVEEVVRLEKLTVLGWRE.VPVNSDVLGIQA..KNNQPHIEQILVTCPEG........
Q9S2Y9_STRCO/20-378VGIAFLPVDGTEDAV......SRIETIAHEEGLTVLGWRE.VPVAPQMLGATA..RSTMPVFRQVFVGDGAS........
Q9RXX2_DEIRA/53-426VGMIFLPKEIASRRA....CEQELERAVIAEGQVVLGWRD.VPINHAMPMSPA.VKEKEPVIRQIFIGAGPD........
PUR1_CHICK/12-236................................................................................
Q9KC46_BACHD/22-392VGMLFLPQDESLRRE....TERKLEAIVNEEGQTFLGWRT.VPTDDSMLGNAA..KAAMPYIRQLFIQKSEN........
Q9RNZ7_ZYMMB/34-404VGMVFLPRTDLSAQET...CRTIVESEIIDFGYRIYGWRQ.VPVDISVIGEKA..MRTRPEIEQIMIAGPHP........
Q9PA10_XYLFA/24-386VGMVFLPGERAAAAH....CRQVLEAELQRVGVRLCGWRE.VPINRSVCGQLA..RDTLPHIEQVFVDIDPK........
Q9A2F8_CAUCR/30-396VGQIFLPRTDLGAQET...CRTIVEAEALRFGFYIYGWRQ.VPVDTSVIGEKA..NATRPEIEQIMLAAPAG........
Q9KPJ4_VIBCH/37-409VGVVLFPKDEHKRAQ....CRDILERNAKRLDLDVIGYRV.LPTNNSMLGADP..LSTEPQFEHVFISGGPG........
GLTB_PORPU/34-404VGMLFLPTSKLQES......KKIIENVLKEENLEVVGWRL.VPTVEEVLGKQA..YLNKPHVEQMFCRSSNL........
Q51583_PLEBO/24-394VGMVYSSPDRAQREA....GRRIFEQVVAEEGQKVLGWRD.VPTDNSTLGETA..KASEPFMQQVFIQRSAD........
Q9CDD5_MYCLE/18-389TGIAFLPQSSKDAAA....ACAAVEKIAVAEGLHVLGWRN.VPTDASSLGALS..RDAMPTFRQVFMAGAT.........
D8BYX0_ECOLX/43-406VGMLFLNKDPELAAA....ARRIVEEELQRETLSIVGWRD.VPTNEGVLGEIA..LSSLPRIEQIFVNAPAG........
O61143_PLAFA/21-537VAQIFLPQNEERRLF....LYHEIEKEVYNHGLVVLGWRSPIPVRRDVISCSV..KKSEPFIAQMFVCKRSVFKNYDDFN
Q99WD1_STAAM/20-380VGLFFSKERILGSEH.....EAVFKKYFEGEGLSILGYRN.VPVNKDAIAKHV..ADTMPVIQQVFIDIRG.........

PF12481

A8IXL5_BRACM/2-226KFVEKNP.------------------------------------------------------------------------
A9PEF3_POPTR/2-226RFVDTNS.------------------------------------------------------------------------
Q3HRW3_SOLTU/2-241RFVQRNS.------------------------------------------------------------------------
Q2RAK8_ORYSJ/2-226RFLAAAEP------------------------------------------------------------------------
A9NKZ6_PICSI/2-228SFLDALP.------------------------------------------------------------------------
A9NXH4_PICSI/2-226SFFNGFP.------------------------------------------------------------------------
A9TLC6_PHYPA/2-227AYKKSYP.------------------------------------------------------------------------
A9NP52_PICSI/2-226SFVSANS.------------------------------------------------------------------------
B7FHM6_MEDTR/2-224HFESLNP.------------------------------------------------------------------------
C6T2Q6_SOYBN/2-226HFSSVHP.------------------------------------------------------------------------
B9HUQ8_POPTR/2-227HLASLHP.------------------------------------------------------------------------
A5AXQ8_VITVI/2-226FFASLHP.------------------------------------------------------------------------
Q9LIL3_ARATH/2-226HFSSVYP.------------------------------------------------------------------------
A2XLW7_ORYSI/2-228GFAGAHA.------------------------------------------------------------------------
B3TM05_ELAGV/2-228HFSATRE.------------------------------------------------------------------------
Q6F390_ORYSJ/2-226RFRDARP.------------------------------------------------------------------------
Q9FG81_ARATH/2-227HFASVNP.------------------------------------------------------------------------
A8IXL3_BRACM/2-239QFVSKNS.------------------------------------------------------------------------
A5BPK4_VITVI/2-230EFLSAHPA------------------------------------------------------------------------
Q9FYX7_SOYBN/2-232DFLSHHPH------------------------------------------------------------------------
A9PBW3_POPTR/2-230DFLSHRPQ------------------------------------------------------------------------
Q9LE80_ARATH/2-229DFLSHHQN------------------------------------------------------------------------
C6T9Q0_SOYBN/2-229DFMSCNSS------------------------------------------------------------------------
A9PK29_9ROSI/2-230DFVSANPP------------------------------------------------------------------------
A6YGE8_CARPA/2-230DFSSSHPT------------------------------------------------------------------------
B8YIB1_MIRJA/2-231IFHQNYNN------------------------------------------------------------------------
Q40127_SOLLC/2-272NFLSANQN------------------------------------------------------------------------
A2XZ07_ORYSI/2-231DFHALHPI------------------------------------------------------------------------
Q43378_ASPOF/2-233DFHSAHPS------------------------------------------------------------------------
Q05FE8_ELAGV/2-228EFHSLHPG------------------------------------------------------------------------
B8LRD8_PICSI/3-230SFVSSMS.------------------------------------------------------------------------
Q307Z6_SOLTU/2-223SFKSWKP.------------------------------------------------------------------------
A9NZE6_PICSI/2-230IFVSTQP.------------------------------------------------------------------------

PF13230

A4JBJ9_BURVG/1-273KSKNTIA-------------------------------------------------------------------------
B3CXI0_BURM1/1-273KSKNTIA-------------------------------------------------------------------------
A1V0D8_BURMS/1-273KSKNTIA-------------------------------------------------------------------------
B2UFJ6_RALPJ/1-272KSKNVIS-------------------------------------------------------------------------
Q0A7W5_ALHEH/1-270KSRAAIC-------------------------------------------------------------------------
Q3A260_PELCD/1-273HSLNVVA-------------------------------------------------------------------------
B0V907_ACIBY/1-271KSRNVIA-------------------------------------------------------------------------
B2SYL4_BURPP/1-273KSKNTIA-------------------------------------------------------------------------
Q1BZ50_BURCA/1-273KSKNTIA-------------------------------------------------------------------------
A9LB76_BURML/1-273KSKNTIA-------------------------------------------------------------------------
C9YH78_9BURK/11-284KSKTVVA-------------------------------------------------------------------------
B0VTE1_ACIBS/1-271KSRNVIA-------------------------------------------------------------------------
C9YDF1_9BURK/1-277KSHNVVA-------------------------------------------------------------------------
Q2SZ73_BURTA/24-296KSKNTIA-------------------------------------------------------------------------
A3MPF1_BURM7/1-273KSKNTIA-------------------------------------------------------------------------
Q6FDQ6_ACIAD/4-274KSRNVIA-------------------------------------------------------------------------
C4KV44_BURPE/13-285KSKNTIA-------------------------------------------------------------------------
B9C0I0_9BURK/25-297KSKNTIA-------------------------------------------------------------------------
C6TY74_BURPE/1-273KSKNTIA-------------------------------------------------------------------------
Q2NG26_METST/1-246YTKSALA-------------------------------------------------------------------------
Q13UA7_BURXL/1-273KSKNTIA-------------------------------------------------------------------------
A0K4K0_BURCH/1-273KSKNTIA-------------------------------------------------------------------------
A2WCM9_9BURK/1-273KSKNTIA-------------------------------------------------------------------------
Q475U0_CUPPJ/1-272KSKNVIS-------------------------------------------------------------------------
B4AR53_FRANO/2-279ISNSFIG-------------------------------------------------------------------------
C6RPJ8_ACIRA/1-271KSRNVIA-------------------------------------------------------------------------
D0LFZ1_HALO1/1-274RAVNFVC-------------------------------------------------------------------------
B1M0S3_METRJ/1-260KSRIVVA-------------------------------------------------------------------------
B2AH51_CUPTR/1-272KSKNVIS-------------------------------------------------------------------------
C6BC48_RALP1/1-272KSKNVIS-------------------------------------------------------------------------
D0C9S1_ACIBA/1-271KSRNVIA-------------------------------------------------------------------------
A7JMK2_FRANO/2-279ISNSFIG-------------------------------------------------------------------------
A7YT79_FRATU/2-279ISNSFIG-------------------------------------------------------------------------
B9BD23_9BURK/25-297KSKNTIA-------------------------------------------------------------------------
A9VWD5_METEP/29-300KSRIVVA-------------------------------------------------------------------------
A3NDH4_BURP6/1-273KSKNTIA-------------------------------------------------------------------------
A0Q741_FRATN/2-279ISNSFIG-------------------------------------------------------------------------
C4GG62_9NEIS/1-273KSENVIA-------------------------------------------------------------------------
D5WD47_BURSC/1-273KSKNTIA-------------------------------------------------------------------------
Q63QV9_BURPS/1-273KSKNTIA-------------------------------------------------------------------------
A2S5G7_BURM9/1-273KSKNTIA-------------------------------------------------------------------------
B5S8H8_RALSL/13-284KSKNVIS-------------------------------------------------------------------------
C7CMW0_METED/1-272KSRIVVA-------------------------------------------------------------------------
B2HV32_ACIBC/1-271KSRNVIA-------------------------------------------------------------------------
Q1LRD7_RALME/1-272KSKNVIS-------------------------------------------------------------------------
B7KSM2_METC4/1-272KSRIVVA-------------------------------------------------------------------------
C5AB16_BURGB/1-273KSKNTIA-------------------------------------------------------------------------
Q0BI95_BURCM/1-273KSKNTIA-------------------------------------------------------------------------
B5SG66_RALSL/13-284KSKNVIS-------------------------------------------------------------------------
D0C3B3_9GAMM/1-271KSRNVIA-------------------------------------------------------------------------
Q0KEE5_CUPNH/1-272KSKNVIS-------------------------------------------------------------------------
D0SU94_ACILW/1-271KSRNVIA-------------------------------------------------------------------------
C5ASQ1_METEA/1-272KSRIVVA-------------------------------------------------------------------------
A9ER87_SORC5/1-279ESSLLVL-------------------------------------------------------------------------
B1N200_BURPE/1-273KSKNTIA-------------------------------------------------------------------------
A8KUB1_BURPE/1-273KSKNTIA-------------------------------------------------------------------------
B2JGV6_BURP8/1-272KSKNTIA-------------------------------------------------------------------------
A7JIF8_FRANO/2-279ISNSFIG-------------------------------------------------------------------------
A5J900_BURML/13-285KSKNTIA-------------------------------------------------------------------------
A7NBB7_FRATF/2-279ISNSFIG-------------------------------------------------------------------------
Q47AN0_DECAR/1-267RSKNVIA-------------------------------------------------------------------------
A3RRN4_RALSL/13-284KSKNVIS-------------------------------------------------------------------------
B1FF86_9BURK/25-297KSKNTIA-------------------------------------------------------------------------
B9CJ55_9BURK/25-297KSKNTIA-------------------------------------------------------------------------
D0WIN3_9ACTN/1-249ESTHILA-------------------------------------------------------------------------
A5XUZ1_BURML/13-285KSKNTIA-------------------------------------------------------------------------
A4IYM1_FRATW/2-279ISNSFIG-------------------------------------------------------------------------
C5N7G0_BURML/13-285KSKNTIA-------------------------------------------------------------------------
C0VJ77_9GAMM/1-271KSRNVIA-------------------------------------------------------------------------
Q5P4D2_AROAE/1-272RSLNVIA-------------------------------------------------------------------------
D0T4E4_ACIRA/1-271KSRNVIA-------------------------------------------------------------------------
Q8Y251_RALSO/1-272KSKNVIS-------------------------------------------------------------------------
B0TY56_FRAP2/2-277CSSTFIG-------------------------------------------------------------------------
Q3JNQ6_BURP1/13-285KSKNTIA-------------------------------------------------------------------------
D3E130_METRM/1-248VCKNMLA-------------------------------------------------------------------------
A3M328_ACIBT/1-271KSRNVIA-------------------------------------------------------------------------
D0S0M3_ACICA/1-271KSRNVIA-------------------------------------------------------------------------
C4ANW9_BURML/13-285KSKNTIA-------------------------------------------------------------------------
A2VSW5_9BURK/1-273KSKNTIA-------------------------------------------------------------------------
C6YWP7_9GAMM/2-277CSSTFIG-------------------------------------------------------------------------
D0S8W3_ACIJO/1-271KSRNVIA-------------------------------------------------------------------------
Q62H44_BURMA/1-273KSKNTIA-------------------------------------------------------------------------
A4KQS8_FRATU/2-279ISNSFIG-------------------------------------------------------------------------
B7CLH7_BURPE/13-285KSKNTIA-------------------------------------------------------------------------
B2H0I4_BURPE/1-273KSKNTIA-------------------------------------------------------------------------
A9G0L9_SORC5/1-275HTALAIA-------------------------------------------------------------------------
A8EIA4_BURPE/1-273KSKNTIA-------------------------------------------------------------------------
D3S2D4_FERPA/1-270RSNIVVS-------------------------------------------------------------------------
C4ZMI2_THASP/1-272RSLNVIA-------------------------------------------------------------------------
Q39JK4_BURS3/1-273KSKNTIA-------------------------------------------------------------------------
A1K1T1_AZOSB/1-272RSLNVIA-------------------------------------------------------------------------
Q220N7_RHOFD/1-283KSHNVIA-------------------------------------------------------------------------
A4MF24_BURPE/13-285KSKNTIA-------------------------------------------------------------------------
C8PUW8_9GAMM/1-285KAMNVIS-------------------------------------------------------------------------
D0SKG0_ACIJU/1-271KSRNVIA-------------------------------------------------------------------------
A9AH86_BURM1/25-297KSKNTIA-------------------------------------------------------------------------
A3NZ85_BURP0/1-273KSKNTIA-------------------------------------------------------------------------

PF09147

Q8KM13_PHOLM/3-201--------------------------------------------------------------------------------
Q9XB61_ERWCA/3-203--------------------------------------------------------------------------------
Q2NVG4_SODGM/4-196--------------------------------------------------------------------------------

PF00227

PSB2_CRYNJ/1-184--------------------------------------------------------------------------------
PSB_HALSA/45-226--------------------------------------------------------------------------------
PSA1_HALVD/33-217--------------------------------------------------------------------------------
PSB3A_ARATH/5-189--------------------------------------------------------------------------------
PSB6_DICDI/11-193--------------------------------------------------------------------------------
PSA3_DICDI/31-216--------------------------------------------------------------------------------
PSB4_MOUSE/50-237--------------------------------------------------------------------------------
PSB2_AERPE/22-203--------------------------------------------------------------------------------
PSA3_MOUSE/31-217--------------------------------------------------------------------------------
PSA2_CARAU/29-213--------------------------------------------------------------------------------
PSB2_ORYSJ/1-182--------------------------------------------------------------------------------
PSA3_CAEEL/31-216--------------------------------------------------------------------------------
PSB1_AERPE/2-185--------------------------------------------------------------------------------
Q8SSI0_ENCCU/6-190--------------------------------------------------------------------------------
HSLV_THEMA/2-176--------------------------------------------------------------------------------
PSB4_ARATH/28-213--------------------------------------------------------------------------------
O96780_TRYBR/26-207--------------------------------------------------------------------------------
PSA3_ENCCU/26-211--------------------------------------------------------------------------------
PSB3_GIAIN/6-191--------------------------------------------------------------------------------
Q98S57_GUITH/22-204--------------------------------------------------------------------------------
Q9VK14_DROME/29-214--------------------------------------------------------------------------------
HSLV_RICPR/6-181--------------------------------------------------------------------------------
Q8UUL9_ORYLA/13-196--------------------------------------------------------------------------------
PSB7_SCHPO/32-213--------------------------------------------------------------------------------
O12994_ORYLA/18-200--------------------------------------------------------------------------------
PSA_MYCS2/24-210--------------------------------------------------------------------------------
PSA5_CAEEL/31-219--------------------------------------------------------------------------------
PSA_AERPE/35-220--------------------------------------------------------------------------------
PSB_ARCFU/8-191--------------------------------------------------------------------------------
PSB6_SCHPO/21-203--------------------------------------------------------------------------------
Q98RW3_GUITH/25-209--------------------------------------------------------------------------------
PSA_METTH/32-216--------------------------------------------------------------------------------
PSA_SULSO/33-219--------------------------------------------------------------------------------
Q9AW13_GUITH/5-185--------------------------------------------------------------------------------
PSA1_DROME/29-216--------------------------------------------------------------------------------
PSA4_DICDI/28-217--------------------------------------------------------------------------------
PSA6_YEAST/40-228--------------------------------------------------------------------------------
PSA_METAC/30-214--------------------------------------------------------------------------------
PSB_STRCO/50-238--------------------------------------------------------------------------------
O18314_CIOIN/37-218--------------------------------------------------------------------------------
PSA6_CAEEL/35-220--------------------------------------------------------------------------------
Q9NDA3_9TRYP/29-214--------------------------------------------------------------------------------
PSA4_ENCCU/27-206--------------------------------------------------------------------------------
PSA71_DROVI/28-211--------------------------------------------------------------------------------
PSB_HALVD/46-226--------------------------------------------------------------------------------
PSA5A_ARATH/31-218--------------------------------------------------------------------------------
Q9W470_DROME/45-226--------------------------------------------------------------------------------
PSB3_DROME/6-190--------------------------------------------------------------------------------
PSA7_CAEEL/27-212--------------------------------------------------------------------------------
PSA_PYRAE/32-215--------------------------------------------------------------------------------
PSB5_SCHPO/58-240--------------------------------------------------------------------------------
HSLV_XYLFT/4-178--------------------------------------------------------------------------------
Q8T8V8_DROME/68-250--------------------------------------------------------------------------------
Q8UVV0_HETFR/67-249--------------------------------------------------------------------------------
HSLV_THETN/1-176--------------------------------------------------------------------------------
Q8SR95_ENCCU/28-203--------------------------------------------------------------------------------
PSB_METAC/6-189--------------------------------------------------------------------------------
O62102_CAEEL/43-224--------------------------------------------------------------------------------
PSA1B_ARATH/29-214--------------------------------------------------------------------------------
PSB1_SULTO/2-183--------------------------------------------------------------------------------
PSA1_DICDI/29-216--------------------------------------------------------------------------------
Q98S31_GUITH/31-212--------------------------------------------------------------------------------
PSB1_PYRFU/3-185--------------------------------------------------------------------------------
PSB1_YEAST/26-210--------------------------------------------------------------------------------
PSA4_CAEEL/28-213--------------------------------------------------------------------------------
PSB4_DROME/54-242--------------------------------------------------------------------------------
PSB3_CAEEL/5-189--------------------------------------------------------------------------------
PSA_METJA/32-215--------------------------------------------------------------------------------
PSA3_DROME/31-216--------------------------------------------------------------------------------
PSB1_PYRAE/1-181--------------------------------------------------------------------------------
HSLV_LISMO/2-179--------------------------------------------------------------------------------
PSA1_TRYBR/29-216--------------------------------------------------------------------------------
PSA7_CHICK/26-211--------------------------------------------------------------------------------
PSB_METKA/7-191--------------------------------------------------------------------------------
Q966I8_CAEEL/20-202--------------------------------------------------------------------------------
Q98RR2_GUITH/8-190--------------------------------------------------------------------------------
PSA6_SCHPO/30-219--------------------------------------------------------------------------------
PSA1_TRYCR/29-216--------------------------------------------------------------------------------
PSA6_DROME/35-218--------------------------------------------------------------------------------
Q8UVV5_HETFR/15-196--------------------------------------------------------------------------------
PSA2_NEUCR/28-213--------------------------------------------------------------------------------
Q8T915_DROME/46-228--------------------------------------------------------------------------------
PSA_SULTO/33-220--------------------------------------------------------------------------------
PSA72_DROME/28-213--------------------------------------------------------------------------------
PSB1_SULSO/2-183--------------------------------------------------------------------------------
PSB3_ONCMY/5-190--------------------------------------------------------------------------------
PSA7_DICDI/29-211--------------------------------------------------------------------------------
PSB2_PYRAE/5-187--------------------------------------------------------------------------------
PSA3_ARATH/31-216--------------------------------------------------------------------------------
HSLV_CHLTE/8-181--------------------------------------------------------------------------------
Q9NJV7_CRYPV/10-192--------------------------------------------------------------------------------
PSA4_DROME/28-219--------------------------------------------------------------------------------
PSA_HALSA/33-217--------------------------------------------------------------------------------
PSA7_SCHPO/27-211--------------------------------------------------------------------------------
Q9RAW7_9ACTO/49-237--------------------------------------------------------------------------------
PSB2_SULSO/11-192--------------------------------------------------------------------------------
PSB5_CHICK/52-234--------------------------------------------------------------------------------
Q8T759_BRAFL/68-250--------------------------------------------------------------------------------
Q9BMX8_9TRYP/1-187--------------------------------------------------------------------------------
PSA_THEAC/31-212--------------------------------------------------------------------------------
Q9AW25_GUITH/1-182--------------------------------------------------------------------------------
PSB6_ARATH/9-191--------------------------------------------------------------------------------
Q9GRG9_9TRYP/103-285--------------------------------------------------------------------------------
PSA_METKA/33-217--------------------------------------------------------------------------------
PSB2_ENCCU/1-181--------------------------------------------------------------------------------
PSA4_YEAST/29-216--------------------------------------------------------------------------------
PSA6_TOBAC/32-220--------------------------------------------------------------------------------
Q90ZQ5_ONCMY/42-229--------------------------------------------------------------------------------
PSB2_DROME/3-185--------------------------------------------------------------------------------
Q98S25_GUITH/3-186--------------------------------------------------------------------------------
PSA3_ACACA/29-214--------------------------------------------------------------------------------
PSB7_ENCCU/3-183--------------------------------------------------------------------------------
PSA2_DROME/29-213--------------------------------------------------------------------------------
HSLV_CAMJE/1-176--------------------------------------------------------------------------------
O12993_ORYLA/11-192--------------------------------------------------------------------------------
O77396_PLAF7/31-221--------------------------------------------------------------------------------
PSB1_MOUSE/33-212--------------------------------------------------------------------------------
PSB2_YEAST/1-184--------------------------------------------------------------------------------
PSA2_SCHPO/28-213--------------------------------------------------------------------------------
PSA2_YEAST/28-214--------------------------------------------------------------------------------
Q8UUL8_ORYLA/38-219--------------------------------------------------------------------------------
HSLV_STAAW/5-181--------------------------------------------------------------------------------
PSA4_SCHPO/28-215--------------------------------------------------------------------------------
PSA7L_MOUSE/28-213--------------------------------------------------------------------------------
PSB7_YEAST/26-207--------------------------------------------------------------------------------
PSA1_CAEEL/29-215--------------------------------------------------------------------------------
PSA1_RHOER/24-209--------------------------------------------------------------------------------
PSA1_SCHPO/29-215--------------------------------------------------------------------------------
PSA1_ENCCU/38-223--------------------------------------------------------------------------------
Q8SR59_ENCCU/27-210--------------------------------------------------------------------------------
PSB2_NEUCR/2-184--------------------------------------------------------------------------------
PSB6_ENCCU/7-186--------------------------------------------------------------------------------
PSB2A_ARATH/1-182--------------------------------------------------------------------------------
PSA1_CHICK/28-214--------------------------------------------------------------------------------
O12992_LAMJA/28-210--------------------------------------------------------------------------------
PSB5_YEAST/72-255--------------------------------------------------------------------------------
PSB3_YEAST/7-190--------------------------------------------------------------------------------
PSB2_PYRFU/7-188--------------------------------------------------------------------------------
O12999_XENLA/13-194--------------------------------------------------------------------------------
Q8UVY0_PAROL/68-248--------------------------------------------------------------------------------
PSB9_MUSMB/17-198--------------------------------------------------------------------------------
PSA7_TRYBB/26-209--------------------------------------------------------------------------------
PSB3_SCHPO/5-189--------------------------------------------------------------------------------
PSA7_YEAST/27-215--------------------------------------------------------------------------------
PSA1_ORYSJ/29-214--------------------------------------------------------------------------------
PSB_THEAC/5-186--------------------------------------------------------------------------------
Q9PUS1_DANRE/38-219--------------------------------------------------------------------------------
Q8SR88_ENCCU/28-210--------------------------------------------------------------------------------
Q9XG34_GUITH/25-205--------------------------------------------------------------------------------
PSA73_DROME/28-214--------------------------------------------------------------------------------
PSA3_SCHPO/30-215--------------------------------------------------------------------------------
Q94II8_ORYSJ/46-234--------------------------------------------------------------------------------
PSA_ARCFU/31-214--------------------------------------------------------------------------------
PSA2_CAEEL/28-211--------------------------------------------------------------------------------
PSA_PYRFU/33-215--------------------------------------------------------------------------------
PSA2_HALVD/32-215--------------------------------------------------------------------------------
PSB2_SCHPO/1-184--------------------------------------------------------------------------------
PSA2_TRYBB/27-211--------------------------------------------------------------------------------
PSB6_YEAST/16-197--------------------------------------------------------------------------------
PSA_MYCTU/26-206--------------------------------------------------------------------------------
Q8T8U1_DROME/1-183--------------------------------------------------------------------------------
PSB2_SULTO/10-191--------------------------------------------------------------------------------
Q9N9W9_GIAIN/29-210--------------------------------------------------------------------------------
PSB_METJA/3-187--------------------------------------------------------------------------------
Q9VJJ0_DROME/1-183--------------------------------------------------------------------------------
PSB_METTH/6-188--------------------------------------------------------------------------------
O76468_CRYPV/29-215--------------------------------------------------------------------------------
Q9LST5_ORYSJ/57-239--------------------------------------------------------------------------------
PSB3_TRYBB/6-190--------------------------------------------------------------------------------
HSLV_RALSO/3-177--------------------------------------------------------------------------------
PSB2_CAEEL/1-186--------------------------------------------------------------------------------
CLPQ_BACSU/3-180--------------------------------------------------------------------------------
HSLV_AQUAE/2-176--------------------------------------------------------------------------------
HSLV_BORBU/2-179--------------------------------------------------------------------------------

PF01112

ASPG_HUMAN/8-335...--------------------------------..-------------------------------------------
ASPG_ELIMR/24-340EPK--------------------------------TT-------------------------------------------
ASGX_SYNY3/1-309...--------------------------------..-------------------------------------------
IAAA_ECOLI/2-317...--------------------------------..-------------------------------------------
ASPGA_ARATH/2-314...--------------------------------..-------------------------------------------
ASPG_LUPAL/2-324...--------------------------------..-------------------------------------------
ASPG_CAEEL/7-348...--------------------------------..-------------------------------------------

PF01019

GGT7_HUMAN/154-655LRE.....ETL.........QRSWETK....PGL.LV-------------------------------------------
GGT5_HUMAN/58-581HAP.....SLL.........DQCAQALPLGTGAQ.WI-------------------------------------------
PAC1_PSES3/39-540ATA.....EMYECLSDEIGKQRDTRDRQNVVGAK.AV-------------------------------------------
GGT1_HUMAN/55-564AFA.....TMF............NSSEQSQKGGL.SV-------------------------------------------
CAPD_BACAN/63-522.........YF.........TGNQKPH.........I-------------------------------------------
Q9XTY7_CAEEL/52-571ASR.....DMF...........LNDSDGSKYGFK.AA-------------------------------------------
Q9C2D7_NEUCS/45-598CTL.....ENVR...KSLKIPEGTVGKIPMSSVH.AV-------------------------------------------
Q9VWT3_DROME/55-566AHK.....DMF.............VGETSITGAK.SG-------------------------------------------
Q9XZS5_DROME/54-560ATQ.....DMF..............VKTEITGAL.SC-------------------------------------------
GGT5_RAT/58-567HDQ.....RLL.........DQCTNALPLCTGAQ.WI-------------------------------------------
Q9VXA5_DROME/259-772ATE.....DMF...........AQQPENSDKGPL.SI-------------------------------------------
Q9VYR2_DROME/74-587LRA.....DNF.........SSFRDEQDFKRSGW.SI-------------------------------------------
YWRD_BACSU/24-520VTR.....DVY...........KGKSAIPLRGIDSAI-------------------------------------------
Q987N3_RHILO/31-523ATV.....DWY.........LDRGFSELPKQGPH.AV-------------------------------------------
P71828_MYCTU/21-507WTP.....EYF............GGNAVPVLGWN.SV-------------------------------------------
Q9I6W8_PSEAE/37-533LDR.....ERV.........RAAGHERMPLYGWT.PV-------------------------------------------
Q9KEI5_BACHD/38-534LTM.....EAV........KAKGYEQELPPYGVI.PV-------------------------------------------
Q9RU70_DEIRA/37-530LSL.....EAL............PGGEMPKYGWT.PV-------------------------------------------
Q9R6V5_SYNE7/31-503WTP.....ERF...........AHIPQMPKRGWD.SV-------------------------------------------
Q54353_STRLN/27-595ATP.....QAF.........SDLGLEHIPGSGLL.PA-------------------------------------------
O54174_STRCO/42-600ATI.....EHF.........RAEGLDHVPGAGAL.AA-------------------------------------------
Q9EYI3_STRNO/28-615ATP.....AHY.........RRLGLDLVPGTGPL.AA-------------------------------------------
Q97A97_THEVO/25-500VNR.....GLY.........FELGYSRIPERGIYSAI-------------------------------------------
Q9HJH4_THEAC/27-510VSI.....DYY.........ESMGLTKIPERGPYAAI-------------------------------------------
Q97TX5_SULSO/22-473LKV.....DKI................NSDRGPL.TV-------------------------------------------
Q9YFW3_AERPE/25-493LTR.....EEV.........LGRGLQEIPESGPL.SP-------------------------------------------
Q9KM31_VIBCH/18-514IAL.....TDY...........DPAQGLPQQGGAAAL-------------------------------------------
GGT_SYNY3/21-511KAV.....DFY.....PVALNFGGAWQTFHIGKG.AI-------------------------------------------
P71750_MYCTU/94-636ATE.....NYLR...WVSDVDRSAPRPNARASGR.SI-------------------------------------------
Q9KVF2_VIBCH/67-583ATP.....ELF.....LDSTGQPMKFYDAVVGGR.SV-------------------------------------------
GGT_BACSU/61-577ATP.....DMF......LDENGKAIPFSERVTKGTAV-------------------------------------------
Q9AAR5_CAUCR/64-579ATP.....DMF.....MGPEGKPLSFVKVLLSGR.SS-------------------------------------------
O69935_STRCO/61-590ADE.....KLF......TEDGKPLAFADAVTSGL.SV-------------------------------------------
Q99X13_STAAM/30-540VDK.....QFY.....LDDSGEYKSFFDMTTHGK.TV-------------------------------------------
Q9A9J6_CAUCR/62-572AKL.....ETF......VDANGKEMDDVASRGYR.AP-------------------------------------------
GGT_ECOLI/63-574ATR.....DMF......LDDQGNPDSKKSLTSHL.AS-------------------------------------------
O25743_HELPY/52-566ATK.....NMF......LDKQGNVVPKLSEDGYL.AA-------------------------------------------
GGT_PSEUA/49-569ATA.....NMY......LDKDGNVIKGASTTGYL.AV-------------------------------------------
Q98B64_RHILO/52-573ATK.....TMY......LDKDGNPVKGASLDGYL.AV-------------------------------------------
Q9ABW6_CAUCR/71-577ARA.....DMY......LGPDGELVEGLSLYGGL.AA-------------------------------------------
GGT_PSEAE/44-550ASK.....TMY......LDDKGEVIENLSLVGAK.AA-------------------------------------------
Q9I6D3_PSEAE/53-562AYA.....DMY.......RRNGKVDPRLSVDGPL.AA-------------------------------------------
Q9PEP4_XYLFA/53-572VNL.....GTF......LNKDGQLDHDRSINGPW.SA-------------------------------------------
ECM38_YEAST/123-654SHK.....FMF...........ENCSLCSKIGGL.AV-------------------------------------------
GGT2_SCHPO/96-606VSK.....HMF...........DKNPMLAQVGPL.SI-------------------------------------------
GGT1_SCHPO/114-625ASK.....NMF...........HGNSTLSQVGGL.SV-------------------------------------------
Q9P6C7_NEUCS/50-580ATQ.....DMY...........NDDPNASVLGAR.SV-------------------------------------------
O65652_ARATH/48-572ATEVKRVLNMY...........GGNVDLKKKGAL.SV-------------------------------------------
Q9M0G0_ARATH/95-632ASK.....DMY...........KNDASAKSLGAL.SM-------------------------------------------
O18256_CAEEL/87-600ATE.....KMY...........VHDKDSAQFGYQ.SI-------------------------------------------
O97392_BRUMA/63-583ASR.....DMF...........INDEFGSKYGFR.AI-------------------------------------------
Q9N5V4_CAEEL/118-635ATE.....EMY...........RDKWNQSRIGWK.AI-------------------------------------------

PF02275

YXEI_BACSU/2-316DGR--------------------AHQTQY.--------------------------------------------------
ASAH1_HUMAN/143-394NNK--------------------.TVFKAS--------------------------------------------------
CBH_LACPL/2-312VEN--------------------.LDHHY.--------------------------------------------------
CBH_CLOPE/2-317NKK--------------------ELTTKY.--------------------------------------------------
P72765_SYNY3/54-367LGD--------------------MLVVKDN--------------------------------------------------
P97038_LACJH/2-316LDN--------------------.TTTKK.--------------------------------------------------
PAC_LYSSH/4-320ENV--------------------VINNSY.--------------------------------------------------
ASAH1_MOUSE/142-393LKP--------------------LTVNLDF--------------------------------------------------

PF03417

Q99SW3_STAAM/102-313YQP--------------------TD.....--------------------------------------------------
Q9W369_DROME/127-375VAH--------------------IISDKPQ--------------------------------------------------
Q7VXA7_BORPE/103-331DVR--------------------PDDA...--------------------------------------------------
Q8ETF3_OCEIH/100-313VDP--------------------E......--------------------------------------------------
Q981H5_RHILO/99-326VGT--------------------.......--------------------------------------------------
Q8CVA0_OCEIH/100-312FQP--------------------TD.....--------------------------------------------------
Q8CUR6_OCEIH/102-312YKP--------------------TD.....--------------------------------------------------
Q7QEK0_ANOGA/123-370SAH--------------------IISESPE--------------------------------------------------
Q896G2_CLOTE/101-321KDN--------------------.......--------------------------------------------------
Q8TP46_METAC/185-453VAS--------------------PDDG...--------------------------------------------------
Q8XYL6_RALSO/104-332QCR--------------------IDGS...--------------------------------------------------
Q8RH78_FUSNN/95-316KLN--------------------.......--------------------------------------------------
Q7NWB3_CHRVO/36-263HPE--------------------.......--------------------------------------------------
Q8CRS5_STAES/102-313FQP--------------------ND.....--------------------------------------------------
Q92XD1_RHIME/155-360TEW--------------------.......--------------------------------------------------
Q81DJ8_BACCR/98-334THV--------------------E......--------------------------------------------------
AAAA_EMENI/108-335TIC--------------------Q......--------------------------------------------------
AAAA_PENCH/108-335TIR--------------------Q......--------------------------------------------------

PF03577

PEPDA_STRPQ/2-403YRS--------------------VQSSFEM--------------------------------------------------
PEPD_BIFLO/2-428YKS--------------------VISHLTI--------------------------------------------------
Q8E6I4_STRA3/2-403YKS--------------------VLSNFEV--------------------------------------------------
Q93TK2_STRGN/25-448IVD--------------------ESNGFTY--------------------------------------------------
Q93F45_EDWTA/24-429FHA--------------------NENKFTY--------------------------------------------------
Q8A7H5_BACTN/21-440...--------------------.......--------------------------------------------------
Q8G733_BIFLO/20-471YRS--------------------VLSHVEI--------------------------------------------------
PEPDA_LACLA/2-401YRS--------------------ITTACEF--------------------------------------------------
Q8Z7Q9_SALTI/19-417YKA--------------------HRNNFSW--------------------------------------------------
PEPDB_LACLA/10-410YKA--------------------VLSDLEL--------------------------------------------------
Q8DTN0_STRMU/3-404YRS--------------------VLSNFEI--------------------------------------------------
PEPDA_LACHE/5-408YTS--------------------VISKQKI--------------------------------------------------
PEPD_LACSK/9-407YVS--------------------KYNGLTM--------------------------------------------------

PF01804

PAC2_PSES3/30-767LGA...........EAAEADILVRRLGMEK......VCRRDFEALGAEA.......KDMLRAYVAGVNAFLA....S.GA
Q9I2K4_PSEAE/47-796FGA...........KTLPMDRFARTLGFRR......TAEGIYANLDAPT.......RVLLQRYSDGINAYLE...LA.PA
QUIP_PSEAE/54-838VGP...........GALEIDRFMRTVNLRQ......AAEIQYRNASPRL.......QRFFEVYARGVNAYLY...RY.RD
O86089_9PROT/45-712WGP...........DYEQTTVWLLTNGVPER......AQQWYAQQSPDF.......RANLDAFAAGINAYAQ......QN
PAC_ARTVI/30-794FGE...........DYLSKDEQSRRDGYSN.....KEIKKMIDGLDRQP.......RELIAKFAEGISRYVNEALKDPDD
O29763_ARCFU/48-774FGE...........DFFDSDEFHVKMDFLG......AAEASWSVLKDSE......IGDLLVAYSEGVNYYIK......NR
AAC_ACTUT/37-776FGAT........GPDDADVRTTSSTQAIDDR.....VAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLR...RT.GV
Q9HKC5_THEAC/40-802LGS...........GYYNYDRFQTMTGAPLTAQRDWNAIVSNMSVNSTDYL....TYQAVTAYSQGINDYINYS.ES.HN
PVDQ_PSEAE/31-755FGSEGKS...SAELDNLPSDIFYAWLNQPE......ALQAFWQAQTPAV.......RQLLEGYAAGFNRFLR.......E
Q97XS1_SULSO/56-827VGA...........KALSSDIAMHLIGIPQ......NAIMSAQYLKHNYPT....IYSYLEAFSQGVNDYIN.T.LN.YR
Q9A9G3_CAUCR/35-682KGA...........GAAPTDYVVSLLEVWP......TVDKHYAELPAEL.......RAIMEAYADGVSLYVA........
Q9AK68_STRCO/1-782LGP...........EALSWDRLARRARLAD......TARRCFTALERKDPE....TAAWVRAYTDGVNEGLTEP.GH.PN
Q55592_SYNY3/35-700WGI...........DYLDNDQYVHTMNIPR......RSEVWLNAQTPAM.......RRDLESFAQGINNYFQ......QH
Q979D7_THEVO/70-856VGQ...........TTLSTDILMRELQFYN......TAVEEYQNLPKTS.F....TYESLHAFVSGINAYIQ.N.LT.YS
Q9RYQ4_DEIRA/36-778LGAEGKTVVGFQPVNNLDSDVFFKTVIEPG......RLQAGYRDQPQIL........ALMRGYVAGVNRYLR....D.TP
Q9HI83_THEAC/66-851AGP...........STLQTDIFMRELQLYN......TAIMERQNLSADN.M....TYIYLKSFVLGINAYIG.N.LT.YS
Q9S258_STRCO/103-886AGGA........PANQGLEQQFWRSAPYTEA.....DLEAQIESAAAKAGERGELALADVDAYVAGVNAYIDAS..DKGR
O34142_ALCFA/29-806LGPGE.......QDAYVKYDMQVRQNFTPA......SIQRQIAALSKDE.......RDIFRGYADGYNAYLEQVRRR.PE
Q9I6I6_PSEAE/41-787LGP...........KLVDTDRLFRTLRIRD.....HAAEYSARQDKQSQ......PWKVLEAYLDGVNQFQE......NN
Q9A972_CAUCR/34-719EGE...........KAIWADLRQKLFIDPA......VLKADYAKSPAWL.......KALMNAWADGLNYYLQ......T.
PAC_KLUCI/31-836LGK...........AFVSFDKDIRQNYWPD......SIRAQIASLSAED.......KSILQGYADGMNAWIDKVNASPDK

PF04916

PLBL1_MOUSE/8-549LDK--------------------NGDAYGY--------------------------------------------------
PLBL2_CAEEL/31-578...--------------------..VAVAR--------------------------------------------------
PLBL1_CAEEL/2-552...--------------------..LATAY--------------------------------------------------
PLBL3_CAEEL/2-570SR.--------------------..VALGK--------------------------------------------------
PLBL_DROME/35-658..P--------------------TGVGRIC--------------------------------------------------
O76517_TRYBR/6-615ASG--------------------KYAAIVN--------------------------------------------------

PF13522

Q319R2_PROM9/31-164--------------------------------------------------------------------------------
A2C1R3_PROM1/29-159--------------------------------------------------------------------------------
A6H137_FLAPJ/32-161--------------------------------------------------------------------------------
A1ZI98_9BACT/32-161--------------------------------------------------------------------------------
D1B558_SULD5/28-151--------------------------------------------------------------------------------
B6BGG4_9PROT/28-151--------------------------------------------------------------------------------
Q15WL8_PSEA6/32-161--------------------------------------------------------------------------------
A1ZXW5_9BACT/31-157--------------------------------------------------------------------------------
C6C0L2_DESAD/29-158--------------------------------------------------------------------------------
B9UJ05_9ACTO/31-161--------------------------------------------------------------------------------
D0LGD9_HALO1/33-165--------------------------------------------------------------------------------
D2AY63_STRRD/33-164--------------------------------------------------------------------------------
Q67SX7_SYMTH/33-163--------------------------------------------------------------------------------
D1PMI4_9FIRM/34-164--------------------------------------------------------------------------------
A8A8Q5_IGNH4/48-172--------------------------------------------------------------------------------
A3MVE4_PYRCJ/52-198--------------------------------------------------------------------------------
A2BKU3_HYPBU/86-222--------------------------------------------------------------------------------
A8MDJ1_CALMQ/76-219--------------------------------------------------------------------------------
C3MRQ6_SULIM/67-191--------------------------------------------------------------------------------
C4RDQ3_9ACTO/71-217--------------------------------------------------------------------------------
C1A341_RHOE4/69-214--------------------------------------------------------------------------------
B1VRV8_STRGG/70-217--------------------------------------------------------------------------------
A8L8S4_FRASN/71-216--------------------------------------------------------------------------------
B1MFS0_MYCA9/68-197--------------------------------------------------------------------------------
D1ACB4_THECD/68-206--------------------------------------------------------------------------------
B8DT41_BIFA0/71-227--------------------------------------------------------------------------------
B4CXP1_9BACT/50-172--------------------------------------------------------------------------------
D1A6E6_THECD/85-229--------------------------------------------------------------------------------
B1YDA4_THENV/101-253--------------------------------------------------------------------------------
Q313Y7_DESDG/69-208--------------------------------------------------------------------------------
A9J6W7_BPLUZ/64-191--------------------------------------------------------------------------------
Q2L1U1_BORA1/78-209--------------------------------------------------------------------------------
C7RIV9_ACCPU/72-218--------------------------------------------------------------------------------
A3SJ02_9RHOB/30-184--------------------------------------------------------------------------------
D0LWC5_HALO1/57-200--------------------------------------------------------------------------------
C7P6F6_METFA/31-174--------------------------------------------------------------------------------
A6UTH5_META3/46-188--------------------------------------------------------------------------------
Q67SU9_SYMTH/28-156--------------------------------------------------------------------------------
C0GFE8_9FIRM/28-153--------------------------------------------------------------------------------
B6EHL2_ALISL/33-161--------------------------------------------------------------------------------
A3WK96_9GAMM/33-166--------------------------------------------------------------------------------
B8IIU0_METNO/27-152--------------------------------------------------------------------------------
D4LAQ5_RUMC1/30-159--------------------------------------------------------------------------------
A8AA00_IGNH4/31-161--------------------------------------------------------------------------------
A1TKR9_ACIAC/32-162--------------------------------------------------------------------------------
Q1MNZ8_LAWIP/32-161--------------------------------------------------------------------------------
C7MBC0_BRAFD/30-167--------------------------------------------------------------------------------
C6A089_THESM/27-158--------------------------------------------------------------------------------
A1TKS1_ACIAC/32-165--------------------------------------------------------------------------------
A8TMT0_9PROT/32-161--------------------------------------------------------------------------------
A8M5J5_SALAI/32-161--------------------------------------------------------------------------------
A5CX28_VESOH/32-161--------------------------------------------------------------------------------
B8HUI9_CYAP4/34-167--------------------------------------------------------------------------------
C7G790_9FIRM/29-159--------------------------------------------------------------------------------
C5F126_9HELI/26-156--------------------------------------------------------------------------------
E8WTP4_GEOS8/31-159--------------------------------------------------------------------------------
Q92TY3_RHIME/30-158--------------------------------------------------------------------------------
B8HND1_CYAP4/33-164--------------------------------------------------------------------------------
C9YDI6_9BURK/28-159--------------------------------------------------------------------------------
A4TWE4_9PROT/27-157--------------------------------------------------------------------------------
Q7W1A1_BORPA/30-164--------------------------------------------------------------------------------
A7BTD4_9GAMM/10-143--------------------------------------------------------------------------------
B0RW09_XANCB/35-167--------------------------------------------------------------------------------
Q988G2_RHILO/34-166--------------------------------------------------------------------------------
A6DK48_9BACT/33-162--------------------------------------------------------------------------------
Q2IZV2_RHOP2/32-164--------------------------------------------------------------------------------
A4IWP6_FRATW/32-164--------------------------------------------------------------------------------

PF13537

Q5ASH6_EMENI/53-172--------------------------------------------------------------------------------
B9PWN3_TOXGO/71-193--------------------------------------------------------------------------------
Q2LTR9_SYNAS/73-199--------------------------------------------------------------------------------
Q2YZN6_9DELT/73-201--------------------------------------------------------------------------------
Q5LFT8_BACFN/74-198--------------------------------------------------------------------------------
D1PAI4_9BACT/75-199--------------------------------------------------------------------------------
C9RMT9_FIBSS/74-201--------------------------------------------------------------------------------
C1DTA6_SULAA/82-202--------------------------------------------------------------------------------
D1PIW6_9FIRM/46-166--------------------------------------------------------------------------------
C5F101_9HELI/91-211--------------------------------------------------------------------------------
C6E3Y8_GEOSM/48-168--------------------------------------------------------------------------------
A6DEM6_9PROT/51-165--------------------------------------------------------------------------------
A5Z6H5_9FIRM/45-164--------------------------------------------------------------------------------
A1VAB5_DESVV/59-173--------------------------------------------------------------------------------
D4M4V2_9FIRM/52-165--------------------------------------------------------------------------------
C5KCG7_PERM5/48-170--------------------------------------------------------------------------------
C0GG67_9FIRM/53-166--------------------------------------------------------------------------------
A1ASZ8_PELPD/48-167--------------------------------------------------------------------------------
C7MKT6_CRYCD/71-192--------------------------------------------------------------------------------
E8WTP4_GEOS8/46-165--------------------------------------------------------------------------------
Q09SM5_BORPP/47-168--------------------------------------------------------------------------------
B3KYI2_PHAVU/48-166--------------------------------------------------------------------------------
B8HND1_CYAP4/57-170--------------------------------------------------------------------------------
B7AUG5_9FIRM/44-164--------------------------------------------------------------------------------
D1N3I7_9BACT/47-166--------------------------------------------------------------------------------
A6H137_FLAPJ/47-167--------------------------------------------------------------------------------
D3T763_THEIA/48-169--------------------------------------------------------------------------------
Q0AZ18_SYNWW/47-167--------------------------------------------------------------------------------
A4BSJ7_9GAMM/48-168--------------------------------------------------------------------------------
Q1MNZ8_LAWIP/47-167--------------------------------------------------------------------------------
A9GJ27_SORC5/48-167--------------------------------------------------------------------------------
C6J0Z3_9BACL/48-167--------------------------------------------------------------------------------
A3CX83_METMJ/47-167--------------------------------------------------------------------------------
A8ESL9_ARCB4/53-166--------------------------------------------------------------------------------
D3EKK9_GEOS4/48-169--------------------------------------------------------------------------------
C7LP19_DESBD/84-205--------------------------------------------------------------------------------
B1WQP9_CYAA5/45-160--------------------------------------------------------------------------------
C2VRM4_BACCE/48-169--------------------------------------------------------------------------------
C4FEA3_9BIFI/47-166--------------------------------------------------------------------------------
C1DDD8_LARHH/51-168--------------------------------------------------------------------------------
Q07U44_RHOP5/47-166--------------------------------------------------------------------------------
A7NGM6_ROSCS/48-167--------------------------------------------------------------------------------
F2G8Q8_ALTMD/54-167--------------------------------------------------------------------------------
E8WQK3_GEOS8/47-167--------------------------------------------------------------------------------
C0ZGQ1_BREBN/48-169--------------------------------------------------------------------------------
B7KM32_CYAP7/57-169--------------------------------------------------------------------------------
Q65FV9_BACLD/50-169--------------------------------------------------------------------------------
D1PIW9_9FIRM/48-167--------------------------------------------------------------------------------
Q216T1_RHOPB/47-166--------------------------------------------------------------------------------
D3SEV0_THISK/48-168--------------------------------------------------------------------------------
A8AA00_IGNH4/55-167--------------------------------------------------------------------------------
D6Z0B3_DESAT/43-160--------------------------------------------------------------------------------
A6CE28_9PLAN/47-166--------------------------------------------------------------------------------
Q12VP2_METBU/43-162--------------------------------------------------------------------------------
C5A2K1_THEGJ/42-164--------------------------------------------------------------------------------
D5SUU8_PLAL2/54-173--------------------------------------------------------------------------------
C9BZ32_ENTFC/45-164--------------------------------------------------------------------------------
Q60BD5_METCA/46-165--------------------------------------------------------------------------------
B1HXB0_LYSSC/54-169--------------------------------------------------------------------------------
A7IB45_METB6/47-167--------------------------------------------------------------------------------
C7P6F6_METFA/66-180--------------------------------------------------------------------------------
D7VX33_9FLAO/60-173--------------------------------------------------------------------------------
B0N4I8_9FIRM/45-164--------------------------------------------------------------------------------
C5BIB9_TERTT/48-165--------------------------------------------------------------------------------
C0BH32_9BACT/48-167--------------------------------------------------------------------------------
C3KLT2_RHISN/70-189--------------------------------------------------------------------------------
D0U2E2_STRPT/48-167--------------------------------------------------------------------------------
Q3SM07_THIDA/48-168--------------------------------------------------------------------------------
A4E9B2_9ACTN/52-166--------------------------------------------------------------------------------
A1ZI98_9BACT/47-167--------------------------------------------------------------------------------
C7RT03_ACCPU/48-168--------------------------------------------------------------------------------
E6VZL8_DESAO/47-168--------------------------------------------------------------------------------
D4KMF4_9FIRM/44-165--------------------------------------------------------------------------------
A4XLL9_CALS8/48-169--------------------------------------------------------------------------------
O87986_BORBO/51-167--------------------------------------------------------------------------------
B8GV93_THISH/47-166--------------------------------------------------------------------------------
Q1N7B0_9SPHN/48-168--------------------------------------------------------------------------------
B9JNF8_AGRRK/48-167--------------------------------------------------------------------------------
B3QUX4_CHLT3/58-171--------------------------------------------------------------------------------
A1TKR9_ACIAC/49-168--------------------------------------------------------------------------------
A1WX67_HALHL/50-170--------------------------------------------------------------------------------
A1VHY0_DESVV/74-190--------------------------------------------------------------------------------
C8VWD2_DESAS/48-169--------------------------------------------------------------------------------
Q26BI0_FLABB/48-167--------------------------------------------------------------------------------
B0BZG4_ACAM1/47-167--------------------------------------------------------------------------------
A9B763_HERA2/45-164--------------------------------------------------------------------------------
A8RHM4_9CLOT/52-173--------------------------------------------------------------------------------
A3WBV5_9SPHN/48-168--------------------------------------------------------------------------------
A6C8F5_9PLAN/48-167--------------------------------------------------------------------------------
C9YDI6_9BURK/45-165--------------------------------------------------------------------------------
C9P5X6_VIBME/48-167--------------------------------------------------------------------------------
A9AVN7_HERA2/53-166--------------------------------------------------------------------------------
D9TR59_THETC/48-169--------------------------------------------------------------------------------
D5SQH7_PLAL2/59-173--------------------------------------------------------------------------------
Q15WL8_PSEA6/47-167--------------------------------------------------------------------------------
Q3SMN0_THIDA/47-165--------------------------------------------------------------------------------
B8JFB6_ANAD2/49-168--------------------------------------------------------------------------------
Q30XB0_DESDG/46-165--------------------------------------------------------------------------------
A4AWP2_MARSH/48-167--------------------------------------------------------------------------------
B8GVB9_THISH/48-167--------------------------------------------------------------------------------
Q30W35_DESDG/52-171--------------------------------------------------------------------------------
Q11EB5_MESSB/46-165--------------------------------------------------------------------------------
B8LMV0_PICSI/48-166--------------------------------------------------------------------------------
C0GFE8_9FIRM/43-159--------------------------------------------------------------------------------
Q09SL0_BORPP/51-171--------------------------------------------------------------------------------
D4L906_9FIRM/48-169--------------------------------------------------------------------------------
B6BY61_9GAMM/48-168--------------------------------------------------------------------------------
D7VXP6_9FLAO/48-166--------------------------------------------------------------------------------
Q89GP7_BRAJA/53-172--------------------------------------------------------------------------------
D2ELX2_PEDAC/45-164--------------------------------------------------------------------------------
Q31I32_THICR/47-165--------------------------------------------------------------------------------
B6FJ58_9CLOT/52-165--------------------------------------------------------------------------------
C6C0L2_DESAD/44-164--------------------------------------------------------------------------------
A0YEF5_9GAMM/47-166--------------------------------------------------------------------------------
A8FUC6_SHESH/48-167--------------------------------------------------------------------------------
B5CZ45_9BACE/48-167--------------------------------------------------------------------------------
D3PM21_MEIRD/68-181--------------------------------------------------------------------------------
B5EA88_GEOBB/47-168--------------------------------------------------------------------------------
Q81GN9_BACCR/48-169--------------------------------------------------------------------------------
C7PT80_CHIPD/48-167--------------------------------------------------------------------------------
A6UTH5_META3/82-194--------------------------------------------------------------------------------
A9W815_METEP/53-166--------------------------------------------------------------------------------
A1HQU4_9FIRM/48-169--------------------------------------------------------------------------------
Q67SX7_SYMTH/48-169--------------------------------------------------------------------------------
A0L574_MAGSM/48-168--------------------------------------------------------------------------------
Q67SU9_SYMTH/44-162--------------------------------------------------------------------------------
A6TWB0_ALKMQ/48-169--------------------------------------------------------------------------------
A3QHF6_SHELP/46-166--------------------------------------------------------------------------------
D1KBT8_9GAMM/47-167--------------------------------------------------------------------------------
D3RU48_ALLVD/48-168--------------------------------------------------------------------------------
Q21PG9_SACD2/57-171--------------------------------------------------------------------------------
C1ATQ5_RHOOB/48-169--------------------------------------------------------------------------------
A0LYW1_GRAFK/45-164--------------------------------------------------------------------------------
A4U2W9_9PROT/51-171--------------------------------------------------------------------------------
D4L5M3_9FIRM/57-164--------------------------------------------------------------------------------
B0TFK1_HELMI/48-169--------------------------------------------------------------------------------
B9YZR4_9NEIS/45-165--------------------------------------------------------------------------------
A4A561_9GAMM/25-145--------------------------------------------------------------------------------
Q9KCR1_BACHD/48-169--------------------------------------------------------------------------------
B7FT50_PHATC/57-178--------------------------------------------------------------------------------
E6TYW0_BACCJ/46-165--------------------------------------------------------------------------------
Q1GRU1_SPHAL/48-168--------------------------------------------------------------------------------
A1TKS1_ACIAC/51-171--------------------------------------------------------------------------------
A3XJR6_LEEBM/48-167--------------------------------------------------------------------------------
D3MRS2_9FIRM/52-169--------------------------------------------------------------------------------
C0GHN0_9FIRM/48-169--------------------------------------------------------------------------------
A7BSS9_9GAMM/58-174--------------------------------------------------------------------------------
Q1I2K2_PSEE4/47-166--------------------------------------------------------------------------------
Q65LI2_BACLD/48-169--------------------------------------------------------------------------------
C2FYF7_9SPHI/48-166--------------------------------------------------------------------------------
A4W840_ENT38/48-167--------------------------------------------------------------------------------
A2SJD9_METPP/43-164--------------------------------------------------------------------------------
ASNS_DICDI/48-169--------------------------------------------------------------------------------
Q1YPR6_9GAMM/67-187--------------------------------------------------------------------------------
D3FZ77_BACPE/48-169--------------------------------------------------------------------------------
C4KBW1_THASP/51-171--------------------------------------------------------------------------------
Q319R2_PROM9/48-170--------------------------------------------------------------------------------
Q605Z5_METCA/46-165--------------------------------------------------------------------------------
A4CM46_ROBBH/48-167--------------------------------------------------------------------------------
D4LAQ5_RUMC1/45-165--------------------------------------------------------------------------------
A3EK19_VIBCL/50-168--------------------------------------------------------------------------------
Q81ZU7_NITEU/48-168--------------------------------------------------------------------------------
C3KRD5_RHISN/51-172--------------------------------------------------------------------------------
D3AFP1_9CLOT/57-178--------------------------------------------------------------------------------
A8LVP2_SALAI/46-166--------------------------------------------------------------------------------
Q7MSW6_WOLSU/42-160--------------------------------------------------------------------------------
C7HFF8_CLOTM/48-169--------------------------------------------------------------------------------
C6J1Y5_9BACL/48-169--------------------------------------------------------------------------------
Q2WB52_MAGSA/47-166--------------------------------------------------------------------------------
B2IYJ4_NOSP7/59-173--------------------------------------------------------------------------------
A9EDC0_9FLAO/48-167--------------------------------------------------------------------------------
A6CPY7_9BACI/48-169--------------------------------------------------------------------------------
Q15RM5_PSEA6/55-167--------------------------------------------------------------------------------
A5CX28_VESOH/47-167--------------------------------------------------------------------------------
D3SB42_THISK/47-167--------------------------------------------------------------------------------
Q11Z14_CYTH3/48-168--------------------------------------------------------------------------------
B2TNC6_CLOBB/48-169--------------------------------------------------------------------------------
C0QEN5_DESAH/70-189--------------------------------------------------------------------------------
Q3B1S8_PELLD/46-166--------------------------------------------------------------------------------
D6Z4G9_DESAT/48-167--------------------------------------------------------------------------------
A9I748_BORPD/47-170--------------------------------------------------------------------------------
Q5WH52_BACSK/48-169--------------------------------------------------------------------------------
C0ZBJ4_BREBN/48-169--------------------------------------------------------------------------------
C5Y2Y7_SORBI/48-174--------------------------------------------------------------------------------
E6TYI4_BACCJ/48-169--------------------------------------------------------------------------------
B6C089_9GAMM/57-171--------------------------------------------------------------------------------
Q2SJG4_HAHCH/57-171--------------------------------------------------------------------------------
B1VMY8_STRGG/48-173--------------------------------------------------------------------------------
Q9RJK2_STRCO/48-166--------------------------------------------------------------------------------
D3QAD7_STANL/49-169--------------------------------------------------------------------------------
Q9KJI6_DESGI/52-171--------------------------------------------------------------------------------
B5E8P8_GEOBB/54-171--------------------------------------------------------------------------------
C3IWN5_BACTU/45-164--------------------------------------------------------------------------------
C1A5T9_GEMAT/55-168--------------------------------------------------------------------------------
B4BIR0_9BACI/48-169--------------------------------------------------------------------------------
Q2NA36_ERYLH/48-168--------------------------------------------------------------------------------
A2TSH4_9FLAO/48-167--------------------------------------------------------------------------------
C2QBK6_BACCE/45-169--------------------------------------------------------------------------------
Q01XN2_SOLUE/46-165--------------------------------------------------------------------------------
B8KJD2_9GAMM/25-145--------------------------------------------------------------------------------
C2WMM0_BACCE/48-169--------------------------------------------------------------------------------
C4K7X1_HAMD5/55-167--------------------------------------------------------------------------------
A0Q7S4_FRATN/47-170--------------------------------------------------------------------------------
Q7MBG3_WOLSU/61-173--------------------------------------------------------------------------------
A7NLM8_ROSCS/43-157--------------------------------------------------------------------------------
C5T0U7_ACIDE/48-168--------------------------------------------------------------------------------
B1I0Y5_DESAP/48-169--------------------------------------------------------------------------------
B0NXA9_9CLOT/52-173--------------------------------------------------------------------------------
C8W452_DESAS/48-169--------------------------------------------------------------------------------
D5X1P1_THIK1/46-165--------------------------------------------------------------------------------
D3V2B7_XENBS/51-170--------------------------------------------------------------------------------
Q2WBC9_MAGSA/51-171--------------------------------------------------------------------------------
C7PAG8_CHIPD/57-168--------------------------------------------------------------------------------
B4SPR9_STRM5/59-173--------------------------------------------------------------------------------
D2SAR5_GEOOG/50-170--------------------------------------------------------------------------------
C1F7T8_ACIC5/52-172--------------------------------------------------------------------------------
B7GLW0_ANOFW/61-182--------------------------------------------------------------------------------
A4FX82_METM5/68-180--------------------------------------------------------------------------------
B1K8L8_BURCC/51-174--------------------------------------------------------------------------------
C8XKV4_NAKMY/46-165--------------------------------------------------------------------------------
E3I7S3_RHOVT/58-174--------------------------------------------------------------------------------
B6IXV0_RHOCS/58-172--------------------------------------------------------------------------------
Q86A01_DICDI/50-171--------------------------------------------------------------------------------
D5VTZ9_METIM/63-169--------------------------------------------------------------------------------
A8ZX58_DESOH/43-159--------------------------------------------------------------------------------
B8GLI4_THISH/54-167--------------------------------------------------------------------------------
A5Z4P6_9FIRM/78-197--------------------------------------------------------------------------------
B8BZR9_THAPS/57-178--------------------------------------------------------------------------------
B6IYJ4_RHOCS/51-171--------------------------------------------------------------------------------
Q12HN2_SHEDO/46-166--------------------------------------------------------------------------------
B5JNG8_9BACT/50-171--------------------------------------------------------------------------------
Q11FH2_MESSB/47-167--------------------------------------------------------------------------------
D1PRL7_9FIRM/57-170--------------------------------------------------------------------------------
A8PQZ5_MALGO/63-179--------------------------------------------------------------------------------
Q1QD48_PSYCK/55-169--------------------------------------------------------------------------------
Q220Y3_RHOFD/48-168--------------------------------------------------------------------------------
D0NLW5_PHYIT/50-171--------------------------------------------------------------------------------
Q2LWL8_SYNAS/62-175--------------------------------------------------------------------------------
A5AAI5_ASPNC/47-168--------------------------------------------------------------------------------
D2QWZ5_PIRSD/59-178--------------------------------------------------------------------------------
C5ZZB9_9HELI/41-162--------------------------------------------------------------------------------
B4UY04_9ACTO/48-169--------------------------------------------------------------------------------
Q988G2_RHILO/58-172--------------------------------------------------------------------------------
A6LS88_CLOB8/48-169--------------------------------------------------------------------------------
B5DPA2_DROPS/60-180--------------------------------------------------------------------------------
A7BY79_9GAMM/47-167--------------------------------------------------------------------------------
Q7N3E7_PHOLL/51-170--------------------------------------------------------------------------------
A1ZXW5_9BACT/46-163--------------------------------------------------------------------------------
C7C1Y2_9ACTO/48-169--------------------------------------------------------------------------------
D0TID9_9BACE/48-167--------------------------------------------------------------------------------
C1I2N8_9CLOT/50-171--------------------------------------------------------------------------------
Q5QU50_IDILO/50-172--------------------------------------------------------------------------------
B1Y730_LEPCP/47-166--------------------------------------------------------------------------------
F1TF15_9CLOT/46-165--------------------------------------------------------------------------------
B3QJY0_RHOPT/43-167--------------------------------------------------------------------------------
A4J8B3_DESRM/48-169--------------------------------------------------------------------------------
A4YLK3_BRASO/46-166--------------------------------------------------------------------------------
A7Z383_BACA2/48-169--------------------------------------------------------------------------------
Q9RA27_VIBMA/55-167--------------------------------------------------------------------------------
B9HNE0_POPTR/48-166--------------------------------------------------------------------------------
A4BL90_9GAMM/46-165--------------------------------------------------------------------------------
A4LI33_BURPE/58-174--------------------------------------------------------------------------------
Q7WR34_BORBR/41-162--------------------------------------------------------------------------------
C7MST2_SACVD/46-164--------------------------------------------------------------------------------
C3XDE6_9HELI/72-187--------------------------------------------------------------------------------
B8KQP7_9GAMM/45-164--------------------------------------------------------------------------------
A9B583_HERA2/48-167--------------------------------------------------------------------------------
Q89HI1_BRAJA/49-169--------------------------------------------------------------------------------
Q74BS3_GEOSL/54-166--------------------------------------------------------------------------------
B4LH96_DROVI/67-180--------------------------------------------------------------------------------
A5N6Y5_CLOK5/48-169--------------------------------------------------------------------------------
Q01UW3_SOLUE/48-167--------------------------------------------------------------------------------
A7ZF04_CAMC1/47-167--------------------------------------------------------------------------------
B1HS43_LYSSC/48-169--------------------------------------------------------------------------------
Q8EN79_OCEIH/48-169--------------------------------------------------------------------------------
A4FMI9_SACEN/48-169--------------------------------------------------------------------------------
Q2G5V9_NOVAD/48-168--------------------------------------------------------------------------------
C7XTT3_9LACO/50-170--------------------------------------------------------------------------------
A5D4J4_PELTS/48-170--------------------------------------------------------------------------------
B7AKA8_9BACE/48-167--------------------------------------------------------------------------------
D2JNW7_9NOSO/48-167--------------------------------------------------------------------------------
B6YQV5_AZOPC/48-166--------------------------------------------------------------------------------
C1DDD9_LARHH/48-169--------------------------------------------------------------------------------
B8J3E1_DESDA/50-169--------------------------------------------------------------------------------
A5VDL7_SPHWW/48-168--------------------------------------------------------------------------------
Q49BF3_STRHY/48-169--------------------------------------------------------------------------------
D6S3E6_9LACO/53-166--------------------------------------------------------------------------------
D1R677_9CHLA/51-167--------------------------------------------------------------------------------
C7MBC0_BRAFD/45-173--------------------------------------------------------------------------------
Q2RIX6_MOOTA/48-169--------------------------------------------------------------------------------
D2AY63_STRRD/48-170--------------------------------------------------------------------------------
A4BPQ6_9GAMM/34-148--------------------------------------------------------------------------------
Q23CU8_TETTS/60-177--------------------------------------------------------------------------------
C4XTN2_DESMR/52-171--------------------------------------------------------------------------------
B9R487_9RHOB/47-167--------------------------------------------------------------------------------
A8UK10_9FLAO/67-188--------------------------------------------------------------------------------
E6U4Y9_ETHHY/50-171--------------------------------------------------------------------------------
A8JG07_CHLRE/48-170--------------------------------------------------------------------------------
B3QY65_CHLT3/47-167--------------------------------------------------------------------------------
A0L450_MAGSM/47-167--------------------------------------------------------------------------------
Q97GX2_CLOAB/48-169--------------------------------------------------------------------------------
A5V1L8_ROSS1/55-168--------------------------------------------------------------------------------
Q2B953_9BACI/48-169--------------------------------------------------------------------------------
A7T4X2_NEMVE/47-165--------------------------------------------------------------------------------
B6WVV2_9DELT/50-170--------------------------------------------------------------------------------
B1ZBU4_METPB/46-166--------------------------------------------------------------------------------
Q1YFQ6_MOBAS/47-167--------------------------------------------------------------------------------
C3RLY9_9FIRM/51-170--------------------------------------------------------------------------------
A5GQB9_SYNR3/51-164--------------------------------------------------------------------------------
Q2SJH5_HAHCH/45-158--------------------------------------------------------------------------------
B9MJX9_ANATD/48-169--------------------------------------------------------------------------------
B4WJY6_9SYNE/57-172--------------------------------------------------------------------------------
D1PMI4_9FIRM/49-170--------------------------------------------------------------------------------
C7QF66_CATAD/44-168--------------------------------------------------------------------------------
A4KUB6_STRHI/48-167--------------------------------------------------------------------------------
Q094S0_STIAD/48-170--------------------------------------------------------------------------------
A0LCM5_MAGSM/57-173--------------------------------------------------------------------------------
A9WSE9_RENSM/44-167--------------------------------------------------------------------------------
B8GGE5_METPE/42-162--------------------------------------------------------------------------------
C4WQP2_9RHIZ/54-174--------------------------------------------------------------------------------
B3QPH1_CHLP8/47-167--------------------------------------------------------------------------------
A4X7Y5_SALTO/75-195--------------------------------------------------------------------------------
B0ML15_9FIRM/25-146--------------------------------------------------------------------------------
A4X9C7_SALTO/62-175--------------------------------------------------------------------------------
B4U6E2_HYDS0/59-178--------------------------------------------------------------------------------
Q47GK4_DECAR/53-176--------------------------------------------------------------------------------
Q9FAR2_STRAU/48-169--------------------------------------------------------------------------------
E3I873_RHOVT/48-171--------------------------------------------------------------------------------
D1RME1_LEGLO/47-168--------------------------------------------------------------------------------
B8HUI9_CYAP4/51-173--------------------------------------------------------------------------------
A4B944_9GAMM/61-173--------------------------------------------------------------------------------
A6UNP9_METVS/74-187--------------------------------------------------------------------------------
Q2RPM9_RHORT/48-168--------------------------------------------------------------------------------
A5EHY9_BRASB/48-167--------------------------------------------------------------------------------
D0KYR8_HALNC/47-171--------------------------------------------------------------------------------
D3U9Z6_9ACTO/48-170--------------------------------------------------------------------------------
D4JEU7_9FIRM/51-163--------------------------------------------------------------------------------
D0FNI9_ERWPE/48-169--------------------------------------------------------------------------------
Q3S8R1_STRRM/48-170--------------------------------------------------------------------------------
Q988H1_RHILO/49-168--------------------------------------------------------------------------------
B2W1S8_PYRTR/47-168--------------------------------------------------------------------------------
Q8DM85_THEEB/58-177--------------------------------------------------------------------------------
D0CMS6_9SYNE/50-172--------------------------------------------------------------------------------
A1VVT9_POLNA/47-167--------------------------------------------------------------------------------
C4Z9V1_EUBR3/52-173--------------------------------------------------------------------------------
Q6ACN3_LEIXX/48-169--------------------------------------------------------------------------------
Q21S99_RHOFD/47-167--------------------------------------------------------------------------------
A8UQ31_9FLAO/44-163--------------------------------------------------------------------------------
Q2LWN2_SYNAS/59-175--------------------------------------------------------------------------------
Q0IDQ7_SYNS3/54-169--------------------------------------------------------------------------------
B5VJ70_YEAS6/54-167--------------------------------------------------------------------------------
Q39TM3_GEOMG/59-172--------------------------------------------------------------------------------
Q7NXB4_CHRVO/48-170--------------------------------------------------------------------------------
Q6LYS0_METMP/74-187--------------------------------------------------------------------------------
A5KQS7_9FIRM/52-173--------------------------------------------------------------------------------
C2HRD9_VIBCL/52-164--------------------------------------------------------------------------------
A4BIU0_9GAMM/50-169--------------------------------------------------------------------------------
B8FYG6_DESHD/49-170--------------------------------------------------------------------------------
B2H132_BURPE/51-170--------------------------------------------------------------------------------
D3RUI4_ALLVD/47-167--------------------------------------------------------------------------------
A9KFJ4_COXBN/59-173--------------------------------------------------------------------------------
B9UJ05_9ACTO/48-167--------------------------------------------------------------------------------
B3L4A4_PLAKH/60-174--------------------------------------------------------------------------------
C0ZB16_BREBN/47-166--------------------------------------------------------------------------------
Q7USD1_RHOBA/65-177--------------------------------------------------------------------------------
C3K8M3_PSEFS/49-168--------------------------------------------------------------------------------
Q8PRB2_XANAC/57-170--------------------------------------------------------------------------------
A4VJI0_PSEU5/47-167--------------------------------------------------------------------------------
B7DPG1_9BACL/48-169--------------------------------------------------------------------------------
D2B1Z0_STRRD/45-164--------------------------------------------------------------------------------
Q02LN1_PSEAB/48-168--------------------------------------------------------------------------------
C7R704_KANKD/50-172--------------------------------------------------------------------------------
D3RQ21_ALLVD/47-166--------------------------------------------------------------------------------
C6WV73_METML/48-165--------------------------------------------------------------------------------
A8FBS7_BACP2/50-171--------------------------------------------------------------------------------
Q2RSV6_RHORT/47-167--------------------------------------------------------------------------------
Q20ZN3_RHOPB/48-168--------------------------------------------------------------------------------
D8JX32_HYPDA/59-177--------------------------------------------------------------------------------
Q2SLG5_HAHCH/47-167--------------------------------------------------------------------------------
B9P339_PROMR/61-175--------------------------------------------------------------------------------
A3HRD8_9BACT/47-167--------------------------------------------------------------------------------
C7Q560_CATAD/48-168--------------------------------------------------------------------------------
D5CRA4_SIDLE/47-167--------------------------------------------------------------------------------
D3PM19_MEIRD/52-172--------------------------------------------------------------------------------
E6VSF4_DESAO/52-176--------------------------------------------------------------------------------
C6PVS3_9CLOT/56-167--------------------------------------------------------------------------------
B7VAM4_PSEA8/58-174--------------------------------------------------------------------------------
Q6CH25_YARLI/47-167--------------------------------------------------------------------------------
D9SNK4_CLOC7/48-169--------------------------------------------------------------------------------
B4KUK4_DROMO/68-180--------------------------------------------------------------------------------
C5DQZ1_ZYGRC/47-167--------------------------------------------------------------------------------
F1TGG9_9CLOT/49-170--------------------------------------------------------------------------------
A9IE16_BORPD/48-171--------------------------------------------------------------------------------
D1B558_SULD5/43-157--------------------------------------------------------------------------------
C7QI69_CATAD/48-174--------------------------------------------------------------------------------
A3ZYU5_9PLAN/59-178--------------------------------------------------------------------------------
Q1IDC0_PSEE4/52-172--------------------------------------------------------------------------------
B1J8H6_PSEPW/48-170--------------------------------------------------------------------------------
Q0RHA1_FRAAA/20-140--------------------------------------------------------------------------------
Q5P2C5_AROAE/49-168--------------------------------------------------------------------------------
ASNH2_METJA/68-181--------------------------------------------------------------------------------
A0QVJ3_MYCS2/47-167--------------------------------------------------------------------------------
B4S380_PROA2/47-167--------------------------------------------------------------------------------
A3UKJ3_9RHOB/53-170--------------------------------------------------------------------------------
B6IX73_RHOCS/48-168--------------------------------------------------------------------------------
E8W5U4_STRFA/48-170--------------------------------------------------------------------------------
Q4FTY4_PSYA2/57-168--------------------------------------------------------------------------------
A4YY74_BRASO/59-175--------------------------------------------------------------------------------
D0LGD9_HALO1/48-171--------------------------------------------------------------------------------
D3FFB1_CONWI/46-165--------------------------------------------------------------------------------
Q4FTY1_PSYA2/56-172--------------------------------------------------------------------------------
B4WAP0_9CAUL/47-167--------------------------------------------------------------------------------
E8WR80_GEOS8/55-170--------------------------------------------------------------------------------
C6BTG8_DESAD/52-175--------------------------------------------------------------------------------
C3XKC4_9HELI/41-162--------------------------------------------------------------------------------
A8PKM5_9COXI/48-166--------------------------------------------------------------------------------
Q56619_VIBCL/54-169--------------------------------------------------------------------------------
D3RTP3_ALLVD/44-164--------------------------------------------------------------------------------
Q2MGB4_STRGR/49-171--------------------------------------------------------------------------------
C4I635_BURPE/48-173--------------------------------------------------------------------------------
B8IXH9_METNO/49-168--------------------------------------------------------------------------------
Q8ECG7_SHEON/56-171--------------------------------------------------------------------------------
D2S7W6_GEOOG/47-167--------------------------------------------------------------------------------
D5WZF9_THIK1/47-167--------------------------------------------------------------------------------
Q0A658_ALHEH/47-170--------------------------------------------------------------------------------
Q9FB19_9ACTO/51-170--------------------------------------------------------------------------------
Q2ILL8_ANADE/59-177--------------------------------------------------------------------------------
C6W7W6_ACTMD/51-172--------------------------------------------------------------------------------
A9FKC0_SORC5/48-170--------------------------------------------------------------------------------
C5UWI4_CLOBO/51-163--------------------------------------------------------------------------------
Q6ASA1_DESPS/50-173--------------------------------------------------------------------------------
Q7MSW7_WOLSU/49-158--------------------------------------------------------------------------------
Q220Y1_RHOFD/25-144--------------------------------------------------------------------------------
C7LT29_DESBD/46-162--------------------------------------------------------------------------------
Q2CH15_9RHOB/27-140--------------------------------------------------------------------------------
Q6U1H6_SHIDY/60-175--------------------------------------------------------------------------------
A8I1E3_AZOC5/46-166--------------------------------------------------------------------------------
Q6YPY1_ONYPE/48-167--------------------------------------------------------------------------------
Q11P23_CYTH3/44-161--------------------------------------------------------------------------------
Q0H2X8_9ACTO/48-170--------------------------------------------------------------------------------
A5WC05_PSYWF/51-174--------------------------------------------------------------------------------
D7VVT0_9FLAO/46-165--------------------------------------------------------------------------------
Q8TZ36_METKA/54-162--------------------------------------------------------------------------------
B5WKQ6_9BURK/48-170--------------------------------------------------------------------------------
C5M4U1_CANTT/47-167--------------------------------------------------------------------------------
A4YXC2_BRASO/59-177--------------------------------------------------------------------------------
Q5P0P7_AROAE/47-167--------------------------------------------------------------------------------
A1UEP1_MYCSK/47-167--------------------------------------------------------------------------------
Q30V26_DESDG/57-186--------------------------------------------------------------------------------
B0UMG8_METS4/47-167--------------------------------------------------------------------------------
A7HRA6_PARL1/47-167--------------------------------------------------------------------------------
A8TMT0_9PROT/47-167--------------------------------------------------------------------------------
A0ZBU8_NODSP/27-148--------------------------------------------------------------------------------
D9SCG7_GALCS/47-167--------------------------------------------------------------------------------
A4RU16_OSTLU/60-172--------------------------------------------------------------------------------
A7BTD4_9GAMM/34-149--------------------------------------------------------------------------------
C9NMI3_9VIBR/47-166--------------------------------------------------------------------------------
A4RXB8_OSTLU/49-169--------------------------------------------------------------------------------
B7J9F8_ACIF2/53-166--------------------------------------------------------------------------------
C6WBZ3_ACTMD/47-166--------------------------------------------------------------------------------
Q125B0_POLSJ/59-179--------------------------------------------------------------------------------
D0L316_GORB4/47-167--------------------------------------------------------------------------------
A1KKP3_MYCBP/68-182--------------------------------------------------------------------------------
Q30U87_SULDN/50-157--------------------------------------------------------------------------------
C8XB77_NAKMY/47-167--------------------------------------------------------------------------------
A0SZV7_9ACTO/48-170--------------------------------------------------------------------------------
C5ZZB1_9HELI/46-164--------------------------------------------------------------------------------
Q0YTU9_9CHLB/34-161--------------------------------------------------------------------------------
E0TGP5_PARBH/48-167--------------------------------------------------------------------------------
A8W7D4_9ACTO/48-173--------------------------------------------------------------------------------
D1PQ59_9FIRM/23-146--------------------------------------------------------------------------------
D5UY52_TSUPD/59-174--------------------------------------------------------------------------------
B6R111_9RHOB/41-164--------------------------------------------------------------------------------
A0CK03_PARTE/58-173--------------------------------------------------------------------------------
A6R1E0_AJECN/101-225--------------------------------------------------------------------------------
B6BKE4_9PROT/42-158--------------------------------------------------------------------------------
B5VUJ3_SPIMA/45-163--------------------------------------------------------------------------------
Q6CVM7_KLULA/47-167--------------------------------------------------------------------------------
Q6QW19_AZOBR/13-131--------------------------------------------------------------------------------
Q0W279_UNCMA/45-150--------------------------------------------------------------------------------
C0JRY2_STRLU/48-170--------------------------------------------------------------------------------
D5VU54_METIM/64-176--------------------------------------------------------------------------------
A6WDH3_KINRD/47-167--------------------------------------------------------------------------------
C4R588_PICPG/47-167--------------------------------------------------------------------------------
QUEC_SULAC/78-205--------------------------------------------------------------------------------
A4TXA1_9PROT/48-167--------------------------------------------------------------------------------
Q30U64_SULDN/41-156--------------------------------------------------------------------------------
O46196_AEDAE/70-187--------------------------------------------------------------------------------
A3SJ02_9RHOB/70-190--------------------------------------------------------------------------------
D0KR75_SULS9/78-205--------------------------------------------------------------------------------
C7BSC5_PHOAA/57-169--------------------------------------------------------------------------------
A4X3E4_SALTO/47-167--------------------------------------------------------------------------------
A6DK48_9BACT/48-168--------------------------------------------------------------------------------
QUEC2_SULTO/78-205--------------------------------------------------------------------------------
A0RRA8_CAMFF/43-159--------------------------------------------------------------------------------
C3RME3_9FIRM/51-164--------------------------------------------------------------------------------
C9YX81_STRSW/47-167--------------------------------------------------------------------------------
A0E625_PARTE/60-175--------------------------------------------------------------------------------
C0JRV7_9ACTO/48-170--------------------------------------------------------------------------------
D2SYZ2_MICEC/48-170--------------------------------------------------------------------------------
B2AEL9_PODAN/77-201--------------------------------------------------------------------------------
D2AQS0_STRRD/47-167--------------------------------------------------------------------------------
A6Q4Y9_NITSB/42-158--------------------------------------------------------------------------------
Q7UHC5_RHOBA/51-170--------------------------------------------------------------------------------
Q4Y1E6_PLACH/56-170--------------------------------------------------------------------------------
Q2W7V5_MAGSA/46-162--------------------------------------------------------------------------------
C5ZWC6_9HELI/53-161--------------------------------------------------------------------------------
Q7VEF5_PROMA/50-177--------------------------------------------------------------------------------
Q46Q66_CUPPJ/58-178--------------------------------------------------------------------------------
D3D0N6_9ACTO/47-163--------------------------------------------------------------------------------
ASNS_MIMIV/58-170--------------------------------------------------------------------------------
Q8KY35_STRCU/48-171--------------------------------------------------------------------------------
C3XLB4_9HELI/53-164--------------------------------------------------------------------------------
C4XQN6_DESMR/45-165--------------------------------------------------------------------------------
A3T3D5_9RHOB/31-153--------------------------------------------------------------------------------
A4YE70_METS5/78-205--------------------------------------------------------------------------------
Q1VVM8_9FLAO/52-161--------------------------------------------------------------------------------
A2R076_ASPNC/60-179--------------------------------------------------------------------------------
B8NXQ8_ASPFN/55-174--------------------------------------------------------------------------------
Q2W001_MAGSA/34-147--------------------------------------------------------------------------------
D1ALZ0_SEBTE/51-164--------------------------------------------------------------------------------
A8ZZB3_DESOH/53-170--------------------------------------------------------------------------------
Q1NS49_9DELT/43-160--------------------------------------------------------------------------------
A0RRB3_CAMFF/41-154--------------------------------------------------------------------------------
Q11NT7_CYTH3/50-168--------------------------------------------------------------------------------
Q2U6M1_ASPOR/59-178--------------------------------------------------------------------------------
Q8KSW7_9ACTO/48-172--------------------------------------------------------------------------------
D0DVH8_LACFE/51-164--------------------------------------------------------------------------------
O26514_METTH/65-169--------------------------------------------------------------------------------
Q7M7N7_WOLSU/41-156--------------------------------------------------------------------------------
A5FV61_ACICJ/47-161--------------------------------------------------------------------------------
Q0CLR1_ASPTN/62-174--------------------------------------------------------------------------------
B6HLP8_PENCW/58-177--------------------------------------------------------------------------------
B7V387_PSEA8/41-153--------------------------------------------------------------------------------
B1YDA4_THENV/121-259--------------------------------------------------------------------------------
D4C7W3_9CLOT/47-159--------------------------------------------------------------------------------
B0TYV0_FRAP2/51-161--------------------------------------------------------------------------------
C7RIV9_ACCPU/97-224--------------------------------------------------------------------------------
C1E3Q0_MICSR/60-172--------------------------------------------------------------------------------
Q2L1U1_BORA1/88-215--------------------------------------------------------------------------------
D1Z1D8_METPS/43-149--------------------------------------------------------------------------------
A1ZFN5_9BACT/52-169--------------------------------------------------------------------------------
B4RF38_PHEZH/47-166--------------------------------------------------------------------------------
C9PF78_VIBFU/43-158--------------------------------------------------------------------------------
Q0BQM1_GRABC/48-163--------------------------------------------------------------------------------
A8EQV6_ARCB4/41-156--------------------------------------------------------------------------------
A8G661_PROM2/51-168--------------------------------------------------------------------------------
Q5FPJ6_GLUOX/47-164--------------------------------------------------------------------------------
B4SIH4_STRM5/50-164--------------------------------------------------------------------------------
A1ZXW4_9BACT/46-164--------------------------------------------------------------------------------
Q313Y7_DESDG/87-214--------------------------------------------------------------------------------
B7RW46_9GAMM/47-167--------------------------------------------------------------------------------
A8ME82_CALMQ/83-211--------------------------------------------------------------------------------
Q8KRY7_PSESX/56-177--------------------------------------------------------------------------------
C7JBX0_ACEP3/48-163--------------------------------------------------------------------------------
C5K3E6_AJEDS/64-193--------------------------------------------------------------------------------
D1A6E6_THECD/109-235--------------------------------------------------------------------------------
A3WF90_9SPHN/49-165--------------------------------------------------------------------------------
B9P358_PROMR/59-169--------------------------------------------------------------------------------
D1P7K2_9ENTR/45-159--------------------------------------------------------------------------------
Q1V7N1_VIBAL/45-159--------------------------------------------------------------------------------
Q8H9W0_9CAUD/81-197--------------------------------------------------------------------------------
D0MHA3_RHOM4/51-167--------------------------------------------------------------------------------
B2A1P6_NATTJ/45-164--------------------------------------------------------------------------------
D1CB97_THET1/45-164--------------------------------------------------------------------------------
A5GA44_GEOUR/54-181--------------------------------------------------------------------------------
D1CIY9_THET1/47-165--------------------------------------------------------------------------------
Q2RW74_RHORT/56-169--------------------------------------------------------------------------------

PF00310

GLT1_ORYSJ/100-477.....S..............EADFEQQLYILRR.LSIL......S-----------------------------------
GLTB2_ARATH/108-480....DK..............VDDVERELYICRK.LIER......A-----------------------------------
GLUT1_ARATH/117-494.....S..............KADFEQQMYILRR.VSMV......A-----------------------------------
GLTA_BACSU/22-388....L.K............DNLSFERKLYVIRK.QAEN......W-----------------------------------
PUR1_BACSU/12-206...........................LTAHKG.QGLI......T-----------------------------------
GFPT1_HUMAN/2-215..........................KVKALDE.EVHK......Q-----------------------------------
GLMS_ECOLI/2-194..........................HMTRLRR.LGKV......Q-----------------------------------
ASNS_CRIGR/2-161...GY.TN.........CCFG..FHRLAVVDPL.FGMQ......P-----------------------------------
GFA1_YEAST/2-209..........................DSTFIYK.QIGKVSALKEE-----------------------------------
GFA1_SCHPO/2-205..................................KLEA......S-----------------------------------
ASNB_ECOLI/2-162.............................AHER.LSIV......D-----------------------------------
PUR1_SHIFL/2-211...........................CFRLRKANGLV......S-----------------------------------
GLMS_HAEIN/2-194.........................NELQRIRC.LGKV......K-----------------------------------
PUR1_HAEIN/2-210...........................RFRLRKANGLV......S-----------------------------------
NODM_RHILV/2-193..............................HRR.RAEG......K-----------------------------------
ASNS1_PEA/2-161............................YLAHQ.RLAI......V-----------------------------------
GLMS_BACSU/2-193..........................HVFKEKG.RIAD......L-----------------------------------
GLT1_YEAST/54-428...KQ.PE..........FNETKFRTQLYLLRK.EASL......Q-----------------------------------
PUR1_YEAST/2-214..........................RIYQCKG.NGMA......R-----------------------------------
Q9R6W7_NOSS1/35-403....................GDALERQLFIARK.RLIQ......S-----------------------------------
O08339_RHOSH/34-404......I............DDEQFERELYIIRR.RIEK......A-----------------------------------
Q98H51_RHILO/54-428....I.P............DDEEYEARLYLLRK.VISG......R-----------------------------------
Q9Z465_CORGT/16-380...................SGEDLDRVMFFIRK.RCER......E-----------------------------------
Q97IG8_CLOAB/23-393...................NQTDFERNLYIIRK.RAES......E-----------------------------------
GLT1_SCHPO/69-442...DG.EA.........EFDTDLFERQLYVLRK.QSSH......L-----------------------------------
GLTB_ANTSP/27-400...................IDYKLDKHLYLVRK.KIEK......L-----------------------------------
Q9VVA4_DROME/88-454......S............DEKAFERQVFVLRK.RASH......E-----------------------------------
Q9CPJ9_PASMU/2-216..........................RVFRDNQ.AAHS......S-----------------------------------
GLTB_CYACA/37-408...................QGRSLDFHLYRVRR.KIEK......E-----------------------------------
Q9KPY3_VIBCH/2-217..........................RTFKDPN.PSSQ......S-----------------------------------
Q9XDC9_CLOSA/21-385....T.K............KEKDFERKLYIVRR.NIEK......R-----------------------------------
Q9HUD5_PSEAE/15-378...................SDQDFAIKLFSARR.RSSV......A-----------------------------------
Q9CG24_LACLA/23-377....K.AV..........SEISNFENDLFIIRR.NLEK......R-----------------------------------
GLTB_AZOBR/37-405......V............SDEQFELDLYIIRR.RIEK......A-----------------------------------
Q9P540_NEUCS/54-436.GNEP.ETTD.....PEKFDERLFERQLYVLRK.RATH......T-----------------------------------
Q9JY00_NEIMB/2-216..........................RLFHDDK.PSVN......S-----------------------------------
Q9KPJ1_VIBCH/13-376......W............RERDVERRLYIARR.RIEK......Q-----------------------------------
PUR1_SCHPO/2-213..........................RLYQCKG.SGMV......A-----------------------------------
GLTB_SYNY3/43-413....L.T............DDLDFERKLYVIRK.LTHG......A-----------------------------------
Q51579_PLEBO/39-409....................DEELERKLYVARK.RIHR......T-----------------------------------
O67512_AQUAE/8-365...................PEEERELRLFFARR.KIEK......K-----------------------------------
Q9I437_PSEAE/2-215..........................RLFQDPL.ASVD......S-----------------------------------
GLTS_SYNY3/37-404......C............AGDELDRRLYIARS.IIGK......K-----------------------------------
Q9S2Y9_STRCO/20-378...................RGIALDRHAFALRK.RAER......E-----------------------------------
Q9RXX2_DEIRA/53-426....T.L............VPDALERKLYVIRR.RASN......A-----------------------------------
PUR1_CHICK/12-236........................SQAFKVHKG.MGLI......N-----------------------------------
Q9KC46_BACHD/22-392....V.K............AGLDFERKLYVIRK.RAEN......E-----------------------------------
Q9RNZ7_ZYMMB/34-404....D.E...........MSAWNFEKNLYLIRR.RIEK......K-----------------------------------
Q9PA10_XYLFA/24-386......H............SEDAFGVALFLARR.RAER......Q-----------------------------------
Q9A2F8_CAUCR/30-396......L............EGEALERALFLCRK.RIEK......R-----------------------------------
Q9KPJ4_VIBCH/37-409....M.Q............PD.ELERKLYVLRN.YTVR......V-----------------------------------
GLTB_PORPU/34-404...................SKNELEQQLFLVRK.KIER......Y-----------------------------------
Q51583_PLEBO/24-394....L.A............DDLAFERKLYVIRK.RSHS......A-----------------------------------
Q9CDD5_MYCLE/18-389....................GLTLERRAYVIRK.RAEH......E-----------------------------------
D8BYX0_ECOLX/43-406......W............RPRDMERRLFIARR.RIEK......R-----------------------------------
O61143_PLAFA/21-537IYPFSDINFTDDSNLKLNELPDDIELLSFFIRK.KLVR......H-----------------------------------
Q99WD1_STAAM/20-380....................IEDVEKRLFLARK.QLEF......Y-----------------------------------

PF12481

A8IXL5_BRACM/2-226--------------------------------------------------------------------------------
A9PEF3_POPTR/2-226--------------------------------------------------------------------------------
Q3HRW3_SOLTU/2-241--------------------------------------------------------------------------------
Q2RAK8_ORYSJ/2-226--------------------------------------------------------------------------------
A9NKZ6_PICSI/2-228--------------------------------------------------------------------------------
A9NXH4_PICSI/2-226--------------------------------------------------------------------------------
A9TLC6_PHYPA/2-227--------------------------------------------------------------------------------
A9NP52_PICSI/2-226--------------------------------------------------------------------------------
B7FHM6_MEDTR/2-224--------------------------------------------------------------------------------
C6T2Q6_SOYBN/2-226--------------------------------------------------------------------------------
B9HUQ8_POPTR/2-227--------------------------------------------------------------------------------
A5AXQ8_VITVI/2-226--------------------------------------------------------------------------------
Q9LIL3_ARATH/2-226--------------------------------------------------------------------------------
A2XLW7_ORYSI/2-228--------------------------------------------------------------------------------
B3TM05_ELAGV/2-228--------------------------------------------------------------------------------
Q6F390_ORYSJ/2-226--------------------------------------------------------------------------------
Q9FG81_ARATH/2-227--------------------------------------------------------------------------------
A8IXL3_BRACM/2-239--------------------------------------------------------------------------------
A5BPK4_VITVI/2-230--------------------------------------------------------------------------------
Q9FYX7_SOYBN/2-232--------------------------------------------------------------------------------
A9PBW3_POPTR/2-230--------------------------------------------------------------------------------
Q9LE80_ARATH/2-229--------------------------------------------------------------------------------
C6T9Q0_SOYBN/2-229--------------------------------------------------------------------------------
A9PK29_9ROSI/2-230--------------------------------------------------------------------------------
A6YGE8_CARPA/2-230--------------------------------------------------------------------------------
B8YIB1_MIRJA/2-231--------------------------------------------------------------------------------
Q40127_SOLLC/2-272--------------------------------------------------------------------------------
A2XZ07_ORYSI/2-231--------------------------------------------------------------------------------
Q43378_ASPOF/2-233--------------------------------------------------------------------------------
Q05FE8_ELAGV/2-228--------------------------------------------------------------------------------
B8LRD8_PICSI/3-230--------------------------------------------------------------------------------
Q307Z6_SOLTU/2-223--------------------------------------------------------------------------------
A9NZE6_PICSI/2-230--------------------------------------------------------------------------------

PF13230

A4JBJ9_BURVG/1-273--------------------------------------------------------------------------------
B3CXI0_BURM1/1-273--------------------------------------------------------------------------------
A1V0D8_BURMS/1-273--------------------------------------------------------------------------------
B2UFJ6_RALPJ/1-272--------------------------------------------------------------------------------
Q0A7W5_ALHEH/1-270--------------------------------------------------------------------------------
Q3A260_PELCD/1-273--------------------------------------------------------------------------------
B0V907_ACIBY/1-271--------------------------------------------------------------------------------
B2SYL4_BURPP/1-273--------------------------------------------------------------------------------
Q1BZ50_BURCA/1-273--------------------------------------------------------------------------------
A9LB76_BURML/1-273--------------------------------------------------------------------------------
C9YH78_9BURK/11-284--------------------------------------------------------------------------------
B0VTE1_ACIBS/1-271--------------------------------------------------------------------------------
C9YDF1_9BURK/1-277--------------------------------------------------------------------------------
Q2SZ73_BURTA/24-296--------------------------------------------------------------------------------
A3MPF1_BURM7/1-273--------------------------------------------------------------------------------
Q6FDQ6_ACIAD/4-274--------------------------------------------------------------------------------
C4KV44_BURPE/13-285--------------------------------------------------------------------------------
B9C0I0_9BURK/25-297--------------------------------------------------------------------------------
C6TY74_BURPE/1-273--------------------------------------------------------------------------------
Q2NG26_METST/1-246--------------------------------------------------------------------------------
Q13UA7_BURXL/1-273--------------------------------------------------------------------------------
A0K4K0_BURCH/1-273--------------------------------------------------------------------------------
A2WCM9_9BURK/1-273--------------------------------------------------------------------------------
Q475U0_CUPPJ/1-272--------------------------------------------------------------------------------
B4AR53_FRANO/2-279--------------------------------------------------------------------------------
C6RPJ8_ACIRA/1-271--------------------------------------------------------------------------------
D0LFZ1_HALO1/1-274--------------------------------------------------------------------------------
B1M0S3_METRJ/1-260--------------------------------------------------------------------------------
B2AH51_CUPTR/1-272--------------------------------------------------------------------------------
C6BC48_RALP1/1-272--------------------------------------------------------------------------------
D0C9S1_ACIBA/1-271--------------------------------------------------------------------------------
A7JMK2_FRANO/2-279--------------------------------------------------------------------------------
A7YT79_FRATU/2-279--------------------------------------------------------------------------------
B9BD23_9BURK/25-297--------------------------------------------------------------------------------
A9VWD5_METEP/29-300--------------------------------------------------------------------------------
A3NDH4_BURP6/1-273--------------------------------------------------------------------------------
A0Q741_FRATN/2-279--------------------------------------------------------------------------------
C4GG62_9NEIS/1-273--------------------------------------------------------------------------------
D5WD47_BURSC/1-273--------------------------------------------------------------------------------
Q63QV9_BURPS/1-273--------------------------------------------------------------------------------
A2S5G7_BURM9/1-273--------------------------------------------------------------------------------
B5S8H8_RALSL/13-284--------------------------------------------------------------------------------
C7CMW0_METED/1-272--------------------------------------------------------------------------------
B2HV32_ACIBC/1-271--------------------------------------------------------------------------------
Q1LRD7_RALME/1-272--------------------------------------------------------------------------------
B7KSM2_METC4/1-272--------------------------------------------------------------------------------
C5AB16_BURGB/1-273--------------------------------------------------------------------------------
Q0BI95_BURCM/1-273--------------------------------------------------------------------------------
B5SG66_RALSL/13-284--------------------------------------------------------------------------------
D0C3B3_9GAMM/1-271--------------------------------------------------------------------------------
Q0KEE5_CUPNH/1-272--------------------------------------------------------------------------------
D0SU94_ACILW/1-271--------------------------------------------------------------------------------
C5ASQ1_METEA/1-272--------------------------------------------------------------------------------
A9ER87_SORC5/1-279--------------------------------------------------------------------------------
B1N200_BURPE/1-273--------------------------------------------------------------------------------
A8KUB1_BURPE/1-273--------------------------------------------------------------------------------
B2JGV6_BURP8/1-272--------------------------------------------------------------------------------
A7JIF8_FRANO/2-279--------------------------------------------------------------------------------
A5J900_BURML/13-285--------------------------------------------------------------------------------
A7NBB7_FRATF/2-279--------------------------------------------------------------------------------
Q47AN0_DECAR/1-267--------------------------------------------------------------------------------
A3RRN4_RALSL/13-284--------------------------------------------------------------------------------
B1FF86_9BURK/25-297--------------------------------------------------------------------------------
B9CJ55_9BURK/25-297--------------------------------------------------------------------------------
D0WIN3_9ACTN/1-249--------------------------------------------------------------------------------
A5XUZ1_BURML/13-285--------------------------------------------------------------------------------
A4IYM1_FRATW/2-279--------------------------------------------------------------------------------
C5N7G0_BURML/13-285--------------------------------------------------------------------------------
C0VJ77_9GAMM/1-271--------------------------------------------------------------------------------
Q5P4D2_AROAE/1-272--------------------------------------------------------------------------------
D0T4E4_ACIRA/1-271--------------------------------------------------------------------------------
Q8Y251_RALSO/1-272--------------------------------------------------------------------------------
B0TY56_FRAP2/2-277--------------------------------------------------------------------------------
Q3JNQ6_BURP1/13-285--------------------------------------------------------------------------------
D3E130_METRM/1-248--------------------------------------------------------------------------------
A3M328_ACIBT/1-271--------------------------------------------------------------------------------
D0S0M3_ACICA/1-271--------------------------------------------------------------------------------
C4ANW9_BURML/13-285--------------------------------------------------------------------------------
A2VSW5_9BURK/1-273--------------------------------------------------------------------------------
C6YWP7_9GAMM/2-277--------------------------------------------------------------------------------
D0S8W3_ACIJO/1-271--------------------------------------------------------------------------------
Q62H44_BURMA/1-273--------------------------------------------------------------------------------
A4KQS8_FRATU/2-279--------------------------------------------------------------------------------
B7CLH7_BURPE/13-285--------------------------------------------------------------------------------
B2H0I4_BURPE/1-273--------------------------------------------------------------------------------
A9G0L9_SORC5/1-275--------------------------------------------------------------------------------
A8EIA4_BURPE/1-273--------------------------------------------------------------------------------
D3S2D4_FERPA/1-270--------------------------------------------------------------------------------
C4ZMI2_THASP/1-272--------------------------------------------------------------------------------
Q39JK4_BURS3/1-273--------------------------------------------------------------------------------
A1K1T1_AZOSB/1-272--------------------------------------------------------------------------------
Q220N7_RHOFD/1-283--------------------------------------------------------------------------------
A4MF24_BURPE/13-285--------------------------------------------------------------------------------
C8PUW8_9GAMM/1-285--------------------------------------------------------------------------------
D0SKG0_ACIJU/1-271--------------------------------------------------------------------------------
A9AH86_BURM1/25-297--------------------------------------------------------------------------------
A3NZ85_BURP0/1-273--------------------------------------------------------------------------------

PF09147

Q8KM13_PHOLM/3-201--------------------------------------------------------------------------------
Q9XB61_ERWCA/3-203--------------------------------------------------------------------------------
Q2NVG4_SODGM/4-196--------------------------------------------------------------------------------

PF00227

PSB2_CRYNJ/1-184--------------------------------------------------------------------------------
PSB_HALSA/45-226--------------------------------------------------------------------------------
PSA1_HALVD/33-217--------------------------------------------------------------------------------
PSB3A_ARATH/5-189--------------------------------------------------------------------------------
PSB6_DICDI/11-193--------------------------------------------------------------------------------
PSA3_DICDI/31-216--------------------------------------------------------------------------------
PSB4_MOUSE/50-237--------------------------------------------------------------------------------
PSB2_AERPE/22-203--------------------------------------------------------------------------------
PSA3_MOUSE/31-217--------------------------------------------------------------------------------
PSA2_CARAU/29-213--------------------------------------------------------------------------------
PSB2_ORYSJ/1-182--------------------------------------------------------------------------------
PSA3_CAEEL/31-216--------------------------------------------------------------------------------
PSB1_AERPE/2-185--------------------------------------------------------------------------------
Q8SSI0_ENCCU/6-190--------------------------------------------------------------------------------
HSLV_THEMA/2-176--------------------------------------------------------------------------------
PSB4_ARATH/28-213--------------------------------------------------------------------------------
O96780_TRYBR/26-207--------------------------------------------------------------------------------
PSA3_ENCCU/26-211--------------------------------------------------------------------------------
PSB3_GIAIN/6-191--------------------------------------------------------------------------------
Q98S57_GUITH/22-204--------------------------------------------------------------------------------
Q9VK14_DROME/29-214--------------------------------------------------------------------------------
HSLV_RICPR/6-181--------------------------------------------------------------------------------
Q8UUL9_ORYLA/13-196--------------------------------------------------------------------------------
PSB7_SCHPO/32-213--------------------------------------------------------------------------------
O12994_ORYLA/18-200--------------------------------------------------------------------------------
PSA_MYCS2/24-210--------------------------------------------------------------------------------
PSA5_CAEEL/31-219--------------------------------------------------------------------------------
PSA_AERPE/35-220--------------------------------------------------------------------------------
PSB_ARCFU/8-191--------------------------------------------------------------------------------
PSB6_SCHPO/21-203--------------------------------------------------------------------------------
Q98RW3_GUITH/25-209--------------------------------------------------------------------------------
PSA_METTH/32-216--------------------------------------------------------------------------------
PSA_SULSO/33-219--------------------------------------------------------------------------------
Q9AW13_GUITH/5-185--------------------------------------------------------------------------------
PSA1_DROME/29-216--------------------------------------------------------------------------------
PSA4_DICDI/28-217--------------------------------------------------------------------------------
PSA6_YEAST/40-228--------------------------------------------------------------------------------
PSA_METAC/30-214--------------------------------------------------------------------------------
PSB_STRCO/50-238--------------------------------------------------------------------------------
O18314_CIOIN/37-218--------------------------------------------------------------------------------
PSA6_CAEEL/35-220--------------------------------------------------------------------------------
Q9NDA3_9TRYP/29-214--------------------------------------------------------------------------------
PSA4_ENCCU/27-206--------------------------------------------------------------------------------
PSA71_DROVI/28-211--------------------------------------------------------------------------------
PSB_HALVD/46-226--------------------------------------------------------------------------------
PSA5A_ARATH/31-218--------------------------------------------------------------------------------
Q9W470_DROME/45-226--------------------------------------------------------------------------------
PSB3_DROME/6-190--------------------------------------------------------------------------------
PSA7_CAEEL/27-212--------------------------------------------------------------------------------
PSA_PYRAE/32-215--------------------------------------------------------------------------------
PSB5_SCHPO/58-240--------------------------------------------------------------------------------
HSLV_XYLFT/4-178--------------------------------------------------------------------------------
Q8T8V8_DROME/68-250--------------------------------------------------------------------------------
Q8UVV0_HETFR/67-249--------------------------------------------------------------------------------
HSLV_THETN/1-176--------------------------------------------------------------------------------
Q8SR95_ENCCU/28-203--------------------------------------------------------------------------------
PSB_METAC/6-189--------------------------------------------------------------------------------
O62102_CAEEL/43-224--------------------------------------------------------------------------------
PSA1B_ARATH/29-214--------------------------------------------------------------------------------
PSB1_SULTO/2-183--------------------------------------------------------------------------------
PSA1_DICDI/29-216--------------------------------------------------------------------------------
Q98S31_GUITH/31-212--------------------------------------------------------------------------------
PSB1_PYRFU/3-185--------------------------------------------------------------------------------
PSB1_YEAST/26-210--------------------------------------------------------------------------------
PSA4_CAEEL/28-213--------------------------------------------------------------------------------
PSB4_DROME/54-242--------------------------------------------------------------------------------
PSB3_CAEEL/5-189--------------------------------------------------------------------------------
PSA_METJA/32-215--------------------------------------------------------------------------------
PSA3_DROME/31-216--------------------------------------------------------------------------------
PSB1_PYRAE/1-181--------------------------------------------------------------------------------
HSLV_LISMO/2-179--------------------------------------------------------------------------------
PSA1_TRYBR/29-216--------------------------------------------------------------------------------
PSA7_CHICK/26-211--------------------------------------------------------------------------------
PSB_METKA/7-191--------------------------------------------------------------------------------
Q966I8_CAEEL/20-202--------------------------------------------------------------------------------
Q98RR2_GUITH/8-190--------------------------------------------------------------------------------
PSA6_SCHPO/30-219--------------------------------------------------------------------------------
PSA1_TRYCR/29-216--------------------------------------------------------------------------------
PSA6_DROME/35-218--------------------------------------------------------------------------------
Q8UVV5_HETFR/15-196--------------------------------------------------------------------------------
PSA2_NEUCR/28-213--------------------------------------------------------------------------------
Q8T915_DROME/46-228--------------------------------------------------------------------------------
PSA_SULTO/33-220--------------------------------------------------------------------------------
PSA72_DROME/28-213--------------------------------------------------------------------------------
PSB1_SULSO/2-183--------------------------------------------------------------------------------
PSB3_ONCMY/5-190--------------------------------------------------------------------------------
PSA7_DICDI/29-211--------------------------------------------------------------------------------
PSB2_PYRAE/5-187--------------------------------------------------------------------------------
PSA3_ARATH/31-216--------------------------------------------------------------------------------
HSLV_CHLTE/8-181--------------------------------------------------------------------------------
Q9NJV7_CRYPV/10-192--------------------------------------------------------------------------------
PSA4_DROME/28-219--------------------------------------------------------------------------------
PSA_HALSA/33-217--------------------------------------------------------------------------------
PSA7_SCHPO/27-211--------------------------------------------------------------------------------
Q9RAW7_9ACTO/49-237--------------------------------------------------------------------------------
PSB2_SULSO/11-192--------------------------------------------------------------------------------
PSB5_CHICK/52-234--------------------------------------------------------------------------------
Q8T759_BRAFL/68-250--------------------------------------------------------------------------------
Q9BMX8_9TRYP/1-187--------------------------------------------------------------------------------
PSA_THEAC/31-212--------------------------------------------------------------------------------
Q9AW25_GUITH/1-182--------------------------------------------------------------------------------
PSB6_ARATH/9-191--------------------------------------------------------------------------------
Q9GRG9_9TRYP/103-285--------------------------------------------------------------------------------
PSA_METKA/33-217--------------------------------------------------------------------------------
PSB2_ENCCU/1-181--------------------------------------------------------------------------------
PSA4_YEAST/29-216--------------------------------------------------------------------------------
PSA6_TOBAC/32-220--------------------------------------------------------------------------------
Q90ZQ5_ONCMY/42-229--------------------------------------------------------------------------------
PSB2_DROME/3-185--------------------------------------------------------------------------------
Q98S25_GUITH/3-186--------------------------------------------------------------------------------
PSA3_ACACA/29-214--------------------------------------------------------------------------------
PSB7_ENCCU/3-183--------------------------------------------------------------------------------
PSA2_DROME/29-213--------------------------------------------------------------------------------
HSLV_CAMJE/1-176--------------------------------------------------------------------------------
O12993_ORYLA/11-192--------------------------------------------------------------------------------
O77396_PLAF7/31-221--------------------------------------------------------------------------------
PSB1_MOUSE/33-212--------------------------------------------------------------------------------
PSB2_YEAST/1-184--------------------------------------------------------------------------------
PSA2_SCHPO/28-213--------------------------------------------------------------------------------
PSA2_YEAST/28-214--------------------------------------------------------------------------------
Q8UUL8_ORYLA/38-219--------------------------------------------------------------------------------
HSLV_STAAW/5-181--------------------------------------------------------------------------------
PSA4_SCHPO/28-215--------------------------------------------------------------------------------
PSA7L_MOUSE/28-213--------------------------------------------------------------------------------
PSB7_YEAST/26-207--------------------------------------------------------------------------------
PSA1_CAEEL/29-215--------------------------------------------------------------------------------
PSA1_RHOER/24-209--------------------------------------------------------------------------------
PSA1_SCHPO/29-215--------------------------------------------------------------------------------
PSA1_ENCCU/38-223--------------------------------------------------------------------------------
Q8SR59_ENCCU/27-210--------------------------------------------------------------------------------
PSB2_NEUCR/2-184--------------------------------------------------------------------------------
PSB6_ENCCU/7-186--------------------------------------------------------------------------------
PSB2A_ARATH/1-182--------------------------------------------------------------------------------
PSA1_CHICK/28-214--------------------------------------------------------------------------------
O12992_LAMJA/28-210--------------------------------------------------------------------------------
PSB5_YEAST/72-255--------------------------------------------------------------------------------
PSB3_YEAST/7-190--------------------------------------------------------------------------------
PSB2_PYRFU/7-188--------------------------------------------------------------------------------
O12999_XENLA/13-194--------------------------------------------------------------------------------
Q8UVY0_PAROL/68-248--------------------------------------------------------------------------------
PSB9_MUSMB/17-198--------------------------------------------------------------------------------
PSA7_TRYBB/26-209--------------------------------------------------------------------------------
PSB3_SCHPO/5-189--------------------------------------------------------------------------------
PSA7_YEAST/27-215--------------------------------------------------------------------------------
PSA1_ORYSJ/29-214--------------------------------------------------------------------------------
PSB_THEAC/5-186--------------------------------------------------------------------------------
Q9PUS1_DANRE/38-219--------------------------------------------------------------------------------
Q8SR88_ENCCU/28-210--------------------------------------------------------------------------------
Q9XG34_GUITH/25-205--------------------------------------------------------------------------------
PSA73_DROME/28-214--------------------------------------------------------------------------------
PSA3_SCHPO/30-215--------------------------------------------------------------------------------
Q94II8_ORYSJ/46-234--------------------------------------------------------------------------------
PSA_ARCFU/31-214--------------------------------------------------------------------------------
PSA2_CAEEL/28-211--------------------------------------------------------------------------------
PSA_PYRFU/33-215--------------------------------------------------------------------------------
PSA2_HALVD/32-215--------------------------------------------------------------------------------
PSB2_SCHPO/1-184--------------------------------------------------------------------------------
PSA2_TRYBB/27-211--------------------------------------------------------------------------------
PSB6_YEAST/16-197--------------------------------------------------------------------------------
PSA_MYCTU/26-206--------------------------------------------------------------------------------
Q8T8U1_DROME/1-183--------------------------------------------------------------------------------
PSB2_SULTO/10-191--------------------------------------------------------------------------------
Q9N9W9_GIAIN/29-210--------------------------------------------------------------------------------
PSB_METJA/3-187--------------------------------------------------------------------------------
Q9VJJ0_DROME/1-183--------------------------------------------------------------------------------
PSB_METTH/6-188--------------------------------------------------------------------------------
O76468_CRYPV/29-215--------------------------------------------------------------------------------
Q9LST5_ORYSJ/57-239--------------------------------------------------------------------------------
PSB3_TRYBB/6-190--------------------------------------------------------------------------------
HSLV_RALSO/3-177--------------------------------------------------------------------------------
PSB2_CAEEL/1-186--------------------------------------------------------------------------------
CLPQ_BACSU/3-180--------------------------------------------------------------------------------
HSLV_AQUAE/2-176--------------------------------------------------------------------------------
HSLV_BORBU/2-179--------------------------------------------------------------------------------

PF01112

ASPG_HUMAN/8-335--------------------.LPLVVNTWP---------...FKN-----------------------------------
ASPG_ELIMR/24-340--------------------NKPIVLSTWN---------..FGLH-----------------------------------
ASGX_SYNY3/1-309--------------------.KGGLATVRQ---------S..LHQ-----------------------------------
IAAA_ECOLI/2-317--------------------QMSLQQELRY---------IEALSA-----------------------------------
ASPGA_ARATH/2-314--------------------.LPDERRIPR---------ESALRH-----------------------------------
ASPG_LUPAL/2-324--------------------.LPPERRKPR---------EEGLRH-----------------------------------
ASPG_CAEEL/7-348--------------------SLPMVITTWG---------SDGFKK-----------------------------------

PF01019

GGT7_HUMAN/154-655--------------------GVPGMVKGLHEAHQLYG..RLPWSQ-----------------------------------
GGT5_HUMAN/58-581--------------------GVPGELRGYAEAHRRHG..RLPWAQ-----------------------------------
PAC1_PSES3/39-540--------------------AVPGALKGWCEALARFG..TLPLAE-----------------------------------
GGT1_HUMAN/55-564--------------------AVPGEIRGYELAHQRHG..RLPWAR-----------------------------------
CAPD_BACAN/63-522--------------------GVPGFVAGMEYIHDNYG..SLPMGE-----------------------------------
Q9XTY7_CAEEL/52-571--------------------GTPGEIAGYWHIFKKFGSGKVTWKE-----------------------------------
Q9C2D7_NEUCS/45-598--------------------TVPGAAAGWVDTVERFGSGKLTMGQ-----------------------------------
Q9VWT3_DROME/55-566--------------------AVPGEILGYWEMHRRYG..ILPWKR-----------------------------------
Q9XZS5_DROME/54-560--------------------AVPAEIYGYSELHDKYG..RLPWKT-----------------------------------
GGT5_RAT/58-567--------------------GVPGELRGYAEAHRRYG..RLPWAQ-----------------------------------
Q9VXA5_DROME/259-772--------------------AVPGEVMGYHVAHQKFG..QLPWAE-----------------------------------
Q9VYR2_DROME/74-587--------------------AVPAELAGYAVAHQRFG..RLKWKD-----------------------------------
YWRD_BACSU/24-520--------------------TVPGMVDSWDAVLKEYG..RLSLAD-----------------------------------
Q987N3_RHILO/31-523--------------------TVPGAIDAWCRLLQDHG..SKDLAE-----------------------------------
P71828_MYCTU/21-507--------------------TVPGAVSAWVELHARFG..RLPFET-----------------------------------
Q9I6W8_PSEAE/37-533--------------------TVPGCPAAWGELSRRFG..KLPFEQ-----------------------------------
Q9KEI5_BACHD/38-534--------------------TVPGAPGAWAELAKMYG..NLPLAA-----------------------------------
Q9RU70_DEIRA/37-530--------------------TVPGAVRGWTDLHGRFG..RLDFAQ-----------------------------------
Q9R6V5_SYNE7/31-503--------------------TVPGAVSAWVALSDRWG..QLPFAQ-----------------------------------
Q54353_STRLN/27-595--------------------CVPGAFGGWLRLLAEFG..TLRLAD-----------------------------------
O54174_STRCO/42-600--------------------AVPGAVDSWLWLLAEFG..TWELAD-----------------------------------
Q9EYI3_STRNO/28-615--------------------AVPGAFDAWLLLLRDHG..TKPLDA-----------------------------------
Q97A97_THEVO/25-500--------------------TVPGLVDLWNSLYLEYA..TMRFSD-----------------------------------
Q9HJH4_THEAC/27-510--------------------TVPGIAGSWDEIFRKFA..TMDIAD-----------------------------------
Q97TX5_SULSO/22-473--------------------VVPGLVDLWEFIYENYA..SKSLHE-----------------------------------
Q9YFW3_AERPE/25-493--------------------TTPGYLAGLYHSWRSFG..TMEWAS-----------------------------------
Q9KM31_VIBCH/18-514--------------------TMAGTISGWQTALQLFSS.GISLST-----------------------------------
GGT_SYNY3/21-511--------------------AVPGMVAGLFAAHRKLG..QLPFKV-----------------------------------
P71750_MYCTU/94-636--------------------GVPGILRMLEMVHNEHG..RTPWRD-----------------------------------
Q9KVF2_VIBCH/67-583--------------------GTPGTVKLLWETHRQYG..KLEWAR-----------------------------------
GGT_BACSU/61-577--------------------GVPGTLKGLEEALDKWG..TRSMKQ-----------------------------------
Q9AAR5_CAUCR/64-579--------------------GVPGAVAMLAQAQKDHG..KVAWST-----------------------------------
O69935_STRCO/61-590--------------------GTPGTPATWQTALDRWG..SRKLAS-----------------------------------
Q99X13_STAAM/30-540--------------------AVPAIPKLFDYIHKRYA..KLSLED-----------------------------------
Q9A9J6_CAUCR/62-572--------------------TVPGTVAGLHLAHQKYG..RLPWKQ-----------------------------------
GGT_ECOLI/63-574--------------------GTPGTVAGFSLALDKYG..TMPLNK-----------------------------------
O25743_HELPY/52-566--------------------GVPGTVAGMEAMLKKYG..TKKLSQ-----------------------------------
GGT_PSEUA/49-569--------------------GVPGTVSGMEYAREKYG..TKTRQQ-----------------------------------
Q98B64_RHILO/52-573--------------------GVPGSVAGFEIAREKYG..TLSRQD-----------------------------------
Q9ABW6_CAUCR/71-577--------------------GVPGTVRGLAMAHQRFG..KLPWGQ-----------------------------------
GGT_PSEAE/44-550--------------------GVPGTVMGLWEAHKRFG..KLPWSE-----------------------------------
Q9I6D3_PSEAE/53-562--------------------AIPGLPAALVELSSRYG..RKPLAD-----------------------------------
Q9PEP4_XYLFA/53-572--------------------GIPGLPAALVELAEHYG..KLPLRQ-----------------------------------
ECM38_YEAST/123-654--------------------GVPGELMGLYRLFKERGSGQVDWRD-----------------------------------
GGT2_SCHPO/96-606--------------------AIPGELAGLYEAWKSHG..LLDWSK-----------------------------------
GGT1_SCHPO/114-625--------------------AVPGEIAGYERAWKMYG..SLPWHK-----------------------------------
Q9P6C7_NEUCS/50-580--------------------AIPSELRGLEYVHSKYG..RLPWHD-----------------------------------
O65652_ARATH/48-572--------------------GVPGEVAGLFTAWKQHG..KLPWKR-----------------------------------
Q9M0G0_ARATH/95-632--------------------GVPGEIAGLYEAWKRYG..RLPWKP-----------------------------------
O18256_CAEEL/87-600--------------------GIPGELHGLWTAYQKYGSKVIPWSD-----------------------------------
O97392_BRUMA/63-583--------------------ATPGEIAGYWLAFKRFGSGKISWYD-----------------------------------
Q9N5V4_CAEEL/118-635--------------------AVPGELHGLRTEFERFGSGKVEWRQ-----------------------------------

PF02275

YXEI_BACSU/2-316--------------------.............AFIG--.MGRKL-----------------------------------
ASAH1_HUMAN/143-394--------------------S..........FAGYVG--.MLTGF-----------------------------------
CBH_LACPL/2-312--------------------.............AIIG--.ITADV-----------------------------------
CBH_CLOPE/2-317--------------------.............AVLG--.MGTIF-----------------------------------
P72765_SYNY3/54-367--------------------PAQWTSKYGSVVTTVYG--.MGT..-----------------------------------
P97038_LACJH/2-316--------------------.............AVIG--.MGIVV-----------------------------------
PAC_LYSSH/4-320--------------------.............AFVG--.MGSTD-----------------------------------
ASAH1_MOUSE/142-393--------------------QRNNK..TVFKATSFVG--YVGMLT-----------------------------------

PF03417

Q99SW3_STAAM/102-313--------------------.......SGL---AQIG---P...V-----------------------------------
Q9W369_DROME/127-375--------------------GKYNVKEEHF---MSLC---Y...A-----------------------------------
Q7VXA7_BORPE/103-331--------------------.......PGY---ISFY---Y...P-----------------------------------
Q8ETF3_OCEIH/100-313--------------------.......KSF---ASAG---Y...S-----------------------------------
Q981H5_RHILO/99-326--------------------.......SGF---EFAT---V...A-----------------------------------
Q8CVA0_OCEIH/100-312--------------------.......TGL---TTIG---P...S-----------------------------------
Q8CUR6_OCEIH/102-312--------------------.......AGY---ATVG---P...T-----------------------------------
Q7QEK0_ANOGA/123-370--------------------GKHKVVEERF---TSLC---Y...A-----------------------------------
Q896G2_CLOTE/101-321--------------------......EGWF---TTYD---Y...F-----------------------------------
Q8TP46_METAC/185-453--------------------.......IGH---AFLT---Y...P-----------------------------------
Q8XYL6_RALSO/104-332--------------------.......PGF---AAFV---Y...P-----------------------------------
Q8RH78_FUSNN/95-316--------------------.......SNF---SFIG---N...T-----------------------------------
Q7NWB3_CHRVO/36-263--------------------.......HGY---AYLG---LYADN-----------------------------------
Q8CRS5_STAES/102-313--------------------.......GGL---SQIG---P...T-----------------------------------
Q92XD1_RHIME/155-360--------------------.......SGL---KVIA---K...A-----------------------------------
Q81DJ8_BACCR/98-334--------------------.......GAY---AHSG---F...S-----------------------------------
AAAA_EMENI/108-335--------------------.......PGL---PTIK---MITEA-----------------------------------
AAAA_PENCH/108-335--------------------.......AGL---PTIK---FITEA-----------------------------------

PF03577

PEPDA_STRPQ/2-403--------------------...DLPDNPMTYTSVPD--A....L-----------------------------------
PEPD_BIFLO/2-428--------------------...TLPDDPLQYTAVPN--A....D-----------------------------------
Q8E6I4_STRA3/2-403--------------------...DLPDNPLPYTSVPD--A....L-----------------------------------
Q93TK2_STRGN/25-448--------------------...PHAANEMKYTATYD--SARGDG-----------------------------------
Q93F45_EDWTA/24-429--------------------...SVPKKAFSYTSFSN--GKEGKQ-----------------------------------
Q8A7H5_BACTN/21-440--------------------...HYPAATYPKGTMLK--VYEWDT-----------------------------------
Q8G733_BIFLO/20-471--------------------...ELPDNPCRYTIAPN--V....L-----------------------------------
PEPDA_LACLA/2-401--------------------...DLPENPLSYTSTPD--A....D-----------------------------------
Q8Z7Q9_SALTI/19-417--------------------...PLPETAMRYTAIHD--F....D-----------------------------------
PEPDB_LACLA/10-410--------------------...DLPENPLRYTSTPN--A....V-----------------------------------
Q8DTN0_STRMU/3-404--------------------...DLPDNPLSYTSVPN--A....L-----------------------------------
PEPDA_LACHE/5-408--------------------DDEDLAETPLRYTSAPD--V....S-----------------------------------
PEPD_LACSK/9-407--------------------...PLPEEGYRYTSTPN--G....D-----------------------------------

PF01804

PAC2_PSES3/30-767PLPIEYGLLGAE........PEPWEPWHSIAVMRRLG--LLMGSV......................WFKLWRMLALP..
Q9I2K4_PSEAE/47-796ALPLEFSLVRHER.......PGPWGPVDSLSLHLLYS--WTLSANLGMQLQRLALAEHLDLARI.NEVFAPYPGERPP..
QUIP_PSEAE/54-838KLPMDLAQSGYR........PEYWKPEDSALVFALLN--FGLAVNLQEEIASLTLAQKVGSDKL.AWLTPTYPDENLP..
O86089_9PROT/45-712PDDISPDVRQVL........PVSGADVVAHAHR.LMN--FLYVAS...........................PGRTLG..
PAC_ARTVI/30-794KLSKEFHEYQFL........PQKWTSTDVVRVYMVSM--TYLWIITR.ELKNAEILAKLEHEYGTEVSRKMFDDLVWKND
O29763_ARCFU/48-774PLPMEFKLAGYK........PKEWTPVDSLLLGKEIS--WSLTGR.....FWDLERSFIVEKLG.EKALELYPDYLNH..
AAC_ACTUT/37-776HRLTDPACRGKAW.......VRPLSEIDLWRTSWDSM--VRAGSG....................ALLDGIVAATPPT..
Q9HKC5_THEAC/40-802LLPFEFNLLDYK........PGYWSPVDTFAVQEYMI--QTLEFS.DDSILYSLLSYKIGSLVN.DLITPFSPIPQFY..
PVDQ_PSEAE/31-755ADGKTTSCLGQPW.......LRAIATDDLLRLTRRLL--VEGGVG....................QFADALVAAAPPG..
Q97XS1_SULSO/56-827DLPLEFKLLNVR........PYYWSPDYSLAFGEYMG--WSLTSGFNDELKSALLYTYFNYSEI.NEINPYYPHFIDG..
Q9A9G3_CAUCR/35-682KHP.EKAKPGLL........PVTGKDVAAGFIFKQPF--FYGLDG...........................ELRRIT..
Q9AK68_STRCO/1-782PAP.EFARTGLA........PGRWDPWTPLGV.....--WLATHI.............L.........FAGFPAKLWR..
Q55592_SYNY3/35-700PDFSQPSLRQVL........PITAQDVVAHVQR.LLL--FEFVTN...........................PQAVAS..
Q979D7_THEVO/70-856KLPILFKILNYE........PHKWNVTDVLAVQQLFL--WENSAGGFDPVYFNIALEKMPESLI.KAIYPAYPAGIQHPI
Q9RYQ4_DEIRA/36-778PEQWPSACRNADW.......VRPLTELDVMRLGEEKA--IQASAG....................AMVSAITSARPPQ..
Q9HI83_THEAC/66-851KLPLLFKILNVE........PHRWNVTDVLAVQQLFL--WENSAGGLDPIYFNFALQKMPESVI.KAIYPAYPAGVQNPI
Q9S258_STRCO/103-886YFPGEYVLTGHKDAITNAGTIEHFKRSDLIALASVIG--SLFGAGGGGEVNNALSLLAAQEKYGVAEGTEVWESFRQRND
O34142_ALCFA/29-806LLPKEYVDFDFQ........PEPLTDFDVVMIWVGSM--ANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWIN.
Q9I6I6_PSEAE/41-787PAPLEFDLLGIP........RRPFTPEDTLSIAGYMA--YSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLT..
Q9A972_CAUCR/34-719.HPTVKPRVIQR........FEPWMALSFSEGSIGGD--IERVALT........................QLEAFYGK..
PAC_KLUCI/31-836LLPQQFSTFGFK........PKHWEPFDVAMIFVGTM--ANRFSDSTSEIDNLALLTAVKDKYGNDEGMAVFNQLKWLVN

PF04916

PLBL1_MOUSE/8-549--------------------YNDSIKTTGWGILEIRA--GYGSQV-----------------------------------
PLBL2_CAEEL/31-578--------------------WQNAVNTTGWTFLEVET--KE...N-----------------------------------
PLBL1_CAEEL/2-552--------------------FHDEVNQTGWAFLEVDV--ISP..K-----------------------------------
PLBL3_CAEEL/2-570--------------------YSNQVNTTGWGILEIET--FA...S-----------------------------------
PLBL_DROME/35-658--------------------YKDSVYENGWAQIEVET--QR...T-----------------------------------
O76517_TRYBR/6-615--------------------VSNTFNKTGWDVVTAVA--NDGFMH-----------------------------------

PF13522

Q319R2_PROM9/31-164----------------------------------------------------------------....Y...........
A2C1R3_PROM1/29-159----------------------------------------------------------------....N...........
A6H137_FLAPJ/32-161----------------------------------------------------------------....N...........
A1ZI98_9BACT/32-161----------------------------------------------------------------....N...........
D1B558_SULD5/28-151----------------------------------------------------------------....D...........
B6BGG4_9PROT/28-151----------------------------------------------------------------....N...........
Q15WL8_PSEA6/32-161----------------------------------------------------------------....Y...........
A1ZXW5_9BACT/31-157----------------------------------------------------------------....R...........
C6C0L2_DESAD/29-158----------------------------------------------------------------....S...........
B9UJ05_9ACTO/31-161----------------------------------------------------------------....R...........
D0LGD9_HALO1/33-165----------------------------------------------------------------....A...........
D2AY63_STRRD/33-164----------------------------------------------------------------....D...........
Q67SX7_SYMTH/33-163----------------------------------------------------------------....H...........
D1PMI4_9FIRM/34-164----------------------------------------------------------------....R...........
A8A8Q5_IGNH4/48-172----------------------------------------------------------------................
A3MVE4_PYRCJ/52-198----------------------------------------------------------------IPMGE...........
A2BKU3_HYPBU/86-222----------------------------------------------------------------....T...........
A8MDJ1_CALMQ/76-219----------------------------------------------------------------....G...........
C3MRQ6_SULIM/67-191----------------------------------------------------------------....I...........
C4RDQ3_9ACTO/71-217----------------------------------------------------------------....G...........
C1A341_RHOE4/69-214----------------------------------------------------------------....G...........
B1VRV8_STRGG/70-217----------------------------------------------------------------....T...........
A8L8S4_FRASN/71-216----------------------------------------------------------------....G...........
B1MFS0_MYCA9/68-197----------------------------------------------------------------....G...........
D1ACB4_THECD/68-206----------------------------------------------------------------....S...........
B8DT41_BIFA0/71-227----------------------------------------------------------------SVPVR...........
B4CXP1_9BACT/50-172----------------------------------------------------------------....E...........
D1A6E6_THECD/85-229----------------------------------------------------------------LPLLD...........
B1YDA4_THENV/101-253----------------------------------------------------------------....K...........
Q313Y7_DESDG/69-208----------------------------------------------------------------....T...........
A9J6W7_BPLUZ/64-191----------------------------------------------------------------....R...........
Q2L1U1_BORA1/78-209----------------------------------------------------------------................
C7RIV9_ACCPU/72-218----------------------------------------------------------------....S...........
A3SJ02_9RHOB/30-184----------------------------------------------------------------....DVQRADFEIRKL
D0LWC5_HALO1/57-200----------------------------------------------------------------................
C7P6F6_METFA/31-174----------------------------------------------------------------....EVVYFEDFKDVE
A6UTH5_META3/46-188----------------------------------------------------------------....EVIYFNDFNELK
Q67SU9_SYMTH/28-156----------------------------------------------------------------................
C0GFE8_9FIRM/28-153----------------------------------------------------------------....K...........
B6EHL2_ALISL/33-161----------------------------------------------------------------....K...........
A3WK96_9GAMM/33-166----------------------------------------------------------------....E...........
B8IIU0_METNO/27-152----------------------------------------------------------------....P...........
D4LAQ5_RUMC1/30-159----------------------------------------------------------------....D...........
A8AA00_IGNH4/31-161----------------------------------------------------------------....D...........
A1TKR9_ACIAC/32-162----------------------------------------------------------------....G...........
Q1MNZ8_LAWIP/32-161----------------------------------------------------------------....C...........
C7MBC0_BRAFD/30-167----------------------------------------------------------------....R...........
C6A089_THESM/27-158----------------------------------------------------------------....N...........
A1TKS1_ACIAC/32-165----------------------------------------------------------------....E...........
A8TMT0_9PROT/32-161----------------------------------------------------------------....S...........
A8M5J5_SALAI/32-161----------------------------------------------------------------....W...........
A5CX28_VESOH/32-161----------------------------------------------------------------....H...........
B8HUI9_CYAP4/34-167----------------------------------------------------------------....K...........
C7G790_9FIRM/29-159----------------------------------------------------------------....G...........
C5F126_9HELI/26-156----------------------------------------------------------------....V...........
E8WTP4_GEOS8/31-159----------------------------------------------------------------....H...........
Q92TY3_RHIME/30-158----------------------------------------------------------------....G...........
B8HND1_CYAP4/33-164----------------------------------------------------------------....C...........
C9YDI6_9BURK/28-159----------------------------------------------------------------....D...........
A4TWE4_9PROT/27-157----------------------------------------------------------------....G...........
Q7W1A1_BORPA/30-164----------------------------------------------------------------....D...........
A7BTD4_9GAMM/10-143----------------------------------------------------------------....G...........
B0RW09_XANCB/35-167----------------------------------------------------------------....G...........
Q988G2_RHILO/34-166----------------------------------------------------------------....G...........
A6DK48_9BACT/33-162----------------------------------------------------------------....H...........
Q2IZV2_RHOP2/32-164----------------------------------------------------------------....E...........
A4IWP6_FRATW/32-164----------------------------------------------------------------....Q...........

PF13537

Q5ASH6_EMENI/53-172--------------------------------------------------------------------------------
B9PWN3_TOXGO/71-193--------------------------------------------------------------------------------
Q2LTR9_SYNAS/73-199--------------------------------------------------------------------------------
Q2YZN6_9DELT/73-201--------------------------------------------------------------------------------
Q5LFT8_BACFN/74-198--------------------------------------------------------------------------------
D1PAI4_9BACT/75-199--------------------------------------------------------------------------------
C9RMT9_FIBSS/74-201--------------------------------------------------------------------------------
C1DTA6_SULAA/82-202--------------------------------------------------------------------------------
D1PIW6_9FIRM/46-166--------------------------------------------------------------------------------
C5F101_9HELI/91-211--------------------------------------------------------------------------------
C6E3Y8_GEOSM/48-168--------------------------------------------------------------------------------
A6DEM6_9PROT/51-165--------------------------------------------------------------------------------
A5Z6H5_9FIRM/45-164--------------------------------------------------------------------------------
A1VAB5_DESVV/59-173--------------------------------------------------------------------------------
D4M4V2_9FIRM/52-165--------------------------------------------------------------------------------
C5KCG7_PERM5/48-170--------------------------------------------------------------------------------
C0GG67_9FIRM/53-166--------------------------------------------------------------------------------
A1ASZ8_PELPD/48-167--------------------------------------------------------------------------------
C7MKT6_CRYCD/71-192--------------------------------------------------------------------------------
E8WTP4_GEOS8/46-165--------------------------------------------------------------------------------
Q09SM5_BORPP/47-168--------------------------------------------------------------------------------
B3KYI2_PHAVU/48-166--------------------------------------------------------------------------------
B8HND1_CYAP4/57-170--------------------------------------------------------------------------------
B7AUG5_9FIRM/44-164--------------------------------------------------------------------------------
D1N3I7_9BACT/47-166--------------------------------------------------------------------------------
A6H137_FLAPJ/47-167--------------------------------------------------------------------------------
D3T763_THEIA/48-169--------------------------------------------------------------------------------
Q0AZ18_SYNWW/47-167--------------------------------------------------------------------------------
A4BSJ7_9GAMM/48-168--------------------------------------------------------------------------------
Q1MNZ8_LAWIP/47-167--------------------------------------------------------------------------------
A9GJ27_SORC5/48-167--------------------------------------------------------------------------------
C6J0Z3_9BACL/48-167--------------------------------------------------------------------------------
A3CX83_METMJ/47-167--------------------------------------------------------------------------------
A8ESL9_ARCB4/53-166--------------------------------------------------------------------------------
D3EKK9_GEOS4/48-169--------------------------------------------------------------------------------
C7LP19_DESBD/84-205--------------------------------------------------------------------------------
B1WQP9_CYAA5/45-160--------------------------------------------------------------------------------
C2VRM4_BACCE/48-169--------------------------------------------------------------------------------
C4FEA3_9BIFI/47-166--------------------------------------------------------------------------------
C1DDD8_LARHH/51-168--------------------------------------------------------------------------------
Q07U44_RHOP5/47-166--------------------------------------------------------------------------------
A7NGM6_ROSCS/48-167--------------------------------------------------------------------------------
F2G8Q8_ALTMD/54-167--------------------------------------------------------------------------------
E8WQK3_GEOS8/47-167--------------------------------------------------------------------------------
C0ZGQ1_BREBN/48-169--------------------------------------------------------------------------------
B7KM32_CYAP7/57-169--------------------------------------------------------------------------------
Q65FV9_BACLD/50-169--------------------------------------------------------------------------------
D1PIW9_9FIRM/48-167--------------------------------------------------------------------------------
Q216T1_RHOPB/47-166--------------------------------------------------------------------------------
D3SEV0_THISK/48-168--------------------------------------------------------------------------------
A8AA00_IGNH4/55-167--------------------------------------------------------------------------------
D6Z0B3_DESAT/43-160--------------------------------------------------------------------------------
A6CE28_9PLAN/47-166--------------------------------------------------------------------------------
Q12VP2_METBU/43-162--------------------------------------------------------------------------------
C5A2K1_THEGJ/42-164--------------------------------------------------------------------------------
D5SUU8_PLAL2/54-173--------------------------------------------------------------------------------
C9BZ32_ENTFC/45-164--------------------------------------------------------------------------------
Q60BD5_METCA/46-165--------------------------------------------------------------------------------
B1HXB0_LYSSC/54-169--------------------------------------------------------------------------------
A7IB45_METB6/47-167--------------------------------------------------------------------------------
C7P6F6_METFA/66-180--------------------------------------------------------------------------------
D7VX33_9FLAO/60-173--------------------------------------------------------------------------------
B0N4I8_9FIRM/45-164--------------------------------------------------------------------------------
C5BIB9_TERTT/48-165--------------------------------------------------------------------------------
C0BH32_9BACT/48-167--------------------------------------------------------------------------------
C3KLT2_RHISN/70-189--------------------------------------------------------------------------------
D0U2E2_STRPT/48-167--------------------------------------------------------------------------------
Q3SM07_THIDA/48-168--------------------------------------------------------------------------------
A4E9B2_9ACTN/52-166--------------------------------------------------------------------------------
A1ZI98_9BACT/47-167--------------------------------------------------------------------------------
C7RT03_ACCPU/48-168--------------------------------------------------------------------------------
E6VZL8_DESAO/47-168--------------------------------------------------------------------------------
D4KMF4_9FIRM/44-165--------------------------------------------------------------------------------
A4XLL9_CALS8/48-169--------------------------------------------------------------------------------
O87986_BORBO/51-167--------------------------------------------------------------------------------
B8GV93_THISH/47-166--------------------------------------------------------------------------------
Q1N7B0_9SPHN/48-168--------------------------------------------------------------------------------
B9JNF8_AGRRK/48-167--------------------------------------------------------------------------------
B3QUX4_CHLT3/58-171--------------------------------------------------------------------------------
A1TKR9_ACIAC/49-168--------------------------------------------------------------------------------
A1WX67_HALHL/50-170--------------------------------------------------------------------------------
A1VHY0_DESVV/74-190--------------------------------------------------------------------------------
C8VWD2_DESAS/48-169--------------------------------------------------------------------------------
Q26BI0_FLABB/48-167--------------------------------------------------------------------------------
B0BZG4_ACAM1/47-167--------------------------------------------------------------------------------
A9B763_HERA2/45-164--------------------------------------------------------------------------------
A8RHM4_9CLOT/52-173--------------------------------------------------------------------------------
A3WBV5_9SPHN/48-168--------------------------------------------------------------------------------
A6C8F5_9PLAN/48-167--------------------------------------------------------------------------------
C9YDI6_9BURK/45-165--------------------------------------------------------------------------------
C9P5X6_VIBME/48-167--------------------------------------------------------------------------------
A9AVN7_HERA2/53-166--------------------------------------------------------------------------------
D9TR59_THETC/48-169--------------------------------------------------------------------------------
D5SQH7_PLAL2/59-173--------------------------------------------------------------------------------
Q15WL8_PSEA6/47-167--------------------------------------------------------------------------------
Q3SMN0_THIDA/47-165--------------------------------------------------------------------------------
B8JFB6_ANAD2/49-168--------------------------------------------------------------------------------
Q30XB0_DESDG/46-165--------------------------------------------------------------------------------
A4AWP2_MARSH/48-167--------------------------------------------------------------------------------
B8GVB9_THISH/48-167--------------------------------------------------------------------------------
Q30W35_DESDG/52-171--------------------------------------------------------------------------------
Q11EB5_MESSB/46-165--------------------------------------------------------------------------------
B8LMV0_PICSI/48-166--------------------------------------------------------------------------------
C0GFE8_9FIRM/43-159--------------------------------------------------------------------------------
Q09SL0_BORPP/51-171--------------------------------------------------------------------------------
D4L906_9FIRM/48-169--------------------------------------------------------------------------------
B6BY61_9GAMM/48-168--------------------------------------------------------------------------------
D7VXP6_9FLAO/48-166--------------------------------------------------------------------------------
Q89GP7_BRAJA/53-172--------------------------------------------------------------------------------
D2ELX2_PEDAC/45-164--------------------------------------------------------------------------------
Q31I32_THICR/47-165--------------------------------------------------------------------------------
B6FJ58_9CLOT/52-165--------------------------------------------------------------------------------
C6C0L2_DESAD/44-164--------------------------------------------------------------------------------
A0YEF5_9GAMM/47-166--------------------------------------------------------------------------------
A8FUC6_SHESH/48-167--------------------------------------------------------------------------------
B5CZ45_9BACE/48-167--------------------------------------------------------------------------------
D3PM21_MEIRD/68-181--------------------------------------------------------------------------------
B5EA88_GEOBB/47-168--------------------------------------------------------------------------------
Q81GN9_BACCR/48-169--------------------------------------------------------------------------------
C7PT80_CHIPD/48-167--------------------------------------------------------------------------------
A6UTH5_META3/82-194--------------------------------------------------------------------------------
A9W815_METEP/53-166--------------------------------------------------------------------------------
A1HQU4_9FIRM/48-169--------------------------------------------------------------------------------
Q67SX7_SYMTH/48-169--------------------------------------------------------------------------------
A0L574_MAGSM/48-168--------------------------------------------------------------------------------
Q67SU9_SYMTH/44-162--------------------------------------------------------------------------------
A6TWB0_ALKMQ/48-169--------------------------------------------------------------------------------
A3QHF6_SHELP/46-166--------------------------------------------------------------------------------
D1KBT8_9GAMM/47-167--------------------------------------------------------------------------------
D3RU48_ALLVD/48-168--------------------------------------------------------------------------------
Q21PG9_SACD2/57-171--------------------------------------------------------------------------------
C1ATQ5_RHOOB/48-169--------------------------------------------------------------------------------
A0LYW1_GRAFK/45-164--------------------------------------------------------------------------------
A4U2W9_9PROT/51-171--------------------------------------------------------------------------------
D4L5M3_9FIRM/57-164--------------------------------------------------------------------------------
B0TFK1_HELMI/48-169--------------------------------------------------------------------------------
B9YZR4_9NEIS/45-165--------------------------------------------------------------------------------
A4A561_9GAMM/25-145--------------------------------------------------------------------------------
Q9KCR1_BACHD/48-169--------------------------------------------------------------------------------
B7FT50_PHATC/57-178--------------------------------------------------------------------------------
E6TYW0_BACCJ/46-165--------------------------------------------------------------------------------
Q1GRU1_SPHAL/48-168--------------------------------------------------------------------------------
A1TKS1_ACIAC/51-171--------------------------------------------------------------------------------
A3XJR6_LEEBM/48-167--------------------------------------------------------------------------------
D3MRS2_9FIRM/52-169--------------------------------------------------------------------------------
C0GHN0_9FIRM/48-169--------------------------------------------------------------------------------
A7BSS9_9GAMM/58-174--------------------------------------------------------------------------------
Q1I2K2_PSEE4/47-166--------------------------------------------------------------------------------
Q65LI2_BACLD/48-169--------------------------------------------------------------------------------
C2FYF7_9SPHI/48-166--------------------------------------------------------------------------------
A4W840_ENT38/48-167--------------------------------------------------------------------------------
A2SJD9_METPP/43-164--------------------------------------------------------------------------------
ASNS_DICDI/48-169--------------------------------------------------------------------------------
Q1YPR6_9GAMM/67-187--------------------------------------------------------------------------------
D3FZ77_BACPE/48-169--------------------------------------------------------------------------------
C4KBW1_THASP/51-171--------------------------------------------------------------------------------
Q319R2_PROM9/48-170--------------------------------------------------------------------------------
Q605Z5_METCA/46-165--------------------------------------------------------------------------------
A4CM46_ROBBH/48-167--------------------------------------------------------------------------------
D4LAQ5_RUMC1/45-165--------------------------------------------------------------------------------
A3EK19_VIBCL/50-168--------------------------------------------------------------------------------
Q81ZU7_NITEU/48-168--------------------------------------------------------------------------------
C3KRD5_RHISN/51-172--------------------------------------------------------------------------------
D3AFP1_9CLOT/57-178--------------------------------------------------------------------------------
A8LVP2_SALAI/46-166--------------------------------------------------------------------------------
Q7MSW6_WOLSU/42-160--------------------------------------------------------------------------------
C7HFF8_CLOTM/48-169--------------------------------------------------------------------------------
C6J1Y5_9BACL/48-169--------------------------------------------------------------------------------
Q2WB52_MAGSA/47-166--------------------------------------------------------------------------------
B2IYJ4_NOSP7/59-173--------------------------------------------------------------------------------
A9EDC0_9FLAO/48-167--------------------------------------------------------------------------------
A6CPY7_9BACI/48-169--------------------------------------------------------------------------------
Q15RM5_PSEA6/55-167--------------------------------------------------------------------------------
A5CX28_VESOH/47-167--------------------------------------------------------------------------------
D3SB42_THISK/47-167--------------------------------------------------------------------------------
Q11Z14_CYTH3/48-168--------------------------------------------------------------------------------
B2TNC6_CLOBB/48-169--------------------------------------------------------------------------------
C0QEN5_DESAH/70-189--------------------------------------------------------------------------------
Q3B1S8_PELLD/46-166--------------------------------------------------------------------------------
D6Z4G9_DESAT/48-167--------------------------------------------------------------------------------
A9I748_BORPD/47-170--------------------------------------------------------------------------------
Q5WH52_BACSK/48-169--------------------------------------------------------------------------------
C0ZBJ4_BREBN/48-169--------------------------------------------------------------------------------
C5Y2Y7_SORBI/48-174--------------------------------------------------------------------------------
E6TYI4_BACCJ/48-169--------------------------------------------------------------------------------
B6C089_9GAMM/57-171--------------------------------------------------------------------------------
Q2SJG4_HAHCH/57-171--------------------------------------------------------------------------------
B1VMY8_STRGG/48-173--------------------------------------------------------------------------------
Q9RJK2_STRCO/48-166--------------------------------------------------------------------------------
D3QAD7_STANL/49-169--------------------------------------------------------------------------------
Q9KJI6_DESGI/52-171--------------------------------------------------------------------------------
B5E8P8_GEOBB/54-171--------------------------------------------------------------------------------
C3IWN5_BACTU/45-164--------------------------------------------------------------------------------
C1A5T9_GEMAT/55-168--------------------------------------------------------------------------------
B4BIR0_9BACI/48-169--------------------------------------------------------------------------------
Q2NA36_ERYLH/48-168--------------------------------------------------------------------------------
A2TSH4_9FLAO/48-167--------------------------------------------------------------------------------
C2QBK6_BACCE/45-169--------------------------------------------------------------------------------
Q01XN2_SOLUE/46-165--------------------------------------------------------------------------------
B8KJD2_9GAMM/25-145--------------------------------------------------------------------------------
C2WMM0_BACCE/48-169--------------------------------------------------------------------------------
C4K7X1_HAMD5/55-167--------------------------------------------------------------------------------
A0Q7S4_FRATN/47-170--------------------------------------------------------------------------------
Q7MBG3_WOLSU/61-173--------------------------------------------------------------------------------
A7NLM8_ROSCS/43-157--------------------------------------------------------------------------------
C5T0U7_ACIDE/48-168--------------------------------------------------------------------------------
B1I0Y5_DESAP/48-169--------------------------------------------------------------------------------
B0NXA9_9CLOT/52-173--------------------------------------------------------------------------------
C8W452_DESAS/48-169--------------------------------------------------------------------------------
D5X1P1_THIK1/46-165--------------------------------------------------------------------------------
D3V2B7_XENBS/51-170--------------------------------------------------------------------------------
Q2WBC9_MAGSA/51-171--------------------------------------------------------------------------------
C7PAG8_CHIPD/57-168--------------------------------------------------------------------------------
B4SPR9_STRM5/59-173--------------------------------------------------------------------------------
D2SAR5_GEOOG/50-170--------------------------------------------------------------------------------
C1F7T8_ACIC5/52-172--------------------------------------------------------------------------------
B7GLW0_ANOFW/61-182--------------------------------------------------------------------------------
A4FX82_METM5/68-180--------------------------------------------------------------------------------
B1K8L8_BURCC/51-174--------------------------------------------------------------------------------
C8XKV4_NAKMY/46-165--------------------------------------------------------------------------------
E3I7S3_RHOVT/58-174--------------------------------------------------------------------------------
B6IXV0_RHOCS/58-172--------------------------------------------------------------------------------
Q86A01_DICDI/50-171--------------------------------------------------------------------------------
D5VTZ9_METIM/63-169--------------------------------------------------------------------------------
A8ZX58_DESOH/43-159--------------------------------------------------------------------------------
B8GLI4_THISH/54-167--------------------------------------------------------------------------------
A5Z4P6_9FIRM/78-197--------------------------------------------------------------------------------
B8BZR9_THAPS/57-178--------------------------------------------------------------------------------
B6IYJ4_RHOCS/51-171--------------------------------------------------------------------------------
Q12HN2_SHEDO/46-166--------------------------------------------------------------------------------
B5JNG8_9BACT/50-171--------------------------------------------------------------------------------
Q11FH2_MESSB/47-167--------------------------------------------------------------------------------
D1PRL7_9FIRM/57-170--------------------------------------------------------------------------------
A8PQZ5_MALGO/63-179--------------------------------------------------------------------------------
Q1QD48_PSYCK/55-169--------------------------------------------------------------------------------
Q220Y3_RHOFD/48-168--------------------------------------------------------------------------------
D0NLW5_PHYIT/50-171--------------------------------------------------------------------------------
Q2LWL8_SYNAS/62-175--------------------------------------------------------------------------------
A5AAI5_ASPNC/47-168--------------------------------------------------------------------------------
D2QWZ5_PIRSD/59-178--------------------------------------------------------------------------------
C5ZZB9_9HELI/41-162--------------------------------------------------------------------------------
B4UY04_9ACTO/48-169--------------------------------------------------------------------------------
Q988G2_RHILO/58-172--------------------------------------------------------------------------------
A6LS88_CLOB8/48-169--------------------------------------------------------------------------------
B5DPA2_DROPS/60-180--------------------------------------------------------------------------------
A7BY79_9GAMM/47-167--------------------------------------------------------------------------------
Q7N3E7_PHOLL/51-170--------------------------------------------------------------------------------
A1ZXW5_9BACT/46-163--------------------------------------------------------------------------------
C7C1Y2_9ACTO/48-169--------------------------------------------------------------------------------
D0TID9_9BACE/48-167--------------------------------------------------------------------------------
C1I2N8_9CLOT/50-171--------------------------------------------------------------------------------
Q5QU50_IDILO/50-172--------------------------------------------------------------------------------
B1Y730_LEPCP/47-166--------------------------------------------------------------------------------
F1TF15_9CLOT/46-165--------------------------------------------------------------------------------
B3QJY0_RHOPT/43-167--------------------------------------------------------------------------------
A4J8B3_DESRM/48-169--------------------------------------------------------------------------------
A4YLK3_BRASO/46-166--------------------------------------------------------------------------------
A7Z383_BACA2/48-169--------------------------------------------------------------------------------
Q9RA27_VIBMA/55-167--------------------------------------------------------------------------------
B9HNE0_POPTR/48-166--------------------------------------------------------------------------------
A4BL90_9GAMM/46-165--------------------------------------------------------------------------------
A4LI33_BURPE/58-174--------------------------------------------------------------------------------
Q7WR34_BORBR/41-162--------------------------------------------------------------------------------
C7MST2_SACVD/46-164--------------------------------------------------------------------------------
C3XDE6_9HELI/72-187--------------------------------------------------------------------------------
B8KQP7_9GAMM/45-164--------------------------------------------------------------------------------
A9B583_HERA2/48-167--------------------------------------------------------------------------------
Q89HI1_BRAJA/49-169--------------------------------------------------------------------------------
Q74BS3_GEOSL/54-166--------------------------------------------------------------------------------
B4LH96_DROVI/67-180--------------------------------------------------------------------------------
A5N6Y5_CLOK5/48-169--------------------------------------------------------------------------------
Q01UW3_SOLUE/48-167--------------------------------------------------------------------------------
A7ZF04_CAMC1/47-167--------------------------------------------------------------------------------
B1HS43_LYSSC/48-169--------------------------------------------------------------------------------
Q8EN79_OCEIH/48-169--------------------------------------------------------------------------------
A4FMI9_SACEN/48-169--------------------------------------------------------------------------------
Q2G5V9_NOVAD/48-168--------------------------------------------------------------------------------
C7XTT3_9LACO/50-170--------------------------------------------------------------------------------
A5D4J4_PELTS/48-170--------------------------------------------------------------------------------
B7AKA8_9BACE/48-167--------------------------------------------------------------------------------
D2JNW7_9NOSO/48-167--------------------------------------------------------------------------------
B6YQV5_AZOPC/48-166--------------------------------------------------------------------------------
C1DDD9_LARHH/48-169--------------------------------------------------------------------------------
B8J3E1_DESDA/50-169--------------------------------------------------------------------------------
A5VDL7_SPHWW/48-168--------------------------------------------------------------------------------
Q49BF3_STRHY/48-169--------------------------------------------------------------------------------
D6S3E6_9LACO/53-166--------------------------------------------------------------------------------
D1R677_9CHLA/51-167--------------------------------------------------------------------------------
C7MBC0_BRAFD/45-173--------------------------------------------------------------------------------
Q2RIX6_MOOTA/48-169--------------------------------------------------------------------------------
D2AY63_STRRD/48-170--------------------------------------------------------------------------------
A4BPQ6_9GAMM/34-148--------------------------------------------------------------------------------
Q23CU8_TETTS/60-177--------------------------------------------------------------------------------
C4XTN2_DESMR/52-171--------------------------------------------------------------------------------
B9R487_9RHOB/47-167--------------------------------------------------------------------------------
A8UK10_9FLAO/67-188--------------------------------------------------------------------------------
E6U4Y9_ETHHY/50-171--------------------------------------------------------------------------------
A8JG07_CHLRE/48-170--------------------------------------------------------------------------------
B3QY65_CHLT3/47-167--------------------------------------------------------------------------------
A0L450_MAGSM/47-167--------------------------------------------------------------------------------
Q97GX2_CLOAB/48-169--------------------------------------------------------------------------------
A5V1L8_ROSS1/55-168--------------------------------------------------------------------------------
Q2B953_9BACI/48-169--------------------------------------------------------------------------------
A7T4X2_NEMVE/47-165--------------------------------------------------------------------------------
B6WVV2_9DELT/50-170--------------------------------------------------------------------------------
B1ZBU4_METPB/46-166--------------------------------------------------------------------------------
Q1YFQ6_MOBAS/47-167--------------------------------------------------------------------------------
C3RLY9_9FIRM/51-170--------------------------------------------------------------------------------
A5GQB9_SYNR3/51-164--------------------------------------------------------------------------------
Q2SJH5_HAHCH/45-158--------------------------------------------------------------------------------
B9MJX9_ANATD/48-169--------------------------------------------------------------------------------
B4WJY6_9SYNE/57-172--------------------------------------------------------------------------------
D1PMI4_9FIRM/49-170--------------------------------------------------------------------------------
C7QF66_CATAD/44-168--------------------------------------------------------------------------------
A4KUB6_STRHI/48-167--------------------------------------------------------------------------------
Q094S0_STIAD/48-170--------------------------------------------------------------------------------
A0LCM5_MAGSM/57-173--------------------------------------------------------------------------------
A9WSE9_RENSM/44-167--------------------------------------------------------------------------------
B8GGE5_METPE/42-162--------------------------------------------------------------------------------
C4WQP2_9RHIZ/54-174--------------------------------------------------------------------------------
B3QPH1_CHLP8/47-167--------------------------------------------------------------------------------
A4X7Y5_SALTO/75-195--------------------------------------------------------------------------------
B0ML15_9FIRM/25-146--------------------------------------------------------------------------------
A4X9C7_SALTO/62-175--------------------------------------------------------------------------------
B4U6E2_HYDS0/59-178--------------------------------------------------------------------------------
Q47GK4_DECAR/53-176--------------------------------------------------------------------------------
Q9FAR2_STRAU/48-169--------------------------------------------------------------------------------
E3I873_RHOVT/48-171--------------------------------------------------------------------------------
D1RME1_LEGLO/47-168--------------------------------------------------------------------------------
B8HUI9_CYAP4/51-173--------------------------------------------------------------------------------
A4B944_9GAMM/61-173--------------------------------------------------------------------------------
A6UNP9_METVS/74-187--------------------------------------------------------------------------------
Q2RPM9_RHORT/48-168--------------------------------------------------------------------------------
A5EHY9_BRASB/48-167--------------------------------------------------------------------------------
D0KYR8_HALNC/47-171--------------------------------------------------------------------------------
D3U9Z6_9ACTO/48-170--------------------------------------------------------------------------------
D4JEU7_9FIRM/51-163--------------------------------------------------------------------------------
D0FNI9_ERWPE/48-169--------------------------------------------------------------------------------
Q3S8R1_STRRM/48-170--------------------------------------------------------------------------------
Q988H1_RHILO/49-168--------------------------------------------------------------------------------
B2W1S8_PYRTR/47-168--------------------------------------------------------------------------------
Q8DM85_THEEB/58-177--------------------------------------------------------------------------------
D0CMS6_9SYNE/50-172--------------------------------------------------------------------------------
A1VVT9_POLNA/47-167--------------------------------------------------------------------------------
C4Z9V1_EUBR3/52-173--------------------------------------------------------------------------------
Q6ACN3_LEIXX/48-169--------------------------------------------------------------------------------
Q21S99_RHOFD/47-167--------------------------------------------------------------------------------
A8UQ31_9FLAO/44-163--------------------------------------------------------------------------------
Q2LWN2_SYNAS/59-175--------------------------------------------------------------------------------
Q0IDQ7_SYNS3/54-169--------------------------------------------------------------------------------
B5VJ70_YEAS6/54-167--------------------------------------------------------------------------------
Q39TM3_GEOMG/59-172--------------------------------------------------------------------------------
Q7NXB4_CHRVO/48-170--------------------------------------------------------------------------------
Q6LYS0_METMP/74-187--------------------------------------------------------------------------------
A5KQS7_9FIRM/52-173--------------------------------------------------------------------------------
C2HRD9_VIBCL/52-164--------------------------------------------------------------------------------
A4BIU0_9GAMM/50-169--------------------------------------------------------------------------------
B8FYG6_DESHD/49-170--------------------------------------------------------------------------------
B2H132_BURPE/51-170--------------------------------------------------------------------------------
D3RUI4_ALLVD/47-167--------------------------------------------------------------------------------
A9KFJ4_COXBN/59-173--------------------------------------------------------------------------------
B9UJ05_9ACTO/48-167--------------------------------------------------------------------------------
B3L4A4_PLAKH/60-174--------------------------------------------------------------------------------
C0ZB16_BREBN/47-166--------------------------------------------------------------------------------
Q7USD1_RHOBA/65-177--------------------------------------------------------------------------------
C3K8M3_PSEFS/49-168--------------------------------------------------------------------------------
Q8PRB2_XANAC/57-170--------------------------------------------------------------------------------
A4VJI0_PSEU5/47-167--------------------------------------------------------------------------------
B7DPG1_9BACL/48-169--------------------------------------------------------------------------------
D2B1Z0_STRRD/45-164--------------------------------------------------------------------------------
Q02LN1_PSEAB/48-168--------------------------------------------------------------------------------
C7R704_KANKD/50-172--------------------------------------------------------------------------------
D3RQ21_ALLVD/47-166--------------------------------------------------------------------------------
C6WV73_METML/48-165--------------------------------------------------------------------------------
A8FBS7_BACP2/50-171--------------------------------------------------------------------------------
Q2RSV6_RHORT/47-167--------------------------------------------------------------------------------
Q20ZN3_RHOPB/48-168--------------------------------------------------------------------------------
D8JX32_HYPDA/59-177--------------------------------------------------------------------------------
Q2SLG5_HAHCH/47-167--------------------------------------------------------------------------------
B9P339_PROMR/61-175--------------------------------------------------------------------------------
A3HRD8_9BACT/47-167--------------------------------------------------------------------------------
C7Q560_CATAD/48-168--------------------------------------------------------------------------------
D5CRA4_SIDLE/47-167--------------------------------------------------------------------------------
D3PM19_MEIRD/52-172--------------------------------------------------------------------------------
E6VSF4_DESAO/52-176--------------------------------------------------------------------------------
C6PVS3_9CLOT/56-167--------------------------------------------------------------------------------
B7VAM4_PSEA8/58-174--------------------------------------------------------------------------------
Q6CH25_YARLI/47-167--------------------------------------------------------------------------------
D9SNK4_CLOC7/48-169--------------------------------------------------------------------------------
B4KUK4_DROMO/68-180--------------------------------------------------------------------------------
C5DQZ1_ZYGRC/47-167--------------------------------------------------------------------------------
F1TGG9_9CLOT/49-170--------------------------------------------------------------------------------
A9IE16_BORPD/48-171--------------------------------------------------------------------------------
D1B558_SULD5/43-157--------------------------------------------------------------------------------
C7QI69_CATAD/48-174--------------------------------------------------------------------------------
A3ZYU5_9PLAN/59-178--------------------------------------------------------------------------------
Q1IDC0_PSEE4/52-172--------------------------------------------------------------------------------
B1J8H6_PSEPW/48-170--------------------------------------------------------------------------------
Q0RHA1_FRAAA/20-140--------------------------------------------------------------------------------
Q5P2C5_AROAE/49-168--------------------------------------------------------------------------------
ASNH2_METJA/68-181--------------------------------------------------------------------------------
A0QVJ3_MYCS2/47-167--------------------------------------------------------------------------------
B4S380_PROA2/47-167--------------------------------------------------------------------------------
A3UKJ3_9RHOB/53-170--------------------------------------------------------------------------------
B6IX73_RHOCS/48-168--------------------------------------------------------------------------------
E8W5U4_STRFA/48-170--------------------------------------------------------------------------------
Q4FTY4_PSYA2/57-168--------------------------------------------------------------------------------
A4YY74_BRASO/59-175--------------------------------------------------------------------------------
D0LGD9_HALO1/48-171--------------------------------------------------------------------------------
D3FFB1_CONWI/46-165--------------------------------------------------------------------------------
Q4FTY1_PSYA2/56-172--------------------------------------------------------------------------------
B4WAP0_9CAUL/47-167--------------------------------------------------------------------------------
E8WR80_GEOS8/55-170--------------------------------------------------------------------------------
C6BTG8_DESAD/52-175--------------------------------------------------------------------------------
C3XKC4_9HELI/41-162--------------------------------------------------------------------------------
A8PKM5_9COXI/48-166--------------------------------------------------------------------------------
Q56619_VIBCL/54-169--------------------------------------------------------------------------------
D3RTP3_ALLVD/44-164--------------------------------------------------------------------------------
Q2MGB4_STRGR/49-171--------------------------------------------------------------------------------
C4I635_BURPE/48-173--------------------------------------------------------------------------------
B8IXH9_METNO/49-168--------------------------------------------------------------------------------
Q8ECG7_SHEON/56-171--------------------------------------------------------------------------------
D2S7W6_GEOOG/47-167--------------------------------------------------------------------------------
D5WZF9_THIK1/47-167--------------------------------------------------------------------------------
Q0A658_ALHEH/47-170--------------------------------------------------------------------------------
Q9FB19_9ACTO/51-170--------------------------------------------------------------------------------
Q2ILL8_ANADE/59-177--------------------------------------------------------------------------------
C6W7W6_ACTMD/51-172--------------------------------------------------------------------------------
A9FKC0_SORC5/48-170--------------------------------------------------------------------------------
C5UWI4_CLOBO/51-163--------------------------------------------------------------------------------
Q6ASA1_DESPS/50-173--------------------------------------------------------------------------------
Q7MSW7_WOLSU/49-158--------------------------------------------------------------------------------
Q220Y1_RHOFD/25-144--------------------------------------------------------------------------------
C7LT29_DESBD/46-162--------------------------------------------------------------------------------
Q2CH15_9RHOB/27-140--------------------------------------------------------------------------------
Q6U1H6_SHIDY/60-175--------------------------------------------------------------------------------
A8I1E3_AZOC5/46-166--------------------------------------------------------------------------------
Q6YPY1_ONYPE/48-167--------------------------------------------------------------------------------
Q11P23_CYTH3/44-161--------------------------------------------------------------------------------
Q0H2X8_9ACTO/48-170--------------------------------------------------------------------------------
A5WC05_PSYWF/51-174--------------------------------------------------------------------------------
D7VVT0_9FLAO/46-165--------------------------------------------------------------------------------
Q8TZ36_METKA/54-162--------------------------------------------------------------------------------
B5WKQ6_9BURK/48-170--------------------------------------------------------------------------------
C5M4U1_CANTT/47-167--------------------------------------------------------------------------------
A4YXC2_BRASO/59-177--------------------------------------------------------------------------------
Q5P0P7_AROAE/47-167--------------------------------------------------------------------------------
A1UEP1_MYCSK/47-167--------------------------------------------------------------------------------
Q30V26_DESDG/57-186--------------------------------------------------------------------------------
B0UMG8_METS4/47-167--------------------------------------------------------------------------------
A7HRA6_PARL1/47-167--------------------------------------------------------------------------------
A8TMT0_9PROT/47-167--------------------------------------------------------------------------------
A0ZBU8_NODSP/27-148--------------------------------------------------------------------------------
D9SCG7_GALCS/47-167--------------------------------------------------------------------------------
A4RU16_OSTLU/60-172--------------------------------------------------------------------------------
A7BTD4_9GAMM/34-149--------------------------------------------------------------------------------
C9NMI3_9VIBR/47-166--------------------------------------------------------------------------------
A4RXB8_OSTLU/49-169--------------------------------------------------------------------------------
B7J9F8_ACIF2/53-166--------------------------------------------------------------------------------
C6WBZ3_ACTMD/47-166--------------------------------------------------------------------------------
Q125B0_POLSJ/59-179--------------------------------------------------------------------------------
D0L316_GORB4/47-167--------------------------------------------------------------------------------
A1KKP3_MYCBP/68-182--------------------------------------------------------------------------------
Q30U87_SULDN/50-157--------------------------------------------------------------------------------
C8XB77_NAKMY/47-167--------------------------------------------------------------------------------
A0SZV7_9ACTO/48-170--------------------------------------------------------------------------------
C5ZZB1_9HELI/46-164--------------------------------------------------------------------------------
Q0YTU9_9CHLB/34-161--------------------------------------------------------------------------------
E0TGP5_PARBH/48-167--------------------------------------------------------------------------------
A8W7D4_9ACTO/48-173--------------------------------------------------------------------------------
D1PQ59_9FIRM/23-146--------------------------------------------------------------------------------
D5UY52_TSUPD/59-174--------------------------------------------------------------------------------
B6R111_9RHOB/41-164--------------------------------------------------------------------------------
A0CK03_PARTE/58-173--------------------------------------------------------------------------------
A6R1E0_AJECN/101-225--------------------------------------------------------------------------------
B6BKE4_9PROT/42-158--------------------------------------------------------------------------------
B5VUJ3_SPIMA/45-163--------------------------------------------------------------------------------
Q6CVM7_KLULA/47-167--------------------------------------------------------------------------------
Q6QW19_AZOBR/13-131--------------------------------------------------------------------------------
Q0W279_UNCMA/45-150--------------------------------------------------------------------------------
C0JRY2_STRLU/48-170--------------------------------------------------------------------------------
D5VU54_METIM/64-176--------------------------------------------------------------------------------
A6WDH3_KINRD/47-167--------------------------------------------------------------------------------
C4R588_PICPG/47-167--------------------------------------------------------------------------------
QUEC_SULAC/78-205--------------------------------------------------------------------------------
A4TXA1_9PROT/48-167--------------------------------------------------------------------------------
Q30U64_SULDN/41-156--------------------------------------------------------------------------------
O46196_AEDAE/70-187--------------------------------------------------------------------------------
A3SJ02_9RHOB/70-190--------------------------------------------------------------------------------
D0KR75_SULS9/78-205--------------------------------------------------------------------------------
C7BSC5_PHOAA/57-169--------------------------------------------------------------------------------
A4X3E4_SALTO/47-167--------------------------------------------------------------------------------
A6DK48_9BACT/48-168--------------------------------------------------------------------------------
QUEC2_SULTO/78-205--------------------------------------------------------------------------------
A0RRA8_CAMFF/43-159--------------------------------------------------------------------------------
C3RME3_9FIRM/51-164--------------------------------------------------------------------------------
C9YX81_STRSW/47-167--------------------------------------------------------------------------------
A0E625_PARTE/60-175--------------------------------------------------------------------------------
C0JRV7_9ACTO/48-170--------------------------------------------------------------------------------
D2SYZ2_MICEC/48-170--------------------------------------------------------------------------------
B2AEL9_PODAN/77-201--------------------------------------------------------------------------------
D2AQS0_STRRD/47-167--------------------------------------------------------------------------------
A6Q4Y9_NITSB/42-158--------------------------------------------------------------------------------
Q7UHC5_RHOBA/51-170--------------------------------------------------------------------------------
Q4Y1E6_PLACH/56-170--------------------------------------------------------------------------------
Q2W7V5_MAGSA/46-162--------------------------------------------------------------------------------
C5ZWC6_9HELI/53-161--------------------------------------------------------------------------------
Q7VEF5_PROMA/50-177--------------------------------------------------------------------------------
Q46Q66_CUPPJ/58-178--------------------------------------------------------------------------------
D3D0N6_9ACTO/47-163--------------------------------------------------------------------------------
ASNS_MIMIV/58-170--------------------------------------------------------------------------------
Q8KY35_STRCU/48-171--------------------------------------------------------------------------------
C3XLB4_9HELI/53-164--------------------------------------------------------------------------------
C4XQN6_DESMR/45-165--------------------------------------------------------------------------------
A3T3D5_9RHOB/31-153--------------------------------------------------------------------------------
A4YE70_METS5/78-205--------------------------------------------------------------------------------
Q1VVM8_9FLAO/52-161--------------------------------------------------------------------------------
A2R076_ASPNC/60-179--------------------------------------------------------------------------------
B8NXQ8_ASPFN/55-174--------------------------------------------------------------------------------
Q2W001_MAGSA/34-147--------------------------------------------------------------------------------
D1ALZ0_SEBTE/51-164--------------------------------------------------------------------------------
A8ZZB3_DESOH/53-170--------------------------------------------------------------------------------
Q1NS49_9DELT/43-160--------------------------------------------------------------------------------
A0RRB3_CAMFF/41-154--------------------------------------------------------------------------------
Q11NT7_CYTH3/50-168--------------------------------------------------------------------------------
Q2U6M1_ASPOR/59-178--------------------------------------------------------------------------------
Q8KSW7_9ACTO/48-172--------------------------------------------------------------------------------
D0DVH8_LACFE/51-164--------------------------------------------------------------------------------
O26514_METTH/65-169--------------------------------------------------------------------------------
Q7M7N7_WOLSU/41-156--------------------------------------------------------------------------------
A5FV61_ACICJ/47-161--------------------------------------------------------------------------------
Q0CLR1_ASPTN/62-174--------------------------------------------------------------------------------
B6HLP8_PENCW/58-177--------------------------------------------------------------------------------
B7V387_PSEA8/41-153--------------------------------------------------------------------------------
B1YDA4_THENV/121-259--------------------------------------------------------------------------------
D4C7W3_9CLOT/47-159--------------------------------------------------------------------------------
B0TYV0_FRAP2/51-161--------------------------------------------------------------------------------
C7RIV9_ACCPU/97-224--------------------------------------------------------------------------------
C1E3Q0_MICSR/60-172--------------------------------------------------------------------------------
Q2L1U1_BORA1/88-215--------------------------------------------------------------------------------
D1Z1D8_METPS/43-149--------------------------------------------------------------------------------
A1ZFN5_9BACT/52-169--------------------------------------------------------------------------------
B4RF38_PHEZH/47-166--------------------------------------------------------------------------------
C9PF78_VIBFU/43-158--------------------------------------------------------------------------------
Q0BQM1_GRABC/48-163--------------------------------------------------------------------------------
A8EQV6_ARCB4/41-156--------------------------------------------------------------------------------
A8G661_PROM2/51-168--------------------------------------------------------------------------------
Q5FPJ6_GLUOX/47-164--------------------------------------------------------------------------------
B4SIH4_STRM5/50-164--------------------------------------------------------------------------------
A1ZXW4_9BACT/46-164--------------------------------------------------------------------------------
Q313Y7_DESDG/87-214--------------------------------------------------------------------------------
B7RW46_9GAMM/47-167--------------------------------------------------------------------------------
A8ME82_CALMQ/83-211--------------------------------------------------------------------------------
Q8KRY7_PSESX/56-177--------------------------------------------------------------------------------
C7JBX0_ACEP3/48-163--------------------------------------------------------------------------------
C5K3E6_AJEDS/64-193--------------------------------------------------------------------------------
D1A6E6_THECD/109-235--------------------------------------------------------------------------------
A3WF90_9SPHN/49-165--------------------------------------------------------------------------------
B9P358_PROMR/59-169--------------------------------------------------------------------------------
D1P7K2_9ENTR/45-159--------------------------------------------------------------------------------
Q1V7N1_VIBAL/45-159--------------------------------------------------------------------------------
Q8H9W0_9CAUD/81-197--------------------------------------------------------------------------------
D0MHA3_RHOM4/51-167--------------------------------------------------------------------------------
B2A1P6_NATTJ/45-164--------------------------------------------------------------------------------
D1CB97_THET1/45-164--------------------------------------------------------------------------------
A5GA44_GEOUR/54-181--------------------------------------------------------------------------------
D1CIY9_THET1/47-165--------------------------------------------------------------------------------
Q2RW74_RHORT/56-169--------------------------------------------------------------------------------

PF00310

GLT1_ORYSJ/100-477-------------------------------------IRAALNLRRG.GKRDFYMCSLSSRTIVYKGQLKPCQLKGYYYA
GLTB2_ARATH/108-480-------------------------------------VASESWA......SELYFSSLSNQTIVYKGMLRSEVLGLF.YP
GLUT1_ARATH/117-494-------------------------------------IRAALNLQHG.AMKDFYICSLSSRTIVYKGQLKPDQLKDYYYA
GLTA_BACSU/22-388-------------------------------------GVTEGL........DFYFASLSSQTIVYKGLLTPEQVDAF.YS
PUR1_BACSU/12-206-------------------------------------EVFQNG.....................................
GFPT1_HUMAN/2-215-------------------------------------QDMD.......................................
GLMS_ECOLI/2-194-------------------------------------MLAQAA.....................................
ASNS_CRIGR/2-161-------------------------------------IRVKKY.....................................
GFA1_YEAST/2-209-------------------------------------ITKQNP........N............................
GFA1_SCHPO/2-205-------------------------------------IKGSNV........N............................
ASNB_ECOLI/2-162-------------------------------------VNAG.......................................
PUR1_SHIFL/2-211-------------------------------------DVFEAR.....................................
GLMS_HAEIN/2-194-------------------------------------ALDEAV.....................................
PUR1_HAEIN/2-210-------------------------------------DVFHQE.....................................
NODM_RHILV/2-193-------------------------------------LGNLKT........R............................
ASNS1_PEA/2-161-------------------------------------DPASGD.....................................
GLMS_BACSU/2-193-------------------------------------RE...V.....................................
GLT1_YEAST/54-428-------------------------------------IGLENW.........FYVCSLNNTTIVYKGQLTPAQVYNY.YP
PUR1_YEAST/2-214-------------------------------------DVFTQQ.....................................
Q9R6W7_NOSS1/35-403-------------------------------------GKKVSL........EFYICSLSSRTIVYKAMVRSAVLGAF.YL
O08339_RHOSH/34-404-------------------------------------AQAGSIQ.......GLYLCSLSCRSIIYKGMMLAEQVATF.YP
Q98H51_RHILO/54-428-------------------------------------IYAENDNK....DIGAYCVSLSARTIVYKGMFLAYQVGAY.YK
Q9Z465_CORGT/16-380-------------------------------------LGTTNGR......DTVYFPSLSSRTIIYKGMLTTLQLEGF.FE
Q97IG8_CLOAB/23-393-------------------------------------VKRLVERG....SEYFYICSLSSRTIVYKGLLLADQIKSF.YM
GLT1_SCHPO/69-442-------------------------------------IGKEKW.........FYICSLHRETIVYKGQLAPVQVYNY.FL
GLTB_ANTSP/27-400-------------------------------------VSKLDINT....NKQFYICSFSSKTIVYKGMLRSEFLVKY.YN
Q9VVA4_DROME/88-454-------------------------------------LIKPGR........RFYICSLSDRTVVYKGLFTSDQLWDY.YT
Q9CPJ9_PASMU/2-216-------------------------------------PIADCV.....................................
GLTB_CYACA/37-408-------------------------------------ITVRAYSW....AKDFYFCSCSNHTIVYKGMVKSTSLGQF.YQ
Q9KPY3_VIBCH/2-217-------------------------------------KIAELV.....................................
Q9XDC9_CLOSA/21-385-------------------------------------AAWISKFL....NETFYIASFSSKTIVYKGMLLSTQLRVF.YK
Q9HUD5_PSEAE/15-378-------------------------------------NAADSD.........HYICSFSHKTIIYKGLMMPADLAAF.YP
Q9CG24_LACLA/23-377-------------------------------------FDEEE..........LYICSLSSQTVVYKGMLHAYQVKLF.YP
GLTB_AZOBR/37-405-------------------------------------VKGEQIN.......DFYICSLSARSIIYKGMFLAEQLTTF.YP
Q9P540_NEUCS/54-436-------------------------------------IGLQNW.........FYICSLSNKNIVYKGQLAPIQVYQY.YN
Q9JY00_NEIMB/2-216-------------------------------------PVADLV.....................................
Q9KPJ1_VIBCH/13-376-------------------------------------ITDDRD.........FYICSLSTQVLVYKGLCMPADLPRF.YL
PUR1_SCHPO/2-213-------------------------------------DVFSQH.....................................
GLTB_SYNY3/43-413-------------------------------------IRSPKID......TYWYVASLSARTLVYKGMLTTAQVGQY.YP
Q51579_PLEBO/39-409-------------------------------------LAVRPEAG....FDELYVCSFSTRTIVYKGMVRSEILGKF.YL
O67512_AQUAE/8-365-------------------------------------YEDK...........VYIPSLSTRTIVYKGMLVAPQLDNF.YQ
Q9I437_PSEAE/2-215-------------------------------------EVARLV.....................................
GLTS_SYNY3/37-404-------------------------------------LAED...........FYVCSFSCRTIVYKGMVRSIILGEF.YL
Q9S2Y9_STRCO/20-378-------------------------------------AG.............VYFPSLSARTIVYKGMLTTGQLEPF.FP
Q9RXX2_DEIRA/53-426-------------------------------------ILGLNFTH....GQEYYVPSMSCRTIIYKGLLLADQVGEY.YR
PUR1_CHICK/12-236-------------------------------------HVFNAD........S............................
Q9KC46_BACHD/22-392-------------------------------------IGPLVES......GSFYFASFSSRTIVYKGMLTTEQVDQF.YL
Q9RNZ7_ZYMMB/34-404-------------------------------------VIAAQTN.......KIISARCLVRSIVYKGLYLAEALPTC.YP
Q9PA10_XYLFA/24-386-------------------------------------LCDYHD.........FYVATLSPYAISYKGMVLPDKLPVF.YP
Q9A2F8_CAUCR/30-396-------------------------------------VHAQNIS.......DFYICSLSAKSLIYKGMFLAEAIDEF.YP
Q9KPJ4_VIBCH/37-409-------------------------------------CLESVSNI....GDDFYINSMSYKTLVYKGQLTTEQVPQY.FL
GLTB_PORPU/34-404-------------------------------------IGINGKEW....AHEFYVCSLSCYTIVYKGMMRSAVLGQF.YQ
Q51583_PLEBO/24-394-------------------------------------IRQTGID......PFWYPASLSCRTLVYKGMLMPLQVKEY.YP
Q9CDD5_MYCLE/18-389-------------------------------------LGTKGPGQDGPGRETIYFPSLSSQTFVYKGMLTTPQLKAF.YR
D8BYX0_ECOLX/43-406-------------------------------------LEADKD.........FYVCSLSNLVNIYKGLCMPTDLPRF.YL
O61143_PLAFA/21-537-------------------------------------ND.............MYFCSFSSRTIVYKGLLTPSQIYLY.FE
Q99WD1_STAAM/20-380-------------------------------------STQCDL........ELYFTSLSRKTIVYKGWLRSDQIKKL.YT

PF12481

A8IXL5_BRACM/2-226--------------------------------------------------------------------------------
A9PEF3_POPTR/2-226--------------------------------------------------------------------------------
Q3HRW3_SOLTU/2-241--------------------------------------------------------------------------------
Q2RAK8_ORYSJ/2-226--------------------------------------------------------------------------------
A9NKZ6_PICSI/2-228--------------------------------------------------------------------------------
A9NXH4_PICSI/2-226--------------------------------------------------------------------------------
A9TLC6_PHYPA/2-227--------------------------------------------------------------------------------
A9NP52_PICSI/2-226--------------------------------------------------------------------------------
B7FHM6_MEDTR/2-224--------------------------------------------------------------------------------
C6T2Q6_SOYBN/2-226--------------------------------------------------------------------------------
B9HUQ8_POPTR/2-227--------------------------------------------------------------------------------
A5AXQ8_VITVI/2-226--------------------------------------------------------------------------------
Q9LIL3_ARATH/2-226--------------------------------------------------------------------------------
A2XLW7_ORYSI/2-228--------------------------------------------------------------------------------
B3TM05_ELAGV/2-228--------------------------------------------------------------------------------
Q6F390_ORYSJ/2-226--------------------------------------------------------------------------------
Q9FG81_ARATH/2-227--------------------------------------------------------------------------------
A8IXL3_BRACM/2-239--------------------------------------------------------------------------------
A5BPK4_VITVI/2-230--------------------------------------------------------------------------------
Q9FYX7_SOYBN/2-232--------------------------------------------------------------------------------
A9PBW3_POPTR/2-230--------------------------------------------------------------------------------
Q9LE80_ARATH/2-229--------------------------------------------------------------------------------
C6T9Q0_SOYBN/2-229--------------------------------------------------------------------------------
A9PK29_9ROSI/2-230--------------------------------------------------------------------------------
A6YGE8_CARPA/2-230--------------------------------------------------------------------------------
B8YIB1_MIRJA/2-231--------------------------------------------------------------------------------
Q40127_SOLLC/2-272--------------------------------------------------------------------------------
A2XZ07_ORYSI/2-231--------------------------------------------------------------------------------
Q43378_ASPOF/2-233--------------------------------------------------------------------------------
Q05FE8_ELAGV/2-228--------------------------------------------------------------------------------
B8LRD8_PICSI/3-230--------------------------------------------------------------------------------
Q307Z6_SOLTU/2-223--------------------------------------------------------------------------------
A9NZE6_PICSI/2-230--------------------------------------------------------------------------------

PF13230

A4JBJ9_BURVG/1-273--------------------------------------------------------------------------------
B3CXI0_BURM1/1-273--------------------------------------------------------------------------------
A1V0D8_BURMS/1-273--------------------------------------------------------------------------------
B2UFJ6_RALPJ/1-272--------------------------------------------------------------------------------
Q0A7W5_ALHEH/1-270--------------------------------------------------------------------------------
Q3A260_PELCD/1-273--------------------------------------------------------------------------------
B0V907_ACIBY/1-271--------------------------------------------------------------------------------
B2SYL4_BURPP/1-273--------------------------------------------------------------------------------
Q1BZ50_BURCA/1-273--------------------------------------------------------------------------------
A9LB76_BURML/1-273--------------------------------------------------------------------------------
C9YH78_9BURK/11-284--------------------------------------------------------------------------------
B0VTE1_ACIBS/1-271--------------------------------------------------------------------------------
C9YDF1_9BURK/1-277--------------------------------------------------------------------------------
Q2SZ73_BURTA/24-296--------------------------------------------------------------------------------
A3MPF1_BURM7/1-273--------------------------------------------------------------------------------
Q6FDQ6_ACIAD/4-274--------------------------------------------------------------------------------
C4KV44_BURPE/13-285--------------------------------------------------------------------------------
B9C0I0_9BURK/25-297--------------------------------------------------------------------------------
C6TY74_BURPE/1-273--------------------------------------------------------------------------------
Q2NG26_METST/1-246--------------------------------------------------------------------------------
Q13UA7_BURXL/1-273--------------------------------------------------------------------------------
A0K4K0_BURCH/1-273--------------------------------------------------------------------------------
A2WCM9_9BURK/1-273--------------------------------------------------------------------------------
Q475U0_CUPPJ/1-272--------------------------------------------------------------------------------
B4AR53_FRANO/2-279--------------------------------------------------------------------------------
C6RPJ8_ACIRA/1-271--------------------------------------------------------------------------------
D0LFZ1_HALO1/1-274--------------------------------------------------------------------------------
B1M0S3_METRJ/1-260--------------------------------------------------------------------------------
B2AH51_CUPTR/1-272--------------------------------------------------------------------------------
C6BC48_RALP1/1-272--------------------------------------------------------------------------------
D0C9S1_ACIBA/1-271--------------------------------------------------------------------------------
A7JMK2_FRANO/2-279--------------------------------------------------------------------------------
A7YT79_FRATU/2-279--------------------------------------------------------------------------------
B9BD23_9BURK/25-297--------------------------------------------------------------------------------
A9VWD5_METEP/29-300--------------------------------------------------------------------------------
A3NDH4_BURP6/1-273--------------------------------------------------------------------------------
A0Q741_FRATN/2-279--------------------------------------------------------------------------------
C4GG62_9NEIS/1-273--------------------------------------------------------------------------------
D5WD47_BURSC/1-273--------------------------------------------------------------------------------
Q63QV9_BURPS/1-273--------------------------------------------------------------------------------
A2S5G7_BURM9/1-273--------------------------------------------------------------------------------
B5S8H8_RALSL/13-284--------------------------------------------------------------------------------
C7CMW0_METED/1-272--------------------------------------------------------------------------------
B2HV32_ACIBC/1-271--------------------------------------------------------------------------------
Q1LRD7_RALME/1-272--------------------------------------------------------------------------------
B7KSM2_METC4/1-272--------------------------------------------------------------------------------
C5AB16_BURGB/1-273--------------------------------------------------------------------------------
Q0BI95_BURCM/1-273--------------------------------------------------------------------------------
B5SG66_RALSL/13-284--------------------------------------------------------------------------------
D0C3B3_9GAMM/1-271--------------------------------------------------------------------------------
Q0KEE5_CUPNH/1-272--------------------------------------------------------------------------------
D0SU94_ACILW/1-271--------------------------------------------------------------------------------
C5ASQ1_METEA/1-272--------------------------------------------------------------------------------
A9ER87_SORC5/1-279--------------------------------------------------------------------------------
B1N200_BURPE/1-273--------------------------------------------------------------------------------
A8KUB1_BURPE/1-273--------------------------------------------------------------------------------
B2JGV6_BURP8/1-272--------------------------------------------------------------------------------
A7JIF8_FRANO/2-279--------------------------------------------------------------------------------
A5J900_BURML/13-285--------------------------------------------------------------------------------
A7NBB7_FRATF/2-279--------------------------------------------------------------------------------
Q47AN0_DECAR/1-267--------------------------------------------------------------------------------
A3RRN4_RALSL/13-284--------------------------------------------------------------------------------
B1FF86_9BURK/25-297--------------------------------------------------------------------------------
B9CJ55_9BURK/25-297--------------------------------------------------------------------------------
D0WIN3_9ACTN/1-249--------------------------------------------------------------------------------
A5XUZ1_BURML/13-285--------------------------------------------------------------------------------
A4IYM1_FRATW/2-279--------------------------------------------------------------------------------
C5N7G0_BURML/13-285--------------------------------------------------------------------------------
C0VJ77_9GAMM/1-271--------------------------------------------------------------------------------
Q5P4D2_AROAE/1-272--------------------------------------------------------------------------------
D0T4E4_ACIRA/1-271--------------------------------------------------------------------------------
Q8Y251_RALSO/1-272--------------------------------------------------------------------------------
B0TY56_FRAP2/2-277--------------------------------------------------------------------------------
Q3JNQ6_BURP1/13-285--------------------------------------------------------------------------------
D3E130_METRM/1-248--------------------------------------------------------------------------------
A3M328_ACIBT/1-271--------------------------------------------------------------------------------
D0S0M3_ACICA/1-271--------------------------------------------------------------------------------
C4ANW9_BURML/13-285--------------------------------------------------------------------------------
A2VSW5_9BURK/1-273--------------------------------------------------------------------------------
C6YWP7_9GAMM/2-277--------------------------------------------------------------------------------
D0S8W3_ACIJO/1-271--------------------------------------------------------------------------------
Q62H44_BURMA/1-273--------------------------------------------------------------------------------
A4KQS8_FRATU/2-279--------------------------------------------------------------------------------
B7CLH7_BURPE/13-285--------------------------------------------------------------------------------
B2H0I4_BURPE/1-273--------------------------------------------------------------------------------
A9G0L9_SORC5/1-275--------------------------------------------------------------------------------
A8EIA4_BURPE/1-273--------------------------------------------------------------------------------
D3S2D